F492117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1244 | 355 | 2488 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100324241|Ga0070664_1003242412 |
| Length | 149 |
| Sequence | MARRQAPQPDPDEIAPEAMPETSASALAKPTRRGGRSLQSLPGGRDDESPLALDRLIHERLRLGIVSALAVNDALTFVELKRLLKTTDGNLSVHARKLEEAGYVSCTKEFEGRTPRTEYRLTRAGRLALERYLEHMEALIKATREGTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 260 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 263 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 264 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 265 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 351 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 2.01 |
| Rhizosphere | 96.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070664_100324241 | 3300005564 | Bacteria | 1396 |
| 2 | MRS1b_contig_1215992 | 2162886011 | Unclassified | 1227 |
| 3 | MBSR1b_contig_3003525 | 2162886012 | Unclassified | 1081 |
| 4 | JGI25406J46586_10053464 | 3300003203 | Bacteria | 1340 |
| 5 | Ga0065712_10078642 | 3300005290 | Bacteria | 3311 |
| 6 | Ga0065712_10259735 | 3300005290 | Bacteria | 940 |
| 7 | Ga0065712_10294369 | 3300005290 | Unclassified | 855 |
| 8 | Ga0065715_10102479 | 3300005293 | Bacteria | 3111 |
| 9 | Ga0065715_10308038 | 3300005293 | Unclassified | 1026 |
| 10 | Ga0065715_11057488 | 3300005293 | Bacteria | 519 |
| 11 | Ga0065707_10939840 | 3300005295 | Unclassified | 555 |
| 12 | Ga0070658_10030350 | 3300005327 | Bacteria | 4344 |
| 13 | Ga0070658_10968460 | 3300005327 | Bacteria | 740 |
| 14 | Ga0070658_11407492 | 3300005327 | Bacteria | 605 |
| 15 | Ga0070676_10005157 | 3300005328 | Bacteria | 6937 |
| 16 | Ga0070676_10028633 | 3300005328 | Bacteria | 3165 |
| 17 | Ga0070676_10037538 | 3300005328 | Bacteria | 2794 |
| 18 | Ga0070676_10431242 | 3300005328 | Bacteria | 923 |
| 19 | Ga0070676_10894634 | 3300005328 | Bacteria | 661 |
| 20 | Ga0070676_10903223 | 3300005328 | Bacteria | 658 |
| 21 | Ga0070683_100006943 | 3300005329 | Bacteria | 9518 |
| 22 | Ga0070683_100058428 | 3300005329 | Bacteria | 3583 |
| 23 | Ga0070683_100064473 | 3300005329 | Bacteria | 3411 |
| 24 | Ga0070683_100102066 | 3300005329 | Bacteria | 2701 |
| 25 | Ga0070683_100510381 | 3300005329 | Bacteria | 1149 |
| 26 | Ga0070690_100046976 | 3300005330 | Bacteria | 2746 |
| 27 | Ga0070690_100059190 | 3300005330 | Bacteria | 2462 |
| 28 | Ga0070690_100384687 | 3300005330 | Unclassified | 1027 |
| 29 | Ga0070690_100478192 | 3300005330 | Bacteria | 928 |
| 30 | Ga0070690_100629836 | 3300005330 | Bacteria | 817 |
| 31 | Ga0070670_100005553 | 3300005331 | Bacteria | 10639 |
| 32 | Ga0070670_100104495 | 3300005331 | Bacteria | 2440 |
| 33 | Ga0070670_100153430 | 3300005331 | Bacteria | 1994 |
| 34 | Ga0070670_101608049 | 3300005331 | Unclassified | 597 |
| 35 | Ga0070677_10021725 | 3300005333 | Unclassified | 2358 |
| 36 | Ga0070677_10225482 | 3300005333 | Bacteria | 918 |
| 37 | Ga0070677_10426352 | 3300005333 | Bacteria | 704 |
| 38 | Ga0068869_100001426 | 3300005334 | Bacteria | 14158 |
| 39 | Ga0068869_100075005 | 3300005334 | Bacteria | 2512 |
| 40 | Ga0068869_100126141 | 3300005334 | Bacteria | 1963 |
| 41 | Ga0070666_10048472 | 3300005335 | Bacteria | 2855 |
| 42 | Ga0070666_10216074 | 3300005335 | Bacteria | 1351 |
| 43 | Ga0070666_10286167 | 3300005335 | Unclassified | 1172 |
| 44 | Ga0070666_10310620 | 3300005335 | Bacteria | 1124 |
| 45 | Ga0070680_100001348 | 3300005336 | Bacteria | 17759 |
| 46 | Ga0070680_100025639 | 3300005336 | Bacteria | 4713 |
| 47 | Ga0070680_100055999 | 3300005336 | Bacteria | 3223 |
| 48 | Ga0070680_100149828 | 3300005336 | Bacteria | 1958 |
| 49 | Ga0070680_100208809 | 3300005336 | Bacteria | 1647 |
| 50 | Ga0070680_100539643 | 3300005336 | Bacteria | 999 |
| 51 | Ga0070680_101150709 | 3300005336 | Unclassified | 671 |
| 52 | Ga0070682_100000710 | 3300005337 | Bacteria | 19958 |
| 53 | Ga0070682_100006101 | 3300005337 | Bacteria | 6745 |
| 54 | Ga0070682_100905193 | 3300005337 | Bacteria | 725 |
| 55 | Ga0070682_100984518 | 3300005337 | Bacteria | 699 |
| 56 | Ga0068868_100001287 | 3300005338 | Bacteria | 17275 |
| 57 | Ga0068868_100078197 | 3300005338 | Bacteria | 2648 |
| 58 | Ga0068868_100115264 | 3300005338 | Bacteria | 2187 |
| 59 | Ga0068868_100395526 | 3300005338 | Bacteria | 1192 |
| 60 | Ga0068868_101059865 | 3300005338 | Bacteria | 744 |
| 61 | Ga0068868_102392196 | 3300005338 | Unclassified | 504 |
| 62 | Ga0070660_100052808 | 3300005339 | Bacteria | 3134 |
| 63 | Ga0070660_100221202 | 3300005339 | Bacteria | 1539 |
| 64 | Ga0070660_100315210 | 3300005339 | Unclassified | 1284 |
| 65 | Ga0070689_100068722 | 3300005340 | Bacteria | 2763 |
| 66 | Ga0070691_10004718 | 3300005341 | Bacteria | 6202 |
| 67 | Ga0070691_10034143 | 3300005341 | Unclassified | 2394 |
| 68 | Ga0070691_10143723 | 3300005341 | Bacteria | 1218 |
| 69 | Ga0070691_10529828 | 3300005341 | Bacteria | 685 |
| 70 | Ga0070687_100080915 | 3300005343 | Bacteria | 1772 |
| 71 | Ga0070687_100550018 | 3300005343 | Unclassified | 785 |
| 72 | Ga0070687_100939310 | 3300005343 | Unclassified | 623 |
| 73 | Ga0070661_100108630 | 3300005344 | Bacteria | 2070 |
| 74 | Ga0070661_100215865 | 3300005344 | Unclassified | 1470 |
| 75 | Ga0070661_100337505 | 3300005344 | Bacteria | 1180 |
| 76 | Ga0070661_100431177 | 3300005344 | Bacteria | 1046 |
| 77 | Ga0070692_10038705 | 3300005345 | Bacteria | 2432 |
| 78 | Ga0070692_10125772 | 3300005345 | Bacteria | 1435 |
| 79 | Ga0070692_10517676 | 3300005345 | Bacteria | 776 |
| 80 | Ga0070692_10667778 | 3300005345 | Unclassified | 696 |
| 81 | Ga0070668_100049309 | 3300005347 | Unclassified | 3240 |
| 82 | Ga0070668_101375207 | 3300005347 | Unclassified | 643 |
| 83 | Ga0070669_100000069 | 3300005353 | Bacteria | 100095 |
| 84 | Ga0070669_100013681 | 3300005353 | Bacteria | 5769 |
| 85 | Ga0070669_100034824 | 3300005353 | Bacteria | 3646 |
| 86 | Ga0070669_100801527 | 3300005353 | Unclassified | 800 |
| 87 | Ga0070669_101396926 | 3300005353 | Bacteria | 607 |
| 88 | Ga0070669_101983596 | 3300005353 | Unclassified | 509 |
| 89 | Ga0070675_100002658 | 3300005354 | Bacteria | 13434 |
| 90 | Ga0070675_100039617 | 3300005354 | Bacteria | 3845 |
| 91 | Ga0070675_100070496 | 3300005354 | Bacteria | 2897 |
| 92 | Ga0070675_100109247 | 3300005354 | Bacteria | 2337 |
| 93 | Ga0070675_100440865 | 3300005354 | Unclassified | 1167 |
| 94 | Ga0070675_100504932 | 3300005354 | Bacteria | 1090 |
| 95 | Ga0070675_100511608 | 3300005354 | Bacteria | 1083 |
| 96 | Ga0070671_100043392 | 3300005355 | Bacteria | 3736 |
| 97 | Ga0070671_100087682 | 3300005355 | Unclassified | 2604 |
| 98 | Ga0070671_100260075 | 3300005355 | Bacteria | 1475 |
| 99 | Ga0070671_100289853 | 3300005355 | Bacteria | 1393 |
| 100 | Ga0070671_100359193 | 3300005355 | Unclassified | 1244 |
| 101 | Ga0070671_100915795 | 3300005355 | Unclassified | 766 |
| 102 | Ga0070671_101005545 | 3300005355 | Unclassified | 731 |
| 103 | Ga0070674_100000197 | 3300005356 | Bacteria | 28921 |
| 104 | Ga0070674_101737692 | 3300005356 | Bacteria | 565 |
| 105 | Ga0070674_101813788 | 3300005356 | Bacteria | 553 |
| 106 | Ga0070673_100026057 | 3300005364 | Bacteria | 4313 |
| 107 | Ga0070673_100099837 | 3300005364 | Bacteria | 2388 |
| 108 | Ga0070673_100569062 | 3300005364 | Unclassified | 1031 |
| 109 | Ga0070688_100014947 | 3300005365 | Bacteria | 4407 |
| 110 | Ga0070688_100037110 | 3300005365 | Bacteria | 2968 |
| 111 | Ga0070688_100231995 | 3300005365 | Unclassified | 1306 |
| 112 | Ga0070688_100495210 | 3300005365 | Bacteria | 921 |
| 113 | Ga0070688_100769115 | 3300005365 | Unclassified | 751 |
| 114 | Ga0070659_100108547 | 3300005366 | Bacteria | 2239 |
| 115 | Ga0070659_100158622 | 3300005366 | Bacteria | 1849 |
| 116 | Ga0070659_100269135 | 3300005366 | Bacteria | 1415 |
| 117 | Ga0070667_100001651 | 3300005367 | Bacteria | 19943 |
| 118 | Ga0070667_100016243 | 3300005367 | Bacteria | 6159 |
| 119 | Ga0070667_100198515 | 3300005367 | Bacteria | 1780 |
| 120 | Ga0070667_100229493 | 3300005367 | Bacteria | 1655 |
| 121 | Ga0070667_100497764 | 3300005367 | Unclassified | 1117 |
| 122 | Ga0070667_100588247 | 3300005367 | Unclassified | 1025 |
| 123 | Ga0070667_100677071 | 3300005367 | Bacteria | 953 |
| 124 | Ga0070709_10000089 | 3300005434 | Bacteria | 65260 |
| 125 | Ga0070709_10087644 | 3300005434 | Bacteria | 2046 |
| 126 | Ga0070709_10257671 | 3300005434 | Bacteria | 1259 |
| 127 | Ga0070709_10291976 | 3300005434 | Unclassified | 1188 |
| 128 | Ga0070709_10457167 | 3300005434 | Unclassified | 963 |
| 129 | Ga0070709_10491445 | 3300005434 | Bacteria | 931 |
| 130 | Ga0070709_10766364 | 3300005434 | Bacteria | 755 |
| 131 | Ga0070709_11232934 | 3300005434 | Unclassified | 602 |
| 132 | Ga0070714_100076023 | 3300005435 | Unclassified | 2915 |
| 133 | Ga0070713_100012283 | 3300005436 | Bacteria | 6275 |
| 134 | Ga0070713_100073954 | 3300005436 | Bacteria | 2886 |
| 135 | Ga0070713_100385967 | 3300005436 | Bacteria | 1306 |
| 136 | Ga0070713_100554477 | 3300005436 | Bacteria | 1088 |
| 137 | Ga0070713_102478297 | 3300005436 | Bacteria | 501 |
| 138 | Ga0070710_10036452 | 3300005437 | Bacteria | 2689 |
| 139 | Ga0070710_10347963 | 3300005437 | Bacteria | 980 |
| 140 | Ga0070710_10450902 | 3300005437 | Unclassified | 872 |
| 141 | Ga0070711_100015672 | 3300005439 | Bacteria | 4799 |
| 142 | Ga0070711_100042436 | 3300005439 | Bacteria | 3074 |
| 143 | Ga0070711_100073899 | 3300005439 | Bacteria | 2410 |
| 144 | Ga0070711_100343296 | 3300005439 | Bacteria | 1199 |
| 145 | Ga0070711_100640782 | 3300005439 | Bacteria | 890 |
| 146 | Ga0070705_100013396 | 3300005440 | Unclassified | 4194 |
| 147 | Ga0070705_100022908 | 3300005440 | Bacteria | 3345 |
| 148 | Ga0070705_100132449 | 3300005440 | Bacteria | 1628 |
| 149 | Ga0070705_100329537 | 3300005440 | Bacteria | 1105 |
| 150 | Ga0070700_100294326 | 3300005441 | Bacteria | 1182 |
| 151 | Ga0070700_100449172 | 3300005441 | Unclassified | 980 |
| 152 | Ga0070700_100912614 | 3300005441 | Bacteria | 716 |
| 153 | Ga0070694_100005175 | 3300005444 | Bacteria | 7871 |
| 154 | Ga0070694_100123713 | 3300005444 | Unclassified | 1859 |
| 155 | Ga0070694_100176976 | 3300005444 | Bacteria | 1575 |
| 156 | Ga0070708_100000271 | 3300005445 | Bacteria | 38546 |
| 157 | Ga0070708_100071322 | 3300005445 | Bacteria | 3127 |
| 158 | Ga0070708_100254360 | 3300005445 | Bacteria | 1650 |
| 159 | Ga0070708_100395201 | 3300005445 | Bacteria | 1304 |
| 160 | Ga0070708_101181894 | 3300005445 | Bacteria | 716 |
| 161 | Ga0070708_101843239 | 3300005445 | Unclassified | 561 |
| 162 | Ga0070663_100408642 | 3300005455 | Bacteria | 1111 |
| 163 | Ga0070678_100002411 | 3300005456 | Bacteria | 10240 |
| 164 | Ga0070678_100155682 | 3300005456 | Bacteria | 1846 |
| 165 | Ga0070678_100515849 | 3300005456 | Bacteria | 1057 |
| 166 | Ga0070678_101731602 | 3300005456 | Unclassified | 588 |
| 167 | Ga0070662_100000040 | 3300005457 | Bacteria | 73497 |
| 168 | Ga0070662_100091491 | 3300005457 | Bacteria | 2285 |
| 169 | Ga0070662_100230871 | 3300005457 | Bacteria | 1480 |
| 170 | Ga0070662_100780932 | 3300005457 | Bacteria | 811 |
| 171 | Ga0070662_101677028 | 3300005457 | Bacteria | 549 |
| 172 | Ga0070681_10003058 | 3300005458 | Bacteria | 15511 |
| 173 | Ga0070681_10022978 | 3300005458 | Bacteria | 6267 |
| 174 | Ga0070681_10031088 | 3300005458 | Bacteria | 5358 |
| 175 | Ga0070681_10038222 | 3300005458 | Bacteria | 4812 |
| 176 | Ga0070681_10066080 | 3300005458 | Bacteria | 3585 |
| 177 | Ga0070681_10122147 | 3300005458 | Bacteria | 2538 |
| 178 | Ga0070681_10244399 | 3300005458 | Bacteria | 1708 |
| 179 | Ga0070681_11712825 | 3300005458 | Bacteria | 555 |
| 180 | Ga0068867_100000144 | 3300005459 | Bacteria | 45710 |
| 181 | Ga0068867_100017896 | 3300005459 | Bacteria | 5034 |
| 182 | Ga0068867_100036130 | 3300005459 | Bacteria | 3585 |
| 183 | Ga0068867_100136110 | 3300005459 | Bacteria | 1915 |
| 184 | Ga0068867_100358857 | 3300005459 | Bacteria | 1218 |
| 185 | Ga0068867_101366625 | 3300005459 | Unclassified | 656 |
| 186 | Ga0070685_10017987 | 3300005466 | Bacteria | 3795 |
| 187 | Ga0070685_10044335 | 3300005466 | Bacteria | 2546 |
| 188 | Ga0070685_10062086 | 3300005466 | Bacteria | 2190 |
| 189 | Ga0070685_10076860 | 3300005466 | Bacteria | 1992 |
| 190 | Ga0070685_10521899 | 3300005466 | Bacteria | 843 |
| 191 | Ga0070706_100002564 | 3300005467 | Bacteria | 18277 |
| 192 | Ga0070706_100029047 | 3300005467 | Bacteria | 5093 |
| 193 | Ga0070706_100086235 | 3300005467 | Bacteria | 2909 |
| 194 | Ga0070706_100375039 | 3300005467 | Bacteria | 1325 |
| 195 | Ga0070706_100641479 | 3300005467 | Bacteria | 986 |
