F492117

General Info

Members Datasets Scaffolds Average Seq Length
1244 355 2488 127

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100324241|Ga0070664_1003242412
Length 149
Sequence MARRQAPQPDPDEIAPEAMPETSASALAKPTRRGGRSLQSLPGGRDDESPLALDRLIHERLRLGIVSALAVNDALTFVELKRLLKTTDGNLSVHARKLEEAGYVSCTKEFEGRTPRTEYRLTRAGRLALERYLEHMEALIKATREGTRS

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
260 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
263 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
264 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
265 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 2.01
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100324241 3300005564 Bacteria 1396
2 MRS1b_contig_1215992 2162886011 Unclassified 1227
3 MBSR1b_contig_3003525 2162886012 Unclassified 1081
4 JGI25406J46586_10053464 3300003203 Bacteria 1340
5 Ga0065712_10078642 3300005290 Bacteria 3311
6 Ga0065712_10259735 3300005290 Bacteria 940
7 Ga0065712_10294369 3300005290 Unclassified 855
8 Ga0065715_10102479 3300005293 Bacteria 3111
9 Ga0065715_10308038 3300005293 Unclassified 1026
10 Ga0065715_11057488 3300005293 Bacteria 519
11 Ga0065707_10939840 3300005295 Unclassified 555
12 Ga0070658_10030350 3300005327 Bacteria 4344
13 Ga0070658_10968460 3300005327 Bacteria 740
14 Ga0070658_11407492 3300005327 Bacteria 605
15 Ga0070676_10005157 3300005328 Bacteria 6937
16 Ga0070676_10028633 3300005328 Bacteria 3165
17 Ga0070676_10037538 3300005328 Bacteria 2794
18 Ga0070676_10431242 3300005328 Bacteria 923
19 Ga0070676_10894634 3300005328 Bacteria 661
20 Ga0070676_10903223 3300005328 Bacteria 658
21 Ga0070683_100006943 3300005329 Bacteria 9518
22 Ga0070683_100058428 3300005329 Bacteria 3583
23 Ga0070683_100064473 3300005329 Bacteria 3411
24 Ga0070683_100102066 3300005329 Bacteria 2701
25 Ga0070683_100510381 3300005329 Bacteria 1149
26 Ga0070690_100046976 3300005330 Bacteria 2746
27 Ga0070690_100059190 3300005330 Bacteria 2462
28 Ga0070690_100384687 3300005330 Unclassified 1027
29 Ga0070690_100478192 3300005330 Bacteria 928
30 Ga0070690_100629836 3300005330 Bacteria 817
31 Ga0070670_100005553 3300005331 Bacteria 10639
32 Ga0070670_100104495 3300005331 Bacteria 2440
33 Ga0070670_100153430 3300005331 Bacteria 1994
34 Ga0070670_101608049 3300005331 Unclassified 597
35 Ga0070677_10021725 3300005333 Unclassified 2358
36 Ga0070677_10225482 3300005333 Bacteria 918
37 Ga0070677_10426352 3300005333 Bacteria 704
38 Ga0068869_100001426 3300005334 Bacteria 14158
39 Ga0068869_100075005 3300005334 Bacteria 2512
40 Ga0068869_100126141 3300005334 Bacteria 1963
41 Ga0070666_10048472 3300005335 Bacteria 2855
42 Ga0070666_10216074 3300005335 Bacteria 1351
43 Ga0070666_10286167 3300005335 Unclassified 1172
44 Ga0070666_10310620 3300005335 Bacteria 1124
45 Ga0070680_100001348 3300005336 Bacteria 17759
46 Ga0070680_100025639 3300005336 Bacteria 4713
47 Ga0070680_100055999 3300005336 Bacteria 3223
48 Ga0070680_100149828 3300005336 Bacteria 1958
49 Ga0070680_100208809 3300005336 Bacteria 1647
50 Ga0070680_100539643 3300005336 Bacteria 999
51 Ga0070680_101150709 3300005336 Unclassified 671
52 Ga0070682_100000710 3300005337 Bacteria 19958
53 Ga0070682_100006101 3300005337 Bacteria 6745
54 Ga0070682_100905193 3300005337 Bacteria 725
55 Ga0070682_100984518 3300005337 Bacteria 699
56 Ga0068868_100001287 3300005338 Bacteria 17275
57 Ga0068868_100078197 3300005338 Bacteria 2648
58 Ga0068868_100115264 3300005338 Bacteria 2187
59 Ga0068868_100395526 3300005338 Bacteria 1192
60 Ga0068868_101059865 3300005338 Bacteria 744
61 Ga0068868_102392196 3300005338 Unclassified 504
62 Ga0070660_100052808 3300005339 Bacteria 3134
63 Ga0070660_100221202 3300005339 Bacteria 1539
64 Ga0070660_100315210 3300005339 Unclassified 1284
65 Ga0070689_100068722 3300005340 Bacteria 2763
66 Ga0070691_10004718 3300005341 Bacteria 6202
67 Ga0070691_10034143 3300005341 Unclassified 2394
68 Ga0070691_10143723 3300005341 Bacteria 1218
69 Ga0070691_10529828 3300005341 Bacteria 685
70 Ga0070687_100080915 3300005343 Bacteria 1772
71 Ga0070687_100550018 3300005343 Unclassified 785
72 Ga0070687_100939310 3300005343 Unclassified 623
73 Ga0070661_100108630 3300005344 Bacteria 2070
74 Ga0070661_100215865 3300005344 Unclassified 1470
75 Ga0070661_100337505 3300005344 Bacteria 1180
76 Ga0070661_100431177 3300005344 Bacteria 1046
77 Ga0070692_10038705 3300005345 Bacteria 2432
78 Ga0070692_10125772 3300005345 Bacteria 1435
79 Ga0070692_10517676 3300005345 Bacteria 776
80 Ga0070692_10667778 3300005345 Unclassified 696
81 Ga0070668_100049309 3300005347 Unclassified 3240
82 Ga0070668_101375207 3300005347 Unclassified 643
83 Ga0070669_100000069 3300005353 Bacteria 100095
84 Ga0070669_100013681 3300005353 Bacteria 5769
85 Ga0070669_100034824 3300005353 Bacteria 3646
86 Ga0070669_100801527 3300005353 Unclassified 800
87 Ga0070669_101396926 3300005353 Bacteria 607
88 Ga0070669_101983596 3300005353 Unclassified 509
89 Ga0070675_100002658 3300005354 Bacteria 13434
90 Ga0070675_100039617 3300005354 Bacteria 3845
91 Ga0070675_100070496 3300005354 Bacteria 2897
92 Ga0070675_100109247 3300005354 Bacteria 2337
93 Ga0070675_100440865 3300005354 Unclassified 1167
94 Ga0070675_100504932 3300005354 Bacteria 1090
95 Ga0070675_100511608 3300005354 Bacteria 1083
96 Ga0070671_100043392 3300005355 Bacteria 3736
97 Ga0070671_100087682 3300005355 Unclassified 2604
98 Ga0070671_100260075 3300005355 Bacteria 1475
99 Ga0070671_100289853 3300005355 Bacteria 1393
100 Ga0070671_100359193 3300005355 Unclassified 1244
101 Ga0070671_100915795 3300005355 Unclassified 766
102 Ga0070671_101005545 3300005355 Unclassified 731
103 Ga0070674_100000197 3300005356 Bacteria 28921
104 Ga0070674_101737692 3300005356 Bacteria 565
105 Ga0070674_101813788 3300005356 Bacteria 553
106 Ga0070673_100026057 3300005364 Bacteria 4313
107 Ga0070673_100099837 3300005364 Bacteria 2388
108 Ga0070673_100569062 3300005364 Unclassified 1031
109 Ga0070688_100014947 3300005365 Bacteria 4407
110 Ga0070688_100037110 3300005365 Bacteria 2968
111 Ga0070688_100231995 3300005365 Unclassified 1306
112 Ga0070688_100495210 3300005365 Bacteria 921
113 Ga0070688_100769115 3300005365 Unclassified 751
114 Ga0070659_100108547 3300005366 Bacteria 2239
115 Ga0070659_100158622 3300005366 Bacteria 1849
116 Ga0070659_100269135 3300005366 Bacteria 1415
117 Ga0070667_100001651 3300005367 Bacteria 19943
118 Ga0070667_100016243 3300005367 Bacteria 6159
119 Ga0070667_100198515 3300005367 Bacteria 1780
120 Ga0070667_100229493 3300005367 Bacteria 1655
121 Ga0070667_100497764 3300005367 Unclassified 1117
122 Ga0070667_100588247 3300005367 Unclassified 1025
123 Ga0070667_100677071 3300005367 Bacteria 953
124 Ga0070709_10000089 3300005434 Bacteria 65260
125 Ga0070709_10087644 3300005434 Bacteria 2046
126 Ga0070709_10257671 3300005434 Bacteria 1259
127 Ga0070709_10291976 3300005434 Unclassified 1188
128 Ga0070709_10457167 3300005434 Unclassified 963
129 Ga0070709_10491445 3300005434 Bacteria 931
130 Ga0070709_10766364 3300005434 Bacteria 755
131 Ga0070709_11232934 3300005434 Unclassified 602
132 Ga0070714_100076023 3300005435 Unclassified 2915
133 Ga0070713_100012283 3300005436 Bacteria 6275
134 Ga0070713_100073954 3300005436 Bacteria 2886
135 Ga0070713_100385967 3300005436 Bacteria 1306
136 Ga0070713_100554477 3300005436 Bacteria 1088
137 Ga0070713_102478297 3300005436 Bacteria 501
138 Ga0070710_10036452 3300005437 Bacteria 2689
139 Ga0070710_10347963 3300005437 Bacteria 980
140 Ga0070710_10450902 3300005437 Unclassified 872
141 Ga0070711_100015672 3300005439 Bacteria 4799
142 Ga0070711_100042436 3300005439 Bacteria 3074
143 Ga0070711_100073899 3300005439 Bacteria 2410
144 Ga0070711_100343296 3300005439 Bacteria 1199
145 Ga0070711_100640782 3300005439 Bacteria 890
146 Ga0070705_100013396 3300005440 Unclassified 4194
147 Ga0070705_100022908 3300005440 Bacteria 3345
148 Ga0070705_100132449 3300005440 Bacteria 1628
149 Ga0070705_100329537 3300005440 Bacteria 1105
150 Ga0070700_100294326 3300005441 Bacteria 1182
151 Ga0070700_100449172 3300005441 Unclassified 980
152 Ga0070700_100912614 3300005441 Bacteria 716
153 Ga0070694_100005175 3300005444 Bacteria 7871
154 Ga0070694_100123713 3300005444 Unclassified 1859
155 Ga0070694_100176976 3300005444 Bacteria 1575
156 Ga0070708_100000271 3300005445 Bacteria 38546
157 Ga0070708_100071322 3300005445 Bacteria 3127
158 Ga0070708_100254360 3300005445 Bacteria 1650
159 Ga0070708_100395201 3300005445 Bacteria 1304
160 Ga0070708_101181894 3300005445 Bacteria 716
161 Ga0070708_101843239 3300005445 Unclassified 561
162 Ga0070663_100408642 3300005455 Bacteria 1111
163 Ga0070678_100002411 3300005456 Bacteria 10240
164 Ga0070678_100155682 3300005456 Bacteria 1846
165 Ga0070678_100515849 3300005456 Bacteria 1057
166 Ga0070678_101731602 3300005456 Unclassified 588
167 Ga0070662_100000040 3300005457 Bacteria 73497
168 Ga0070662_100091491 3300005457 Bacteria 2285
169 Ga0070662_100230871 3300005457 Bacteria 1480
170 Ga0070662_100780932 3300005457 Bacteria 811
171 Ga0070662_101677028 3300005457 Bacteria 549
172 Ga0070681_10003058 3300005458 Bacteria 15511
173 Ga0070681_10022978 3300005458 Bacteria 6267
174 Ga0070681_10031088 3300005458 Bacteria 5358
175 Ga0070681_10038222 3300005458 Bacteria 4812
176 Ga0070681_10066080 3300005458 Bacteria 3585
177 Ga0070681_10122147 3300005458 Bacteria 2538
178 Ga0070681_10244399 3300005458 Bacteria 1708
179 Ga0070681_11712825 3300005458 Bacteria 555
180 Ga0068867_100000144 3300005459 Bacteria 45710
181 Ga0068867_100017896 3300005459 Bacteria 5034
182 Ga0068867_100036130 3300005459 Bacteria 3585
183 Ga0068867_100136110 3300005459 Bacteria 1915
184 Ga0068867_100358857 3300005459 Bacteria 1218
185 Ga0068867_101366625 3300005459 Unclassified 656
186 Ga0070685_10017987 3300005466 Bacteria 3795
187 Ga0070685_10044335 3300005466 Bacteria 2546
188 Ga0070685_10062086 3300005466 Bacteria 2190
189 Ga0070685_10076860 3300005466 Bacteria 1992
190 Ga0070685_10521899 3300005466 Bacteria 843
191 Ga0070706_100002564 3300005467 Bacteria 18277
192 Ga0070706_100029047 3300005467 Bacteria 5093
193 Ga0070706_100086235 3300005467 Bacteria 2909
194 Ga0070706_100375039 3300005467 Bacteria 1325
195 Ga0070706_100641479 3300005467 Bacteria 986
196 Ga0070706_100928591 3300005467 Bacteria 803
197 Ga0070706_101378053 3300005467 Bacteria 646
198 Ga0070707_100001174 3300005468 Bacteria 25766
199 Ga0070707_100013883 3300005468 Bacteria 7544
200 Ga0070707_100183754 3300005468 Bacteria 2038
201 Ga0070707_100403608 3300005468 Bacteria 1327
202 Ga0070707_100575139 3300005468 Bacteria 1089
203 Ga0070707_100805604 3300005468 Unclassified 903
204 Ga0070707_100951875 3300005468 Bacteria 824
205 Ga0070698_100009906 3300005471 Bacteria 10190
206 Ga0070698_100036742 3300005471 Bacteria 5056
207 Ga0070698_100071446 3300005471 Bacteria 3480
208 Ga0070698_100523681 3300005471 Bacteria 1124
209 Ga0070698_100732604 3300005471 Bacteria 931
210 Ga0070698_102017906 3300005471 Bacteria 530
211 Ga0070699_100022233 3300005518 Bacteria 5464
212 Ga0070699_100076005 3300005518 Bacteria 2923
213 Ga0070699_100088424 3300005518 Bacteria 2706
214 Ga0070699_100093471 3300005518 Bacteria 2631
215 Ga0070699_100125397 3300005518 Bacteria 2260
216 Ga0070699_100145883 3300005518 Bacteria 2091
217 Ga0070699_100192159 3300005518 Bacteria 1814
218 Ga0070699_100600147 3300005518 Bacteria 1004
219 Ga0070699_101029559 3300005518 Bacteria 755
220 Ga0070699_101348733 3300005518 Bacteria 654
221 Ga0070679_100030620 3300005530 Bacteria 5313
222 Ga0070679_100129665 3300005530 Bacteria 2503
223 Ga0070679_100359197 3300005530 Bacteria 1404
224 Ga0070679_100589939 3300005530 Bacteria 1055
225 Ga0070679_101116919 3300005530 Unclassified 733
226 Ga0070679_101591079 3300005530 Bacteria 601
227 Ga0070679_101948090 3300005530 Unclassified 536
228 Ga0070684_100003277 3300005535 Bacteria 12122
229 Ga0070684_100016512 3300005535 Bacteria 6034
230 Ga0070684_100081145 3300005535 Bacteria 2869
231 Ga0070684_100089611 3300005535 Bacteria 2734
232 Ga0070697_100003329 3300005536 Bacteria 12345
233 Ga0070697_100061895 3300005536 Bacteria 3053
234 Ga0070697_100094239 3300005536 Bacteria 2480
235 Ga0070697_100139406 3300005536 Bacteria 2039
236 Ga0070697_100180073 3300005536 Bacteria 1791
237 Ga0070697_100229420 3300005536 Bacteria 1583
238 Ga0070697_101243354 3300005536 Bacteria 664
239 Ga0070697_102022315 3300005536 Bacteria 516
240 Ga0068853_100046224 3300005539 Bacteria 3732
241 Ga0068853_100095936 3300005539 Bacteria 2616
242 Ga0068853_100147650 3300005539 Bacteria 2114
243 Ga0068853_100272526 3300005539 Unclassified 1559
244 Ga0068853_100499956 3300005539 Bacteria 1148
245 Ga0068853_100673010 3300005539 Bacteria 986
246 Ga0068853_100924428 3300005539 Bacteria 838
247 Ga0070672_100013819 3300005543 Bacteria 5708
248 Ga0070686_100074945 3300005544 Bacteria 2225
249 Ga0070686_100172051 3300005544 Unclassified 1532
250 Ga0070686_100243182 3300005544 Bacteria 1311
251 Ga0070686_100319679 3300005544 Bacteria 1157
252 Ga0070695_100006440 3300005545 Bacteria 6943
253 Ga0070695_100010968 3300005545 Bacteria 5417
254 Ga0070695_100018539 3300005545 Bacteria 4228
255 Ga0070695_100054020 3300005545 Bacteria 2584
256 Ga0070695_100085012 3300005545 Bacteria 2100
257 Ga0070695_100148559 3300005545 Bacteria 1633
258 Ga0070695_100383881 3300005545 Bacteria 1061
259 Ga0070695_100683789 3300005545 Bacteria 813
260 Ga0070695_101204667 3300005545 Unclassified 623
261 Ga0070695_101754276 3300005545 Unclassified 520
262 Ga0070696_100001925 3300005546 Bacteria 13674
263 Ga0070696_100011185 3300005546 Bacteria 6006
264 Ga0070696_100965707 3300005546 Bacteria 710
265 Ga0070693_100015057 3300005547 Bacteria 3977
266 Ga0070693_100487283 3300005547 Bacteria 872
267 Ga0070693_100578615 3300005547 Bacteria 808
268 Ga0070665_100006080 3300005548 Bacteria 12341
269 Ga0070665_100412645 3300005548 Unclassified 1359
270 Ga0070665_101634878 3300005548 Unclassified 652
271 Ga0070704_100076560 3300005549 Bacteria 2447
272 Ga0068855_100000575 3300005563 Bacteria 45015
273 Ga0068855_100073696 3300005563 Bacteria 3966
274 Ga0068855_100244523 3300005563 Bacteria 2003
275 Ga0068855_100385153 3300005563 Unclassified 1539
276 Ga0070664_100009874 3300005564 Bacteria 7735
277 Ga0070664_100037495 3300005564 Bacteria 4076
278 Ga0070664_100038968 3300005564 Bacteria 4002
279 Ga0068857_100002591 3300005577 Bacteria 14825
280 Ga0068857_100004522 3300005577 Bacteria 11762
281 Ga0068857_100020580 3300005577 Bacteria 5805
282 Ga0068857_100415766 3300005577 Bacteria 1253
283 Ga0068857_100612490 3300005577 Bacteria 1030
284 Ga0068857_100803535 3300005577 Unclassified 898
285 Ga0068857_100893307 3300005577 Bacteria 852
286 Ga0068857_101609355 3300005577 Unclassified 634
287 Ga0068854_100085292 3300005578 Bacteria 2339
288 Ga0068854_100842746 3300005578 Bacteria 802
289 Ga0068854_100900225 3300005578 Bacteria 778
290 Ga0068854_101803885 3300005578 Bacteria 561
291 Ga0068856_100009628 3300005614 Bacteria 9381
292 Ga0068856_100084303 3300005614 Bacteria 3157
293 Ga0068856_100095042 3300005614 Bacteria 2968
294 Ga0068856_100287006 3300005614 Bacteria 1663
295 Ga0068856_100308600 3300005614 Unclassified 1600
296 Ga0070702_100016403 3300005615 Unclassified 3799
297 Ga0070702_100333629 3300005615 Bacteria 1061
298 Ga0070702_100359608 3300005615 Bacteria 1028
299 Ga0070702_100366539 3300005615 Bacteria 1020
300 Ga0070702_101261353 3300005615 Unclassified 598
301 Ga0070702_101702249 3300005615 Bacteria 524
302 Ga0068852_100323802 3300005616 Bacteria 1498
303 Ga0068852_100324949 3300005616 Bacteria 1495
304 Ga0068852_100553104 3300005616 Unclassified 1151
305 Ga0068852_100794636 3300005616 Bacteria 960
306 Ga0068852_101169464 3300005616 Bacteria 790
307 Ga0068852_101540160 3300005616 Bacteria 687
308 Ga0068859_100011413 3300005617 Bacteria 8931
309 Ga0068859_100215543 3300005617 Bacteria 2007
310 Ga0068864_100001306 3300005618 Bacteria 20734
311 Ga0068864_100023007 3300005618 Bacteria 5230
312 Ga0068864_100089138 3300005618 Bacteria 2718
313 Ga0068864_100109795 3300005618 Bacteria 2456
314 Ga0068864_100502882 3300005618 Bacteria 1166
315 Ga0068866_10000371 3300005718 Bacteria 21133
316 Ga0068866_10582181 3300005718 Unclassified 753
317 Ga0068861_100095003 3300005719 Bacteria 2360
318 Ga0068861_100674144 3300005719 Bacteria 958
319 Ga0068851_10076896 3300005834 Bacteria 1736
320 Ga0068870_10573941 3300005840 Unclassified 763
321 Ga0068870_10940760 3300005840 Bacteria 613
322 Ga0068863_100004629 3300005841 Bacteria 13555
323 Ga0068863_100013880 3300005841 Bacteria 7767
324 Ga0068863_100019350 3300005841 Bacteria 6512
325 Ga0068863_100051436 3300005841 Bacteria 3905
326 Ga0068863_100186051 3300005841 Unclassified 1995
327 Ga0068863_100347156 3300005841 Bacteria 1444
328 Ga0068863_100408505 3300005841 Bacteria 1329
329 Ga0068863_100560732 3300005841 Bacteria 1128
330 Ga0068863_100578709 3300005841 Bacteria 1110
331 Ga0068863_102144009 3300005841 Unclassified 569
332 Ga0068858_100031965 3300005842 Bacteria 4889
333 Ga0068858_100061134 3300005842 Unclassified 3482
334 Ga0068858_100091148 3300005842 Bacteria 2837
335 Ga0068858_100112321 3300005842 Bacteria 2545
336 Ga0068858_100187506 3300005842 Bacteria 1954
337 Ga0068858_101028612 3300005842 Unclassified 808
338 Ga0068858_101326186 3300005842 Bacteria 708
339 Ga0068860_100008121 3300005843 Bacteria 10454
340 Ga0068860_100013172 3300005843 Bacteria 8116
341 Ga0068860_100444466 3300005843 Unclassified 1288
342 Ga0068860_100670144 3300005843 Bacteria 1046
343 Ga0068860_101176329 3300005843 Bacteria 787
344 Ga0068862_100553237 3300005844 Unclassified 1099
345 Ga0068862_100823242 3300005844 Bacteria 908
346 Ga0081455_10029406 3300005937 Bacteria 5010
347 Ga0081455_10444152 3300005937 Bacteria 888
348 Ga0081539_10002282 3300005985 Bacteria 27791
349 Ga0070717_10024268 3300006028 Bacteria 4813
350 Ga0070717_11009896 3300006028 Unclassified 758
351 Ga0070717_11306561 3300006028 Unclassified 659
352 Ga0070717_11484261 3300006028 Unclassified 615
353 Ga0075364_10299880 3300006051 Bacteria 1094
354 Ga0070715_10003486 3300006163 Bacteria 5014
355 Ga0070715_10026306 3300006163 Unclassified 2314
356 Ga0070715_10054833 3300006163 Bacteria 1728
357 Ga0070715_10386339 3300006163 Bacteria 774
358 Ga0070716_100000124 3300006173 Bacteria 30516
359 Ga0070716_100000590 3300006173 Bacteria 15265
360 Ga0070716_100039015 3300006173 Bacteria 2633
361 Ga0070716_100053512 3300006173 Bacteria 2302
362 Ga0070716_100068840 3300006173 Unclassified 2072
363 Ga0070716_100165585 3300006173 Unclassified 1437
364 Ga0070716_100196619 3300006173 Unclassified 1337
365 Ga0070716_100944894 3300006173 Bacteria 678
366 Ga0070716_101087318 3300006173 Bacteria 637
367 Ga0070712_100013754 3300006175 Bacteria 5177
368 Ga0070712_100118775 3300006175 Bacteria 1986
369 Ga0070712_100215046 3300006175 Bacteria 1518
370 Ga0070712_100270359 3300006175 Bacteria 1365
371 Ga0070712_100295060 3300006175 Bacteria 1310
372 Ga0097621_100057378 3300006237 Bacteria 3184
373 Ga0097621_100063876 3300006237 Bacteria 3026
374 Ga0097621_100204432 3300006237 Bacteria 1716
375 Ga0097621_100212684 3300006237 Bacteria 1682
376 Ga0097621_100225744 3300006237 Bacteria 1633
377 Ga0097621_100340943 3300006237 Unclassified 1331
378 Ga0097621_100853805 3300006237 Bacteria 846
379 Ga0068871_100015782 3300006358 Bacteria 5667
380 Ga0068871_100195409 3300006358 Bacteria 1744
381 Ga0068871_100268622 3300006358 Unclassified 1489
382 Ga0068871_100351454 3300006358 Unclassified 1304
383 Ga0068871_101122261 3300006358 Bacteria 736
384 Ga0068871_101170010 3300006358 Bacteria 721
385 Ga0075428_100147718 3300006844 Bacteria 2555
386 Ga0075428_100534935 3300006844 Bacteria 1253
387 Ga0075430_100370183 3300006846 Bacteria 1183
388 Ga0075430_100600385 3300006846 Bacteria 908
389 Ga0075431_100030888 3300006847 Bacteria 5517
390 Ga0075431_100044455 3300006847 Bacteria 4581
391 Ga0075431_100050802 3300006847 Unclassified 4275
392 Ga0075431_100057677 3300006847 Bacteria 4005
393 Ga0075431_100804789 3300006847 Bacteria 913
394 Ga0075433_10016402 3300006852 Bacteria 6104
395 Ga0075433_10033646 3300006852 Bacteria 4396
396 Ga0075433_10046537 3300006852 Bacteria 3774
397 Ga0075433_10099514 3300006852 Bacteria 2574
398 Ga0075433_10300600 3300006852 Bacteria 1421
399 Ga0075434_100003534 3300006871 Bacteria 13947
400 Ga0075434_100003714 3300006871 Bacteria 13633
401 Ga0075434_100007168 3300006871 Bacteria 10305
402 Ga0075434_100010866 3300006871 Bacteria 8558
403 Ga0075434_100022633 3300006871 Bacteria 6119
404 Ga0075434_100092687 3300006871 Bacteria 3024
405 Ga0075434_100107195 3300006871 Bacteria 2804
406 Ga0075434_100109201 3300006871 Bacteria 2777
407 Ga0075434_100144056 3300006871 Bacteria 2403
408 Ga0075429_100091980 3300006880 Bacteria 2646
409 Ga0075429_100888008 3300006880 Unclassified 780
410 Ga0075429_101884269 3300006880 Bacteria 518
411 Ga0068865_100046597 3300006881 Bacteria 2975
412 Ga0068865_100052091 3300006881 Unclassified 2835
413 Ga0068865_100288262 3300006881 Bacteria 1309
414 Ga0068865_100522248 3300006881 Bacteria 993
415 Ga0068865_100848352 3300006881 Unclassified 791
416 Ga0075436_100001018 3300006914 Bacteria 18888
417 Ga0075436_100002018 3300006914 Bacteria 14017
418 Ga0075436_100007884 3300006914 Bacteria 7287
419 Ga0075436_100017242 3300006914 Bacteria 4943
420 Ga0075436_100133320 3300006914 Bacteria 1743
421 Ga0097620_100011413 3300006931 Bacteria 8931
422 Ga0097620_100215559 3300006931 Bacteria 2007
423 Ga0097620_101902605 3300006931 Bacteria 657
424 Ga0075435_100029060 3300007076 Bacteria 4338
425 Ga0075435_100126320 3300007076 Unclassified 2138
426 Ga0075435_100216426 3300007076 Bacteria 1626
427 Ga0075435_100280375 3300007076 Bacteria 1423
428 Ga0075435_100308030 3300007076 Bacteria 1355
429 Ga0075435_100381962 3300007076 Bacteria 1210
430 Ga0075435_101224299 3300007076 Bacteria 657
431 Ga0075435_101653943 3300007076 Bacteria 562
432 Ga0099794_10003116 3300007265 Bacteria 6277
433 Ga0099794_10005039 3300007265 Bacteria 5263
434 Ga0099794_10056952 3300007265 Bacteria 1893
435 Ga0099794_10058922 3300007265 Unclassified 1862
436 Ga0099794_10098315 3300007265 Bacteria 1459
437 Ga0099794_10296672 3300007265 Bacteria 837
438 Ga0099794_10325361 3300007265 Bacteria 798
439 Ga0099794_10371387 3300007265 Bacteria 745
440 Ga0099794_10422937 3300007265 Unclassified 697
441 Ga0099794_10474288 3300007265 Bacteria 657
442 Ga0105250_10220886 3300009092 Bacteria 803
443 Ga0105240_10013290 3300009093 Bacteria 11318
444 Ga0105240_10257429 3300009093 Bacteria 2015
445 Ga0105240_10336552 3300009093 Bacteria 1716
446 Ga0105240_10341585 3300009093 Bacteria 1701
447 Ga0105240_10390648 3300009093 Bacteria 1569
448 Ga0105240_10394295 3300009093 Unclassified 1561
449 Ga0111539_10055168 3300009094 Bacteria 4724
450 Ga0111539_10458885 3300009094 Bacteria 1484
451 Ga0111539_10731600 3300009094 Bacteria 1152
452 Ga0105245_10003441 3300009098 Bacteria 14187
453 Ga0105245_10241574 3300009098 Bacteria 1751
454 Ga0105245_10251419 3300009098 Bacteria 1717
455 Ga0105245_10443406 3300009098 Bacteria 1305
456 Ga0105245_11608624 3300009098 Bacteria 701
457 Ga0105245_12293828 3300009098 Unclassified 593
458 Ga0105245_12412460 3300009098 Unclassified 579
459 Ga0105245_12544758 3300009098 Bacteria 565
460 Ga0105247_10010761 3300009101 Bacteria 5526
461 Ga0105247_10045350 3300009101 Bacteria 2697
462 Ga0105247_10257834 3300009101 Bacteria 1194
463 Ga0105247_10391048 3300009101 Bacteria 988
464 Ga0114129_10000427 3300009147 Bacteria 49990
465 Ga0114129_10041711 3300009147 Bacteria 6463
466 Ga0114129_10050826 3300009147 Bacteria 5821
467 Ga0105243_10001466 3300009148 Bacteria 20725
468 Ga0105243_10109853 3300009148 Bacteria 2304
469 Ga0105243_10504743 3300009148 Bacteria 1147
470 Ga0105241_10008109 3300009174 Bacteria 7731
471 Ga0105241_10017114 3300009174 Bacteria 5324
472 Ga0105241_10070494 3300009174 Unclassified 2712
473 Ga0105241_10213969 3300009174 Bacteria 1616
474 Ga0105242_10000578 3300009176 Bacteria 29041
475 Ga0105242_10011051 3300009176 Bacteria 6937
476 Ga0105242_10133921 3300009176 Bacteria 2143
477 Ga0105242_10254443 3300009176 Bacteria 1584
478 Ga0105242_10261752 3300009176 Bacteria 1563
479 Ga0105242_10297480 3300009176 Unclassified 1472
480 Ga0105242_10366298 3300009176 Bacteria 1335
481 Ga0105242_10620670 3300009176 Bacteria 1047
482 Ga0105242_10729366 3300009176 Bacteria 973
483 Ga0105242_12658411 3300009176 Bacteria 550
484 Ga0105248_10000048 3300009177 Bacteria 154635
485 Ga0105248_10006182 3300009177 Bacteria 13124
486 Ga0105248_10006508 3300009177 Bacteria 12810
487 Ga0105248_10442851 3300009177 Bacteria 1463
488 Ga0105248_12462296 3300009177 Bacteria 593
489 Ga0105237_10033491 3300009545 Bacteria 5205
490 Ga0105237_10044860 3300009545 Bacteria 4451
491 Ga0105237_10118202 3300009545 Bacteria 2645
492 Ga0105237_10830364 3300009545 Bacteria 931
493 Ga0105237_11020278 3300009545 Bacteria 834
494 Ga0105238_10006669 3300009551 Bacteria 11514
495 Ga0105238_10011302 3300009551 Bacteria 8982
496 Ga0105238_10029409 3300009551 Bacteria 5597
497 Ga0105238_10075281 3300009551 Bacteria 3368
498 Ga0105238_11932397 3300009551 Unclassified 623
499 Ga0105249_10023393 3300009553 Bacteria 5544
500 Ga0105249_10033162 3300009553 Bacteria 4675
501 Ga0105249_10266545 3300009553 Unclassified 1704
502 Ga0105249_10801748 3300009553 Bacteria 1006
503 Ga0105249_10888983 3300009553 Bacteria 957
504 Ga0105249_10971291 3300009553 Bacteria 918
505 Ga0105249_11408571 3300009553 Bacteria 769
506 Ga0105249_11580513 3300009553 Unclassified 728
507 Ga0105249_11827390 3300009553 Unclassified 680
508 Ga0105249_12588882 3300009553 Bacteria 580
509 Ga0105239_10004454 3300010375 Bacteria 16743
510 Ga0105239_10008245 3300010375 Bacteria 11882
511 Ga0105239_10016772 3300010375 Bacteria 8096
512 Ga0105239_10071785 3300010375 Bacteria 3804
513 Ga0105239_10129694 3300010375 Bacteria 2803
514 Ga0105239_10292234 3300010375 Bacteria 1835
515 Ga0105239_10539425 3300010375 Unclassified 1328
516 Ga0105239_11471836 3300010375 Bacteria 787
517 Ga0105239_11914550 3300010375 Bacteria 688
518 Ga0105239_12274672 3300010375 Bacteria 631
519 Ga0105246_10029307 3300011119 Bacteria 3623
520 Ga0105246_10203467 3300011119 Bacteria 1541
521 Ga0105246_10416843 3300011119 Bacteria 1119