| 196 | Ga0070706_100928591 | 3300005467 | Bacteria | 803 |
| 197 | Ga0070706_101378053 | 3300005467 | Bacteria | 646 |
| 198 | Ga0070707_100001174 | 3300005468 | Bacteria | 25766 |
| 199 | Ga0070707_100013883 | 3300005468 | Bacteria | 7544 |
| 200 | Ga0070707_100183754 | 3300005468 | Bacteria | 2038 |
| 201 | Ga0070707_100403608 | 3300005468 | Bacteria | 1327 |
| 202 | Ga0070707_100575139 | 3300005468 | Bacteria | 1089 |
| 203 | Ga0070707_100805604 | 3300005468 | Unclassified | 903 |
| 204 | Ga0070707_100951875 | 3300005468 | Bacteria | 824 |
| 205 | Ga0070698_100009906 | 3300005471 | Bacteria | 10190 |
| 206 | Ga0070698_100036742 | 3300005471 | Bacteria | 5056 |
| 207 | Ga0070698_100071446 | 3300005471 | Bacteria | 3480 |
| 208 | Ga0070698_100523681 | 3300005471 | Bacteria | 1124 |
| 209 | Ga0070698_100732604 | 3300005471 | Bacteria | 931 |
| 210 | Ga0070698_102017906 | 3300005471 | Bacteria | 530 |
| 211 | Ga0070699_100022233 | 3300005518 | Bacteria | 5464 |
| 212 | Ga0070699_100076005 | 3300005518 | Bacteria | 2923 |
| 213 | Ga0070699_100088424 | 3300005518 | Bacteria | 2706 |
| 214 | Ga0070699_100093471 | 3300005518 | Bacteria | 2631 |
| 215 | Ga0070699_100125397 | 3300005518 | Bacteria | 2260 |
| 216 | Ga0070699_100145883 | 3300005518 | Bacteria | 2091 |
| 217 | Ga0070699_100192159 | 3300005518 | Bacteria | 1814 |
| 218 | Ga0070699_100600147 | 3300005518 | Bacteria | 1004 |
| 219 | Ga0070699_101029559 | 3300005518 | Bacteria | 755 |
| 220 | Ga0070699_101348733 | 3300005518 | Bacteria | 654 |
| 221 | Ga0070679_100030620 | 3300005530 | Bacteria | 5313 |
| 222 | Ga0070679_100129665 | 3300005530 | Bacteria | 2503 |
| 223 | Ga0070679_100359197 | 3300005530 | Bacteria | 1404 |
| 224 | Ga0070679_100589939 | 3300005530 | Bacteria | 1055 |
| 225 | Ga0070679_101116919 | 3300005530 | Unclassified | 733 |
| 226 | Ga0070679_101591079 | 3300005530 | Bacteria | 601 |
| 227 | Ga0070679_101948090 | 3300005530 | Unclassified | 536 |
| 228 | Ga0070684_100003277 | 3300005535 | Bacteria | 12122 |
| 229 | Ga0070684_100016512 | 3300005535 | Bacteria | 6034 |
| 230 | Ga0070684_100081145 | 3300005535 | Bacteria | 2869 |
| 231 | Ga0070684_100089611 | 3300005535 | Bacteria | 2734 |
| 232 | Ga0070697_100003329 | 3300005536 | Bacteria | 12345 |
| 233 | Ga0070697_100061895 | 3300005536 | Bacteria | 3053 |
| 234 | Ga0070697_100094239 | 3300005536 | Bacteria | 2480 |
| 235 | Ga0070697_100139406 | 3300005536 | Bacteria | 2039 |
| 236 | Ga0070697_100180073 | 3300005536 | Bacteria | 1791 |
| 237 | Ga0070697_100229420 | 3300005536 | Bacteria | 1583 |
| 238 | Ga0070697_101243354 | 3300005536 | Bacteria | 664 |
| 239 | Ga0070697_102022315 | 3300005536 | Bacteria | 516 |
| 240 | Ga0068853_100046224 | 3300005539 | Bacteria | 3732 |
| 241 | Ga0068853_100095936 | 3300005539 | Bacteria | 2616 |
| 242 | Ga0068853_100147650 | 3300005539 | Bacteria | 2114 |
| 243 | Ga0068853_100272526 | 3300005539 | Unclassified | 1559 |
| 244 | Ga0068853_100499956 | 3300005539 | Bacteria | 1148 |
| 245 | Ga0068853_100673010 | 3300005539 | Bacteria | 986 |
| 246 | Ga0068853_100924428 | 3300005539 | Bacteria | 838 |
| 247 | Ga0070672_100013819 | 3300005543 | Bacteria | 5708 |
| 248 | Ga0070686_100074945 | 3300005544 | Bacteria | 2225 |
| 249 | Ga0070686_100172051 | 3300005544 | Unclassified | 1532 |
| 250 | Ga0070686_100243182 | 3300005544 | Bacteria | 1311 |
| 251 | Ga0070686_100319679 | 3300005544 | Bacteria | 1157 |
| 252 | Ga0070695_100006440 | 3300005545 | Bacteria | 6943 |
| 253 | Ga0070695_100010968 | 3300005545 | Bacteria | 5417 |
| 254 | Ga0070695_100018539 | 3300005545 | Bacteria | 4228 |
| 255 | Ga0070695_100054020 | 3300005545 | Bacteria | 2584 |
| 256 | Ga0070695_100085012 | 3300005545 | Bacteria | 2100 |
| 257 | Ga0070695_100148559 | 3300005545 | Bacteria | 1633 |
| 258 | Ga0070695_100383881 | 3300005545 | Bacteria | 1061 |
| 259 | Ga0070695_100683789 | 3300005545 | Bacteria | 813 |
| 260 | Ga0070695_101204667 | 3300005545 | Unclassified | 623 |
| 261 | Ga0070695_101754276 | 3300005545 | Unclassified | 520 |
| 262 | Ga0070696_100001925 | 3300005546 | Bacteria | 13674 |
| 263 | Ga0070696_100011185 | 3300005546 | Bacteria | 6006 |
| 264 | Ga0070696_100965707 | 3300005546 | Bacteria | 710 |
| 265 | Ga0070693_100015057 | 3300005547 | Bacteria | 3977 |
| 266 | Ga0070693_100487283 | 3300005547 | Bacteria | 872 |
| 267 | Ga0070693_100578615 | 3300005547 | Bacteria | 808 |
| 268 | Ga0070665_100006080 | 3300005548 | Bacteria | 12341 |
| 269 | Ga0070665_100412645 | 3300005548 | Unclassified | 1359 |
| 270 | Ga0070665_101634878 | 3300005548 | Unclassified | 652 |
| 271 | Ga0070704_100076560 | 3300005549 | Bacteria | 2447 |
| 272 | Ga0068855_100000575 | 3300005563 | Bacteria | 45015 |
| 273 | Ga0068855_100073696 | 3300005563 | Bacteria | 3966 |
| 274 | Ga0068855_100244523 | 3300005563 | Bacteria | 2003 |
| 275 | Ga0068855_100385153 | 3300005563 | Unclassified | 1539 |
| 276 | Ga0070664_100009874 | 3300005564 | Bacteria | 7735 |
| 277 | Ga0070664_100037495 | 3300005564 | Bacteria | 4076 |
| 278 | Ga0070664_100038968 | 3300005564 | Bacteria | 4002 |
| 279 | Ga0068857_100002591 | 3300005577 | Bacteria | 14825 |
| 280 | Ga0068857_100004522 | 3300005577 | Bacteria | 11762 |
| 281 | Ga0068857_100020580 | 3300005577 | Bacteria | 5805 |
| 282 | Ga0068857_100415766 | 3300005577 | Bacteria | 1253 |
| 283 | Ga0068857_100612490 | 3300005577 | Bacteria | 1030 |
| 284 | Ga0068857_100803535 | 3300005577 | Unclassified | 898 |
| 285 | Ga0068857_100893307 | 3300005577 | Bacteria | 852 |
| 286 | Ga0068857_101609355 | 3300005577 | Unclassified | 634 |
| 287 | Ga0068854_100085292 | 3300005578 | Bacteria | 2339 |
| 288 | Ga0068854_100842746 | 3300005578 | Bacteria | 802 |
| 289 | Ga0068854_100900225 | 3300005578 | Bacteria | 778 |
| 290 | Ga0068854_101803885 | 3300005578 | Bacteria | 561 |
| 291 | Ga0068856_100009628 | 3300005614 | Bacteria | 9381 |
| 292 | Ga0068856_100084303 | 3300005614 | Bacteria | 3157 |
| 293 | Ga0068856_100095042 | 3300005614 | Bacteria | 2968 |
| 294 | Ga0068856_100287006 | 3300005614 | Bacteria | 1663 |
| 295 | Ga0068856_100308600 | 3300005614 | Unclassified | 1600 |
| 296 | Ga0070702_100016403 | 3300005615 | Unclassified | 3799 |
| 297 | Ga0070702_100333629 | 3300005615 | Bacteria | 1061 |
| 298 | Ga0070702_100359608 | 3300005615 | Bacteria | 1028 |
| 299 | Ga0070702_100366539 | 3300005615 | Bacteria | 1020 |
| 300 | Ga0070702_101261353 | 3300005615 | Unclassified | 598 |
| 301 | Ga0070702_101702249 | 3300005615 | Bacteria | 524 |
| 302 | Ga0068852_100323802 | 3300005616 | Bacteria | 1498 |
| 303 | Ga0068852_100324949 | 3300005616 | Bacteria | 1495 |
| 304 | Ga0068852_100553104 | 3300005616 | Unclassified | 1151 |
| 305 | Ga0068852_100794636 | 3300005616 | Bacteria | 960 |
| 306 | Ga0068852_101169464 | 3300005616 | Bacteria | 790 |
| 307 | Ga0068852_101540160 | 3300005616 | Bacteria | 687 |
| 308 | Ga0068859_100011413 | 3300005617 | Bacteria | 8931 |
| 309 | Ga0068859_100215543 | 3300005617 | Bacteria | 2007 |
| 310 | Ga0068864_100001306 | 3300005618 | Bacteria | 20734 |
| 311 | Ga0068864_100023007 | 3300005618 | Bacteria | 5230 |
| 312 | Ga0068864_100089138 | 3300005618 | Bacteria | 2718 |
| 313 | Ga0068864_100109795 | 3300005618 | Bacteria | 2456 |
| 314 | Ga0068864_100502882 | 3300005618 | Bacteria | 1166 |
| 315 | Ga0068866_10000371 | 3300005718 | Bacteria | 21133 |
| 316 | Ga0068866_10582181 | 3300005718 | Unclassified | 753 |
| 317 | Ga0068861_100095003 | 3300005719 | Bacteria | 2360 |
| 318 | Ga0068861_100674144 | 3300005719 | Bacteria | 958 |
| 319 | Ga0068851_10076896 | 3300005834 | Bacteria | 1736 |
| 320 | Ga0068870_10573941 | 3300005840 | Unclassified | 763 |
| 321 | Ga0068870_10940760 | 3300005840 | Bacteria | 613 |
| 322 | Ga0068863_100004629 | 3300005841 | Bacteria | 13555 |
| 323 | Ga0068863_100013880 | 3300005841 | Bacteria | 7767 |
| 324 | Ga0068863_100019350 | 3300005841 | Bacteria | 6512 |
| 325 | Ga0068863_100051436 | 3300005841 | Bacteria | 3905 |
| 326 | Ga0068863_100186051 | 3300005841 | Unclassified | 1995 |
| 327 | Ga0068863_100347156 | 3300005841 | Bacteria | 1444 |
| 328 | Ga0068863_100408505 | 3300005841 | Bacteria | 1329 |
| 329 | Ga0068863_100560732 | 3300005841 | Bacteria | 1128 |
| 330 | Ga0068863_100578709 | 3300005841 | Bacteria | 1110 |
| 331 | Ga0068863_102144009 | 3300005841 | Unclassified | 569 |
| 332 | Ga0068858_100031965 | 3300005842 | Bacteria | 4889 |
| 333 | Ga0068858_100061134 | 3300005842 | Unclassified | 3482 |
| 334 | Ga0068858_100091148 | 3300005842 | Bacteria | 2837 |
| 335 | Ga0068858_100112321 | 3300005842 | Bacteria | 2545 |
| 336 | Ga0068858_100187506 | 3300005842 | Bacteria | 1954 |
| 337 | Ga0068858_101028612 | 3300005842 | Unclassified | 808 |
| 338 | Ga0068858_101326186 | 3300005842 | Bacteria | 708 |
| 339 | Ga0068860_100008121 | 3300005843 | Bacteria | 10454 |
| 340 | Ga0068860_100013172 | 3300005843 | Bacteria | 8116 |
| 341 | Ga0068860_100444466 | 3300005843 | Unclassified | 1288 |
| 342 | Ga0068860_100670144 | 3300005843 | Bacteria | 1046 |
| 343 | Ga0068860_101176329 | 3300005843 | Bacteria | 787 |
| 344 | Ga0068862_100553237 | 3300005844 | Unclassified | 1099 |
| 345 | Ga0068862_100823242 | 3300005844 | Bacteria | 908 |
| 346 | Ga0081455_10029406 | 3300005937 | Bacteria | 5010 |
| 347 | Ga0081455_10444152 | 3300005937 | Bacteria | 888 |
| 348 | Ga0081539_10002282 | 3300005985 | Bacteria | 27791 |
| 349 | Ga0070717_10024268 | 3300006028 | Bacteria | 4813 |
| 350 | Ga0070717_11009896 | 3300006028 | Unclassified | 758 |
| 351 | Ga0070717_11306561 | 3300006028 | Unclassified | 659 |
| 352 | Ga0070717_11484261 | 3300006028 | Unclassified | 615 |
| 353 | Ga0075364_10299880 | 3300006051 | Bacteria | 1094 |
| 354 | Ga0070715_10003486 | 3300006163 | Bacteria | 5014 |
| 355 | Ga0070715_10026306 | 3300006163 | Unclassified | 2314 |
| 356 | Ga0070715_10054833 | 3300006163 | Bacteria | 1728 |
| 357 | Ga0070715_10386339 | 3300006163 | Bacteria | 774 |
| 358 | Ga0070716_100000124 | 3300006173 | Bacteria | 30516 |
| 359 | Ga0070716_100000590 | 3300006173 | Bacteria | 15265 |
| 360 | Ga0070716_100039015 | 3300006173 | Bacteria | 2633 |
| 361 | Ga0070716_100053512 | 3300006173 | Bacteria | 2302 |
| 362 | Ga0070716_100068840 | 3300006173 | Unclassified | 2072 |
| 363 | Ga0070716_100165585 | 3300006173 | Unclassified | 1437 |
| 364 | Ga0070716_100196619 | 3300006173 | Unclassified | 1337 |
| 365 | Ga0070716_100944894 | 3300006173 | Bacteria | 678 |
| 366 | Ga0070716_101087318 | 3300006173 | Bacteria | 637 |
| 367 | Ga0070712_100013754 | 3300006175 | Bacteria | 5177 |
| 368 | Ga0070712_100118775 | 3300006175 | Bacteria | 1986 |
| 369 | Ga0070712_100215046 | 3300006175 | Bacteria | 1518 |
| 370 | Ga0070712_100270359 | 3300006175 | Bacteria | 1365 |
| 371 | Ga0070712_100295060 | 3300006175 | Bacteria | 1310 |
| 372 | Ga0097621_100057378 | 3300006237 | Bacteria | 3184 |
| 373 | Ga0097621_100063876 | 3300006237 | Bacteria | 3026 |
| 374 | Ga0097621_100204432 | 3300006237 | Bacteria | 1716 |
| 375 | Ga0097621_100212684 | 3300006237 | Bacteria | 1682 |
| 376 | Ga0097621_100225744 | 3300006237 | Bacteria | 1633 |
| 377 | Ga0097621_100340943 | 3300006237 | Unclassified | 1331 |
| 378 | Ga0097621_100853805 | 3300006237 | Bacteria | 846 |
| 379 | Ga0068871_100015782 | 3300006358 | Bacteria | 5667 |
| 380 | Ga0068871_100195409 | 3300006358 | Bacteria | 1744 |
| 381 | Ga0068871_100268622 | 3300006358 | Unclassified | 1489 |
| 382 | Ga0068871_100351454 | 3300006358 | Unclassified | 1304 |
| 383 | Ga0068871_101122261 | 3300006358 | Bacteria | 736 |
| 384 | Ga0068871_101170010 | 3300006358 | Bacteria | 721 |
| 385 | Ga0075428_100147718 | 3300006844 | Bacteria | 2555 |
| 386 | Ga0075428_100534935 | 3300006844 | Bacteria | 1253 |
| 387 | Ga0075430_100370183 | 3300006846 | Bacteria | 1183 |
| 388 | Ga0075430_100600385 | 3300006846 | Bacteria | 908 |
| 389 | Ga0075431_100030888 | 3300006847 | Bacteria | 5517 |
| 390 | Ga0075431_100044455 | 3300006847 | Bacteria | 4581 |
| 391 | Ga0075431_100050802 | 3300006847 | Unclassified | 4275 |
| 392 | Ga0075431_100057677 | 3300006847 | Bacteria | 4005 |
| 393 | Ga0075431_100804789 | 3300006847 | Bacteria | 913 |
| 394 | Ga0075433_10016402 | 3300006852 | Bacteria | 6104 |
| 395 | Ga0075433_10033646 | 3300006852 | Bacteria | 4396 |
| 396 | Ga0075433_10046537 | 3300006852 | Bacteria | 3774 |
| 397 | Ga0075433_10099514 | 3300006852 | Bacteria | 2574 |
| 398 | Ga0075433_10300600 | 3300006852 | Bacteria | 1421 |
| 399 | Ga0075434_100003534 | 3300006871 | Bacteria | 13947 |
| 400 | Ga0075434_100003714 | 3300006871 | Bacteria | 13633 |
| 401 | Ga0075434_100007168 | 3300006871 | Bacteria | 10305 |