522 Ga0157373_10347512 3300013100 Bacteria 1058
523 Ga0157373_10351758 3300013100 Unclassified 1051
524 Ga0157373_10371609 3300013100 Bacteria 1022
525 Ga0157371_10450507 3300013102 Unclassified 946
526 Ga0157370_10039076 3300013104 Bacteria 4587
527 Ga0157370_11407800 3300013104 Bacteria 627
528 Ga0157369_10007677 3300013105 Bacteria 12410
529 Ga0157369_10047462 3300013105 Bacteria 4662
530 Ga0157369_10452209 3300013105 Bacteria 1330
531 Ga0157374_10402061 3300013296 Bacteria 1366
532 Ga0157374_10497810 3300013296 Bacteria 1223
533 Ga0157374_10542348 3300013296 Bacteria 1170
534 Ga0157374_12716165 3300013296 Unclassified 523
535 Ga0157378_10000458 3300013297 Bacteria 38993
536 Ga0157378_10001404 3300013297 Bacteria 21665
537 Ga0157378_10038715 3300013297 Bacteria 4227
538 Ga0157378_10079105 3300013297 Bacteria 2968
539 Ga0157378_10198673 3300013297 Bacteria 1896
540 Ga0157378_10336136 3300013297 Bacteria 1471
541 Ga0157378_10373466 3300013297 Bacteria 1398
542 Ga0157378_10530229 3300013297 Bacteria 1180
543 Ga0157378_11231556 3300013297 Unclassified 788
544 Ga0157378_11528119 3300013297 Unclassified 712
545 Ga0163162_10027535 3300013306 Bacteria 5620
546 Ga0163162_10050770 3300013306 Unclassified 4159
547 Ga0163162_10162437 3300013306 Bacteria 2356
548 Ga0163162_10439680 3300013306 Bacteria 1436
549 Ga0163162_11450341 3300013306 Bacteria 781
550 Ga0157372_10003096 3300013307 Bacteria 17910
551 Ga0157372_10057491 3300013307 Bacteria 4348
552 Ga0157372_10908029 3300013307 Unclassified 1022
553 Ga0157375_10027604 3300013308 Bacteria 5308
554 Ga0157375_10249264 3300013308 Bacteria 1936
555 Ga0157375_10390488 3300013308 Bacteria 1558
556 Ga0157375_10416108 3300013308 Bacteria 1510
557 Ga0157375_11004748 3300013308 Bacteria 974
558 Ga0157375_11283374 3300013308 Bacteria 860
559 Ga0157375_12691213 3300013308 Unclassified 595
560 Ga0163163_10000775 3300014325 Bacteria 27113
561 Ga0163163_10042497 3300014325 Bacteria 4452
562 Ga0163163_10071384 3300014325 Bacteria 3460
563 Ga0163163_10300473 3300014325 Bacteria 1658
564 Ga0163163_10465374 3300014325 Bacteria 1325
565 Ga0163163_13042161 3300014325 Bacteria 523
566 Ga0157380_10086070 3300014326 Unclassified 2582
567 Ga0157380_10181557 3300014326 Bacteria 1849
568 Ga0157380_10747493 3300014326 Unclassified 989
569 Ga0157380_11554686 3300014326 Unclassified 716
570 Ga0157377_10069519 3300014745 Bacteria 2032
571 Ga0157377_10216030 3300014745 Bacteria 1225
572 Ga0157377_10221758 3300014745 Bacteria 1211
573 Ga0157379_10003008 3300014968 Bacteria 14232
574 Ga0157379_10179064 3300014968 Bacteria 1915
575 Ga0157379_10397749 3300014968 Bacteria 1266
576 Ga0157379_11521883 3300014968 Unclassified 651
577 Ga0157376_10000005 3300014969 Bacteria 443695
578 Ga0157376_10071571 3300014969 Bacteria 2947
579 Ga0157376_10087962 3300014969 Unclassified 2682
580 Ga0157376_10276855 3300014969 Bacteria 1579
581 Ga0157376_10292920 3300014969 Unclassified 1537
582 Ga0157376_12324177 3300014969 Bacteria 575
583 Ga0163161_10013122 3300017792 Bacteria 5759
584 Ga0163161_10075748 3300017792 Bacteria 2469
585 Ga0163161_10651454 3300017792 Unclassified 873
586 Ga0206356_10726241 3300020070 Bacteria 793
587 Ga0206352_10699970 3300020078 Bacteria 1088
588 Ga0213873_10058313 3300021358 Unclassified 1039
589 Ga0213876_10682854 3300021384 Bacteria 546
590 Ga0213875_10006385 3300021388 Bacteria 6200
591 Ga0224712_10145603 3300022467 Bacteria 1046
592 Ga0228598_1014245 3300024227 Unclassified 1572
593 Ga0228598_1082298 3300024227 Bacteria 646
594 Ga0207653_10005201 3300025885 Bacteria 4067
595 Ga0207653_10063795 3300025885 Bacteria 1248
596 Ga0207682_10007490 3300025893 Unclassified 4346
597 Ga0207692_10028715 3300025898 Unclassified 2635
598 Ga0207692_10281947 3300025898 Bacteria 1006
599 Ga0207692_10308049 3300025898 Bacteria 966
600 Ga0207692_10429551 3300025898 Bacteria 828
601 Ga0207692_10627596 3300025898 Unclassified 693
602 Ga0207642_10000217 3300025899 Bacteria 16924
603 Ga0207642_10462790 3300025899 Unclassified 770
604 Ga0207642_10715006 3300025899 Unclassified 632
605 Ga0207710_10164044 3300025900 Bacteria 1084
606 Ga0207710_10322521 3300025900 Bacteria 783
607 Ga0207710_10420669 3300025900 Unclassified 687
608 Ga0207710_10441956 3300025900 Bacteria 671
609 Ga0207710_10756194 3300025900 Unclassified 510
610 Ga0207688_10570950 3300025901 Unclassified 712
611 Ga0207680_10040634 3300025903 Bacteria 2708
612 Ga0207680_10071033 3300025903 Bacteria 2157
613 Ga0207680_10357626 3300025903 Bacteria 1026
614 Ga0207680_10368875 3300025903 Unclassified 1010
615 Ga0207685_10067613 3300025905 Bacteria 1437
616 Ga0207685_10113744 3300025905 Bacteria 1177
617 Ga0207699_10000070 3300025906 Bacteria 82065
618 Ga0207699_10005919 3300025906 Bacteria 5883
619 Ga0207699_10041220 3300025906 Bacteria 2665
620 Ga0207699_10128825 3300025906 Bacteria 1647
621 Ga0207699_10310203 3300025906 Bacteria 1104
622 Ga0207699_10392121 3300025906 Bacteria 987
623 Ga0207699_10641870 3300025906 Bacteria 775
624 Ga0207699_11087914 3300025906 Unclassified 592
625 Ga0207699_11265316 3300025906 Unclassified 546
626 Ga0207645_10002681 3300025907 Bacteria 13865
627 Ga0207645_10017926 3300025907 Bacteria 4669
628 Ga0207645_10022217 3300025907 Bacteria 4130
629 Ga0207645_10162055 3300025907 Bacteria 1463
630 Ga0207705_10227980 3300025909 Bacteria 1416
631 Ga0207705_10414864 3300025909 Bacteria 1042
632 Ga0207684_10057040 3300025910 Bacteria 3314
633 Ga0207684_10068405 3300025910 Bacteria 3018
634 Ga0207684_10160591 3300025910 Bacteria 1935
635 Ga0207684_10172533 3300025910 Bacteria 1864
636 Ga0207684_10358698 3300025910 Bacteria 1254
637 Ga0207654_10021530 3300025911 Unclassified 3429
638 Ga0207654_10037319 3300025911 Bacteria 2719
639 Ga0207654_10091474 3300025911 Bacteria 1855
640 Ga0207654_10124443 3300025911 Bacteria 1624
641 Ga0207654_10806214 3300025911 Unclassified 678
642 Ga0207707_10006092 3300025912 Bacteria 10551
643 Ga0207707_10011691 3300025912 Bacteria 7640
644 Ga0207707_10068280 3300025912 Bacteria 3097
645 Ga0207707_10073571 3300025912 Bacteria 2980
646 Ga0207707_10179008 3300025912 Bacteria 1851
647 Ga0207695_10000563 3300025913 Bacteria 76084
648 Ga0207695_10179370 3300025913 Bacteria 2039
649 Ga0207695_10210342 3300025913 Unclassified 1856
650 Ga0207695_10214287 3300025913 Bacteria 1835
651 Ga0207695_10355813 3300025913 Bacteria 1351
652 Ga0207695_10418026 3300025913 Bacteria 1225
653 Ga0207671_10016632 3300025914 Bacteria 5711
654 Ga0207671_10056609 3300025914 Bacteria 2905
655 Ga0207671_10084334 3300025914 Bacteria 2386
656 Ga0207671_10402860 3300025914 Bacteria 1088
657 Ga0207671_10825830 3300025914 Bacteria 734
658 Ga0207693_10019653 3300025915 Bacteria 5372
659 Ga0207693_10020695 3300025915 Bacteria 5232
660 Ga0207693_10049630 3300025915 Bacteria 3296
661 Ga0207693_10056472 3300025915 Unclassified 3077
662 Ga0207693_10085305 3300025915 Unclassified 2474
663 Ga0207693_10302870 3300025915 Bacteria 1252
664 Ga0207693_10830601 3300025915 Unclassified 711
665 Ga0207663_10000163 3300025916 Bacteria 30546
666 Ga0207663_10002079 3300025916 Bacteria 9538
667 Ga0207663_10065213 3300025916 Bacteria 2327
668 Ga0207663_10153972 3300025916 Bacteria 1615
669 Ga0207663_10345319 3300025916 Bacteria 1125
670 Ga0207663_10488644 3300025916 Bacteria 955
671 Ga0207660_10010362 3300025917 Bacteria 6048
672 Ga0207660_10020098 3300025917 Bacteria 4478
673 Ga0207660_10271952 3300025917 Bacteria 1342
674 Ga0207660_10275394 3300025917 Bacteria 1334
675 Ga0207662_10062811 3300025918 Bacteria 2232
676 Ga0207662_10157114 3300025918 Unclassified 1450
677 Ga0207662_10219196 3300025918 Unclassified 1238
678 Ga0207657_10037816 3300025919 Bacteria 4305
679 Ga0207657_10160003 3300025919 Bacteria 1829
680 Ga0207657_10295580 3300025919 Unclassified 1284
681 Ga0207649_10073489 3300025920 Bacteria 2191
682 Ga0207649_10083847 3300025920 Bacteria 2070
683 Ga0207649_10230345 3300025920 Bacteria 1324
684 Ga0207649_10740756 3300025920 Unclassified 764
685 Ga0207652_10015913 3300025921 Bacteria 6129
686 Ga0207652_10051683 3300025921 Bacteria 3524
687 Ga0207652_10133665 3300025921 Bacteria 2214
688 Ga0207652_10193638 3300025921 Bacteria 1828
689 Ga0207652_10845311 3300025921 Unclassified 811
690 Ga0207652_11055714 3300025921 Bacteria 712
691 Ga0207646_10000020 3300025922 Bacteria 272909
692 Ga0207646_10017265 3300025922 Bacteria 6759
693 Ga0207646_10019160 3300025922 Bacteria 6363
694 Ga0207646_10027097 3300025922 Bacteria 5226
695 Ga0207646_10083259 3300025922 Bacteria 2861
696 Ga0207646_10181045 3300025922 Bacteria 1904
697 Ga0207646_10276284 3300025922 Bacteria 1518
698 Ga0207646_10872688 3300025922 Unclassified 799
699 Ga0207646_10877431 3300025922 Bacteria 797
700 Ga0207646_11022727 3300025922 Unclassified 729
701 Ga0207646_11159380 3300025922 Unclassified 679
702 Ga0207681_10000034 3300025923 Bacteria 163792
703 Ga0207681_10218465 3300025923 Unclassified 1473
704 Ga0207681_10774327 3300025923 Unclassified 801
705 Ga0207694_10013321 3300025924 Bacteria 6192
706 Ga0207694_10032800 3300025924 Bacteria 3977
707 Ga0207694_10035413 3300025924 Bacteria 3829
708 Ga0207694_10296265 3300025924 Bacteria 1331
709 Ga0207650_10031899 3300025925 Bacteria 3809
710 Ga0207650_10285523 3300025925 Bacteria 1345
711 Ga0207650_10396212 3300025925 Bacteria 1142
712 Ga0207650_11537498 3300025925 Bacteria 565
713 Ga0207659_10019893 3300025926 Bacteria 4428
714 Ga0207659_10120728 3300025926 Bacteria 2008
715 Ga0207659_10313362 3300025926 Bacteria 1292
716 Ga0207659_10338370 3300025926 Unclassified 1246
717 Ga0207659_10340544 3300025926 Unclassified 1242
718 Ga0207659_10388755 3300025926 Bacteria 1165
719 Ga0207659_10900294 3300025926 Unclassified 761
720 Ga0207687_10009310 3300025927 Bacteria 6424
721 Ga0207687_10015895 3300025927 Bacteria 4938
722 Ga0207687_10159489 3300025927 Bacteria 1730
723 Ga0207700_10004110 3300025928 Bacteria 8537
724 Ga0207700_10007176 3300025928 Bacteria 6792
725 Ga0207700_10023400 3300025928 Bacteria 4258
726 Ga0207700_11751088 3300025928 Unclassified 547
727 Ga0207664_10005108 3300025929 Bacteria 8938
728 Ga0207664_10074554 3300025929 Bacteria 2742
729 Ga0207664_10629597 3300025929 Bacteria 964
730 Ga0207644_10323941 3300025931 Bacteria 1246
731 Ga0207644_10415181 3300025931 Bacteria 1102
732 Ga0207644_10554629 3300025931 Unclassified 951
733 Ga0207690_10022088 3300025932 Bacteria 3954
734 Ga0207690_10096945 3300025932 Bacteria 2098
735 Ga0207706_10000005 3300025933 Bacteria 224460
736 Ga0207706_10089812 3300025933 Bacteria 2701
737 Ga0207706_10100039 3300025933 Bacteria 2551
738 Ga0207706_10555830 3300025933 Bacteria 988
739 Ga0207686_10000129 3300025934 Bacteria 61050
740 Ga0207686_10015891 3300025934 Bacteria 4217
741 Ga0207686_10048338 3300025934 Bacteria 2635
742 Ga0207686_10069020 3300025934 Bacteria 2266
743 Ga0207686_10141900 3300025934 Bacteria 1661
744 Ga0207686_10303509 3300025934 Bacteria 1186
745 Ga0207686_10387988 3300025934 Bacteria 1061
746 Ga0207686_10518106 3300025934 Bacteria 928
747 Ga0207686_10570417 3300025934 Bacteria 887
748 Ga0207686_11019235 3300025934 Bacteria 672
749 Ga0207709_10024554 3300025935 Unclassified 3443
750 Ga0207709_10433733 3300025935 Bacteria 1012
751 Ga0207709_10619399 3300025935 Bacteria 859
752 Ga0207709_10853550 3300025935 Unclassified 738
753 Ga0207670_10047154 3300025936 Bacteria 2868
754 Ga0207670_10544985 3300025936 Unclassified 947
755 Ga0207670_11784162 3300025936 Unclassified 523
756 Ga0207669_10000265 3300025937 Bacteria 23882
757 Ga0207669_10762600 3300025937 Unclassified 800
758 Ga0207669_10895059 3300025937 Unclassified 741
759 Ga0207704_10010291 3300025938 Unclassified 4556
760 Ga0207704_10034138 3300025938 Bacteria 2900
761 Ga0207704_10101986 3300025938 Bacteria 1915
762 Ga0207704_10413888 3300025938 Bacteria 1067
763 Ga0207665_10000774 3300025939 Bacteria 21536
764 Ga0207665_10001443 3300025939 Bacteria 15988
765 Ga0207665_10021115 3300025939 Bacteria 4280
766 Ga0207665_10026660 3300025939 Unclassified 3815
767 Ga0207665_10068894 3300025939 Bacteria 2411
768 Ga0207665_10073524 3300025939 Bacteria 2338
769 Ga0207665_10200049 3300025939 Bacteria 1455
770 Ga0207691_10052968 3300025940 Bacteria 3706
771 Ga0207691_10097596 3300025940 Bacteria 2626
772 Ga0207691_10170697 3300025940 Unclassified 1905
773 Ga0207691_10834196 3300025940 Unclassified 773
774 Ga0207711_10008760 3300025941 Bacteria 8462
775 Ga0207711_10025232 3300025941 Bacteria 4987
776 Ga0207711_10078407 3300025941 Bacteria 2882
777 Ga0207711_10531984 3300025941 Bacteria 1096
778 Ga0207711_11749166 3300025941 Bacteria 565
779 Ga0207711_12075465 3300025941 Bacteria 511
780 Ga0207689_10004128 3300025942 Bacteria 13197
781 Ga0207689_10070463 3300025942 Bacteria 2872
782 Ga0207689_10569872 3300025942 Bacteria 951
783 Ga0207689_10595969 3300025942 Bacteria 929
784 Ga0207661_10000775 3300025944 Bacteria 20758
785 Ga0207661_10024100 3300025944 Bacteria 4606
786 Ga0207661_10032909 3300025944 Bacteria 4021
787 Ga0207661_10052253 3300025944 Bacteria 3264
788 Ga0207661_10107807 3300025944 Bacteria 2350
789 Ga0207661_10370116 3300025944 Bacteria 1295
790 Ga0207661_11084850 3300025944 Bacteria 737