| 402 | Ga0075434_100010866 | 3300006871 | Bacteria | 8558 |
| 403 | Ga0075434_100022633 | 3300006871 | Bacteria | 6119 |
| 404 | Ga0075434_100092687 | 3300006871 | Bacteria | 3024 |
| 405 | Ga0075434_100107195 | 3300006871 | Bacteria | 2804 |
| 406 | Ga0075434_100109201 | 3300006871 | Bacteria | 2777 |
| 407 | Ga0075434_100144056 | 3300006871 | Bacteria | 2403 |
| 408 | Ga0075429_100091980 | 3300006880 | Bacteria | 2646 |
| 409 | Ga0075429_100888008 | 3300006880 | Unclassified | 780 |
| 410 | Ga0075429_101884269 | 3300006880 | Bacteria | 518 |
| 411 | Ga0068865_100046597 | 3300006881 | Bacteria | 2975 |
| 412 | Ga0068865_100052091 | 3300006881 | Unclassified | 2835 |
| 413 | Ga0068865_100288262 | 3300006881 | Bacteria | 1309 |
| 414 | Ga0068865_100522248 | 3300006881 | Bacteria | 993 |
| 415 | Ga0068865_100848352 | 3300006881 | Unclassified | 791 |
| 416 | Ga0075436_100001018 | 3300006914 | Bacteria | 18888 |
| 417 | Ga0075436_100002018 | 3300006914 | Bacteria | 14017 |
| 418 | Ga0075436_100007884 | 3300006914 | Bacteria | 7287 |
| 419 | Ga0075436_100017242 | 3300006914 | Bacteria | 4943 |
| 420 | Ga0075436_100133320 | 3300006914 | Bacteria | 1743 |
| 421 | Ga0097620_100011413 | 3300006931 | Bacteria | 8931 |
| 422 | Ga0097620_100215559 | 3300006931 | Bacteria | 2007 |
| 423 | Ga0097620_101902605 | 3300006931 | Bacteria | 657 |
| 424 | Ga0075435_100029060 | 3300007076 | Bacteria | 4338 |
| 425 | Ga0075435_100126320 | 3300007076 | Unclassified | 2138 |
| 426 | Ga0075435_100216426 | 3300007076 | Bacteria | 1626 |
| 427 | Ga0075435_100280375 | 3300007076 | Bacteria | 1423 |
| 428 | Ga0075435_100308030 | 3300007076 | Bacteria | 1355 |
| 429 | Ga0075435_100381962 | 3300007076 | Bacteria | 1210 |
| 430 | Ga0075435_101224299 | 3300007076 | Bacteria | 657 |
| 431 | Ga0075435_101653943 | 3300007076 | Bacteria | 562 |
| 432 | Ga0099794_10003116 | 3300007265 | Bacteria | 6277 |
| 433 | Ga0099794_10005039 | 3300007265 | Bacteria | 5263 |
| 434 | Ga0099794_10056952 | 3300007265 | Bacteria | 1893 |
| 435 | Ga0099794_10058922 | 3300007265 | Unclassified | 1862 |
| 436 | Ga0099794_10098315 | 3300007265 | Bacteria | 1459 |
| 437 | Ga0099794_10296672 | 3300007265 | Bacteria | 837 |
| 438 | Ga0099794_10325361 | 3300007265 | Bacteria | 798 |
| 439 | Ga0099794_10371387 | 3300007265 | Bacteria | 745 |
| 440 | Ga0099794_10422937 | 3300007265 | Unclassified | 697 |
| 441 | Ga0099794_10474288 | 3300007265 | Bacteria | 657 |
| 442 | Ga0105250_10220886 | 3300009092 | Bacteria | 803 |
| 443 | Ga0105240_10013290 | 3300009093 | Bacteria | 11318 |
| 444 | Ga0105240_10257429 | 3300009093 | Bacteria | 2015 |
| 445 | Ga0105240_10336552 | 3300009093 | Bacteria | 1716 |
| 446 | Ga0105240_10341585 | 3300009093 | Bacteria | 1701 |
| 447 | Ga0105240_10390648 | 3300009093 | Bacteria | 1569 |
| 448 | Ga0105240_10394295 | 3300009093 | Unclassified | 1561 |
| 449 | Ga0111539_10055168 | 3300009094 | Bacteria | 4724 |
| 450 | Ga0111539_10458885 | 3300009094 | Bacteria | 1484 |
| 451 | Ga0111539_10731600 | 3300009094 | Bacteria | 1152 |
| 452 | Ga0105245_10003441 | 3300009098 | Bacteria | 14187 |
| 453 | Ga0105245_10241574 | 3300009098 | Bacteria | 1751 |
| 454 | Ga0105245_10251419 | 3300009098 | Bacteria | 1717 |
| 455 | Ga0105245_10443406 | 3300009098 | Bacteria | 1305 |
| 456 | Ga0105245_11608624 | 3300009098 | Bacteria | 701 |
| 457 | Ga0105245_12293828 | 3300009098 | Unclassified | 593 |
| 458 | Ga0105245_12412460 | 3300009098 | Unclassified | 579 |
| 459 | Ga0105245_12544758 | 3300009098 | Bacteria | 565 |
| 460 | Ga0105247_10010761 | 3300009101 | Bacteria | 5526 |
| 461 | Ga0105247_10045350 | 3300009101 | Bacteria | 2697 |
| 462 | Ga0105247_10257834 | 3300009101 | Bacteria | 1194 |
| 463 | Ga0105247_10391048 | 3300009101 | Bacteria | 988 |
| 464 | Ga0114129_10000427 | 3300009147 | Bacteria | 49990 |
| 465 | Ga0114129_10041711 | 3300009147 | Bacteria | 6463 |
| 466 | Ga0114129_10050826 | 3300009147 | Bacteria | 5821 |
| 467 | Ga0105243_10001466 | 3300009148 | Bacteria | 20725 |
| 468 | Ga0105243_10109853 | 3300009148 | Bacteria | 2304 |
| 469 | Ga0105243_10504743 | 3300009148 | Bacteria | 1147 |
| 470 | Ga0105241_10008109 | 3300009174 | Bacteria | 7731 |
| 471 | Ga0105241_10017114 | 3300009174 | Bacteria | 5324 |
| 472 | Ga0105241_10070494 | 3300009174 | Unclassified | 2712 |
| 473 | Ga0105241_10213969 | 3300009174 | Bacteria | 1616 |
| 474 | Ga0105242_10000578 | 3300009176 | Bacteria | 29041 |
| 475 | Ga0105242_10011051 | 3300009176 | Bacteria | 6937 |
| 476 | Ga0105242_10133921 | 3300009176 | Bacteria | 2143 |
| 477 | Ga0105242_10254443 | 3300009176 | Bacteria | 1584 |
| 478 | Ga0105242_10261752 | 3300009176 | Bacteria | 1563 |
| 479 | Ga0105242_10297480 | 3300009176 | Unclassified | 1472 |
| 480 | Ga0105242_10366298 | 3300009176 | Bacteria | 1335 |
| 481 | Ga0105242_10620670 | 3300009176 | Bacteria | 1047 |
| 482 | Ga0105242_10729366 | 3300009176 | Bacteria | 973 |
| 483 | Ga0105242_12658411 | 3300009176 | Bacteria | 550 |
| 484 | Ga0105248_10000048 | 3300009177 | Bacteria | 154635 |
| 485 | Ga0105248_10006182 | 3300009177 | Bacteria | 13124 |
| 486 | Ga0105248_10006508 | 3300009177 | Bacteria | 12810 |
| 487 | Ga0105248_10442851 | 3300009177 | Bacteria | 1463 |
| 488 | Ga0105248_12462296 | 3300009177 | Bacteria | 593 |
| 489 | Ga0105237_10033491 | 3300009545 | Bacteria | 5205 |
| 490 | Ga0105237_10044860 | 3300009545 | Bacteria | 4451 |
| 491 | Ga0105237_10118202 | 3300009545 | Bacteria | 2645 |
| 492 | Ga0105237_10830364 | 3300009545 | Bacteria | 931 |
| 493 | Ga0105237_11020278 | 3300009545 | Bacteria | 834 |
| 494 | Ga0105238_10006669 | 3300009551 | Bacteria | 11514 |
| 495 | Ga0105238_10011302 | 3300009551 | Bacteria | 8982 |
| 496 | Ga0105238_10029409 | 3300009551 | Bacteria | 5597 |
| 497 | Ga0105238_10075281 | 3300009551 | Bacteria | 3368 |
| 498 | Ga0105238_11932397 | 3300009551 | Unclassified | 623 |
| 499 | Ga0105249_10023393 | 3300009553 | Bacteria | 5544 |
| 500 | Ga0105249_10033162 | 3300009553 | Bacteria | 4675 |
| 501 | Ga0105249_10266545 | 3300009553 | Unclassified | 1704 |
| 502 | Ga0105249_10801748 | 3300009553 | Bacteria | 1006 |
| 503 | Ga0105249_10888983 | 3300009553 | Bacteria | 957 |
| 504 | Ga0105249_10971291 | 3300009553 | Bacteria | 918 |
| 505 | Ga0105249_11408571 | 3300009553 | Bacteria | 769 |
| 506 | Ga0105249_11580513 | 3300009553 | Unclassified | 728 |
| 507 | Ga0105249_11827390 | 3300009553 | Unclassified | 680 |
| 508 | Ga0105249_12588882 | 3300009553 | Bacteria | 580 |
| 509 | Ga0105239_10004454 | 3300010375 | Bacteria | 16743 |
| 510 | Ga0105239_10008245 | 3300010375 | Bacteria | 11882 |
| 511 | Ga0105239_10016772 | 3300010375 | Bacteria | 8096 |
| 512 | Ga0105239_10071785 | 3300010375 | Bacteria | 3804 |
| 513 | Ga0105239_10129694 | 3300010375 | Bacteria | 2803 |
| 514 | Ga0105239_10292234 | 3300010375 | Bacteria | 1835 |
| 515 | Ga0105239_10539425 | 3300010375 | Unclassified | 1328 |
| 516 | Ga0105239_11471836 | 3300010375 | Bacteria | 787 |
| 517 | Ga0105239_11914550 | 3300010375 | Bacteria | 688 |
| 518 | Ga0105239_12274672 | 3300010375 | Bacteria | 631 |
| 519 | Ga0105246_10029307 | 3300011119 | Bacteria | 3623 |
| 520 | Ga0105246_10203467 | 3300011119 | Bacteria | 1541 |
| 521 | Ga0105246_10416843 | 3300011119 | Bacteria | 1119 |
| 522 | Ga0157373_10347512 | 3300013100 | Bacteria | 1058 |
| 523 | Ga0157373_10351758 | 3300013100 | Unclassified | 1051 |
| 524 | Ga0157373_10371609 | 3300013100 | Bacteria | 1022 |
| 525 | Ga0157371_10450507 | 3300013102 | Unclassified | 946 |
| 526 | Ga0157370_10039076 | 3300013104 | Bacteria | 4587 |
| 527 | Ga0157370_11407800 | 3300013104 | Bacteria | 627 |
| 528 | Ga0157369_10007677 | 3300013105 | Bacteria | 12410 |
| 529 | Ga0157369_10047462 | 3300013105 | Bacteria | 4662 |
| 530 | Ga0157369_10452209 | 3300013105 | Bacteria | 1330 |
| 531 | Ga0157374_10402061 | 3300013296 | Bacteria | 1366 |
| 532 | Ga0157374_10497810 | 3300013296 | Bacteria | 1223 |
| 533 | Ga0157374_10542348 | 3300013296 | Bacteria | 1170 |
| 534 | Ga0157374_12716165 | 3300013296 | Unclassified | 523 |
| 535 | Ga0157378_10000458 | 3300013297 | Bacteria | 38993 |
| 536 | Ga0157378_10001404 | 3300013297 | Bacteria | 21665 |
| 537 | Ga0157378_10038715 | 3300013297 | Bacteria | 4227 |
| 538 | Ga0157378_10079105 | 3300013297 | Bacteria | 2968 |
| 539 | Ga0157378_10198673 | 3300013297 | Bacteria | 1896 |
| 540 | Ga0157378_10336136 | 3300013297 | Bacteria | 1471 |
| 541 | Ga0157378_10373466 | 3300013297 | Bacteria | 1398 |
| 542 | Ga0157378_10530229 | 3300013297 | Bacteria | 1180 |
| 543 | Ga0157378_11231556 | 3300013297 | Unclassified | 788 |
| 544 | Ga0157378_11528119 | 3300013297 | Unclassified | 712 |
| 545 | Ga0163162_10027535 | 3300013306 | Bacteria | 5620 |
| 546 | Ga0163162_10050770 | 3300013306 | Unclassified | 4159 |
| 547 | Ga0163162_10162437 | 3300013306 | Bacteria | 2356 |
| 548 | Ga0163162_10439680 | 3300013306 | Bacteria | 1436 |
| 549 | Ga0163162_11450341 | 3300013306 | Bacteria | 781 |
| 550 | Ga0157372_10003096 | 3300013307 | Bacteria | 17910 |
| 551 | Ga0157372_10057491 | 3300013307 | Bacteria | 4348 |
| 552 | Ga0157372_10908029 | 3300013307 | Unclassified | 1022 |
| 553 | Ga0157375_10027604 | 3300013308 | Bacteria | 5308 |
| 554 | Ga0157375_10249264 | 3300013308 | Bacteria | 1936 |
| 555 | Ga0157375_10390488 | 3300013308 | Bacteria | 1558 |
| 556 | Ga0157375_10416108 | 3300013308 | Bacteria | 1510 |
| 557 | Ga0157375_11004748 | 3300013308 | Bacteria | 974 |
| 558 | Ga0157375_11283374 | 3300013308 | Bacteria | 860 |
| 559 | Ga0157375_12691213 | 3300013308 | Unclassified | 595 |
| 560 | Ga0163163_10000775 | 3300014325 | Bacteria | 27113 |
| 561 | Ga0163163_10042497 | 3300014325 | Bacteria | 4452 |
| 562 | Ga0163163_10071384 | 3300014325 | Bacteria | 3460 |
| 563 | Ga0163163_10300473 | 3300014325 | Bacteria | 1658 |
| 564 | Ga0163163_10465374 | 3300014325 | Bacteria | 1325 |
| 565 | Ga0163163_13042161 | 3300014325 | Bacteria | 523 |
| 566 | Ga0157380_10086070 | 3300014326 | Unclassified | 2582 |
| 567 | Ga0157380_10181557 | 3300014326 | Bacteria | 1849 |
| 568 | Ga0157380_10747493 | 3300014326 | Unclassified | 989 |
| 569 | Ga0157380_11554686 | 3300014326 | Unclassified | 716 |
| 570 | Ga0157377_10069519 | 3300014745 | Bacteria | 2032 |
| 571 | Ga0157377_10216030 | 3300014745 | Bacteria | 1225 |
| 572 | Ga0157377_10221758 | 3300014745 | Bacteria | 1211 |
| 573 | Ga0157379_10003008 | 3300014968 | Bacteria | 14232 |
| 574 | Ga0157379_10179064 | 3300014968 | Bacteria | 1915 |
| 575 | Ga0157379_10397749 | 3300014968 | Bacteria | 1266 |
| 576 | Ga0157379_11521883 | 3300014968 | Unclassified | 651 |
| 577 | Ga0157376_10000005 | 3300014969 | Bacteria | 443695 |
| 578 | Ga0157376_10071571 | 3300014969 | Bacteria | 2947 |
| 579 | Ga0157376_10087962 | 3300014969 | Unclassified | 2682 |
| 580 | Ga0157376_10276855 | 3300014969 | Bacteria | 1579 |
| 581 | Ga0157376_10292920 | 3300014969 | Unclassified | 1537 |
| 582 | Ga0157376_12324177 | 3300014969 | Bacteria | 575 |
| 583 | Ga0163161_10013122 | 3300017792 | Bacteria | 5759 |
| 584 | Ga0163161_10075748 | 3300017792 | Bacteria | 2469 |
| 585 | Ga0163161_10651454 | 3300017792 | Unclassified | 873 |
| 586 | Ga0206356_10726241 | 3300020070 | Bacteria | 793 |
| 587 | Ga0206352_10699970 | 3300020078 | Bacteria | 1088 |
| 588 | Ga0213873_10058313 | 3300021358 | Unclassified | 1039 |
| 589 | Ga0213876_10682854 | 3300021384 | Bacteria | 546 |
| 590 | Ga0213875_10006385 | 3300021388 | Bacteria | 6200 |
| 591 | Ga0224712_10145603 | 3300022467 | Bacteria | 1046 |
| 592 | Ga0228598_1014245 | 3300024227 | Unclassified | 1572 |
| 593 | Ga0228598_1082298 | 3300024227 | Bacteria | 646 |
| 594 | Ga0207653_10005201 | 3300025885 | Bacteria | 4067 |
| 595 | Ga0207653_10063795 | 3300025885 | Bacteria | 1248 |
| 596 | Ga0207682_10007490 | 3300025893 | Unclassified | 4346 |
| 597 | Ga0207692_10028715 | 3300025898 | Unclassified | 2635 |
| 598 | Ga0207692_10281947 | 3300025898 | Bacteria | 1006 |
| 599 | Ga0207692_10308049 | 3300025898 | Bacteria | 966 |
| 600 | Ga0207692_10429551 | 3300025898 | Bacteria | 828 |
| 601 | Ga0207692_10627596 | 3300025898 | Unclassified | 693 |
| 602 | Ga0207642_10000217 | 3300025899 | Bacteria | 16924 |
| 603 | Ga0207642_10462790 | 3300025899 | Unclassified | 770 |
| 604 | Ga0207642_10715006 | 3300025899 | Unclassified | 632 |
| 605 | Ga0207710_10164044 | 3300025900 | Bacteria | 1084 |
| 606 | Ga0207710_10322521 | 3300025900 | Bacteria | 783 |
| 607 | Ga0207710_10420669 | 3300025900 | Unclassified | 687 |
| 608 | Ga0207710_10441956 | 3300025900 | Bacteria | 671 |
| 609 | Ga0207710_10756194 | 3300025900 | Unclassified | 510 |
| 610 | Ga0207688_10570950 | 3300025901 | Unclassified | 712 |
| 611 | Ga0207680_10040634 | 3300025903 | Bacteria | 2708 |
| 612 | Ga0207680_10071033 | 3300025903 | Bacteria | 2157 |
| 613 | Ga0207680_10357626 | 3300025903 | Bacteria | 1026 |
| 614 | Ga0207680_10368875 | 3300025903 | Unclassified | 1010 |
| 615 | Ga0207685_10067613 | 3300025905 | Bacteria | 1437 |
| 616 | Ga0207685_10113744 | 3300025905 | Bacteria | 1177 |
| 617 | Ga0207699_10000070 | 3300025906 | Bacteria | 82065 |
| 618 | Ga0207699_10005919 | 3300025906 | Bacteria | 5883 |
| 619 | Ga0207699_10041220 | 3300025906 | Bacteria | 2665 |
| 620 | Ga0207699_10128825 | 3300025906 | Bacteria | 1647 |
| 621 | Ga0207699_10310203 | 3300025906 | Bacteria | 1104 |
| 622 | Ga0207699_10392121 | 3300025906 | Bacteria | 987 |
| 623 | Ga0207699_10641870 | 3300025906 | Bacteria | 775 |
| 624 | Ga0207699_11087914 | 3300025906 | Unclassified | 592 |
| 625 | Ga0207699_11265316 | 3300025906 | Unclassified | 546 |
| 626 | Ga0207645_10002681 | 3300025907 | Bacteria | 13865 |
| 627 | Ga0207645_10017926 | 3300025907 | Bacteria | 4669 |
| 628 | Ga0207645_10022217 | 3300025907 | Bacteria | 4130 |
| 629 | Ga0207645_10162055 | 3300025907 | Bacteria | 1463 |
| 630 | Ga0207705_10227980 | 3300025909 | Bacteria | 1416 |
| 631 | Ga0207705_10414864 | 3300025909 | Bacteria | 1042 |
| 632 | Ga0207684_10057040 | 3300025910 | Bacteria | 3314 |
| 633 | Ga0207684_10068405 | 3300025910 | Bacteria | 3018 |
| 634 | Ga0207684_10160591 | 3300025910 | Bacteria | 1935 |
| 635 | Ga0207684_10172533 | 3300025910 | Bacteria | 1864 |
| 636 | Ga0207684_10358698 | 3300025910 | Bacteria | 1254 |
| 637 | Ga0207654_10021530 | 3300025911 | Unclassified | 3429 |
| 638 | Ga0207654_10037319 | 3300025911 | Bacteria | 2719 |
| 639 | Ga0207654_10091474 | 3300025911 | Bacteria | 1855 |
| 640 | Ga0207654_10124443 | 3300025911 | Bacteria | 1624 |
| 641 | Ga0207654_10806214 | 3300025911 | Unclassified | 678 |
| 642 | Ga0207707_10006092 | 3300025912 | Bacteria | 10551 |
| 643 | Ga0207707_10011691 | 3300025912 | Bacteria | 7640 |
| 644 | Ga0207707_10068280 | 3300025912 | Bacteria | 3097 |
| 645 | Ga0207707_10073571 | 3300025912 | Bacteria | 2980 |
| 646 | Ga0207707_10179008 | 3300025912 | Bacteria | 1851 |
| 647 | Ga0207695_10000563 | 3300025913 | Bacteria | 76084 |
| 648 | Ga0207695_10179370 | 3300025913 | Bacteria | 2039 |
| 649 | Ga0207695_10210342 | 3300025913 | Unclassified | 1856 |
| 650 | Ga0207695_10214287 | 3300025913 | Bacteria | 1835 |
| 651 | Ga0207695_10355813 | 3300025913 | Bacteria | 1351 |
| 652 | Ga0207695_10418026 | 3300025913 | Bacteria | 1225 |
| 653 | Ga0207671_10016632 | 3300025914 | Bacteria | 5711 |
| 654 | Ga0207671_10056609 | 3300025914 | Bacteria | 2905 |
| 655 | Ga0207671_10084334 | 3300025914 | Bacteria | 2386 |
| 656 | Ga0207671_10402860 | 3300025914 | Bacteria | 1088 |
| 657 | Ga0207671_10825830 | 3300025914 | Bacteria | 734 |
| 658 | Ga0207693_10019653 | 3300025915 | Bacteria | 5372 |
| 659 | Ga0207693_10020695 | 3300025915 | Bacteria | 5232 |
| 660 | Ga0207693_10049630 | 3300025915 | Bacteria | 3296 |
| 661 | Ga0207693_10056472 | 3300025915 | Unclassified | 3077 |
| 662 | Ga0207693_10085305 | 3300025915 | Unclassified | 2474 |
| 663 | Ga0207693_10302870 | 3300025915 | Bacteria | 1252 |
| 664 | Ga0207693_10830601 | 3300025915 | Unclassified | 711 |
| 665 | Ga0207663_10000163 | 3300025916 | Bacteria | 30546 |
| 666 | Ga0207663_10002079 | 3300025916 | Bacteria | 9538 |
| 667 | Ga0207663_10065213 | 3300025916 | Bacteria | 2327 |
| 668 | Ga0207663_10153972 | 3300025916 | Bacteria | 1615 |
| 669 | Ga0207663_10345319 | 3300025916 | Bacteria | 1125 |
| 670 | Ga0207663_10488644 | 3300025916 | Bacteria | 955 |
| 671 | Ga0207660_10010362 | 3300025917 | Bacteria | 6048 |
| 672 | Ga0207660_10020098 | 3300025917 | Bacteria | 4478 |
| 673 | Ga0207660_10271952 | 3300025917 | Bacteria | 1342 |
| 674 | Ga0207660_10275394 | 3300025917 | Bacteria | 1334 |
| 675 | Ga0207662_10062811 | 3300025918 | Bacteria | 2232 |
| 676 | Ga0207662_10157114 | 3300025918 | Unclassified | 1450 |
| 677 | Ga0207662_10219196 | 3300025918 | Unclassified | 1238 |
| 678 | Ga0207657_10037816 | 3300025919 | Bacteria | 4305 |
| 679 | Ga0207657_10160003 | 3300025919 | Bacteria | 1829 |
| 680 | Ga0207657_10295580 | 3300025919 | Unclassified | 1284 |
| 681 | Ga0207649_10073489 | 3300025920 | Bacteria | 2191 |
| 682 | Ga0207649_10083847 | 3300025920 | Bacteria | 2070 |
| 683 | Ga0207649_10230345 | 3300025920 | Bacteria | 1324 |
| 684 | Ga0207649_10740756 | 3300025920 | Unclassified | 764 |
| 685 | Ga0207652_10015913 | 3300025921 | Bacteria | 6129 |
| 686 | Ga0207652_10051683 | 3300025921 | Bacteria | 3524 |
| 687 | Ga0207652_10133665 | 3300025921 | Bacteria | 2214 |
| 688 | Ga0207652_10193638 | 3300025921 | Bacteria | 1828 |
| 689 | Ga0207652_10845311 | 3300025921 | Unclassified | 811 |
| 690 | Ga0207652_11055714 | 3300025921 | Bacteria | 712 |
| 691 | Ga0207646_10000020 | 3300025922 | Bacteria | 272909 |
| 692 | Ga0207646_10017265 | 3300025922 | Bacteria | 6759 |
| 693 | Ga0207646_10019160 | 3300025922 | Bacteria | 6363 |
| 694 | Ga0207646_10027097 | 3300025922 | Bacteria | 5226 |
| 695 | Ga0207646_10083259 | 3300025922 | Bacteria | 2861 |
| 696 | Ga0207646_10181045 | 3300025922 | Bacteria | 1904 |
| 697 | Ga0207646_10276284 | 3300025922 | Bacteria | 1518 |
| 698 | Ga0207646_10872688 | 3300025922 | Unclassified | 799 |
| 699 | Ga0207646_10877431 | 3300025922 | Bacteria | 797 |
| 700 | Ga0207646_11022727 | 3300025922 | Unclassified | 729 |
| 701 | Ga0207646_11159380 | 3300025922 | Unclassified | 679 |
| 702 | Ga0207681_10000034 | 3300025923 | Bacteria | 163792 |
| 703 | Ga0207681_10218465 | 3300025923 | Unclassified | 1473 |
| 704 | Ga0207681_10774327 | 3300025923 | Unclassified | 801 |
| 705 | Ga0207694_10013321 | 3300025924 | Bacteria | 6192 |
| 706 | Ga0207694_10032800 | 3300025924 | Bacteria | 3977 |
| 707 | Ga0207694_10035413 | 3300025924 | Bacteria | 3829 |
| 708 | Ga0207694_10296265 | 3300025924 | Bacteria | 1331 |
| 709 | Ga0207650_10031899 | 3300025925 | Bacteria | 3809 |
| 710 | Ga0207650_10285523 | 3300025925 | Bacteria | 1345 |
| 711 | Ga0207650_10396212 | 3300025925 | Bacteria | 1142 |
| 712 | Ga0207650_11537498 | 3300025925 | Bacteria | 565 |
| 713 | Ga0207659_10019893 | 3300025926 | Bacteria | 4428 |
| 714 | Ga0207659_10120728 | 3300025926 | Bacteria | 2008 |
| 715 | Ga0207659_10313362 | 3300025926 | Bacteria | 1292 |
| 716 | Ga0207659_10338370 | 3300025926 | Unclassified | 1246 |
| 717 | Ga0207659_10340544 | 3300025926 | Unclassified | 1242 |
| 718 | Ga0207659_10388755 | 3300025926 | Bacteria | 1165 |
| 719 | Ga0207659_10900294 | 3300025926 | Unclassified | 761 |
| 720 | Ga0207687_10009310 | 3300025927 | Bacteria | 6424 |
| 721 | Ga0207687_10015895 | 3300025927 | Bacteria | 4938 |
| 722 | Ga0207687_10159489 | 3300025927 | Bacteria | 1730 |
| 723 | Ga0207700_10004110 | 3300025928 | Bacteria | 8537 |
| 724 | Ga0207700_10007176 | 3300025928 | Bacteria | 6792 |
| 725 | Ga0207700_10023400 | 3300025928 | Bacteria | 4258 |
| 726 | Ga0207700_11751088 | 3300025928 | Unclassified | 547 |
| 727 | Ga0207664_10005108 | 3300025929 | Bacteria | 8938 |
| 728 | Ga0207664_10074554 | 3300025929 | Bacteria | 2742 |
| 729 | Ga0207664_10629597 | 3300025929 | Bacteria | 964 |
| 730 | Ga0207644_10323941 | 3300025931 | Bacteria | 1246 |
| 731 | Ga0207644_10415181 | 3300025931 | Bacteria | 1102 |
| 732 | Ga0207644_10554629 | 3300025931 | Unclassified | 951 |
| 733 | Ga0207690_10022088 | 3300025932 | Bacteria | 3954 |
| 734 | Ga0207690_10096945 | 3300025932 | Bacteria | 2098 |
| 735 | Ga0207706_10000005 | 3300025933 | Bacteria | 224460 |
| 736 | Ga0207706_10089812 | 3300025933 | Bacteria | 2701 |
| 737 | Ga0207706_10100039 | 3300025933 | Bacteria | 2551 |
| 738 | Ga0207706_10555830 | 3300025933 | Bacteria | 988 |
| 739 | Ga0207686_10000129 | 3300025934 | Bacteria | 61050 |
| 740 | Ga0207686_10015891 | 3300025934 | Bacteria | 4217 |
| 741 | Ga0207686_10048338 | 3300025934 | Bacteria | 2635 |
| 742 | Ga0207686_10069020 | 3300025934 | Bacteria | 2266 |
| 743 | Ga0207686_10141900 | 3300025934 | Bacteria | 1661 |
| 744 | Ga0207686_10303509 | 3300025934 | Bacteria | 1186 |
| 745 | Ga0207686_10387988 | 3300025934 | Bacteria | 1061 |
| 746 | Ga0207686_10518106 | 3300025934 | Bacteria | 928 |
| 747 | Ga0207686_10570417 | 3300025934 | Bacteria | 887 |
| 748 | Ga0207686_11019235 | 3300025934 | Bacteria | 672 |
| 749 | Ga0207709_10024554 | 3300025935 | Unclassified | 3443 |
| 750 | Ga0207709_10433733 | 3300025935 | Bacteria | 1012 |
| 751 | Ga0207709_10619399 | 3300025935 | Bacteria | 859 |
| 752 | Ga0207709_10853550 | 3300025935 | Unclassified | 738 |
| 753 | Ga0207670_10047154 | 3300025936 | Bacteria | 2868 |
| 754 | Ga0207670_10544985 | 3300025936 | Unclassified | 947 |
| 755 | Ga0207670_11784162 | 3300025936 | Unclassified | 523 |
| 756 | Ga0207669_10000265 | 3300025937 | Bacteria | 23882 |
| 757 | Ga0207669_10762600 | 3300025937 | Unclassified | 800 |
| 758 | Ga0207669_10895059 | 3300025937 | Unclassified | 741 |
| 759 | Ga0207704_10010291 | 3300025938 | Unclassified | 4556 |
| 760 | Ga0207704_10034138 | 3300025938 | Bacteria | 2900 |
| 761 | Ga0207704_10101986 | 3300025938 | Bacteria | 1915 |
| 762 | Ga0207704_10413888 | 3300025938 | Bacteria | 1067 |
| 763 | Ga0207665_10000774 | 3300025939 | Bacteria | 21536 |
| 764 | Ga0207665_10001443 | 3300025939 | Bacteria | 15988 |
| 765 | Ga0207665_10021115 | 3300025939 | Bacteria | 4280 |
| 766 | Ga0207665_10026660 | 3300025939 | Unclassified | 3815 |
| 767 | Ga0207665_10068894 | 3300025939 | Bacteria | 2411 |
| 768 | Ga0207665_10073524 | 3300025939 | Bacteria | 2338 |
| 769 | Ga0207665_10200049 | 3300025939 | Bacteria | 1455 |
| 770 | Ga0207691_10052968 | 3300025940 | Bacteria | 3706 |
| 771 | Ga0207691_10097596 | 3300025940 | Bacteria | 2626 |
| 772 | Ga0207691_10170697 | 3300025940 | Unclassified | 1905 |
| 773 | Ga0207691_10834196 | 3300025940 | Unclassified | 773 |
| 774 | Ga0207711_10008760 | 3300025941 | Bacteria | 8462 |
| 775 | Ga0207711_10025232 | 3300025941 | Bacteria | 4987 |
| 776 | Ga0207711_10078407 | 3300025941 | Bacteria | 2882 |
| 777 | Ga0207711_10531984 | 3300025941 | Bacteria | 1096 |
| 778 | Ga0207711_11749166 | 3300025941 | Bacteria | 565 |
| 779 | Ga0207711_12075465 | 3300025941 | Bacteria | 511 |
| 780 | Ga0207689_10004128 | 3300025942 | Bacteria | 13197 |
| 781 | Ga0207689_10070463 | 3300025942 | Bacteria | 2872 |
| 782 | Ga0207689_10569872 | 3300025942 | Bacteria | 951 |
| 783 | Ga0207689_10595969 | 3300025942 | Bacteria | 929 |
| 784 | Ga0207661_10000775 | 3300025944 | Bacteria | 20758 |
| 785 | Ga0207661_10024100 | 3300025944 | Bacteria | 4606 |
| 786 | Ga0207661_10032909 | 3300025944 | Bacteria | 4021 |
| 787 | Ga0207661_10052253 | 3300025944 | Bacteria | 3264 |
| 788 | Ga0207661_10107807 | 3300025944 | Bacteria | 2350 |
| 789 | Ga0207661_10370116 | 3300025944 | Bacteria | 1295 |
| 790 | Ga0207661_11084850 | 3300025944 | Bacteria | 737 |
| 791 | Ga0207661_11553535 | 3300025944 | Unclassified | 606 |
| 792 | Ga0207679_10002634 | 3300025945 | Bacteria | 11075 |
| 793 | Ga0207679_10055132 | 3300025945 | Bacteria | 2929 |
| 794 | Ga0207679_10096386 | 3300025945 | Bacteria | 2302 |
| 795 | Ga0207679_10412963 | 3300025945 | Bacteria | 1190 |
| 796 | Ga0207679_10757948 | 3300025945 | Bacteria | 883 |
| 797 | Ga0207667_10001778 | 3300025949 | Bacteria | 27124 |
| 798 | Ga0207667_10006264 | 3300025949 | Bacteria | 14444 |
| 799 | Ga0207667_10031871 | 3300025949 | Bacteria | 5685 |
| 800 | Ga0207667_10355302 | 3300025949 | Unclassified | 1494 |
| 801 | Ga0207651_10016817 | 3300025960 | Bacteria | 4300 |
| 802 | Ga0207651_10100878 | 3300025960 | Unclassified | 2141 |
| 803 | Ga0207651_10314819 | 3300025960 | Bacteria | 1306 |
| 804 | Ga0207651_10339517 | 3300025960 | Bacteria | 1261 |
| 805 | Ga0207651_11186565 | 3300025960 | Unclassified | 685 |
| 806 | Ga0207712_10008358 | 3300025961 | Bacteria | 6540 |
| 807 | Ga0207712_10437427 | 3300025961 | Bacteria | 1107 |
| 808 | Ga0207712_11762547 | 3300025961 | Unclassified | 555 |
| 809 | Ga0207668_10198145 | 3300025972 | Bacteria | 1597 |
| 810 | Ga0207640_10166220 | 3300025981 | Bacteria | 1638 |
| 811 | Ga0207640_10340379 | 3300025981 | Unclassified | 1201 |
| 812 | Ga0207658_10098706 | 3300025986 | Bacteria | 2282 |
| 813 | Ga0207658_10147642 | 3300025986 | Bacteria | 1912 |
| 814 | Ga0207658_10646336 | 3300025986 | Bacteria | 953 |
| 815 | Ga0207658_11178154 | 3300025986 | Unclassified | 700 |
| 816 | Ga0207677_10022009 | 3300026023 | Bacteria | 3909 |
| 817 | Ga0207677_10072466 | 3300026023 | Bacteria | 2435 |