791 Ga0207661_11553535 3300025944 Unclassified 606
792 Ga0207679_10002634 3300025945 Bacteria 11075
793 Ga0207679_10055132 3300025945 Bacteria 2929
794 Ga0207679_10096386 3300025945 Bacteria 2302
795 Ga0207679_10412963 3300025945 Bacteria 1190
796 Ga0207679_10757948 3300025945 Bacteria 883
797 Ga0207667_10001778 3300025949 Bacteria 27124
798 Ga0207667_10006264 3300025949 Bacteria 14444
799 Ga0207667_10031871 3300025949 Bacteria 5685
800 Ga0207667_10355302 3300025949 Unclassified 1494
801 Ga0207651_10016817 3300025960 Bacteria 4300
802 Ga0207651_10100878 3300025960 Unclassified 2141
803 Ga0207651_10314819 3300025960 Bacteria 1306
804 Ga0207651_10339517 3300025960 Bacteria 1261
805 Ga0207651_11186565 3300025960 Unclassified 685
806 Ga0207712_10008358 3300025961 Bacteria 6540
807 Ga0207712_10437427 3300025961 Bacteria 1107
808 Ga0207712_11762547 3300025961 Unclassified 555
809 Ga0207668_10198145 3300025972 Bacteria 1597
810 Ga0207640_10166220 3300025981 Bacteria 1638
811 Ga0207640_10340379 3300025981 Unclassified 1201
812 Ga0207658_10098706 3300025986 Bacteria 2282
813 Ga0207658_10147642 3300025986 Bacteria 1912
814 Ga0207658_10646336 3300025986 Bacteria 953
815 Ga0207658_11178154 3300025986 Unclassified 700
816 Ga0207677_10022009 3300026023 Bacteria 3909
817 Ga0207677_10072466 3300026023 Bacteria 2435
818 Ga0207677_11017327 3300026023 Bacteria 752
819 Ga0207677_11777976 3300026023 Bacteria 572
820 Ga0207703_10023203 3300026035 Bacteria 4873
821 Ga0207703_10061300 3300026035 Bacteria 3079
822 Ga0207703_10071335 3300026035 Bacteria 2869
823 Ga0207703_10128768 3300026035 Bacteria 2183
824 Ga0207703_10479799 3300026035 Unclassified 1165
825 Ga0207703_10494422 3300026035 Unclassified 1147
826 Ga0207703_10754669 3300026035 Bacteria 927
827 Ga0207703_11149899 3300026035 Bacteria 746
828 Ga0207639_10075777 3300026041 Bacteria 2647
829 Ga0207639_10118028 3300026041 Bacteria 2175
830 Ga0207639_10210403 3300026041 Unclassified 1674
831 Ga0207639_10323222 3300026041 Bacteria 1371
832 Ga0207639_10589023 3300026041 Bacteria 1024
833 Ga0207639_10617432 3300026041 Bacteria 1001
834 Ga0207639_10926411 3300026041 Bacteria 815
835 Ga0207678_10539142 3300026067 Bacteria 1020
836 Ga0207708_10078604 3300026075 Unclassified 2533
837 Ga0207708_10083233 3300026075 Bacteria 2459
838 Ga0207708_10153065 3300026075 Unclassified 1817
839 Ga0207708_10172815 3300026075 Bacteria 1712
840 Ga0207708_10296831 3300026075 Bacteria 1313
841 Ga0207708_11328099 3300026075 Unclassified 630
842 Ga0207702_10111347 3300026078 Bacteria 2434
843 Ga0207702_10249655 3300026078 Unclassified 1666
844 Ga0207702_10337824 3300026078 Bacteria 1438
845 Ga0207702_10487815 3300026078 Bacteria 1200
846 Ga0207702_10595702 3300026078 Bacteria 1084
847 Ga0207702_11294824 3300026078 Bacteria 723
848 Ga0207641_10000673 3300026088 Bacteria 37086
849 Ga0207641_10072292 3300026088 Bacteria 2970
850 Ga0207641_10110027 3300026088 Bacteria 2441
851 Ga0207641_10561495 3300026088 Unclassified 1114
852 Ga0207641_10566005 3300026088 Bacteria 1110
853 Ga0207641_10572548 3300026088 Bacteria 1103
854 Ga0207641_10810587 3300026088 Unclassified 926
855 Ga0207641_11527415 3300026088 Bacteria 669
856 Ga0207641_12103622 3300026088 Unclassified 565
857 Ga0207648_10000021 3300026089 Bacteria 139257
858 Ga0207648_10044955 3300026089 Bacteria 3874
859 Ga0207648_10233660 3300026089 Bacteria 1636
860 Ga0207648_10377700 3300026089 Bacteria 1281
861 Ga0207648_10857427 3300026089 Unclassified 847
862 Ga0207648_11041158 3300026089 Unclassified 767
863 Ga0207648_12109408 3300026089 Bacteria 525
864 Ga0207676_10008617 3300026095 Bacteria 7248
865 Ga0207676_10184017 3300026095 Unclassified 1832
866 Ga0207676_10288859 3300026095 Bacteria 1492
867 Ga0207676_10332777 3300026095 Bacteria 1398
868 Ga0207676_10814793 3300026095 Unclassified 911
869 Ga0207674_10001486 3300026116 Bacteria 30262
870 Ga0207674_10002911 3300026116 Bacteria 21255
871 Ga0207674_10005071 3300026116 Bacteria 15722
872 Ga0207674_10011599 3300026116 Bacteria 9899
873 Ga0207674_10434205 3300026116 Bacteria 1269
874 Ga0207674_11208357 3300026116 Unclassified 726
875 Ga0207674_11915252 3300026116 Unclassified 559
876 Ga0207675_100003902 3300026118 Bacteria 14501
877 Ga0207675_100127101 3300026118 Bacteria 2415
878 Ga0207675_100579130 3300026118 Bacteria 1124
879 Ga0207683_10007609 3300026121 Bacteria 9278
880 Ga0207683_10393740 3300026121 Bacteria 1274
881 Ga0207683_11316141 3300026121 Unclassified 669
882 Ga0207698_10180882 3300026142 Bacteria 1868
883 Ga0207698_10453997 3300026142 Unclassified 1238
884 Ga0207698_10699514 3300026142 Bacteria 1008
885 Ga0209588_1006055 3300027671 Bacteria 3493
886 Ga0209588_1022012 3300027671 Bacteria 2005
887 Ga0209588_1025551 3300027671 Bacteria 1869
888 Ga0209588_1028705 3300027671 Unclassified 1772
889 Ga0209588_1169127 3300027671 Bacteria 688
890 Ga0209588_1282704 3300027671 Bacteria 501
891 Ga0209974_10053294 3300027876 Bacteria 1362
892 Ga0207428_10025646 3300027907 Bacteria 4932
893 Ga0207428_10174566 3300027907 Bacteria 1626
894 Ga0207428_10544966 3300027907 Unclassified 839
895 Ga0268266_10000416 3300028379 Bacteria 64671
896 Ga0268266_10362091 3300028379 Unclassified 1365
897 Ga0268265_10685855 3300028380 Unclassified 988
898 Ga0268265_10791829 3300028380 Bacteria 923
899 Ga0268264_10003798 3300028381 Bacteria 12955
900 Ga0268264_10023927 3300028381 Bacteria 4983
901 Ga0268264_10089263 3300028381 Bacteria 2654
902 Ga0268264_10206511 3300028381 Bacteria 1800
903 Ga0268264_10386957 3300028381 Bacteria 1341
904 Ga0268264_12258030 3300028381 Unclassified 551
905 Ga0265334_10231006 3300028573 Unclassified 639
906 Ga0265338_10002463 3300028800 Bacteria 27648
907 Ga0265338_10003852 3300028800 Bacteria 20806
908 Ga0265762_1121964 3300030760 Bacteria 597
909 Ga0265760_10014729 3300031090 Unclassified 2242
910 Ga0265332_10025074 3300031238 Unclassified 2621
911 Ga0265328_10007859 3300031239 Bacteria 4431
912 Ga0265325_10057759 3300031241 Unclassified 1978
913 Ga0265325_10127924 3300031241 Bacteria 1219
914 Ga0265339_10006275 3300031249 Bacteria 7815
915 Ga0265331_10203088 3300031250 Unclassified 892
916 Ga0265316_10786295 3300031344 Unclassified 668
917 Ga0307408_100966364 3300031548 Bacteria 783
918 Ga0265313_10006814 3300031595 Bacteria 7978
919 Ga0307508_10025945 3300031616 Bacteria 5314
920 Ga0265342_10565423 3300031712 Unclassified 576
921 Ga0307405_10237438 3300031731 Bacteria 1348
922 Ga0307413_10385075 3300031824 Bacteria 1094
923 Ga0307413_10690405 3300031824 Unclassified 847
924 Ga0307406_10088706 3300031901 Bacteria 2076
925 Ga0307412_10187589 3300031911 Bacteria 1561
926 Ga0307416_103820882 3300032002 Unclassified 504
927 Ga0307411_10474832 3300032005 Bacteria 1052
928 Ga0373926_0005187 3300035083 Bacteria 4288
929 Ga0373929_0077551 3300035085 Unclassified 805
930 Ga0373934_0008592 3300035086 Bacteria 3808
931 Ga0373934_0351900 3300035086 Bacteria 613
932 Ga0373944_0169004 3300035089 Bacteria 779
933 Ga0373923_0299102 3300035111 Bacteria 761
934 Ga0373923_0549474 3300035111 Unclassified 566
935 Ga0373936_0123277 3300035113 Bacteria 1109
936 Ga0373936_0363546 3300035113 Bacteria 660
937 Ga0373939_0010509 3300035114 Bacteria 2317
938 Ga0373939_0539439 3300035114 Unclassified 503
939 Ga0373941_0000825 3300035115 Bacteria 6368
940 Ga0373945_0192724 3300035116 Unclassified 843
941 Ga0373953_0054053 3300035117 Bacteria 1628
942 Ga0373954_0030861 3300035118 Unclassified 2472
943 Ga0373954_0200590 3300035118 Bacteria 980
944 Ga0373954_0308744 3300035118 Bacteria 780
945 Ga0373956_0001187 3300035119 Bacteria 10761
946 Ga0373956_0029447 3300035119 Bacteria 2395
947 Ga0373957_0041710 3300035120 Bacteria 1729
948 Ga0373957_0049429 3300035120 Bacteria 1605
949 Ga0373943_0412876 3300035170 Bacteria 781
950 Ga0373943_0820203 3300035170 Unclassified 554
951 Ga0373946_0051503 3300035171 Unclassified 1723
952 Ga0373955_0001637 3300035172 Bacteria 9584
953 Ga0373955_0054160 3300035172 Bacteria 2193
954 Ga0373955_0084056 3300035172 Bacteria 1804
955 Ga0373955_0163689 3300035172 Bacteria 1314
956 Ga0373955_0406524 3300035172 Bacteria 828
957 Ga0373942_0119782 3300035207 Bacteria 821
958 Ga0373961_0003589 3300035241 Bacteria 3820
959 Ga0373961_0037868 3300035241 Bacteria 1380
960 Ga0373924_0070118 3300035410 Bacteria 1478
961 Ga0373924_0122233 3300035410 Bacteria 1130
962 Ga0373931_0088264 3300035691 Bacteria 1723
963 Ga0373935_0063167 3300035692 Bacteria 2373
964 Ga0373935_0227245 3300035692 Bacteria 1298
965 Ga0373935_0373873 3300035692 Bacteria 1019
966 Ga0373927_0244470 3300035695 Unclassified 1179
967 Ga0373927_0331813 3300035695 Bacteria 1002
968 Ga0373933_0000428 3300035724 Bacteria 26447
969 Ga0373947_0010931 3300035725 Bacteria 5212
970 Ga0373947_0183509 3300035725 Bacteria 1363
971 Ga0373947_0187022 3300035725 Bacteria 1350
972 Ga0373947_0192950 3300035725 Bacteria 1330
973 Ga0373947_0592983 3300035725 Unclassified 755
974 Ga0373937_0000735 3300036401 Bacteria 28345
975 Ga0373937_0020117 3300036401 Bacteria 5981
976 Ga0373937_0032472 3300036401 Bacteria 4735
977 Ga0373937_0032953 3300036401 Bacteria 4701
978 Ga0373937_0048000 3300036401 Unclassified 3907
979 Ga0373937_0223940 3300036401 Bacteria 1770
980 Ga0373937_0285503 3300036401 Bacteria 1559
981 Ga0373937_0325479 3300036401 Bacteria 1454
982 Ga0373937_0439969 3300036401 Bacteria 1238
983 Ga0373937_1416070 3300036401 Unclassified 643
984 Ga0373925_0022994 3300037068 Bacteria 4549
985 Ga0373925_0024902 3300037068 Bacteria 4371
986 Ga0373925_0171271 3300037068 Bacteria 1714
987 Ga0395898_1140120 3300037466 Bacteria 712
988 Ga0395905_0755381 3300037471 Unclassified 875
989 Ga0436364_0124008 3300037853 Bacteria 10700
990 Ga0436364_1437153 3300037853 Bacteria 1210
991 Ga0395901_0731418 3300038443 Unclassified 984
992 Ga0395901_1155840 3300038443 Bacteria 742
993 Ga0436365_0013084 3300039437 Bacteria 1231
994 Ga0436365_0066995 3300039437 Bacteria 1894
995 Ga0436365_0535749 3300039437 Bacteria 559
996 Ga0436365_1390038 3300039437 Bacteria 1619
997 Ga0436362_0272322 3300039453 Unclassified 542
998 Ga0436362_0439696 3300039453 Unclassified 1398
999 Ga0439461_0006092 3300041410 Bacteria 2089
1000 Ga0451839_0610758 3300041496 Bacteria 548
1001 Ga0439431_0062334 3300041997 Bacteria 983
1002 Ga0450923_067617 3300042125 Unclassified 788
1003 Ga0450896_008177 3300042133 Unclassified 1449
1004 Ga0439446_0206060 3300042156 Bacteria 665
1005 Ga0439434_0058549 3300042435 Bacteria 1202
1006 Ga0451577_0055478 3300042876 Bacteria 3535
1007 Ga0451577_0954053 3300042876 Bacteria 771
1008 Ga0453683_0003964 3300044673 Bacteria 10704
1009 Ga0453683_0005264 3300044673 Bacteria 9054
1010 Ga0453683_0669781 3300044673 Unclassified 679
1011 Ga0453684_0032308 3300044712 Bacteria 7330
1012 Ga0453684_0503350 3300044712 Bacteria 1341
1013 Ga0453684_0630053 3300044712 Bacteria 1172
1014 Ga0451576_0014367 3300045051 Bacteria 8817
1015 Ga0451576_0114334 3300045051 Unclassified 2809
1016 Ga0451576_0246638 3300045051 Bacteria 1866
1017 Ga0451576_1808278 3300045051 Bacteria 631
1018 Ga0495592_0003544 3300046454 Bacteria 11209
1019 Ga0495592_0327493 3300046454 Bacteria 988
1020 Ga0495592_0375387 3300046454 Bacteria 906
1021 Ga0495592_0429184 3300046454 Bacteria 832
1022 Ga0495592_0448698 3300046454 Bacteria 809
1023 Ga0495603_0009349 3300046455 Bacteria 5925
1024 Ga0495603_0138888 3300046455 Bacteria 1414
1025 Ga0495603_0216269 3300046455 Bacteria 1106
1026 Ga0495651_0108315 3300046462 Bacteria 2058
1027 Ga0495651_0250184 3300046462 Bacteria 1211
1028 Ga0495651_0322569 3300046462 Unclassified 1029
1029 Ga0495653_0189030 3300046463 Bacteria 1407
1030 Ga0495653_0738766 3300046463 Bacteria 595
1031 Ga0495580_0005913 3300046472 Bacteria 10031
1032 Ga0495580_0010116 3300046472 Bacteria 7368
1033 Ga0495580_0262120 3300046472 Bacteria 1182
1034 Ga0495580_0421143 3300046472 Unclassified 898
1035 Ga0495580_0625456 3300046472 Unclassified 710
1036 Ga0495582_0001064 3300046473 Bacteria 15449
1037 Ga0495582_0199049 3300046473 Unclassified 1144
1038 Ga0495582_0200620 3300046473 Bacteria 1139
1039 Ga0495582_0897481 3300046473 Bacteria 512
1040 Ga0495639_0058266 3300046475 Bacteria 1766
1041 Ga0495662_0019110 3300046476 Bacteria 3316
1042 Ga0495662_0065243 3300046476 Bacteria 1760
1043 Ga0495594_0447520 3300046499 Unclassified 734
1044 Ga0495594_0553363 3300046499 Unclassified 653
1045 Ga0495608_0043618 3300046511 Bacteria 2996
1046 Ga0495608_0064936 3300046511 Bacteria 2391
1047 Ga0495608_0071018 3300046511 Bacteria 2272
1048 Ga0495608_0223595 3300046511 Unclassified 1180
1049 Ga0495608_0298769 3300046511 Bacteria 997
1050 Ga0495608_0468759 3300046511 Bacteria 765
1051 Ga0495618_0064474 3300046514 Unclassified 2328
1052 Ga0495618_0094260 3300046514 Bacteria 1914
1053 Ga0495618_0321524 3300046514 Unclassified 958
1054 Ga0495628_0041259 3300046516 Bacteria 3684
1055 Ga0495628_0049916 3300046516 Bacteria 3311
1056 Ga0495628_0118858 3300046516 Bacteria 2029
1057 Ga0495628_0332290 3300046516 Bacteria 1120
1058 Ga0495628_0339162 3300046516 Bacteria 1107
1059 Ga0495630_0023609 3300046517 Bacteria 4546
1060 Ga0495630_0221085 3300046517 Bacteria 1446
1061 Ga0495652_0021691 3300046529 Bacteria 5708
1062 Ga0495652_0114360 3300046529 Bacteria 2165
1063 Ga0495652_0210109 3300046529 Bacteria 1470
1064 Ga0495652_0256204 3300046529 Bacteria 1294
1065 Ga0495652_0262551 3300046529 Unclassified 1274
1066 Ga0495665_0035209 3300046531 Bacteria 2675
1067 Ga0495665_0362878 3300046531 Unclassified 737
1068 Ga0495640_0101161 3300046533 Bacteria 1892
1069 Ga0495640_0185896 3300046533 Bacteria 1322
1070 Ga0495586_0038229 3300046535 Bacteria 2576
1071 Ga0495586_0076562 3300046535 Bacteria 1833
1072 Ga0495586_0424435 3300046535 Bacteria 766
1073 Ga0495586_0452361 3300046535 Bacteria 740
1074 Ga0495587_0010174 3300046536 Bacteria 5999
1075 Ga0495587_0014404 3300046536 Unclassified 4961
1076 Ga0495587_0212217 3300046536 Unclassified 1093
1077 Ga0495587_0323548 3300046536 Unclassified 861
1078 Ga0495645_0006585 3300046543 Bacteria 8068
1079 Ga0495622_0293695 3300046557 Unclassified 709
1080 Ga0495633_0444916 3300046558 Unclassified 585
1081 Ga0495667_0006357 3300046559 Bacteria 8014
1082 Ga0495667_0082503 3300046559 Bacteria 2089
1083 Ga0495667_0117690 3300046559 Unclassified 1716
1084 Ga0495667_0133095 3300046559 Bacteria 1603
1085 Ga0495667_0436186 3300046559 Unclassified 824
1086 Ga0495634_0024089 3300046642 Bacteria 4275
1087 Ga0495634_0165183 3300046642 Bacteria 1393
1088 Ga0495635_0026015 3300046663 Bacteria 4075
1089 Ga0495635_0043114 3300046663 Bacteria 3114
1090 Ga0495635_0133839 3300046663 Bacteria 1690
1091 Ga0495635_0167866 3300046663 Bacteria 1493
1092 Ga0495635_0176846 3300046663 Bacteria 1451
1093 Ga0495635_1015810 3300046663 Unclassified 527
1094 Ga0495659_0047981 3300046664 Bacteria 1546
1095 Ga0495659_0220044 3300046664 Unclassified 784
1096 Ga0495659_0311890 3300046664 Unclassified 666
1097 Ga0495588_0047061 3300046674 Bacteria 2214
1098 Ga0495657_0000539 3300046675 Bacteria 34985
1099 Ga0495657_0041324 3300046675 Bacteria 3156
1100 Ga0495657_0143874 3300046675 Bacteria 1485
1101 Ga0495599_0103294 3300046678 Bacteria 1776
1102 Ga0495599_0283763 3300046678 Unclassified 1002
1103 Ga0495599_0391501 3300046678 Bacteria 828
1104 Ga0495599_0444140 3300046678 Unclassified 769
1105 Ga0495623_0014375 3300046679 Bacteria 5123
1106 Ga0495623_0605347 3300046679 Bacteria 569
1107 Ga0495646_0120810 3300046680 Unclassified 1483
1108 Ga0495658_0013189 3300046683 Bacteria 4205
1109 Ga0495658_0131679 3300046683 Bacteria 1523
1110 Ga0495658_0440491 3300046683 Bacteria 832
1111 Ga0495658_0995877 3300046683 Unclassified 535
1112 Ga0495613_0132732 3300046689 Unclassified 1782
1113 Ga0495624_0172098 3300046690 Unclassified 1321
1114 Ga0495624_0214858 3300046690 Bacteria 1166
1115 Ga0495600_0374470 3300046809 Bacteria 889
1116 Ga0495600_0602624 3300046809 Unclassified 667
1117 Ga0495581_0203251 3300047315 Unclassified 1159
1118 Ga0495604_0002913 3300047317 Bacteria 13707
1119 Ga0495604_0200860 3300047317 Unclassified 1383
1120 Ga0495604_0247111 3300047317 Unclassified 1218
1121 Ga0495604_0320980 3300047317 Unclassified 1035
1122 Ga0495636_0425041 3300047318 Bacteria 635
1123 Ga0495674_0114602 3300047319 Bacteria 2282
1124 Ga0495674_0202235 3300047319 Bacteria 1647
1125 Ga0495674_0401023 3300047319 Bacteria 1107
1126 Ga0495674_0956934 3300047319 Bacteria 658
1127 Ga0495676_0378679 3300047321 Bacteria 942
1128 Ga0495676_0391430 3300047321 Unclassified 923
1129 Ga0495680_0047415 3300047322 Bacteria 3380
1130 Ga0495680_0135667 3300047322 Bacteria 1804
1131 Ga0495680_0199788 3300047322 Bacteria 1435
1132 Ga0495680_1066105 3300047322 Unclassified 512
1133 Ga0495675_0244439 3300047444 Bacteria 1079
1134 Ga0495675_0362775 3300047444 Bacteria 850
1135 Ga0495675_0390319 3300047444 Bacteria 813
1136 Ga0495684_0007510 3300047471 Bacteria 8441
1137 Ga0495684_0101795 3300047471 Bacteria 2171
1138 Ga0495684_0158516 3300047471 Bacteria 1689
1139 Ga0495593_0260162 3300047673 Unclassified 869
1140 Ga0495602_0000583 3300048088 Bacteria 34067
1141 Ga0495602_0029966 3300048088 Bacteria 5170
1142 Ga0495602_0054169 3300048088 Bacteria 3544
1143 Ga0495602_0104674 3300048088 Bacteria 2315
1144 Ga0495602_0268785 3300048088 Unclassified 1261
1145 Ga0495602_1176322 3300048088 Bacteria 500
1146 Ga0495614_0182961 3300048089 Bacteria 943
1147 Ga0496100_0407811 3300048903 Bacteria 1036
1148 Ga0496101_0043618 3300048904 Unclassified 3206
1149 Ga0496102_0015454 3300048905 Bacteria 6649
1150 Ga0496102_0679139 3300048905 Unclassified 953
1151 Ga0496104_0027768 3300048907 Bacteria 5238
1152 Ga0496105_0036709 3300048908 Bacteria 4038
1153 Ga0496105_0201208 3300048908 Unclassified 1626
1154 Ga0496106_0072701 3300048909 Bacteria 2630
1155 Ga0496106_0401392 3300048909 Unclassified 1102
1156 Ga0496106_0933196 3300048909 Bacteria 684
1157 Ga0496107_0235702 3300048910 Bacteria 1362
1158 Ga0496108_1166775 3300048911 Bacteria 652
1159 Ga0496109_0334550 3300048912 Bacteria 1430
1160 Ga0496110_0078860 3300048913 Bacteria 2932
1161 Ga0496112_0137698 3300048915 Bacteria 2411
1162 Ga0496112_0221373 3300048915 Bacteria 1849
1163 Ga0496112_0296572 3300048915 Bacteria 1562
1164 Ga0496114_0000025 3300048917 Bacteria 213656
1165 Ga0496114_0002088 3300048917 Bacteria 15192
1166 Ga0496114_0004152 3300048917 Bacteria 11204
1167 Ga0496114_0054027 3300048917 Bacteria 3349
1168 Ga0496114_0083382 3300048917 Bacteria 2704
1169 Ga0496114_0167735 3300048917 Unclassified 1912
1170 Ga0496115_0001334 3300048918 Bacteria 17587
1171 Ga0496115_0117121 3300048918 Bacteria 2191
1172 Ga0501036_1515235 3300049572 Unclassified 542
1173 Ga0501042_1097048 3300049578 Bacteria 580
1174 Ga0501048_0349277 3300049582 Bacteria 1055
1175 Ga0501048_0509429 3300049582 Bacteria 863
1176 Ga0501067_0125433 3300049583 Bacteria 1429
1177 Ga0501073_0392857 3300049589 Bacteria 958
1178 Ga0501075_0471932 3300049591 Bacteria 957
1179 Ga0501075_1328049 3300049591 Bacteria 545
1180 Ga0501079_0623246 3300049741 Bacteria 849
1181 Ga0501081_0188569 3300049743 Bacteria 1493
1182 Ga0501083_0022984 3300049744 Bacteria 4328
1183 Ga0501263_044046 3300049760 Unclassified 663
1184 nmdc:mga05p37_174997_c1 3300050507 Bacteria 2615
1185 nmdc:mga05p37_63741_c1 3300050507 Bacteria 4536
1186 nmdc:mga09592_59488_c1 3300050508 Bacteria 3230
1187 nmdc:mga0qj67_240696_c1 3300050509 Unclassified 1468
1188 nmdc:mga0qj67_412560_c1 3300050509 Bacteria 1089
1189 nmdc:mga0qj67_60488_c1 3300050509 Bacteria 3006
1190 nmdc:mga06r32_114730_c1 3300050510 Bacteria 2652
1191 nmdc:mga06r32_13443_c1 3300050510 Bacteria 7413
1192 nmdc:mga06r32_35475_c1 3300050510 Bacteria 4705
1193 nmdc:mga06r32_859510_c1 3300050510 Bacteria 865
1194 nmdc:mga08y16_1061544_c1 3300050511 Bacteria 787
1195 nmdc:mga08y16_364576_c1 3300050511 Unclassified 1483
1196 nmdc:mga08y16_596887_c1 3300050511 Unclassified 1113
1197 nmdc:mga0n895_1160753_c1 3300050512 Bacteria 747
1198 nmdc:mga0n895_1524598_c1 3300050512 Unclassified 634
1199 nmdc:mga0n895_3252_c1 3300050512 Bacteria 13023
1200 nmdc:mga0n895_5364_c1 3300050512 Bacteria 10693
1201 nmdc:mga0n895_54374_c1 3300050512 Unclassified 3938
1202 nmdc:mga0n895_62191_c1 3300050512 Bacteria 3689
1203 nmdc:mga0n895_76525_c1 3300050512 Bacteria 3328
1204 nmdc:mga0n895_89907_c1 3300050512 Bacteria 3072
1205 nmdc:mga0n895_9462_c1 3300050512 Bacteria 8526
1206 nmdc:mga0rr50_1017270_c1 3300050513 Unclassified 706
1207 nmdc:mga0rr50_1330148_c1 3300050513 Bacteria 609
1208 nmdc:mga0rr50_16768_c1 3300050513 Bacteria 4875
1209 nmdc:mga0rr50_302875_c1 3300050513 Unclassified 1004
1210 nmdc:mga0rr50_37228_c1 3300050513 Bacteria 3510
1211 nmdc:mga0rr50_374558_c1 3300050513 Bacteria 1200
1212 nmdc:mga0rr50_517487_c1 3300050513 Bacteria 1015
1213 nmdc:mga08x19_148765_c1 3300050514 Bacteria 1585
1214 nmdc:mga08x19_158020_c1 3300050514 Bacteria 1538
1215 nmdc:mga08x19_177920_c1 3300050514 Unclassified 1451
1216 nmdc:mga08x19_18699_c1 3300050514 Bacteria 4247
1217 nmdc:mga08x19_225722_c1 3300050514 Bacteria 1288
1218 nmdc:mga08x19_266_c1 3300050514 Bacteria 39583
1219 nmdc:mga08x19_48662_c1 3300050514 Bacteria 2716
1220 nmdc:mga08x19_577979_c1 3300050514 Unclassified 796
1221 nmdc:mga08x19_99110_c1 3300050514 Bacteria 1931
1222 nmdc:mga0a205_123605_c1 3300050515 Bacteria 2488
1223 nmdc:mga0a205_173558_c1 3300050515 Bacteria 2052
1224 nmdc:mga0a205_2373_c2 3300050515 Bacteria 9651
1225 nmdc:mga0a205_3157_c2 3300050515 Bacteria 9919
1226 nmdc:mga0a205_44121_c1 3300050515 Bacteria 4298
1227 nmdc:mga0a205_485086_c1 3300050515 Bacteria 1094
1228 nmdc:mga0a205_6811_c1 3300050515 Bacteria 10339
1229 Ga0495601_0214659 3300053077 Bacteria 1257
1230 Ga0495601_0401035 3300053077 Unclassified 889
1231 Ga0495601_0713217 3300053077 Bacteria 639
1232 Ga0495595_0704759 3300053084 Unclassified 517
1233 Ga0495619_0006716 3300053085 Bacteria 7279
1234 Ga0495619_0082502 3300053085 Bacteria 2167
1235 Ga0495619_0207169 3300053085 Unclassified 1358
1236 Ga0500651_0188992 3300053093 Bacteria 1220
1237 Ga0500599_013484 3300053736 Bacteria 1106
1238 Ga0501084_0226190 3300054114 Bacteria 1579
1239 Ga0501084_0303411 3300054114 Bacteria 1349
1240 Ga0501084_0979560 3300054114 Unclassified 711
1241 Ga0587070_197265 3300059491 Bacteria 533
1242 Ga0587085_032354 3300059506 Unclassified 867
1243 Ga0501082_0401454 3300060353 Bacteria 1196
1244 Ga0501082_0851096 3300060353 Bacteria 798
1245 Ga0070664_100324241
1246 MRS1b_contig_1215992
1247 MBSR1b_contig_3003525
1248 JGI25406J46586_10053464
1249 Ga0065712_10078642
1250 Ga0065712_10259735
1251 Ga0065712_10294369
1252 Ga0065715_10102479
1253 Ga0065715_10308038
1254 Ga0065715_11057488
1255 Ga0065707_10939840
1256 Ga0070658_10030350
1257 Ga0070658_10968460
1258 Ga0070658_11407492
1259 Ga0070676_10005157
1260 Ga0070676_10028633
1261 Ga0070676_10037538
1262 Ga0070676_10431242
1263 Ga0070676_10894634
1264 Ga0070676_10903223
1265 Ga0070683_100006943
1266 Ga0070683_100058428
1267 Ga0070683_100064473
1268 Ga0070683_100102066
1269 Ga0070683_100510381
1270 Ga0070690_100046976
1271 Ga0070690_100059190
1272 Ga0070690_100384687
1273 Ga0070690_100478192
1274 Ga0070690_100629836
1275 Ga0070670_100005553
1276 Ga0070670_100104495
1277 Ga0070670_100153430
1278 Ga0070670_101608049
1279 Ga0070677_10021725
1280 Ga0070677_10225482
1281 Ga0070677_10426352
1282 Ga0068869_100001426
1283 Ga0068869_100075005
1284 Ga0068869_100126141
1285 Ga0070666_10048472
1286 Ga0070666_10216074
1287 Ga0070666_10286167
1288 Ga0070666_10310620
1289 Ga0070680_100001348
1290 Ga0070680_100025639
1291 Ga0070680_100055999
1292 Ga0070680_100149828
1293 Ga0070680_100208809
1294 Ga0070680_100539643
1295 Ga0070680_101150709
1296 Ga0070682_100000710
1297 Ga0070682_100006101
1298 Ga0070682_100905193
1299 Ga0070682_100984518
1300 Ga0068868_100001287
1301 Ga0068868_100078197
1302 Ga0068868_100115264
1303 Ga0068868_100395526
1304 Ga0068868_101059865
1305 Ga0068868_102392196
1306 Ga0070660_100052808
1307 Ga0070660_100221202
1308 Ga0070660_100315210
1309 Ga0070689_100068722
1310 Ga0070691_10004718
1311 Ga0070691_10034143
1312 Ga0070691_10143723
1313 Ga0070691_10529828
1314 Ga0070687_100080915
1315 Ga0070687_100550018
1316 Ga0070687_100939310
1317 Ga0070661_100108630
1318 Ga0070661_100215865
1319 Ga0070661_100337505
1320 Ga0070661_100431177
1321 Ga0070692_10038705
1322 Ga0070692_10125772
1323 Ga0070692_10517676
1324 Ga0070692_10667778
1325 Ga0070668_100049309
1326 Ga0070668_101375207
1327 Ga0070669_100000069
1328 Ga0070669_100013681
1329 Ga0070669_100034824
1330 Ga0070669_100801527
1331 Ga0070669_101396926
1332 Ga0070669_101983596
1333 Ga0070675_100002658
1334 Ga0070675_100039617
1335 Ga0070675_100070496
1336 Ga0070675_100109247
1337 Ga0070675_100440865
1338 Ga0070675_100504932
1339 Ga0070675_100511608
1340 Ga0070671_100043392
1341 Ga0070671_100087682
1342 Ga0070671_100260075
1343 Ga0070671_100289853
1344 Ga0070671_100359193
1345 Ga0070671_100915795
1346 Ga0070671_101005545
1347 Ga0070674_100000197
1348 Ga0070674_101737692
1349 Ga0070674_101813788
1350 Ga0070673_100026057
1351 Ga0070673_100099837
1352 Ga0070673_100569062
1353 Ga0070688_100014947
1354 Ga0070688_100037110
1355 Ga0070688_100231995
1356 Ga0070688_100495210
1357 Ga0070688_100769115
1358 Ga0070659_100108547
1359 Ga0070659_100158622
1360 Ga0070659_100269135
1361 Ga0070667_100001651
1362 Ga0070667_100016243
1363 Ga0070667_100198515
1364 Ga0070667_100229493
1365 Ga0070667_100497764
1366 Ga0070667_100588247
1367 Ga0070667_100677071
1368 Ga0070709_10000089
1369 Ga0070709_10087644
1370 Ga0070709_10257671
1371 Ga0070709_10291976
1372 Ga0070709_10457167
1373 Ga0070709_10491445
1374 Ga0070709_10766364
1375 Ga0070709_11232934
1376 Ga0070714_100076023
1377 Ga0070713_100012283
1378 Ga0070713_100073954
1379 Ga0070713_100385967
1380 Ga0070713_100554477
1381 Ga0070713_102478297
1382 Ga0070710_10036452
1383 Ga0070710_10347963
1384 Ga0070710_10450902
1385 Ga0070711_100015672
1386 Ga0070711_100042436
1387 Ga0070711_100073899
1388 Ga0070711_100343296
1389 Ga0070711_100640782
1390 Ga0070705_100013396
1391 Ga0070705_100022908
1392 Ga0070705_100132449
1393 Ga0070705_100329537
1394 Ga0070700_100294326
1395 Ga0070700_100449172
1396 Ga0070700_100912614
1397 Ga0070694_100005175
1398 Ga0070694_100123713
1399 Ga0070694_100176976
1400 Ga0070708_100000271
1401 Ga0070708_100071322
1402 Ga0070708_100254360