| 818 | Ga0207677_11017327 | 3300026023 | Bacteria | 752 |
| 819 | Ga0207677_11777976 | 3300026023 | Bacteria | 572 |
| 820 | Ga0207703_10023203 | 3300026035 | Bacteria | 4873 |
| 821 | Ga0207703_10061300 | 3300026035 | Bacteria | 3079 |
| 822 | Ga0207703_10071335 | 3300026035 | Bacteria | 2869 |
| 823 | Ga0207703_10128768 | 3300026035 | Bacteria | 2183 |
| 824 | Ga0207703_10479799 | 3300026035 | Unclassified | 1165 |
| 825 | Ga0207703_10494422 | 3300026035 | Unclassified | 1147 |
| 826 | Ga0207703_10754669 | 3300026035 | Bacteria | 927 |
| 827 | Ga0207703_11149899 | 3300026035 | Bacteria | 746 |
| 828 | Ga0207639_10075777 | 3300026041 | Bacteria | 2647 |
| 829 | Ga0207639_10118028 | 3300026041 | Bacteria | 2175 |
| 830 | Ga0207639_10210403 | 3300026041 | Unclassified | 1674 |
| 831 | Ga0207639_10323222 | 3300026041 | Bacteria | 1371 |
| 832 | Ga0207639_10589023 | 3300026041 | Bacteria | 1024 |
| 833 | Ga0207639_10617432 | 3300026041 | Bacteria | 1001 |
| 834 | Ga0207639_10926411 | 3300026041 | Bacteria | 815 |
| 835 | Ga0207678_10539142 | 3300026067 | Bacteria | 1020 |
| 836 | Ga0207708_10078604 | 3300026075 | Unclassified | 2533 |
| 837 | Ga0207708_10083233 | 3300026075 | Bacteria | 2459 |
| 838 | Ga0207708_10153065 | 3300026075 | Unclassified | 1817 |
| 839 | Ga0207708_10172815 | 3300026075 | Bacteria | 1712 |
| 840 | Ga0207708_10296831 | 3300026075 | Bacteria | 1313 |
| 841 | Ga0207708_11328099 | 3300026075 | Unclassified | 630 |
| 842 | Ga0207702_10111347 | 3300026078 | Bacteria | 2434 |
| 843 | Ga0207702_10249655 | 3300026078 | Unclassified | 1666 |
| 844 | Ga0207702_10337824 | 3300026078 | Bacteria | 1438 |
| 845 | Ga0207702_10487815 | 3300026078 | Bacteria | 1200 |
| 846 | Ga0207702_10595702 | 3300026078 | Bacteria | 1084 |
| 847 | Ga0207702_11294824 | 3300026078 | Bacteria | 723 |
| 848 | Ga0207641_10000673 | 3300026088 | Bacteria | 37086 |
| 849 | Ga0207641_10072292 | 3300026088 | Bacteria | 2970 |
| 850 | Ga0207641_10110027 | 3300026088 | Bacteria | 2441 |
| 851 | Ga0207641_10561495 | 3300026088 | Unclassified | 1114 |
| 852 | Ga0207641_10566005 | 3300026088 | Bacteria | 1110 |
| 853 | Ga0207641_10572548 | 3300026088 | Bacteria | 1103 |
| 854 | Ga0207641_10810587 | 3300026088 | Unclassified | 926 |
| 855 | Ga0207641_11527415 | 3300026088 | Bacteria | 669 |
| 856 | Ga0207641_12103622 | 3300026088 | Unclassified | 565 |
| 857 | Ga0207648_10000021 | 3300026089 | Bacteria | 139257 |
| 858 | Ga0207648_10044955 | 3300026089 | Bacteria | 3874 |
| 859 | Ga0207648_10233660 | 3300026089 | Bacteria | 1636 |
| 860 | Ga0207648_10377700 | 3300026089 | Bacteria | 1281 |
| 861 | Ga0207648_10857427 | 3300026089 | Unclassified | 847 |
| 862 | Ga0207648_11041158 | 3300026089 | Unclassified | 767 |
| 863 | Ga0207648_12109408 | 3300026089 | Bacteria | 525 |
| 864 | Ga0207676_10008617 | 3300026095 | Bacteria | 7248 |
| 865 | Ga0207676_10184017 | 3300026095 | Unclassified | 1832 |
| 866 | Ga0207676_10288859 | 3300026095 | Bacteria | 1492 |
| 867 | Ga0207676_10332777 | 3300026095 | Bacteria | 1398 |
| 868 | Ga0207676_10814793 | 3300026095 | Unclassified | 911 |
| 869 | Ga0207674_10001486 | 3300026116 | Bacteria | 30262 |
| 870 | Ga0207674_10002911 | 3300026116 | Bacteria | 21255 |
| 871 | Ga0207674_10005071 | 3300026116 | Bacteria | 15722 |
| 872 | Ga0207674_10011599 | 3300026116 | Bacteria | 9899 |
| 873 | Ga0207674_10434205 | 3300026116 | Bacteria | 1269 |
| 874 | Ga0207674_11208357 | 3300026116 | Unclassified | 726 |
| 875 | Ga0207674_11915252 | 3300026116 | Unclassified | 559 |
| 876 | Ga0207675_100003902 | 3300026118 | Bacteria | 14501 |
| 877 | Ga0207675_100127101 | 3300026118 | Bacteria | 2415 |
| 878 | Ga0207675_100579130 | 3300026118 | Bacteria | 1124 |
| 879 | Ga0207683_10007609 | 3300026121 | Bacteria | 9278 |
| 880 | Ga0207683_10393740 | 3300026121 | Bacteria | 1274 |
| 881 | Ga0207683_11316141 | 3300026121 | Unclassified | 669 |
| 882 | Ga0207698_10180882 | 3300026142 | Bacteria | 1868 |
| 883 | Ga0207698_10453997 | 3300026142 | Unclassified | 1238 |
| 884 | Ga0207698_10699514 | 3300026142 | Bacteria | 1008 |
| 885 | Ga0209588_1006055 | 3300027671 | Bacteria | 3493 |
| 886 | Ga0209588_1022012 | 3300027671 | Bacteria | 2005 |
| 887 | Ga0209588_1025551 | 3300027671 | Bacteria | 1869 |
| 888 | Ga0209588_1028705 | 3300027671 | Unclassified | 1772 |
| 889 | Ga0209588_1169127 | 3300027671 | Bacteria | 688 |
| 890 | Ga0209588_1282704 | 3300027671 | Bacteria | 501 |
| 891 | Ga0209974_10053294 | 3300027876 | Bacteria | 1362 |
| 892 | Ga0207428_10025646 | 3300027907 | Bacteria | 4932 |
| 893 | Ga0207428_10174566 | 3300027907 | Bacteria | 1626 |
| 894 | Ga0207428_10544966 | 3300027907 | Unclassified | 839 |
| 895 | Ga0268266_10000416 | 3300028379 | Bacteria | 64671 |
| 896 | Ga0268266_10362091 | 3300028379 | Unclassified | 1365 |
| 897 | Ga0268265_10685855 | 3300028380 | Unclassified | 988 |
| 898 | Ga0268265_10791829 | 3300028380 | Bacteria | 923 |
| 899 | Ga0268264_10003798 | 3300028381 | Bacteria | 12955 |
| 900 | Ga0268264_10023927 | 3300028381 | Bacteria | 4983 |
| 901 | Ga0268264_10089263 | 3300028381 | Bacteria | 2654 |
| 902 | Ga0268264_10206511 | 3300028381 | Bacteria | 1800 |
| 903 | Ga0268264_10386957 | 3300028381 | Bacteria | 1341 |
| 904 | Ga0268264_12258030 | 3300028381 | Unclassified | 551 |
| 905 | Ga0265334_10231006 | 3300028573 | Unclassified | 639 |
| 906 | Ga0265338_10002463 | 3300028800 | Bacteria | 27648 |
| 907 | Ga0265338_10003852 | 3300028800 | Bacteria | 20806 |
| 908 | Ga0265762_1121964 | 3300030760 | Bacteria | 597 |
| 909 | Ga0265760_10014729 | 3300031090 | Unclassified | 2242 |
| 910 | Ga0265332_10025074 | 3300031238 | Unclassified | 2621 |
| 911 | Ga0265328_10007859 | 3300031239 | Bacteria | 4431 |
| 912 | Ga0265325_10057759 | 3300031241 | Unclassified | 1978 |
| 913 | Ga0265325_10127924 | 3300031241 | Bacteria | 1219 |
| 914 | Ga0265339_10006275 | 3300031249 | Bacteria | 7815 |
| 915 | Ga0265331_10203088 | 3300031250 | Unclassified | 892 |
| 916 | Ga0265316_10786295 | 3300031344 | Unclassified | 668 |
| 917 | Ga0307408_100966364 | 3300031548 | Bacteria | 783 |
| 918 | Ga0265313_10006814 | 3300031595 | Bacteria | 7978 |
| 919 | Ga0307508_10025945 | 3300031616 | Bacteria | 5314 |
| 920 | Ga0265342_10565423 | 3300031712 | Unclassified | 576 |
| 921 | Ga0307405_10237438 | 3300031731 | Bacteria | 1348 |
| 922 | Ga0307413_10385075 | 3300031824 | Bacteria | 1094 |
| 923 | Ga0307413_10690405 | 3300031824 | Unclassified | 847 |
| 924 | Ga0307406_10088706 | 3300031901 | Bacteria | 2076 |
| 925 | Ga0307412_10187589 | 3300031911 | Bacteria | 1561 |
| 926 | Ga0307416_103820882 | 3300032002 | Unclassified | 504 |
| 927 | Ga0307411_10474832 | 3300032005 | Bacteria | 1052 |
| 928 | Ga0373926_0005187 | 3300035083 | Bacteria | 4288 |
| 929 | Ga0373929_0077551 | 3300035085 | Unclassified | 805 |
| 930 | Ga0373934_0008592 | 3300035086 | Bacteria | 3808 |
| 931 | Ga0373934_0351900 | 3300035086 | Bacteria | 613 |
| 932 | Ga0373944_0169004 | 3300035089 | Bacteria | 779 |
| 933 | Ga0373923_0299102 | 3300035111 | Bacteria | 761 |
| 934 | Ga0373923_0549474 | 3300035111 | Unclassified | 566 |
| 935 | Ga0373936_0123277 | 3300035113 | Bacteria | 1109 |
| 936 | Ga0373936_0363546 | 3300035113 | Bacteria | 660 |
| 937 | Ga0373939_0010509 | 3300035114 | Bacteria | 2317 |
| 938 | Ga0373939_0539439 | 3300035114 | Unclassified | 503 |
| 939 | Ga0373941_0000825 | 3300035115 | Bacteria | 6368 |
| 940 | Ga0373945_0192724 | 3300035116 | Unclassified | 843 |
| 941 | Ga0373953_0054053 | 3300035117 | Bacteria | 1628 |
| 942 | Ga0373954_0030861 | 3300035118 | Unclassified | 2472 |
| 943 | Ga0373954_0200590 | 3300035118 | Bacteria | 980 |
| 944 | Ga0373954_0308744 | 3300035118 | Bacteria | 780 |
| 945 | Ga0373956_0001187 | 3300035119 | Bacteria | 10761 |
| 946 | Ga0373956_0029447 | 3300035119 | Bacteria | 2395 |
| 947 | Ga0373957_0041710 | 3300035120 | Bacteria | 1729 |
| 948 | Ga0373957_0049429 | 3300035120 | Bacteria | 1605 |
| 949 | Ga0373943_0412876 | 3300035170 | Bacteria | 781 |
| 950 | Ga0373943_0820203 | 3300035170 | Unclassified | 554 |
| 951 | Ga0373946_0051503 | 3300035171 | Unclassified | 1723 |
| 952 | Ga0373955_0001637 | 3300035172 | Bacteria | 9584 |
| 953 | Ga0373955_0054160 | 3300035172 | Bacteria | 2193 |
| 954 | Ga0373955_0084056 | 3300035172 | Bacteria | 1804 |
| 955 | Ga0373955_0163689 | 3300035172 | Bacteria | 1314 |
| 956 | Ga0373955_0406524 | 3300035172 | Bacteria | 828 |
| 957 | Ga0373942_0119782 | 3300035207 | Bacteria | 821 |
| 958 | Ga0373961_0003589 | 3300035241 | Bacteria | 3820 |
| 959 | Ga0373961_0037868 | 3300035241 | Bacteria | 1380 |
| 960 | Ga0373924_0070118 | 3300035410 | Bacteria | 1478 |
| 961 | Ga0373924_0122233 | 3300035410 | Bacteria | 1130 |
| 962 | Ga0373931_0088264 | 3300035691 | Bacteria | 1723 |
| 963 | Ga0373935_0063167 | 3300035692 | Bacteria | 2373 |
| 964 | Ga0373935_0227245 | 3300035692 | Bacteria | 1298 |
| 965 | Ga0373935_0373873 | 3300035692 | Bacteria | 1019 |
| 966 | Ga0373927_0244470 | 3300035695 | Unclassified | 1179 |
| 967 | Ga0373927_0331813 | 3300035695 | Bacteria | 1002 |
| 968 | Ga0373933_0000428 | 3300035724 | Bacteria | 26447 |
| 969 | Ga0373947_0010931 | 3300035725 | Bacteria | 5212 |
| 970 | Ga0373947_0183509 | 3300035725 | Bacteria | 1363 |
| 971 | Ga0373947_0187022 | 3300035725 | Bacteria | 1350 |
| 972 | Ga0373947_0192950 | 3300035725 | Bacteria | 1330 |
| 973 | Ga0373947_0592983 | 3300035725 | Unclassified | 755 |
| 974 | Ga0373937_0000735 | 3300036401 | Bacteria | 28345 |
| 975 | Ga0373937_0020117 | 3300036401 | Bacteria | 5981 |
| 976 | Ga0373937_0032472 | 3300036401 | Bacteria | 4735 |
| 977 | Ga0373937_0032953 | 3300036401 | Bacteria | 4701 |
| 978 | Ga0373937_0048000 | 3300036401 | Unclassified | 3907 |
| 979 | Ga0373937_0223940 | 3300036401 | Bacteria | 1770 |
| 980 | Ga0373937_0285503 | 3300036401 | Bacteria | 1559 |
| 981 | Ga0373937_0325479 | 3300036401 | Bacteria | 1454 |
| 982 | Ga0373937_0439969 | 3300036401 | Bacteria | 1238 |
| 983 | Ga0373937_1416070 | 3300036401 | Unclassified | 643 |
| 984 | Ga0373925_0022994 | 3300037068 | Bacteria | 4549 |
| 985 | Ga0373925_0024902 | 3300037068 | Bacteria | 4371 |
| 986 | Ga0373925_0171271 | 3300037068 | Bacteria | 1714 |
| 987 | Ga0395898_1140120 | 3300037466 | Bacteria | 712 |
| 988 | Ga0395905_0755381 | 3300037471 | Unclassified | 875 |
| 989 | Ga0436364_0124008 | 3300037853 | Bacteria | 10700 |
| 990 | Ga0436364_1437153 | 3300037853 | Bacteria | 1210 |
| 991 | Ga0395901_0731418 | 3300038443 | Unclassified | 984 |
| 992 | Ga0395901_1155840 | 3300038443 | Bacteria | 742 |
| 993 | Ga0436365_0013084 | 3300039437 | Bacteria | 1231 |
| 994 | Ga0436365_0066995 | 3300039437 | Bacteria | 1894 |
| 995 | Ga0436365_0535749 | 3300039437 | Bacteria | 559 |
| 996 | Ga0436365_1390038 | 3300039437 | Bacteria | 1619 |
| 997 | Ga0436362_0272322 | 3300039453 | Unclassified | 542 |
| 998 | Ga0436362_0439696 | 3300039453 | Unclassified | 1398 |
| 999 | Ga0439461_0006092 | 3300041410 | Bacteria | 2089 |
| 1000 | Ga0451839_0610758 | 3300041496 | Bacteria | 548 |
| 1001 | Ga0439431_0062334 | 3300041997 | Bacteria | 983 |
| 1002 | Ga0450923_067617 | 3300042125 | Unclassified | 788 |
| 1003 | Ga0450896_008177 | 3300042133 | Unclassified | 1449 |
| 1004 | Ga0439446_0206060 | 3300042156 | Bacteria | 665 |
| 1005 | Ga0439434_0058549 | 3300042435 | Bacteria | 1202 |
| 1006 | Ga0451577_0055478 | 3300042876 | Bacteria | 3535 |
| 1007 | Ga0451577_0954053 | 3300042876 | Bacteria | 771 |
| 1008 | Ga0453683_0003964 | 3300044673 | Bacteria | 10704 |
| 1009 | Ga0453683_0005264 | 3300044673 | Bacteria | 9054 |
| 1010 | Ga0453683_0669781 | 3300044673 | Unclassified | 679 |
| 1011 | Ga0453684_0032308 | 3300044712 | Bacteria | 7330 |
| 1012 | Ga0453684_0503350 | 3300044712 | Bacteria | 1341 |
| 1013 | Ga0453684_0630053 | 3300044712 | Bacteria | 1172 |
| 1014 | Ga0451576_0014367 | 3300045051 | Bacteria | 8817 |
| 1015 | Ga0451576_0114334 | 3300045051 | Unclassified | 2809 |
| 1016 | Ga0451576_0246638 | 3300045051 | Bacteria | 1866 |
| 1017 | Ga0451576_1808278 | 3300045051 | Bacteria | 631 |
| 1018 | Ga0495592_0003544 | 3300046454 | Bacteria | 11209 |
| 1019 | Ga0495592_0327493 | 3300046454 | Bacteria | 988 |
| 1020 | Ga0495592_0375387 | 3300046454 | Bacteria | 906 |
| 1021 | Ga0495592_0429184 | 3300046454 | Bacteria | 832 |
| 1022 | Ga0495592_0448698 | 3300046454 | Bacteria | 809 |
| 1023 | Ga0495603_0009349 | 3300046455 | Bacteria | 5925 |
| 1024 | Ga0495603_0138888 | 3300046455 | Bacteria | 1414 |
| 1025 | Ga0495603_0216269 | 3300046455 | Bacteria | 1106 |
| 1026 | Ga0495651_0108315 | 3300046462 | Bacteria | 2058 |