1403 Ga0070708_100395201
1404 Ga0070708_101181894
1405 Ga0070708_101843239
1406 Ga0070663_100408642
1407 Ga0070678_100002411
1408 Ga0070678_100155682
1409 Ga0070678_100515849
1410 Ga0070678_101731602
1411 Ga0070662_100000040
1412 Ga0070662_100091491
1413 Ga0070662_100230871
1414 Ga0070662_100780932
1415 Ga0070662_101677028
1416 Ga0070681_10003058
1417 Ga0070681_10022978
1418 Ga0070681_10031088
1419 Ga0070681_10038222
1420 Ga0070681_10066080
1421 Ga0070681_10122147
1422 Ga0070681_10244399
1423 Ga0070681_11712825
1424 Ga0068867_100000144
1425 Ga0068867_100017896
1426 Ga0068867_100036130
1427 Ga0068867_100136110
1428 Ga0068867_100358857
1429 Ga0068867_101366625
1430 Ga0070685_10017987
1431 Ga0070685_10044335
1432 Ga0070685_10062086
1433 Ga0070685_10076860
1434 Ga0070685_10521899
1435 Ga0070706_100002564
1436 Ga0070706_100029047
1437 Ga0070706_100086235
1438 Ga0070706_100375039
1439 Ga0070706_100641479
1440 Ga0070706_100928591
1441 Ga0070706_101378053
1442 Ga0070707_100001174
1443 Ga0070707_100013883
1444 Ga0070707_100183754
1445 Ga0070707_100403608
1446 Ga0070707_100575139
1447 Ga0070707_100805604
1448 Ga0070707_100951875
1449 Ga0070698_100009906
1450 Ga0070698_100036742
1451 Ga0070698_100071446
1452 Ga0070698_100523681
1453 Ga0070698_100732604
1454 Ga0070698_102017906
1455 Ga0070699_100022233
1456 Ga0070699_100076005
1457 Ga0070699_100088424
1458 Ga0070699_100093471
1459 Ga0070699_100125397
1460 Ga0070699_100145883
1461 Ga0070699_100192159
1462 Ga0070699_100600147
1463 Ga0070699_101029559
1464 Ga0070699_101348733
1465 Ga0070679_100030620
1466 Ga0070679_100129665
1467 Ga0070679_100359197
1468 Ga0070679_100589939
1469 Ga0070679_101116919
1470 Ga0070679_101591079
1471 Ga0070679_101948090
1472 Ga0070684_100003277
1473 Ga0070684_100016512
1474 Ga0070684_100081145
1475 Ga0070684_100089611
1476 Ga0070697_100003329
1477 Ga0070697_100061895
1478 Ga0070697_100094239
1479 Ga0070697_100139406
1480 Ga0070697_100180073
1481 Ga0070697_100229420
1482 Ga0070697_101243354
1483 Ga0070697_102022315
1484 Ga0068853_100046224
1485 Ga0068853_100095936
1486 Ga0068853_100147650
1487 Ga0068853_100272526
1488 Ga0068853_100499956
1489 Ga0068853_100673010
1490 Ga0068853_100924428
1491 Ga0070672_100013819
1492 Ga0070686_100074945
1493 Ga0070686_100172051
1494 Ga0070686_100243182
1495 Ga0070686_100319679
1496 Ga0070695_100006440
1497 Ga0070695_100010968
1498 Ga0070695_100018539
1499 Ga0070695_100054020
1500 Ga0070695_100085012
1501 Ga0070695_100148559
1502 Ga0070695_100383881
1503 Ga0070695_100683789
1504 Ga0070695_101204667
1505 Ga0070695_101754276
1506 Ga0070696_100001925
1507 Ga0070696_100011185
1508 Ga0070696_100965707
1509 Ga0070693_100015057
1510 Ga0070693_100487283
1511 Ga0070693_100578615
1512 Ga0070665_100006080
1513 Ga0070665_100412645
1514 Ga0070665_101634878
1515 Ga0070704_100076560
1516 Ga0068855_100000575
1517 Ga0068855_100073696
1518 Ga0068855_100244523
1519 Ga0068855_100385153
1520 Ga0070664_100009874
1521 Ga0070664_100037495
1522 Ga0070664_100038968
1523 Ga0068857_100002591
1524 Ga0068857_100004522
1525 Ga0068857_100020580
1526 Ga0068857_100415766
1527 Ga0068857_100612490
1528 Ga0068857_100803535
1529 Ga0068857_100893307
1530 Ga0068857_101609355
1531 Ga0068854_100085292
1532 Ga0068854_100842746
1533 Ga0068854_100900225
1534 Ga0068854_101803885
1535 Ga0068856_100009628
1536 Ga0068856_100084303
1537 Ga0068856_100095042
1538 Ga0068856_100287006
1539 Ga0068856_100308600
1540 Ga0070702_100016403
1541 Ga0070702_100333629
1542 Ga0070702_100359608
1543 Ga0070702_100366539
1544 Ga0070702_101261353
1545 Ga0070702_101702249
1546 Ga0068852_100323802
1547 Ga0068852_100324949
1548 Ga0068852_100553104
1549 Ga0068852_100794636
1550 Ga0068852_101169464
1551 Ga0068852_101540160
1552 Ga0068859_100011413
1553 Ga0068859_100215543
1554 Ga0068864_100001306
1555 Ga0068864_100023007
1556 Ga0068864_100089138
1557 Ga0068864_100109795
1558 Ga0068864_100502882
1559 Ga0068866_10000371
1560 Ga0068866_10582181
1561 Ga0068861_100095003
1562 Ga0068861_100674144
1563 Ga0068851_10076896
1564 Ga0068870_10573941
1565 Ga0068870_10940760
1566 Ga0068863_100004629
1567 Ga0068863_100013880
1568 Ga0068863_100019350
1569 Ga0068863_100051436
1570 Ga0068863_100186051
1571 Ga0068863_100347156
1572 Ga0068863_100408505
1573 Ga0068863_100560732
1574 Ga0068863_100578709
1575 Ga0068863_102144009
1576 Ga0068858_100031965
1577 Ga0068858_100061134
1578 Ga0068858_100091148
1579 Ga0068858_100112321
1580 Ga0068858_100187506
1581 Ga0068858_101028612
1582 Ga0068858_101326186
1583 Ga0068860_100008121
1584 Ga0068860_100013172
1585 Ga0068860_100444466
1586 Ga0068860_100670144
1587 Ga0068860_101176329
1588 Ga0068862_100553237
1589 Ga0068862_100823242
1590 Ga0081455_10029406
1591 Ga0081455_10444152
1592 Ga0081539_10002282
1593 Ga0070717_10024268
1594 Ga0070717_11009896
1595 Ga0070717_11306561
1596 Ga0070717_11484261
1597 Ga0075364_10299880
1598 Ga0070715_10003486
1599 Ga0070715_10026306
1600 Ga0070715_10054833
1601 Ga0070715_10386339
1602 Ga0070716_100000124
1603 Ga0070716_100000590
1604 Ga0070716_100039015
1605 Ga0070716_100053512
1606 Ga0070716_100068840
1607 Ga0070716_100165585
1608 Ga0070716_100196619
1609 Ga0070716_100944894
1610 Ga0070716_101087318
1611 Ga0070712_100013754
1612 Ga0070712_100118775
1613 Ga0070712_100215046
1614 Ga0070712_100270359
1615 Ga0070712_100295060
1616 Ga0097621_100057378
1617 Ga0097621_100063876
1618 Ga0097621_100204432
1619 Ga0097621_100212684
1620 Ga0097621_100225744
1621 Ga0097621_100340943
1622 Ga0097621_100853805
1623 Ga0068871_100015782
1624 Ga0068871_100195409
1625 Ga0068871_100268622
1626 Ga0068871_100351454
1627 Ga0068871_101122261
1628 Ga0068871_101170010
1629 Ga0075428_100147718
1630 Ga0075428_100534935
1631 Ga0075430_100370183
1632 Ga0075430_100600385
1633 Ga0075431_100030888
1634 Ga0075431_100044455
1635 Ga0075431_100050802
1636 Ga0075431_100057677
1637 Ga0075431_100804789
1638 Ga0075433_10016402
1639 Ga0075433_10033646
1640 Ga0075433_10046537
1641 Ga0075433_10099514
1642 Ga0075433_10300600
1643 Ga0075434_100003534
1644 Ga0075434_100003714
1645 Ga0075434_100007168
1646 Ga0075434_100010866
1647 Ga0075434_100022633
1648 Ga0075434_100092687
1649 Ga0075434_100107195
1650 Ga0075434_100109201
1651 Ga0075434_100144056
1652 Ga0075429_100091980
1653 Ga0075429_100888008
1654 Ga0075429_101884269
1655 Ga0068865_100046597
1656 Ga0068865_100052091
1657 Ga0068865_100288262
1658 Ga0068865_100522248
1659 Ga0068865_100848352
1660 Ga0075436_100001018
1661 Ga0075436_100002018
1662 Ga0075436_100007884
1663 Ga0075436_100017242
1664 Ga0075436_100133320
1665 Ga0097620_100011413
1666 Ga0097620_100215559
1667 Ga0097620_101902605
1668 Ga0075435_100029060
1669 Ga0075435_100126320
1670 Ga0075435_100216426
1671 Ga0075435_100280375
1672 Ga0075435_100308030
1673 Ga0075435_100381962
1674 Ga0075435_101224299
1675 Ga0075435_101653943
1676 Ga0099794_10003116
1677 Ga0099794_10005039
1678 Ga0099794_10056952
1679 Ga0099794_10058922
1680 Ga0099794_10098315
1681 Ga0099794_10296672
1682 Ga0099794_10325361
1683 Ga0099794_10371387
1684 Ga0099794_10422937
1685 Ga0099794_10474288
1686 Ga0105250_10220886
1687 Ga0105240_10013290
1688 Ga0105240_10257429
1689 Ga0105240_10336552
1690 Ga0105240_10341585
1691 Ga0105240_10390648
1692 Ga0105240_10394295
1693 Ga0111539_10055168
1694 Ga0111539_10458885
1695 Ga0111539_10731600
1696 Ga0105245_10003441
1697 Ga0105245_10241574
1698 Ga0105245_10251419
1699 Ga0105245_10443406
1700 Ga0105245_11608624
1701 Ga0105245_12293828
1702 Ga0105245_12412460
1703 Ga0105245_12544758
1704 Ga0105247_10010761
1705 Ga0105247_10045350
1706 Ga0105247_10257834
1707 Ga0105247_10391048
1708 Ga0114129_10000427
1709 Ga0114129_10041711
1710 Ga0114129_10050826
1711 Ga0105243_10001466
1712 Ga0105243_10109853
1713 Ga0105243_10504743
1714 Ga0105241_10008109
1715 Ga0105241_10017114
1716 Ga0105241_10070494
1717 Ga0105241_10213969
1718 Ga0105242_10000578
1719 Ga0105242_10011051
1720 Ga0105242_10133921
1721 Ga0105242_10254443
1722 Ga0105242_10261752
1723 Ga0105242_10297480
1724 Ga0105242_10366298
1725 Ga0105242_10620670
1726 Ga0105242_10729366
1727 Ga0105242_12658411
1728 Ga0105248_10000048
1729 Ga0105248_10006182
1730 Ga0105248_10006508
1731 Ga0105248_10442851
1732 Ga0105248_12462296
1733 Ga0105237_10033491
1734 Ga0105237_10044860
1735 Ga0105237_10118202
1736 Ga0105237_10830364
1737 Ga0105237_11020278
1738 Ga0105238_10006669
1739 Ga0105238_10011302
1740 Ga0105238_10029409
1741 Ga0105238_10075281
1742 Ga0105238_11932397
1743 Ga0105249_10023393
1744 Ga0105249_10033162
1745 Ga0105249_10266545
1746 Ga0105249_10801748
1747 Ga0105249_10888983
1748 Ga0105249_10971291
1749 Ga0105249_11408571
1750 Ga0105249_11580513
1751 Ga0105249_11827390
1752 Ga0105249_12588882
1753 Ga0105239_10004454
1754 Ga0105239_10008245
1755 Ga0105239_10016772
1756 Ga0105239_10071785
1757 Ga0105239_10129694
1758 Ga0105239_10292234
1759 Ga0105239_10539425
1760 Ga0105239_11471836
1761 Ga0105239_11914550
1762 Ga0105239_12274672
1763 Ga0105246_10029307
1764 Ga0105246_10203467
1765 Ga0105246_10416843
1766 Ga0157373_10347512
1767 Ga0157373_10351758
1768 Ga0157373_10371609
1769 Ga0157371_10450507
1770 Ga0157370_10039076
1771 Ga0157370_11407800
1772 Ga0157369_10007677
1773 Ga0157369_10047462
1774 Ga0157369_10452209
1775 Ga0157374_10402061
1776 Ga0157374_10497810
1777 Ga0157374_10542348
1778 Ga0157374_12716165
1779 Ga0157378_10000458
1780 Ga0157378_10001404
1781 Ga0157378_10038715
1782 Ga0157378_10079105
1783 Ga0157378_10198673
1784 Ga0157378_10336136
1785 Ga0157378_10373466
1786 Ga0157378_10530229
1787 Ga0157378_11231556
1788 Ga0157378_11528119
1789 Ga0163162_10027535
1790 Ga0163162_10050770
1791 Ga0163162_10162437
1792 Ga0163162_10439680
1793 Ga0163162_11450341
1794 Ga0157372_10003096
1795 Ga0157372_10057491
1796 Ga0157372_10908029
1797 Ga0157375_10027604
1798 Ga0157375_10249264
1799 Ga0157375_10390488
1800 Ga0157375_10416108
1801 Ga0157375_11004748
1802 Ga0157375_11283374
1803 Ga0157375_12691213
1804 Ga0163163_10000775
1805 Ga0163163_10042497
1806 Ga0163163_10071384
1807 Ga0163163_10300473
1808 Ga0163163_10465374
1809 Ga0163163_13042161
1810 Ga0157380_10086070
1811 Ga0157380_10181557
1812 Ga0157380_10747493
1813 Ga0157380_11554686
1814 Ga0157377_10069519
1815 Ga0157377_10216030
1816 Ga0157377_10221758
1817 Ga0157379_10003008
1818 Ga0157379_10179064
1819 Ga0157379_10397749
1820 Ga0157379_11521883
1821 Ga0157376_10000005
1822 Ga0157376_10071571
1823 Ga0157376_10087962
1824 Ga0157376_10276855
1825 Ga0157376_10292920
1826 Ga0157376_12324177
1827 Ga0163161_10013122
1828 Ga0163161_10075748
1829 Ga0163161_10651454
1830 Ga0206356_10726241
1831 Ga0206352_10699970
1832 Ga0213873_10058313
1833 Ga0213876_10682854
1834 Ga0213875_10006385
1835 Ga0224712_10145603
1836 Ga0228598_1014245
1837 Ga0228598_1082298
1838 Ga0207653_10005201
1839 Ga0207653_10063795
1840 Ga0207682_10007490
1841 Ga0207692_10028715
1842 Ga0207692_10281947
1843 Ga0207692_10308049
1844 Ga0207692_10429551
1845 Ga0207692_10627596
1846 Ga0207642_10000217
1847 Ga0207642_10462790
1848 Ga0207642_10715006
1849 Ga0207710_10164044
1850 Ga0207710_10322521
1851 Ga0207710_10420669
1852 Ga0207710_10441956
1853 Ga0207710_10756194
1854 Ga0207688_10570950
1855 Ga0207680_10040634
1856 Ga0207680_10071033
1857 Ga0207680_10357626
1858 Ga0207680_10368875
1859 Ga0207685_10067613
1860 Ga0207685_10113744
1861 Ga0207699_10000070
1862 Ga0207699_10005919
1863 Ga0207699_10041220
1864 Ga0207699_10128825
1865 Ga0207699_10310203
1866 Ga0207699_10392121
1867 Ga0207699_10641870
1868 Ga0207699_11087914
1869 Ga0207699_11265316
1870 Ga0207645_10002681
1871 Ga0207645_10017926
1872 Ga0207645_10022217
1873 Ga0207645_10162055
1874 Ga0207705_10227980
1875 Ga0207705_10414864
1876 Ga0207684_10057040
1877 Ga0207684_10068405
1878 Ga0207684_10160591
1879 Ga0207684_10172533
1880 Ga0207684_10358698
1881 Ga0207654_10021530
1882 Ga0207654_10037319
1883 Ga0207654_10091474
1884 Ga0207654_10124443
1885 Ga0207654_10806214
1886 Ga0207707_10006092
1887 Ga0207707_10011691
1888 Ga0207707_10068280
1889 Ga0207707_10073571
1890 Ga0207707_10179008
1891 Ga0207695_10000563
1892 Ga0207695_10179370
1893 Ga0207695_10210342
1894 Ga0207695_10214287
1895 Ga0207695_10355813
1896 Ga0207695_10418026
1897 Ga0207671_10016632
1898 Ga0207671_10056609
1899 Ga0207671_10084334
1900 Ga0207671_10402860
1901 Ga0207671_10825830
1902 Ga0207693_10019653
1903 Ga0207693_10020695
1904 Ga0207693_10049630
1905 Ga0207693_10056472
1906 Ga0207693_10085305
1907 Ga0207693_10302870
1908 Ga0207693_10830601
1909 Ga0207663_10000163
1910 Ga0207663_10002079
1911 Ga0207663_10065213
1912 Ga0207663_10153972
1913 Ga0207663_10345319
1914 Ga0207663_10488644
1915 Ga0207660_10010362
1916 Ga0207660_10020098
1917 Ga0207660_10271952
1918 Ga0207660_10275394
1919 Ga0207662_10062811
1920 Ga0207662_10157114
1921 Ga0207662_10219196
1922 Ga0207657_10037816
1923 Ga0207657_10160003
1924 Ga0207657_10295580
1925 Ga0207649_10073489
1926 Ga0207649_10083847
1927 Ga0207649_10230345
1928 Ga0207649_10740756
1929 Ga0207652_10015913
1930 Ga0207652_10051683
1931 Ga0207652_10133665
1932 Ga0207652_10193638
1933 Ga0207652_10845311
1934 Ga0207652_11055714
1935 Ga0207646_10000020
1936 Ga0207646_10017265
1937 Ga0207646_10019160
1938 Ga0207646_10027097