| 1027 | Ga0495651_0250184 | 3300046462 | Bacteria | 1211 |
| 1028 | Ga0495651_0322569 | 3300046462 | Unclassified | 1029 |
| 1029 | Ga0495653_0189030 | 3300046463 | Bacteria | 1407 |
| 1030 | Ga0495653_0738766 | 3300046463 | Bacteria | 595 |
| 1031 | Ga0495580_0005913 | 3300046472 | Bacteria | 10031 |
| 1032 | Ga0495580_0010116 | 3300046472 | Bacteria | 7368 |
| 1033 | Ga0495580_0262120 | 3300046472 | Bacteria | 1182 |
| 1034 | Ga0495580_0421143 | 3300046472 | Unclassified | 898 |
| 1035 | Ga0495580_0625456 | 3300046472 | Unclassified | 710 |
| 1036 | Ga0495582_0001064 | 3300046473 | Bacteria | 15449 |
| 1037 | Ga0495582_0199049 | 3300046473 | Unclassified | 1144 |
| 1038 | Ga0495582_0200620 | 3300046473 | Bacteria | 1139 |
| 1039 | Ga0495582_0897481 | 3300046473 | Bacteria | 512 |
| 1040 | Ga0495639_0058266 | 3300046475 | Bacteria | 1766 |
| 1041 | Ga0495662_0019110 | 3300046476 | Bacteria | 3316 |
| 1042 | Ga0495662_0065243 | 3300046476 | Bacteria | 1760 |
| 1043 | Ga0495594_0447520 | 3300046499 | Unclassified | 734 |
| 1044 | Ga0495594_0553363 | 3300046499 | Unclassified | 653 |
| 1045 | Ga0495608_0043618 | 3300046511 | Bacteria | 2996 |
| 1046 | Ga0495608_0064936 | 3300046511 | Bacteria | 2391 |
| 1047 | Ga0495608_0071018 | 3300046511 | Bacteria | 2272 |
| 1048 | Ga0495608_0223595 | 3300046511 | Unclassified | 1180 |
| 1049 | Ga0495608_0298769 | 3300046511 | Bacteria | 997 |
| 1050 | Ga0495608_0468759 | 3300046511 | Bacteria | 765 |
| 1051 | Ga0495618_0064474 | 3300046514 | Unclassified | 2328 |
| 1052 | Ga0495618_0094260 | 3300046514 | Bacteria | 1914 |
| 1053 | Ga0495618_0321524 | 3300046514 | Unclassified | 958 |
| 1054 | Ga0495628_0041259 | 3300046516 | Bacteria | 3684 |
| 1055 | Ga0495628_0049916 | 3300046516 | Bacteria | 3311 |
| 1056 | Ga0495628_0118858 | 3300046516 | Bacteria | 2029 |
| 1057 | Ga0495628_0332290 | 3300046516 | Bacteria | 1120 |
| 1058 | Ga0495628_0339162 | 3300046516 | Bacteria | 1107 |
| 1059 | Ga0495630_0023609 | 3300046517 | Bacteria | 4546 |
| 1060 | Ga0495630_0221085 | 3300046517 | Bacteria | 1446 |
| 1061 | Ga0495652_0021691 | 3300046529 | Bacteria | 5708 |
| 1062 | Ga0495652_0114360 | 3300046529 | Bacteria | 2165 |
| 1063 | Ga0495652_0210109 | 3300046529 | Bacteria | 1470 |
| 1064 | Ga0495652_0256204 | 3300046529 | Bacteria | 1294 |
| 1065 | Ga0495652_0262551 | 3300046529 | Unclassified | 1274 |
| 1066 | Ga0495665_0035209 | 3300046531 | Bacteria | 2675 |
| 1067 | Ga0495665_0362878 | 3300046531 | Unclassified | 737 |
| 1068 | Ga0495640_0101161 | 3300046533 | Bacteria | 1892 |
| 1069 | Ga0495640_0185896 | 3300046533 | Bacteria | 1322 |
| 1070 | Ga0495586_0038229 | 3300046535 | Bacteria | 2576 |
| 1071 | Ga0495586_0076562 | 3300046535 | Bacteria | 1833 |
| 1072 | Ga0495586_0424435 | 3300046535 | Bacteria | 766 |
| 1073 | Ga0495586_0452361 | 3300046535 | Bacteria | 740 |
| 1074 | Ga0495587_0010174 | 3300046536 | Bacteria | 5999 |
| 1075 | Ga0495587_0014404 | 3300046536 | Unclassified | 4961 |
| 1076 | Ga0495587_0212217 | 3300046536 | Unclassified | 1093 |
| 1077 | Ga0495587_0323548 | 3300046536 | Unclassified | 861 |
| 1078 | Ga0495645_0006585 | 3300046543 | Bacteria | 8068 |
| 1079 | Ga0495622_0293695 | 3300046557 | Unclassified | 709 |
| 1080 | Ga0495633_0444916 | 3300046558 | Unclassified | 585 |
| 1081 | Ga0495667_0006357 | 3300046559 | Bacteria | 8014 |
| 1082 | Ga0495667_0082503 | 3300046559 | Bacteria | 2089 |
| 1083 | Ga0495667_0117690 | 3300046559 | Unclassified | 1716 |
| 1084 | Ga0495667_0133095 | 3300046559 | Bacteria | 1603 |
| 1085 | Ga0495667_0436186 | 3300046559 | Unclassified | 824 |
| 1086 | Ga0495634_0024089 | 3300046642 | Bacteria | 4275 |
| 1087 | Ga0495634_0165183 | 3300046642 | Bacteria | 1393 |
| 1088 | Ga0495635_0026015 | 3300046663 | Bacteria | 4075 |
| 1089 | Ga0495635_0043114 | 3300046663 | Bacteria | 3114 |
| 1090 | Ga0495635_0133839 | 3300046663 | Bacteria | 1690 |
| 1091 | Ga0495635_0167866 | 3300046663 | Bacteria | 1493 |
| 1092 | Ga0495635_0176846 | 3300046663 | Bacteria | 1451 |
| 1093 | Ga0495635_1015810 | 3300046663 | Unclassified | 527 |
| 1094 | Ga0495659_0047981 | 3300046664 | Bacteria | 1546 |
| 1095 | Ga0495659_0220044 | 3300046664 | Unclassified | 784 |
| 1096 | Ga0495659_0311890 | 3300046664 | Unclassified | 666 |
| 1097 | Ga0495588_0047061 | 3300046674 | Bacteria | 2214 |
| 1098 | Ga0495657_0000539 | 3300046675 | Bacteria | 34985 |
| 1099 | Ga0495657_0041324 | 3300046675 | Bacteria | 3156 |
| 1100 | Ga0495657_0143874 | 3300046675 | Bacteria | 1485 |
| 1101 | Ga0495599_0103294 | 3300046678 | Bacteria | 1776 |
| 1102 | Ga0495599_0283763 | 3300046678 | Unclassified | 1002 |
| 1103 | Ga0495599_0391501 | 3300046678 | Bacteria | 828 |
| 1104 | Ga0495599_0444140 | 3300046678 | Unclassified | 769 |
| 1105 | Ga0495623_0014375 | 3300046679 | Bacteria | 5123 |
| 1106 | Ga0495623_0605347 | 3300046679 | Bacteria | 569 |
| 1107 | Ga0495646_0120810 | 3300046680 | Unclassified | 1483 |
| 1108 | Ga0495658_0013189 | 3300046683 | Bacteria | 4205 |
| 1109 | Ga0495658_0131679 | 3300046683 | Bacteria | 1523 |
| 1110 | Ga0495658_0440491 | 3300046683 | Bacteria | 832 |
| 1111 | Ga0495658_0995877 | 3300046683 | Unclassified | 535 |
| 1112 | Ga0495613_0132732 | 3300046689 | Unclassified | 1782 |
| 1113 | Ga0495624_0172098 | 3300046690 | Unclassified | 1321 |
| 1114 | Ga0495624_0214858 | 3300046690 | Bacteria | 1166 |
| 1115 | Ga0495600_0374470 | 3300046809 | Bacteria | 889 |
| 1116 | Ga0495600_0602624 | 3300046809 | Unclassified | 667 |
| 1117 | Ga0495581_0203251 | 3300047315 | Unclassified | 1159 |
| 1118 | Ga0495604_0002913 | 3300047317 | Bacteria | 13707 |
| 1119 | Ga0495604_0200860 | 3300047317 | Unclassified | 1383 |
| 1120 | Ga0495604_0247111 | 3300047317 | Unclassified | 1218 |
| 1121 | Ga0495604_0320980 | 3300047317 | Unclassified | 1035 |
| 1122 | Ga0495636_0425041 | 3300047318 | Bacteria | 635 |
| 1123 | Ga0495674_0114602 | 3300047319 | Bacteria | 2282 |
| 1124 | Ga0495674_0202235 | 3300047319 | Bacteria | 1647 |
| 1125 | Ga0495674_0401023 | 3300047319 | Bacteria | 1107 |
| 1126 | Ga0495674_0956934 | 3300047319 | Bacteria | 658 |
| 1127 | Ga0495676_0378679 | 3300047321 | Bacteria | 942 |
| 1128 | Ga0495676_0391430 | 3300047321 | Unclassified | 923 |
| 1129 | Ga0495680_0047415 | 3300047322 | Bacteria | 3380 |
| 1130 | Ga0495680_0135667 | 3300047322 | Bacteria | 1804 |
| 1131 | Ga0495680_0199788 | 3300047322 | Bacteria | 1435 |
| 1132 | Ga0495680_1066105 | 3300047322 | Unclassified | 512 |
| 1133 | Ga0495675_0244439 | 3300047444 | Bacteria | 1079 |
| 1134 | Ga0495675_0362775 | 3300047444 | Bacteria | 850 |
| 1135 | Ga0495675_0390319 | 3300047444 | Bacteria | 813 |
| 1136 | Ga0495684_0007510 | 3300047471 | Bacteria | 8441 |
| 1137 | Ga0495684_0101795 | 3300047471 | Bacteria | 2171 |
| 1138 | Ga0495684_0158516 | 3300047471 | Bacteria | 1689 |
| 1139 | Ga0495593_0260162 | 3300047673 | Unclassified | 869 |
| 1140 | Ga0495602_0000583 | 3300048088 | Bacteria | 34067 |
| 1141 | Ga0495602_0029966 | 3300048088 | Bacteria | 5170 |
| 1142 | Ga0495602_0054169 | 3300048088 | Bacteria | 3544 |
| 1143 | Ga0495602_0104674 | 3300048088 | Bacteria | 2315 |
| 1144 | Ga0495602_0268785 | 3300048088 | Unclassified | 1261 |
| 1145 | Ga0495602_1176322 | 3300048088 | Bacteria | 500 |
| 1146 | Ga0495614_0182961 | 3300048089 | Bacteria | 943 |
| 1147 | Ga0496100_0407811 | 3300048903 | Bacteria | 1036 |
| 1148 | Ga0496101_0043618 | 3300048904 | Unclassified | 3206 |
| 1149 | Ga0496102_0015454 | 3300048905 | Bacteria | 6649 |
| 1150 | Ga0496102_0679139 | 3300048905 | Unclassified | 953 |
| 1151 | Ga0496104_0027768 | 3300048907 | Bacteria | 5238 |
| 1152 | Ga0496105_0036709 | 3300048908 | Bacteria | 4038 |
| 1153 | Ga0496105_0201208 | 3300048908 | Unclassified | 1626 |
| 1154 | Ga0496106_0072701 | 3300048909 | Bacteria | 2630 |
| 1155 | Ga0496106_0401392 | 3300048909 | Unclassified | 1102 |
| 1156 | Ga0496106_0933196 | 3300048909 | Bacteria | 684 |
| 1157 | Ga0496107_0235702 | 3300048910 | Bacteria | 1362 |
| 1158 | Ga0496108_1166775 | 3300048911 | Bacteria | 652 |
| 1159 | Ga0496109_0334550 | 3300048912 | Bacteria | 1430 |
| 1160 | Ga0496110_0078860 | 3300048913 | Bacteria | 2932 |
| 1161 | Ga0496112_0137698 | 3300048915 | Bacteria | 2411 |
| 1162 | Ga0496112_0221373 | 3300048915 | Bacteria | 1849 |
| 1163 | Ga0496112_0296572 | 3300048915 | Bacteria | 1562 |
| 1164 | Ga0496114_0000025 | 3300048917 | Bacteria | 213656 |
| 1165 | Ga0496114_0002088 | 3300048917 | Bacteria | 15192 |
| 1166 | Ga0496114_0004152 | 3300048917 | Bacteria | 11204 |
| 1167 | Ga0496114_0054027 | 3300048917 | Bacteria | 3349 |
| 1168 | Ga0496114_0083382 | 3300048917 | Bacteria | 2704 |
| 1169 | Ga0496114_0167735 | 3300048917 | Unclassified | 1912 |
| 1170 | Ga0496115_0001334 | 3300048918 | Bacteria | 17587 |
| 1171 | Ga0496115_0117121 | 3300048918 | Bacteria | 2191 |
| 1172 | Ga0501036_1515235 | 3300049572 | Unclassified | 542 |
| 1173 | Ga0501042_1097048 | 3300049578 | Bacteria | 580 |
| 1174 | Ga0501048_0349277 | 3300049582 | Bacteria | 1055 |
| 1175 | Ga0501048_0509429 | 3300049582 | Bacteria | 863 |
| 1176 | Ga0501067_0125433 | 3300049583 | Bacteria | 1429 |
| 1177 | Ga0501073_0392857 | 3300049589 | Bacteria | 958 |
| 1178 | Ga0501075_0471932 | 3300049591 | Bacteria | 957 |
| 1179 | Ga0501075_1328049 | 3300049591 | Bacteria | 545 |
| 1180 | Ga0501079_0623246 | 3300049741 | Bacteria | 849 |
| 1181 | Ga0501081_0188569 | 3300049743 | Bacteria | 1493 |
| 1182 | Ga0501083_0022984 | 3300049744 | Bacteria | 4328 |
| 1183 | Ga0501263_044046 | 3300049760 | Unclassified | 663 |
| 1184 | nmdc:mga05p37_174997_c1 | 3300050507 | Bacteria | 2615 |
| 1185 | nmdc:mga05p37_63741_c1 | 3300050507 | Bacteria | 4536 |
| 1186 | nmdc:mga09592_59488_c1 | 3300050508 | Bacteria | 3230 |
| 1187 | nmdc:mga0qj67_240696_c1 | 3300050509 | Unclassified | 1468 |
| 1188 | nmdc:mga0qj67_412560_c1 | 3300050509 | Bacteria | 1089 |
| 1189 | nmdc:mga0qj67_60488_c1 | 3300050509 | Bacteria | 3006 |
| 1190 | nmdc:mga06r32_114730_c1 | 3300050510 | Bacteria | 2652 |
| 1191 | nmdc:mga06r32_13443_c1 | 3300050510 | Bacteria | 7413 |
| 1192 | nmdc:mga06r32_35475_c1 | 3300050510 | Bacteria | 4705 |
| 1193 | nmdc:mga06r32_859510_c1 | 3300050510 | Bacteria | 865 |
| 1194 | nmdc:mga08y16_1061544_c1 | 3300050511 | Bacteria | 787 |
| 1195 | nmdc:mga08y16_364576_c1 | 3300050511 | Unclassified | 1483 |
| 1196 | nmdc:mga08y16_596887_c1 | 3300050511 | Unclassified | 1113 |
| 1197 | nmdc:mga0n895_1160753_c1 | 3300050512 | Bacteria | 747 |
| 1198 | nmdc:mga0n895_1524598_c1 | 3300050512 | Unclassified | 634 |
| 1199 | nmdc:mga0n895_3252_c1 | 3300050512 | Bacteria | 13023 |
| 1200 | nmdc:mga0n895_5364_c1 | 3300050512 | Bacteria | 10693 |
| 1201 | nmdc:mga0n895_54374_c1 | 3300050512 | Unclassified | 3938 |
| 1202 | nmdc:mga0n895_62191_c1 | 3300050512 | Bacteria | 3689 |
| 1203 | nmdc:mga0n895_76525_c1 | 3300050512 | Bacteria | 3328 |
| 1204 | nmdc:mga0n895_89907_c1 | 3300050512 | Bacteria | 3072 |
| 1205 | nmdc:mga0n895_9462_c1 | 3300050512 | Bacteria | 8526 |
| 1206 | nmdc:mga0rr50_1017270_c1 | 3300050513 | Unclassified | 706 |
| 1207 | nmdc:mga0rr50_1330148_c1 | 3300050513 | Bacteria | 609 |
| 1208 | nmdc:mga0rr50_16768_c1 | 3300050513 | Bacteria | 4875 |
| 1209 | nmdc:mga0rr50_302875_c1 | 3300050513 | Unclassified | 1004 |
| 1210 | nmdc:mga0rr50_37228_c1 | 3300050513 | Bacteria | 3510 |
| 1211 | nmdc:mga0rr50_374558_c1 | 3300050513 | Bacteria | 1200 |
| 1212 | nmdc:mga0rr50_517487_c1 | 3300050513 | Bacteria | 1015 |
| 1213 | nmdc:mga08x19_148765_c1 | 3300050514 | Bacteria | 1585 |
| 1214 | nmdc:mga08x19_158020_c1 | 3300050514 | Bacteria | 1538 |
| 1215 | nmdc:mga08x19_177920_c1 | 3300050514 | Unclassified | 1451 |
| 1216 | nmdc:mga08x19_18699_c1 | 3300050514 | Bacteria | 4247 |
| 1217 | nmdc:mga08x19_225722_c1 | 3300050514 | Bacteria | 1288 |
| 1218 | nmdc:mga08x19_266_c1 | 3300050514 | Bacteria | 39583 |
| 1219 | nmdc:mga08x19_48662_c1 | 3300050514 | Bacteria | 2716 |
| 1220 | nmdc:mga08x19_577979_c1 | 3300050514 | Unclassified | 796 |
| 1221 | nmdc:mga08x19_99110_c1 | 3300050514 | Bacteria | 1931 |
| 1222 | nmdc:mga0a205_123605_c1 | 3300050515 | Bacteria | 2488 |
| 1223 | nmdc:mga0a205_173558_c1 | 3300050515 | Bacteria | 2052 |
| 1224 | nmdc:mga0a205_2373_c2 | 3300050515 | Bacteria | 9651 |
| 1225 | nmdc:mga0a205_3157_c2 | 3300050515 | Bacteria | 9919 |
| 1226 | nmdc:mga0a205_44121_c1 | 3300050515 | Bacteria | 4298 |
| 1227 | nmdc:mga0a205_485086_c1 | 3300050515 | Bacteria | 1094 |
| 1228 | nmdc:mga0a205_6811_c1 | 3300050515 | Bacteria | 10339 |
| 1229 | Ga0495601_0214659 | 3300053077 | Bacteria | 1257 |
| 1230 | Ga0495601_0401035 | 3300053077 | Unclassified | 889 |
| 1231 | Ga0495601_0713217 | 3300053077 | Bacteria | 639 |
| 1232 | Ga0495595_0704759 | 3300053084 | Unclassified | 517 |
| 1233 | Ga0495619_0006716 | 3300053085 | Bacteria | 7279 |
| 1234 | Ga0495619_0082502 | 3300053085 | Bacteria | 2167 |
| 1235 | Ga0495619_0207169 | 3300053085 | Unclassified | 1358 |
| 1236 | Ga0500651_0188992 | 3300053093 | Bacteria | 1220 |
| 1237 | Ga0500599_013484 | 3300053736 | Bacteria | 1106 |
| 1238 | Ga0501084_0226190 | 3300054114 | Bacteria | 1579 |
| 1239 | Ga0501084_0303411 | 3300054114 | Bacteria | 1349 |
| 1240 | Ga0501084_0979560 | 3300054114 | Unclassified | 711 |
| 1241 | Ga0587070_197265 | 3300059491 | Bacteria | 533 |
| 1242 | Ga0587085_032354 | 3300059506 | Unclassified | 867 |
| 1243 | Ga0501082_0401454 | 3300060353 | Bacteria | 1196 |
| 1244 | Ga0501082_0851096 | 3300060353 | Bacteria | 798 |
| 1245 | Ga0070664_100324241 | |||
| 1246 | MRS1b_contig_1215992 | |||
| 1247 | MBSR1b_contig_3003525 | |||
| 1248 | JGI25406J46586_10053464 | |||
| 1249 | Ga0065712_10078642 | |||
| 1250 | Ga0065712_10259735 | |||
| 1251 | Ga0065712_10294369 | |||
| 1252 | Ga0065715_10102479 | |||
| 1253 | Ga0065715_10308038 | |||
| 1254 | Ga0065715_11057488 | |||
| 1255 | Ga0065707_10939840 | |||
| 1256 | Ga0070658_10030350 | |||
| 1257 | Ga0070658_10968460 | |||
| 1258 | Ga0070658_11407492 | |||
| 1259 | Ga0070676_10005157 | |||
| 1260 | Ga0070676_10028633 | |||
| 1261 | Ga0070676_10037538 | |||
| 1262 | Ga0070676_10431242 | |||
| 1263 | Ga0070676_10894634 | |||
| 1264 | Ga0070676_10903223 | |||
| 1265 | Ga0070683_100006943 | |||
| 1266 | Ga0070683_100058428 | |||
| 1267 | Ga0070683_100064473 | |||
| 1268 | Ga0070683_100102066 | |||
| 1269 | Ga0070683_100510381 | |||
| 1270 | Ga0070690_100046976 | |||
| 1271 | Ga0070690_100059190 | |||
| 1272 | Ga0070690_100384687 | |||
| 1273 | Ga0070690_100478192 | |||
| 1274 | Ga0070690_100629836 | |||
| 1275 | Ga0070670_100005553 | |||
| 1276 | Ga0070670_100104495 | |||
| 1277 | Ga0070670_100153430 | |||
| 1278 | Ga0070670_101608049 | |||
| 1279 | Ga0070677_10021725 | |||
| 1280 | Ga0070677_10225482 | |||
| 1281 | Ga0070677_10426352 | |||
| 1282 | Ga0068869_100001426 | |||
| 1283 | Ga0068869_100075005 | |||
| 1284 | Ga0068869_100126141 | |||
| 1285 | Ga0070666_10048472 | |||
| 1286 | Ga0070666_10216074 | |||
| 1287 | Ga0070666_10286167 | |||
| 1288 | Ga0070666_10310620 | |||
| 1289 | Ga0070680_100001348 | |||
| 1290 | Ga0070680_100025639 | |||
| 1291 | Ga0070680_100055999 | |||
| 1292 | Ga0070680_100149828 | |||
| 1293 | Ga0070680_100208809 | |||
| 1294 | Ga0070680_100539643 | |||
| 1295 | Ga0070680_101150709 | |||
| 1296 | Ga0070682_100000710 | |||
| 1297 | Ga0070682_100006101 | |||
| 1298 | Ga0070682_100905193 | |||
| 1299 | Ga0070682_100984518 | |||
| 1300 | Ga0068868_100001287 | |||
| 1301 | Ga0068868_100078197 | |||
| 1302 | Ga0068868_100115264 | |||
| 1303 | Ga0068868_100395526 | |||
| 1304 | Ga0068868_101059865 | |||
| 1305 | Ga0068868_102392196 | |||
| 1306 | Ga0070660_100052808 | |||
| 1307 | Ga0070660_100221202 | |||
| 1308 | Ga0070660_100315210 | |||
| 1309 | Ga0070689_100068722 | |||
| 1310 | Ga0070691_10004718 | |||
| 1311 | Ga0070691_10034143 | |||
| 1312 | Ga0070691_10143723 | |||
| 1313 | Ga0070691_10529828 | |||
| 1314 | Ga0070687_100080915 | |||
| 1315 | Ga0070687_100550018 | |||
| 1316 | Ga0070687_100939310 | |||
| 1317 | Ga0070661_100108630 | |||
| 1318 | Ga0070661_100215865 | |||
| 1319 | Ga0070661_100337505 | |||
| 1320 | Ga0070661_100431177 | |||
| 1321 | Ga0070692_10038705 | |||
| 1322 | Ga0070692_10125772 | |||
| 1323 | Ga0070692_10517676 | |||
| 1324 | Ga0070692_10667778 | |||
| 1325 | Ga0070668_100049309 | |||
| 1326 | Ga0070668_101375207 | |||
| 1327 | Ga0070669_100000069 | |||
| 1328 | Ga0070669_100013681 | |||
| 1329 | Ga0070669_100034824 | |||
| 1330 | Ga0070669_100801527 | |||
| 1331 | Ga0070669_101396926 | |||
| 1332 | Ga0070669_101983596 | |||
| 1333 | Ga0070675_100002658 | |||
| 1334 | Ga0070675_100039617 | |||
| 1335 | Ga0070675_100070496 | |||
| 1336 | Ga0070675_100109247 | |||
| 1337 | Ga0070675_100440865 | |||
| 1338 | Ga0070675_100504932 | |||
| 1339 | Ga0070675_100511608 | |||
| 1340 | Ga0070671_100043392 | |||
| 1341 | Ga0070671_100087682 | |||
| 1342 | Ga0070671_100260075 | |||
| 1343 | Ga0070671_100289853 | |||
| 1344 | Ga0070671_100359193 | |||
| 1345 | Ga0070671_100915795 | |||
| 1346 | Ga0070671_101005545 | |||
| 1347 | Ga0070674_100000197 | |||
| 1348 | Ga0070674_101737692 | |||
| 1349 | Ga0070674_101813788 | |||
| 1350 | Ga0070673_100026057 | |||
| 1351 | Ga0070673_100099837 | |||
| 1352 | Ga0070673_100569062 | |||
| 1353 | Ga0070688_100014947 | |||
| 1354 | Ga0070688_100037110 | |||
| 1355 | Ga0070688_100231995 | |||
| 1356 | Ga0070688_100495210 | |||
| 1357 | Ga0070688_100769115 | |||
| 1358 | Ga0070659_100108547 | |||
| 1359 | Ga0070659_100158622 | |||
| 1360 | Ga0070659_100269135 | |||
| 1361 | Ga0070667_100001651 | |||
| 1362 | Ga0070667_100016243 | |||
| 1363 | Ga0070667_100198515 | |||
| 1364 | Ga0070667_100229493 | |||
| 1365 | Ga0070667_100497764 | |||
| 1366 | Ga0070667_100588247 | |||
| 1367 | Ga0070667_100677071 | |||
| 1368 | Ga0070709_10000089 | |||
| 1369 | Ga0070709_10087644 | |||
| 1370 | Ga0070709_10257671 | |||
| 1371 | Ga0070709_10291976 | |||
| 1372 | Ga0070709_10457167 | |||
| 1373 | Ga0070709_10491445 | |||
| 1374 | Ga0070709_10766364 | |||
| 1375 | Ga0070709_11232934 | |||
| 1376 | Ga0070714_100076023 | |||
| 1377 | Ga0070713_100012283 | |||
| 1378 | Ga0070713_100073954 | |||
| 1379 | Ga0070713_100385967 | |||
| 1380 | Ga0070713_100554477 | |||
| 1381 | Ga0070713_102478297 | |||
| 1382 | Ga0070710_10036452 | |||
| 1383 | Ga0070710_10347963 | |||
| 1384 | Ga0070710_10450902 | |||
| 1385 | Ga0070711_100015672 | |||
| 1386 | Ga0070711_100042436 | |||
| 1387 | Ga0070711_100073899 | |||
| 1388 | Ga0070711_100343296 | |||
| 1389 | Ga0070711_100640782 | |||
| 1390 | Ga0070705_100013396 | |||
| 1391 | Ga0070705_100022908 | |||
| 1392 | Ga0070705_100132449 | |||
| 1393 | Ga0070705_100329537 | |||
| 1394 | Ga0070700_100294326 | |||
| 1395 | Ga0070700_100449172 | |||
| 1396 | Ga0070700_100912614 | |||
| 1397 | Ga0070694_100005175 | |||
| 1398 | Ga0070694_100123713 | |||
| 1399 | Ga0070694_100176976 | |||
| 1400 | Ga0070708_100000271 | |||
| 1401 | Ga0070708_100071322 | |||
| 1402 | Ga0070708_100254360 | |||
| 1403 | Ga0070708_100395201 | |||
| 1404 | Ga0070708_101181894 | |||
| 1405 | Ga0070708_101843239 | |||
| 1406 | Ga0070663_100408642 | |||
| 1407 | Ga0070678_100002411 | |||
| 1408 | Ga0070678_100155682 | |||
| 1409 | Ga0070678_100515849 | |||
| 1410 | Ga0070678_101731602 | |||
| 1411 | Ga0070662_100000040 | |||
| 1412 | Ga0070662_100091491 | |||
| 1413 | Ga0070662_100230871 | |||
| 1414 | Ga0070662_100780932 | |||
| 1415 | Ga0070662_101677028 | |||
| 1416 | Ga0070681_10003058 | |||
| 1417 | Ga0070681_10022978 | |||
| 1418 | Ga0070681_10031088 | |||
| 1419 | Ga0070681_10038222 | |||
| 1420 | Ga0070681_10066080 | |||
| 1421 | Ga0070681_10122147 | |||
| 1422 | Ga0070681_10244399 | |||
| 1423 | Ga0070681_11712825 | |||
| 1424 | Ga0068867_100000144 | |||
| 1425 | Ga0068867_100017896 | |||
| 1426 | Ga0068867_100036130 | |||
| 1427 | Ga0068867_100136110 | |||
| 1428 | Ga0068867_100358857 | |||
| 1429 | Ga0068867_101366625 | |||
| 1430 | Ga0070685_10017987 | |||
| 1431 | Ga0070685_10044335 | |||
| 1432 | Ga0070685_10062086 | |||
| 1433 | Ga0070685_10076860 | |||
| 1434 | Ga0070685_10521899 | |||
| 1435 | Ga0070706_100002564 | |||
| 1436 | Ga0070706_100029047 | |||
| 1437 | Ga0070706_100086235 | |||
| 1438 | Ga0070706_100375039 | |||
| 1439 | Ga0070706_100641479 | |||
| 1440 | Ga0070706_100928591 | |||
| 1441 | Ga0070706_101378053 | |||
| 1442 | Ga0070707_100001174 | |||
| 1443 | Ga0070707_100013883 | |||
| 1444 | Ga0070707_100183754 | |||
| 1445 | Ga0070707_100403608 | |||
| 1446 | Ga0070707_100575139 | |||
| 1447 | Ga0070707_100805604 | |||
| 1448 | Ga0070707_100951875 | |||
| 1449 | Ga0070698_100009906 | |||
| 1450 | Ga0070698_100036742 | |||
| 1451 | Ga0070698_100071446 | |||
| 1452 | Ga0070698_100523681 | |||
| 1453 | Ga0070698_100732604 | |||
| 1454 | Ga0070698_102017906 | |||
| 1455 | Ga0070699_100022233 | |||
| 1456 | Ga0070699_100076005 | |||
| 1457 | Ga0070699_100088424 | |||
| 1458 | Ga0070699_100093471 | |||
| 1459 | Ga0070699_100125397 | |||
| 1460 | Ga0070699_100145883 | |||
| 1461 | Ga0070699_100192159 | |||
| 1462 | Ga0070699_100600147 | |||
| 1463 | Ga0070699_101029559 | |||
| 1464 | Ga0070699_101348733 | |||
| 1465 | Ga0070679_100030620 | |||
| 1466 | Ga0070679_100129665 | |||
| 1467 | Ga0070679_100359197 | |||
| 1468 | Ga0070679_100589939 | |||
| 1469 | Ga0070679_101116919 | |||
| 1470 | Ga0070679_101591079 | |||
| 1471 | Ga0070679_101948090 | |||
| 1472 | Ga0070684_100003277 | |||
| 1473 | Ga0070684_100016512 | |||
| 1474 | Ga0070684_100081145 | |||
| 1475 | Ga0070684_100089611 | |||
| 1476 | Ga0070697_100003329 | |||
| 1477 | Ga0070697_100061895 | |||
| 1478 | Ga0070697_100094239 | |||
| 1479 | Ga0070697_100139406 | |||
| 1480 | Ga0070697_100180073 | |||
| 1481 | Ga0070697_100229420 | |||
| 1482 | Ga0070697_101243354 | |||
| 1483 | Ga0070697_102022315 | |||
| 1484 | Ga0068853_100046224 | |||
| 1485 | Ga0068853_100095936 | |||
| 1486 | Ga0068853_100147650 | |||
| 1487 | Ga0068853_100272526 | |||
| 1488 | Ga0068853_100499956 | |||
| 1489 | Ga0068853_100673010 | |||
| 1490 | Ga0068853_100924428 | |||
| 1491 | Ga0070672_100013819 | |||
| 1492 | Ga0070686_100074945 | |||
| 1493 | Ga0070686_100172051 | |||
| 1494 | Ga0070686_100243182 | |||
| 1495 | Ga0070686_100319679 | |||
| 1496 | Ga0070695_100006440 | |||
| 1497 | Ga0070695_100010968 | |||
| 1498 | Ga0070695_100018539 | |||
| 1499 | Ga0070695_100054020 | |||
| 1500 | Ga0070695_100085012 | |||
| 1501 | Ga0070695_100148559 | |||
| 1502 | Ga0070695_100383881 | |||
| 1503 | Ga0070695_100683789 | |||
| 1504 | Ga0070695_101204667 | |||
| 1505 | Ga0070695_101754276 | |||
| 1506 | Ga0070696_100001925 | |||
| 1507 | Ga0070696_100011185 | |||
| 1508 | Ga0070696_100965707 | |||
| 1509 | Ga0070693_100015057 | |||
| 1510 | Ga0070693_100487283 | |||
| 1511 | Ga0070693_100578615 | |||
| 1512 | Ga0070665_100006080 | |||
| 1513 | Ga0070665_100412645 | |||
| 1514 | Ga0070665_101634878 | |||
| 1515 | Ga0070704_100076560 | |||
| 1516 | Ga0068855_100000575 | |||
| 1517 | Ga0068855_100073696 | |||
| 1518 | Ga0068855_100244523 | |||
| 1519 | Ga0068855_100385153 | |||
| 1520 | Ga0070664_100009874 | |||
| 1521 | Ga0070664_100037495 | |||
| 1522 | Ga0070664_100038968 | |||
| 1523 | Ga0068857_100002591 | |||
| 1524 | Ga0068857_100004522 | |||
| 1525 | Ga0068857_100020580 | |||
| 1526 | Ga0068857_100415766 | |||
| 1527 | Ga0068857_100612490 | |||
| 1528 | Ga0068857_100803535 | |||
| 1529 | Ga0068857_100893307 | |||
| 1530 | Ga0068857_101609355 | |||
| 1531 | Ga0068854_100085292 | |||
| 1532 | Ga0068854_100842746 | |||
| 1533 | Ga0068854_100900225 | |||
| 1534 | Ga0068854_101803885 | |||
| 1535 | Ga0068856_100009628 | |||
| 1536 | Ga0068856_100084303 | |||
| 1537 | Ga0068856_100095042 | |||
| 1538 | Ga0068856_100287006 | |||
| 1539 | Ga0068856_100308600 | |||
| 1540 | Ga0070702_100016403 | |||
| 1541 | Ga0070702_100333629 | |||
| 1542 | Ga0070702_100359608 | |||
| 1543 | Ga0070702_100366539 | |||
| 1544 | Ga0070702_101261353 | |||
| 1545 | Ga0070702_101702249 | |||
| 1546 | Ga0068852_100323802 | |||
| 1547 | Ga0068852_100324949 | |||
| 1548 | Ga0068852_100553104 | |||
| 1549 | Ga0068852_100794636 | |||
| 1550 | Ga0068852_101169464 | |||
| 1551 | Ga0068852_101540160 | |||
| 1552 | Ga0068859_100011413 | |||
| 1553 | Ga0068859_100215543 | |||
| 1554 | Ga0068864_100001306 | |||
| 1555 | Ga0068864_100023007 | |||
| 1556 | Ga0068864_100089138 | |||
| 1557 | Ga0068864_100109795 | |||
| 1558 | Ga0068864_100502882 | |||
| 1559 | Ga0068866_10000371 | |||
| 1560 | Ga0068866_10582181 | |||
| 1561 | Ga0068861_100095003 | |||
| 1562 | Ga0068861_100674144 | |||
| 1563 | Ga0068851_10076896 | |||
| 1564 | Ga0068870_10573941 | |||
| 1565 | Ga0068870_10940760 | |||
| 1566 | Ga0068863_100004629 | |||
| 1567 | Ga0068863_100013880 | |||
| 1568 | Ga0068863_100019350 | |||
| 1569 | Ga0068863_100051436 | |||
| 1570 | Ga0068863_100186051 | |||
| 1571 | Ga0068863_100347156 | |||
| 1572 | Ga0068863_100408505 | |||
| 1573 | Ga0068863_100560732 | |||
| 1574 | Ga0068863_100578709 | |||
| 1575 | Ga0068863_102144009 | |||
| 1576 | Ga0068858_100031965 | |||
| 1577 | Ga0068858_100061134 | |||
| 1578 | Ga0068858_100091148 | |||
| 1579 | Ga0068858_100112321 | |||
| 1580 | Ga0068858_100187506 | |||
| 1581 | Ga0068858_101028612 | |||