1939 Ga0207646_10083259
1940 Ga0207646_10181045
1941 Ga0207646_10276284
1942 Ga0207646_10872688
1943 Ga0207646_10877431
1944 Ga0207646_11022727
1945 Ga0207646_11159380
1946 Ga0207681_10000034
1947 Ga0207681_10218465
1948 Ga0207681_10774327
1949 Ga0207694_10013321
1950 Ga0207694_10032800
1951 Ga0207694_10035413
1952 Ga0207694_10296265
1953 Ga0207650_10031899
1954 Ga0207650_10285523
1955 Ga0207650_10396212
1956 Ga0207650_11537498
1957 Ga0207659_10019893
1958 Ga0207659_10120728
1959 Ga0207659_10313362
1960 Ga0207659_10338370
1961 Ga0207659_10340544
1962 Ga0207659_10388755
1963 Ga0207659_10900294
1964 Ga0207687_10009310
1965 Ga0207687_10015895
1966 Ga0207687_10159489
1967 Ga0207700_10004110
1968 Ga0207700_10007176
1969 Ga0207700_10023400
1970 Ga0207700_11751088
1971 Ga0207664_10005108
1972 Ga0207664_10074554
1973 Ga0207664_10629597
1974 Ga0207644_10323941
1975 Ga0207644_10415181
1976 Ga0207644_10554629
1977 Ga0207690_10022088
1978 Ga0207690_10096945
1979 Ga0207706_10000005
1980 Ga0207706_10089812
1981 Ga0207706_10100039
1982 Ga0207706_10555830
1983 Ga0207686_10000129
1984 Ga0207686_10015891
1985 Ga0207686_10048338
1986 Ga0207686_10069020
1987 Ga0207686_10141900
1988 Ga0207686_10303509
1989 Ga0207686_10387988
1990 Ga0207686_10518106
1991 Ga0207686_10570417
1992 Ga0207686_11019235
1993 Ga0207709_10024554
1994 Ga0207709_10433733
1995 Ga0207709_10619399
1996 Ga0207709_10853550
1997 Ga0207670_10047154
1998 Ga0207670_10544985
1999 Ga0207670_11784162
2000 Ga0207669_10000265
2001 Ga0207669_10762600
2002 Ga0207669_10895059
2003 Ga0207704_10010291
2004 Ga0207704_10034138
2005 Ga0207704_10101986
2006 Ga0207704_10413888
2007 Ga0207665_10000774
2008 Ga0207665_10001443
2009 Ga0207665_10021115
2010 Ga0207665_10026660
2011 Ga0207665_10068894
2012 Ga0207665_10073524
2013 Ga0207665_10200049
2014 Ga0207691_10052968
2015 Ga0207691_10097596
2016 Ga0207691_10170697
2017 Ga0207691_10834196
2018 Ga0207711_10008760
2019 Ga0207711_10025232
2020 Ga0207711_10078407
2021 Ga0207711_10531984
2022 Ga0207711_11749166
2023 Ga0207711_12075465
2024 Ga0207689_10004128
2025 Ga0207689_10070463
2026 Ga0207689_10569872
2027 Ga0207689_10595969
2028 Ga0207661_10000775
2029 Ga0207661_10024100
2030 Ga0207661_10032909
2031 Ga0207661_10052253
2032 Ga0207661_10107807
2033 Ga0207661_10370116
2034 Ga0207661_11084850
2035 Ga0207661_11553535
2036 Ga0207679_10002634
2037 Ga0207679_10055132
2038 Ga0207679_10096386
2039 Ga0207679_10412963
2040 Ga0207679_10757948
2041 Ga0207667_10001778
2042 Ga0207667_10006264
2043 Ga0207667_10031871
2044 Ga0207667_10355302
2045 Ga0207651_10016817
2046 Ga0207651_10100878
2047 Ga0207651_10314819
2048 Ga0207651_10339517
2049 Ga0207651_11186565
2050 Ga0207712_10008358
2051 Ga0207712_10437427
2052 Ga0207712_11762547
2053 Ga0207668_10198145
2054 Ga0207640_10166220
2055 Ga0207640_10340379
2056 Ga0207658_10098706
2057 Ga0207658_10147642
2058 Ga0207658_10646336
2059 Ga0207658_11178154
2060 Ga0207677_10022009
2061 Ga0207677_10072466
2062 Ga0207677_11017327
2063 Ga0207677_11777976
2064 Ga0207703_10023203
2065 Ga0207703_10061300
2066 Ga0207703_10071335
2067 Ga0207703_10128768
2068 Ga0207703_10479799
2069 Ga0207703_10494422
2070 Ga0207703_10754669
2071 Ga0207703_11149899
2072 Ga0207639_10075777
2073 Ga0207639_10118028
2074 Ga0207639_10210403
2075 Ga0207639_10323222
2076 Ga0207639_10589023
2077 Ga0207639_10617432
2078 Ga0207639_10926411
2079 Ga0207678_10539142
2080 Ga0207708_10078604
2081 Ga0207708_10083233
2082 Ga0207708_10153065
2083 Ga0207708_10172815
2084 Ga0207708_10296831
2085 Ga0207708_11328099
2086 Ga0207702_10111347
2087 Ga0207702_10249655
2088 Ga0207702_10337824
2089 Ga0207702_10487815
2090 Ga0207702_10595702
2091 Ga0207702_11294824
2092 Ga0207641_10000673
2093 Ga0207641_10072292
2094 Ga0207641_10110027
2095 Ga0207641_10561495
2096 Ga0207641_10566005
2097 Ga0207641_10572548
2098 Ga0207641_10810587
2099 Ga0207641_11527415
2100 Ga0207641_12103622
2101 Ga0207648_10000021
2102 Ga0207648_10044955
2103 Ga0207648_10233660
2104 Ga0207648_10377700
2105 Ga0207648_10857427
2106 Ga0207648_11041158
2107 Ga0207648_12109408
2108 Ga0207676_10008617
2109 Ga0207676_10184017
2110 Ga0207676_10288859
2111 Ga0207676_10332777
2112 Ga0207676_10814793
2113 Ga0207674_10001486
2114 Ga0207674_10002911
2115 Ga0207674_10005071
2116 Ga0207674_10011599
2117 Ga0207674_10434205
2118 Ga0207674_11208357
2119 Ga0207674_11915252
2120 Ga0207675_100003902
2121 Ga0207675_100127101
2122 Ga0207675_100579130
2123 Ga0207683_10007609
2124 Ga0207683_10393740
2125 Ga0207683_11316141
2126 Ga0207698_10180882
2127 Ga0207698_10453997
2128 Ga0207698_10699514
2129 Ga0209588_1006055
2130 Ga0209588_1022012
2131 Ga0209588_1025551
2132 Ga0209588_1028705
2133 Ga0209588_1169127
2134 Ga0209588_1282704
2135 Ga0209974_10053294
2136 Ga0207428_10025646
2137 Ga0207428_10174566
2138 Ga0207428_10544966
2139 Ga0268266_10000416
2140 Ga0268266_10362091
2141 Ga0268265_10685855
2142 Ga0268265_10791829
2143 Ga0268264_10003798
2144 Ga0268264_10023927
2145 Ga0268264_10089263
2146 Ga0268264_10206511
2147 Ga0268264_10386957
2148 Ga0268264_12258030
2149 Ga0265334_10231006
2150 Ga0265338_10002463
2151 Ga0265338_10003852
2152 Ga0265762_1121964
2153 Ga0265760_10014729
2154 Ga0265332_10025074
2155 Ga0265328_10007859
2156 Ga0265325_10057759
2157 Ga0265325_10127924
2158 Ga0265339_10006275
2159 Ga0265331_10203088
2160 Ga0265316_10786295
2161 Ga0307408_100966364
2162 Ga0265313_10006814
2163 Ga0307508_10025945
2164 Ga0265342_10565423
2165 Ga0307405_10237438
2166 Ga0307413_10385075
2167 Ga0307413_10690405
2168 Ga0307406_10088706
2169 Ga0307412_10187589
2170 Ga0307416_103820882
2171 Ga0307411_10474832
2172 Ga0373926_0005187
2173 Ga0373929_0077551
2174 Ga0373934_0008592
2175 Ga0373934_0351900
2176 Ga0373944_0169004
2177 Ga0373923_0299102
2178 Ga0373923_0549474
2179 Ga0373936_0123277
2180 Ga0373936_0363546
2181 Ga0373939_0010509
2182 Ga0373939_0539439
2183 Ga0373941_0000825
2184 Ga0373945_0192724
2185 Ga0373953_0054053
2186 Ga0373954_0030861
2187 Ga0373954_0200590
2188 Ga0373954_0308744
2189 Ga0373956_0001187
2190 Ga0373956_0029447
2191 Ga0373957_0041710
2192 Ga0373957_0049429
2193 Ga0373943_0412876
2194 Ga0373943_0820203
2195 Ga0373946_0051503
2196 Ga0373955_0001637
2197 Ga0373955_0054160
2198 Ga0373955_0084056
2199 Ga0373955_0163689
2200 Ga0373955_0406524
2201 Ga0373942_0119782
2202 Ga0373961_0003589
2203 Ga0373961_0037868
2204 Ga0373924_0070118
2205 Ga0373924_0122233
2206 Ga0373931_0088264
2207 Ga0373935_0063167
2208 Ga0373935_0227245
2209 Ga0373935_0373873
2210 Ga0373927_0244470
2211 Ga0373927_0331813
2212 Ga0373933_0000428
2213 Ga0373947_0010931
2214 Ga0373947_0183509
2215 Ga0373947_0187022
2216 Ga0373947_0192950
2217 Ga0373947_0592983
2218 Ga0373937_0000735
2219 Ga0373937_0020117
2220 Ga0373937_0032472
2221 Ga0373937_0032953
2222 Ga0373937_0048000
2223 Ga0373937_0223940
2224 Ga0373937_0285503
2225 Ga0373937_0325479
2226 Ga0373937_0439969
2227 Ga0373937_1416070
2228 Ga0373925_0022994
2229 Ga0373925_0024902
2230 Ga0373925_0171271
2231 Ga0395898_1140120
2232 Ga0395905_0755381
2233 Ga0436364_0124008
2234 Ga0436364_1437153
2235 Ga0395901_0731418
2236 Ga0395901_1155840
2237 Ga0436365_0013084
2238 Ga0436365_0066995
2239 Ga0436365_0535749
2240 Ga0436365_1390038
2241 Ga0436362_0272322
2242 Ga0436362_0439696
2243 Ga0439461_0006092
2244 Ga0451839_0610758
2245 Ga0439431_0062334
2246 Ga0450923_067617
2247 Ga0450896_008177
2248 Ga0439446_0206060
2249 Ga0439434_0058549
2250 Ga0451577_0055478
2251 Ga0451577_0954053
2252 Ga0453683_0003964
2253 Ga0453683_0005264
2254 Ga0453683_0669781
2255 Ga0453684_0032308
2256 Ga0453684_0503350
2257 Ga0453684_0630053
2258 Ga0451576_0014367
2259 Ga0451576_0114334
2260 Ga0451576_0246638
2261 Ga0451576_1808278
2262 Ga0495592_0003544
2263 Ga0495592_0327493
2264 Ga0495592_0375387
2265 Ga0495592_0429184
2266 Ga0495592_0448698
2267 Ga0495603_0009349
2268 Ga0495603_0138888
2269 Ga0495603_0216269
2270 Ga0495651_0108315
2271 Ga0495651_0250184
2272 Ga0495651_0322569
2273 Ga0495653_0189030
2274 Ga0495653_0738766
2275 Ga0495580_0005913
2276 Ga0495580_0010116
2277 Ga0495580_0262120
2278 Ga0495580_0421143
2279 Ga0495580_0625456
2280 Ga0495582_0001064
2281 Ga0495582_0199049
2282 Ga0495582_0200620
2283 Ga0495582_0897481
2284 Ga0495639_0058266
2285 Ga0495662_0019110
2286 Ga0495662_0065243
2287 Ga0495594_0447520
2288 Ga0495594_0553363
2289 Ga0495608_0043618
2290 Ga0495608_0064936
2291 Ga0495608_0071018
2292 Ga0495608_0223595
2293 Ga0495608_0298769
2294 Ga0495608_0468759
2295 Ga0495618_0064474
2296 Ga0495618_0094260
2297 Ga0495618_0321524
2298 Ga0495628_0041259
2299 Ga0495628_0049916
2300 Ga0495628_0118858
2301 Ga0495628_0332290
2302 Ga0495628_0339162
2303 Ga0495630_0023609
2304 Ga0495630_0221085
2305 Ga0495652_0021691
2306 Ga0495652_0114360
2307 Ga0495652_0210109
2308 Ga0495652_0256204
2309 Ga0495652_0262551
2310 Ga0495665_0035209
2311 Ga0495665_0362878
2312 Ga0495640_0101161
2313 Ga0495640_0185896
2314 Ga0495586_0038229
2315 Ga0495586_0076562
2316 Ga0495586_0424435
2317 Ga0495586_0452361
2318 Ga0495587_0010174
2319 Ga0495587_0014404
2320 Ga0495587_0212217
2321 Ga0495587_0323548
2322 Ga0495645_0006585
2323 Ga0495622_0293695
2324 Ga0495633_0444916
2325 Ga0495667_0006357
2326 Ga0495667_0082503
2327 Ga0495667_0117690
2328 Ga0495667_0133095
2329 Ga0495667_0436186
2330 Ga0495634_0024089
2331 Ga0495634_0165183
2332 Ga0495635_0026015
2333 Ga0495635_0043114
2334 Ga0495635_0133839
2335 Ga0495635_0167866
2336 Ga0495635_0176846
2337 Ga0495635_1015810
2338 Ga0495659_0047981
2339 Ga0495659_0220044
2340 Ga0495659_0311890
2341 Ga0495588_0047061
2342 Ga0495657_0000539
2343 Ga0495657_0041324
2344 Ga0495657_0143874
2345 Ga0495599_0103294
2346 Ga0495599_0283763
2347 Ga0495599_0391501
2348 Ga0495599_0444140
2349 Ga0495623_0014375
2350 Ga0495623_0605347
2351 Ga0495646_0120810
2352 Ga0495658_0013189
2353 Ga0495658_0131679
2354 Ga0495658_0440491
2355 Ga0495658_0995877
2356 Ga0495613_0132732
2357 Ga0495624_0172098
2358 Ga0495624_0214858
2359 Ga0495600_0374470
2360 Ga0495600_0602624
2361 Ga0495581_0203251
2362 Ga0495604_0002913
2363 Ga0495604_0200860
2364 Ga0495604_0247111
2365 Ga0495604_0320980
2366 Ga0495636_0425041
2367 Ga0495674_0114602
2368 Ga0495674_0202235
2369 Ga0495674_0401023
2370 Ga0495674_0956934
2371 Ga0495676_0378679
2372 Ga0495676_0391430
2373 Ga0495680_0047415
2374 Ga0495680_0135667
2375 Ga0495680_0199788
2376 Ga0495680_1066105
2377 Ga0495675_0244439
2378 Ga0495675_0362775
2379 Ga0495675_0390319
2380 Ga0495684_0007510
2381 Ga0495684_0101795
2382 Ga0495684_0158516
2383 Ga0495593_0260162
2384 Ga0495602_0000583
2385 Ga0495602_0029966
2386 Ga0495602_0054169
2387 Ga0495602_0104674
2388 Ga0495602_0268785
2389 Ga0495602_1176322
2390 Ga0495614_0182961
2391 Ga0496100_0407811
2392 Ga0496101_0043618
2393 Ga0496102_0015454
2394 Ga0496102_0679139
2395 Ga0496104_0027768
2396 Ga0496105_0036709
2397 Ga0496105_0201208
2398 Ga0496106_0072701
2399 Ga0496106_0401392
2400 Ga0496106_0933196
2401 Ga0496107_0235702
2402 Ga0496108_1166775
2403 Ga0496109_0334550
2404 Ga0496110_0078860
2405 Ga0496112_0137698
2406 Ga0496112_0221373
2407 Ga0496112_0296572
2408 Ga0496114_0000025
2409 Ga0496114_0002088
2410 Ga0496114_0004152
2411 Ga0496114_0054027
2412 Ga0496114_0083382
2413 Ga0496114_0167735
2414 Ga0496115_0001334
2415 Ga0496115_0117121
2416 Ga0501036_1515235
2417 Ga0501042_1097048
2418 Ga0501048_0349277
2419 Ga0501048_0509429
2420 Ga0501067_0125433
2421 Ga0501073_0392857
2422 Ga0501075_0471932
2423 Ga0501075_1328049
2424 Ga0501079_0623246
2425 Ga0501081_0188569
2426 Ga0501083_0022984
2427 Ga0501263_044046
2428 nmdc:mga05p37_174997_c1
2429 nmdc:mga05p37_63741_c1
2430 nmdc:mga09592_59488_c1
2431 nmdc:mga0qj67_240696_c1
2432 nmdc:mga0qj67_412560_c1
2433 nmdc:mga0qj67_60488_c1
2434 nmdc:mga06r32_114730_c1
2435 nmdc:mga06r32_13443_c1
2436 nmdc:mga06r32_35475_c1
2437 nmdc:mga06r32_859510_c1
2438 nmdc:mga08y16_1061544_c1
2439 nmdc:mga08y16_364576_c1
2440 nmdc:mga08y16_596887_c1
2441 nmdc:mga0n895_1160753_c1
2442 nmdc:mga0n895_1524598_c1
2443 nmdc:mga0n895_3252_c1
2444 nmdc:mga0n895_5364_c1
2445 nmdc:mga0n895_54374_c1
2446 nmdc:mga0n895_62191_c1
2447 nmdc:mga0n895_76525_c1
2448 nmdc:mga0n895_89907_c1
2449 nmdc:mga0n895_9462_c1
2450 nmdc:mga0rr50_1017270_c1
2451 nmdc:mga0rr50_1330148_c1
2452 nmdc:mga0rr50_16768_c1
2453 nmdc:mga0rr50_302875_c1
2454 nmdc:mga0rr50_37228_c1
2455 nmdc:mga0rr50_374558_c1
2456 nmdc:mga0rr50_517487_c1
2457 nmdc:mga08x19_148765_c1
2458 nmdc:mga08x19_158020_c1
2459 nmdc:mga08x19_177920_c1
2460 nmdc:mga08x19_18699_c1
2461 nmdc:mga08x19_225722_c1
2462 nmdc:mga08x19_266_c1
2463 nmdc:mga08x19_48662_c1
2464 nmdc:mga08x19_577979_c1
2465 nmdc:mga08x19_99110_c1
2466 nmdc:mga0a205_123605_c1
2467 nmdc:mga0a205_173558_c1
2468 nmdc:mga0a205_2373_c2
2469 nmdc:mga0a205_3157_c2
2470 nmdc:mga0a205_44121_c1
2471 nmdc:mga0a205_485086_c1
2472 nmdc:mga0a205_6811_c1
2473 Ga0495601_0214659
2474 Ga0495601_0401035
2475 Ga0495601_0713217
2476 Ga0495595_0704759
2477 Ga0495619_0006716
2478 Ga0495619_0082502
2479 Ga0495619_0207169
2480 Ga0500651_0188992
2481 Ga0500599_013484
2482 Ga0501084_0226190
2483 Ga0501084_0303411
2484 Ga0501084_0979560
2485 Ga0587070_197265
2486 Ga0587085_032354
2487 Ga0501082_0401454
2488 Ga0501082_0851096

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

61

140

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

60

105

0.96

PF01638

HxlR

HxlR-like helix-turn-helix

56

147

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9289 21 117
2mlg-assembly1.cif.gz_A stf76 from the sulfolobus islandicus plasmid-virus pssvx 0.9091 33 95
6wxq-assembly1.cif.gz_A crystal structure of crispr-associated transcription factor csa3 complexed with ca4 0.9074 32 104
5hli-assembly1.cif.gz_A structure of disulfide formed abfr 0.8986 37 112
5hlh-assembly3.cif.gz_F crystal structure of the overoxidized abfr bound to dna 0.8969 36 113
ID Description Score Start End Superfamily
af_Q57874_1_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 30 113 1.10.10.10
1ub9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9289 21 117 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9173 30 97 1.10.10.10
af_Q54FU1_288_364_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9129 33 95 1.10.10.10
2mlgA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9091 33 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I4YCS1-F1-model_v4 Helix-turn-helix domain-containing protein 1 26 112
AF-A0A523UZA1-F1-model_v4 Transcriptional regulator 0.9966 27 115
AF-A0A1H4BP91-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9964 27 114 GO:0003677
GO:0005737
AF-A0A2E9ZMA3-F1-model_v4 Transcriptional regulator 0.9963 30 120
AF-A0A7V3ZWQ7-F1-model_v4 ArsR family transcriptional regulator 0.9962 27 118 GO:0003700

Map