| 1582 | Ga0068858_101326186 | |||
| 1583 | Ga0068860_100008121 | |||
| 1584 | Ga0068860_100013172 | |||
| 1585 | Ga0068860_100444466 | |||
| 1586 | Ga0068860_100670144 | |||
| 1587 | Ga0068860_101176329 | |||
| 1588 | Ga0068862_100553237 | |||
| 1589 | Ga0068862_100823242 | |||
| 1590 | Ga0081455_10029406 | |||
| 1591 | Ga0081455_10444152 | |||
| 1592 | Ga0081539_10002282 | |||
| 1593 | Ga0070717_10024268 | |||
| 1594 | Ga0070717_11009896 | |||
| 1595 | Ga0070717_11306561 | |||
| 1596 | Ga0070717_11484261 | |||
| 1597 | Ga0075364_10299880 | |||
| 1598 | Ga0070715_10003486 | |||
| 1599 | Ga0070715_10026306 | |||
| 1600 | Ga0070715_10054833 | |||
| 1601 | Ga0070715_10386339 | |||
| 1602 | Ga0070716_100000124 | |||
| 1603 | Ga0070716_100000590 | |||
| 1604 | Ga0070716_100039015 | |||
| 1605 | Ga0070716_100053512 | |||
| 1606 | Ga0070716_100068840 | |||
| 1607 | Ga0070716_100165585 | |||
| 1608 | Ga0070716_100196619 | |||
| 1609 | Ga0070716_100944894 | |||
| 1610 | Ga0070716_101087318 | |||
| 1611 | Ga0070712_100013754 | |||
| 1612 | Ga0070712_100118775 | |||
| 1613 | Ga0070712_100215046 | |||
| 1614 | Ga0070712_100270359 | |||
| 1615 | Ga0070712_100295060 | |||
| 1616 | Ga0097621_100057378 | |||
| 1617 | Ga0097621_100063876 | |||
| 1618 | Ga0097621_100204432 | |||
| 1619 | Ga0097621_100212684 | |||
| 1620 | Ga0097621_100225744 | |||
| 1621 | Ga0097621_100340943 | |||
| 1622 | Ga0097621_100853805 | |||
| 1623 | Ga0068871_100015782 | |||
| 1624 | Ga0068871_100195409 | |||
| 1625 | Ga0068871_100268622 | |||
| 1626 | Ga0068871_100351454 | |||
| 1627 | Ga0068871_101122261 | |||
| 1628 | Ga0068871_101170010 | |||
| 1629 | Ga0075428_100147718 | |||
| 1630 | Ga0075428_100534935 | |||
| 1631 | Ga0075430_100370183 | |||
| 1632 | Ga0075430_100600385 | |||
| 1633 | Ga0075431_100030888 | |||
| 1634 | Ga0075431_100044455 | |||
| 1635 | Ga0075431_100050802 | |||
| 1636 | Ga0075431_100057677 | |||
| 1637 | Ga0075431_100804789 | |||
| 1638 | Ga0075433_10016402 | |||
| 1639 | Ga0075433_10033646 | |||
| 1640 | Ga0075433_10046537 | |||
| 1641 | Ga0075433_10099514 | |||
| 1642 | Ga0075433_10300600 | |||
| 1643 | Ga0075434_100003534 | |||
| 1644 | Ga0075434_100003714 | |||
| 1645 | Ga0075434_100007168 | |||
| 1646 | Ga0075434_100010866 | |||
| 1647 | Ga0075434_100022633 | |||
| 1648 | Ga0075434_100092687 | |||
| 1649 | Ga0075434_100107195 | |||
| 1650 | Ga0075434_100109201 | |||
| 1651 | Ga0075434_100144056 | |||
| 1652 | Ga0075429_100091980 | |||
| 1653 | Ga0075429_100888008 | |||
| 1654 | Ga0075429_101884269 | |||
| 1655 | Ga0068865_100046597 | |||
| 1656 | Ga0068865_100052091 | |||
| 1657 | Ga0068865_100288262 | |||
| 1658 | Ga0068865_100522248 | |||
| 1659 | Ga0068865_100848352 | |||
| 1660 | Ga0075436_100001018 | |||
| 1661 | Ga0075436_100002018 | |||
| 1662 | Ga0075436_100007884 | |||
| 1663 | Ga0075436_100017242 | |||
| 1664 | Ga0075436_100133320 | |||
| 1665 | Ga0097620_100011413 | |||
| 1666 | Ga0097620_100215559 | |||
| 1667 | Ga0097620_101902605 | |||
| 1668 | Ga0075435_100029060 | |||
| 1669 | Ga0075435_100126320 | |||
| 1670 | Ga0075435_100216426 | |||
| 1671 | Ga0075435_100280375 | |||
| 1672 | Ga0075435_100308030 | |||
| 1673 | Ga0075435_100381962 | |||
| 1674 | Ga0075435_101224299 | |||
| 1675 | Ga0075435_101653943 | |||
| 1676 | Ga0099794_10003116 | |||
| 1677 | Ga0099794_10005039 | |||
| 1678 | Ga0099794_10056952 | |||
| 1679 | Ga0099794_10058922 | |||
| 1680 | Ga0099794_10098315 | |||
| 1681 | Ga0099794_10296672 | |||
| 1682 | Ga0099794_10325361 | |||
| 1683 | Ga0099794_10371387 | |||
| 1684 | Ga0099794_10422937 | |||
| 1685 | Ga0099794_10474288 | |||
| 1686 | Ga0105250_10220886 | |||
| 1687 | Ga0105240_10013290 | |||
| 1688 | Ga0105240_10257429 | |||
| 1689 | Ga0105240_10336552 | |||
| 1690 | Ga0105240_10341585 | |||
| 1691 | Ga0105240_10390648 | |||
| 1692 | Ga0105240_10394295 | |||
| 1693 | Ga0111539_10055168 | |||
| 1694 | Ga0111539_10458885 | |||
| 1695 | Ga0111539_10731600 | |||
| 1696 | Ga0105245_10003441 | |||
| 1697 | Ga0105245_10241574 | |||
| 1698 | Ga0105245_10251419 | |||
| 1699 | Ga0105245_10443406 | |||
| 1700 | Ga0105245_11608624 | |||
| 1701 | Ga0105245_12293828 | |||
| 1702 | Ga0105245_12412460 | |||
| 1703 | Ga0105245_12544758 | |||
| 1704 | Ga0105247_10010761 | |||
| 1705 | Ga0105247_10045350 | |||
| 1706 | Ga0105247_10257834 | |||
| 1707 | Ga0105247_10391048 | |||
| 1708 | Ga0114129_10000427 | |||
| 1709 | Ga0114129_10041711 | |||
| 1710 | Ga0114129_10050826 | |||
| 1711 | Ga0105243_10001466 | |||
| 1712 | Ga0105243_10109853 | |||
| 1713 | Ga0105243_10504743 | |||
| 1714 | Ga0105241_10008109 | |||
| 1715 | Ga0105241_10017114 | |||
| 1716 | Ga0105241_10070494 | |||
| 1717 | Ga0105241_10213969 | |||
| 1718 | Ga0105242_10000578 | |||
| 1719 | Ga0105242_10011051 | |||
| 1720 | Ga0105242_10133921 | |||
| 1721 | Ga0105242_10254443 | |||
| 1722 | Ga0105242_10261752 | |||
| 1723 | Ga0105242_10297480 | |||
| 1724 | Ga0105242_10366298 | |||
| 1725 | Ga0105242_10620670 | |||
| 1726 | Ga0105242_10729366 | |||
| 1727 | Ga0105242_12658411 | |||
| 1728 | Ga0105248_10000048 | |||
| 1729 | Ga0105248_10006182 | |||
| 1730 | Ga0105248_10006508 | |||
| 1731 | Ga0105248_10442851 | |||
| 1732 | Ga0105248_12462296 | |||
| 1733 | Ga0105237_10033491 | |||
| 1734 | Ga0105237_10044860 | |||
| 1735 | Ga0105237_10118202 | |||
| 1736 | Ga0105237_10830364 | |||
| 1737 | Ga0105237_11020278 | |||
| 1738 | Ga0105238_10006669 | |||
| 1739 | Ga0105238_10011302 | |||
| 1740 | Ga0105238_10029409 | |||
| 1741 | Ga0105238_10075281 | |||
| 1742 | Ga0105238_11932397 | |||
| 1743 | Ga0105249_10023393 | |||
| 1744 | Ga0105249_10033162 | |||
| 1745 | Ga0105249_10266545 | |||
| 1746 | Ga0105249_10801748 | |||
| 1747 | Ga0105249_10888983 | |||
| 1748 | Ga0105249_10971291 | |||
| 1749 | Ga0105249_11408571 | |||
| 1750 | Ga0105249_11580513 | |||
| 1751 | Ga0105249_11827390 | |||
| 1752 | Ga0105249_12588882 | |||
| 1753 | Ga0105239_10004454 | |||
| 1754 | Ga0105239_10008245 | |||
| 1755 | Ga0105239_10016772 | |||
| 1756 | Ga0105239_10071785 | |||
| 1757 | Ga0105239_10129694 | |||
| 1758 | Ga0105239_10292234 | |||
| 1759 | Ga0105239_10539425 | |||
| 1760 | Ga0105239_11471836 | |||
| 1761 | Ga0105239_11914550 | |||
| 1762 | Ga0105239_12274672 | |||
| 1763 | Ga0105246_10029307 | |||
| 1764 | Ga0105246_10203467 | |||
| 1765 | Ga0105246_10416843 | |||
| 1766 | Ga0157373_10347512 | |||
| 1767 | Ga0157373_10351758 | |||
| 1768 | Ga0157373_10371609 | |||
| 1769 | Ga0157371_10450507 | |||
| 1770 | Ga0157370_10039076 | |||
| 1771 | Ga0157370_11407800 | |||
| 1772 | Ga0157369_10007677 | |||
| 1773 | Ga0157369_10047462 | |||
| 1774 | Ga0157369_10452209 | |||
| 1775 | Ga0157374_10402061 | |||
| 1776 | Ga0157374_10497810 | |||
| 1777 | Ga0157374_10542348 | |||
| 1778 | Ga0157374_12716165 | |||
| 1779 | Ga0157378_10000458 | |||
| 1780 | Ga0157378_10001404 | |||
| 1781 | Ga0157378_10038715 | |||
| 1782 | Ga0157378_10079105 | |||
| 1783 | Ga0157378_10198673 | |||
| 1784 | Ga0157378_10336136 | |||
| 1785 | Ga0157378_10373466 | |||
| 1786 | Ga0157378_10530229 | |||
| 1787 | Ga0157378_11231556 | |||
| 1788 | Ga0157378_11528119 | |||
| 1789 | Ga0163162_10027535 | |||
| 1790 | Ga0163162_10050770 | |||
| 1791 | Ga0163162_10162437 | |||
| 1792 | Ga0163162_10439680 | |||
| 1793 | Ga0163162_11450341 | |||
| 1794 | Ga0157372_10003096 | |||
| 1795 | Ga0157372_10057491 | |||
| 1796 | Ga0157372_10908029 | |||
| 1797 | Ga0157375_10027604 | |||
| 1798 | Ga0157375_10249264 | |||
| 1799 | Ga0157375_10390488 | |||
| 1800 | Ga0157375_10416108 | |||
| 1801 | Ga0157375_11004748 | |||
| 1802 | Ga0157375_11283374 | |||
| 1803 | Ga0157375_12691213 | |||
| 1804 | Ga0163163_10000775 | |||
| 1805 | Ga0163163_10042497 | |||
| 1806 | Ga0163163_10071384 | |||
| 1807 | Ga0163163_10300473 | |||
| 1808 | Ga0163163_10465374 | |||
| 1809 | Ga0163163_13042161 | |||
| 1810 | Ga0157380_10086070 | |||
| 1811 | Ga0157380_10181557 | |||
| 1812 | Ga0157380_10747493 | |||
| 1813 | Ga0157380_11554686 | |||
| 1814 | Ga0157377_10069519 | |||
| 1815 | Ga0157377_10216030 | |||
| 1816 | Ga0157377_10221758 | |||
| 1817 | Ga0157379_10003008 | |||
| 1818 | Ga0157379_10179064 | |||
| 1819 | Ga0157379_10397749 | |||
| 1820 | Ga0157379_11521883 | |||
| 1821 | Ga0157376_10000005 | |||
| 1822 | Ga0157376_10071571 | |||
| 1823 | Ga0157376_10087962 | |||
| 1824 | Ga0157376_10276855 | |||
| 1825 | Ga0157376_10292920 | |||
| 1826 | Ga0157376_12324177 | |||
| 1827 | Ga0163161_10013122 | |||
| 1828 | Ga0163161_10075748 | |||
| 1829 | Ga0163161_10651454 | |||
| 1830 | Ga0206356_10726241 | |||
| 1831 | Ga0206352_10699970 | |||
| 1832 | Ga0213873_10058313 | |||
| 1833 | Ga0213876_10682854 | |||
| 1834 | Ga0213875_10006385 | |||
| 1835 | Ga0224712_10145603 | |||
| 1836 | Ga0228598_1014245 | |||
| 1837 | Ga0228598_1082298 | |||
| 1838 | Ga0207653_10005201 | |||
| 1839 | Ga0207653_10063795 | |||
| 1840 | Ga0207682_10007490 | |||
| 1841 | Ga0207692_10028715 | |||
| 1842 | Ga0207692_10281947 | |||
| 1843 | Ga0207692_10308049 | |||
| 1844 | Ga0207692_10429551 | |||
| 1845 | Ga0207692_10627596 | |||
| 1846 | Ga0207642_10000217 | |||
| 1847 | Ga0207642_10462790 | |||
| 1848 | Ga0207642_10715006 | |||
| 1849 | Ga0207710_10164044 | |||
| 1850 | Ga0207710_10322521 | |||
| 1851 | Ga0207710_10420669 | |||
| 1852 | Ga0207710_10441956 | |||
| 1853 | Ga0207710_10756194 | |||
| 1854 | Ga0207688_10570950 | |||
| 1855 | Ga0207680_10040634 | |||
| 1856 | Ga0207680_10071033 | |||
| 1857 | Ga0207680_10357626 | |||
| 1858 | Ga0207680_10368875 | |||
| 1859 | Ga0207685_10067613 | |||
| 1860 | Ga0207685_10113744 | |||
| 1861 | Ga0207699_10000070 | |||
| 1862 | Ga0207699_10005919 | |||
| 1863 | Ga0207699_10041220 | |||
| 1864 | Ga0207699_10128825 | |||
| 1865 | Ga0207699_10310203 | |||
| 1866 | Ga0207699_10392121 | |||
| 1867 | Ga0207699_10641870 | |||
| 1868 | Ga0207699_11087914 | |||
| 1869 | Ga0207699_11265316 | |||
| 1870 | Ga0207645_10002681 | |||
| 1871 | Ga0207645_10017926 | |||
| 1872 | Ga0207645_10022217 | |||
| 1873 | Ga0207645_10162055 | |||
| 1874 | Ga0207705_10227980 | |||
| 1875 | Ga0207705_10414864 | |||
| 1876 | Ga0207684_10057040 | |||
| 1877 | Ga0207684_10068405 | |||
| 1878 | Ga0207684_10160591 | |||
| 1879 | Ga0207684_10172533 | |||
| 1880 | Ga0207684_10358698 | |||
| 1881 | Ga0207654_10021530 | |||
| 1882 | Ga0207654_10037319 | |||
| 1883 | Ga0207654_10091474 | |||
| 1884 | Ga0207654_10124443 | |||
| 1885 | Ga0207654_10806214 | |||
| 1886 | Ga0207707_10006092 | |||
| 1887 | Ga0207707_10011691 | |||
| 1888 | Ga0207707_10068280 | |||
| 1889 | Ga0207707_10073571 | |||
| 1890 | Ga0207707_10179008 | |||
| 1891 | Ga0207695_10000563 | |||
| 1892 | Ga0207695_10179370 | |||
| 1893 | Ga0207695_10210342 | |||
| 1894 | Ga0207695_10214287 | |||
| 1895 | Ga0207695_10355813 | |||
| 1896 | Ga0207695_10418026 | |||
| 1897 | Ga0207671_10016632 | |||
| 1898 | Ga0207671_10056609 | |||
| 1899 | Ga0207671_10084334 | |||
| 1900 | Ga0207671_10402860 | |||
| 1901 | Ga0207671_10825830 | |||
| 1902 | Ga0207693_10019653 | |||
| 1903 | Ga0207693_10020695 | |||
| 1904 | Ga0207693_10049630 | |||
| 1905 | Ga0207693_10056472 | |||
| 1906 | Ga0207693_10085305 | |||
| 1907 | Ga0207693_10302870 | |||
| 1908 | Ga0207693_10830601 | |||
| 1909 | Ga0207663_10000163 | |||
| 1910 | Ga0207663_10002079 | |||
| 1911 | Ga0207663_10065213 | |||
| 1912 | Ga0207663_10153972 | |||
| 1913 | Ga0207663_10345319 | |||
| 1914 | Ga0207663_10488644 | |||
| 1915 | Ga0207660_10010362 | |||
| 1916 | Ga0207660_10020098 | |||
| 1917 | Ga0207660_10271952 | |||
| 1918 | Ga0207660_10275394 | |||
| 1919 | Ga0207662_10062811 | |||
| 1920 | Ga0207662_10157114 | |||
| 1921 | Ga0207662_10219196 | |||
| 1922 | Ga0207657_10037816 | |||
| 1923 | Ga0207657_10160003 | |||
| 1924 | Ga0207657_10295580 | |||
| 1925 | Ga0207649_10073489 | |||
| 1926 | Ga0207649_10083847 | |||
| 1927 | Ga0207649_10230345 | |||
| 1928 | Ga0207649_10740756 | |||
| 1929 | Ga0207652_10015913 | |||
| 1930 | Ga0207652_10051683 | |||
| 1931 | Ga0207652_10133665 | |||
| 1932 | Ga0207652_10193638 | |||
| 1933 | Ga0207652_10845311 | |||
| 1934 | Ga0207652_11055714 | |||
| 1935 | Ga0207646_10000020 | |||
| 1936 | Ga0207646_10017265 | |||
| 1937 | Ga0207646_10019160 | |||
| 1938 | Ga0207646_10027097 | |||
| 1939 | Ga0207646_10083259 | |||
| 1940 | Ga0207646_10181045 | |||
| 1941 | Ga0207646_10276284 | |||
| 1942 | Ga0207646_10872688 | |||
| 1943 | Ga0207646_10877431 | |||
| 1944 | Ga0207646_11022727 | |||
| 1945 | Ga0207646_11159380 | |||
| 1946 | Ga0207681_10000034 | |||
| 1947 | Ga0207681_10218465 | |||
| 1948 | Ga0207681_10774327 | |||
| 1949 | Ga0207694_10013321 | |||
| 1950 | Ga0207694_10032800 | |||
| 1951 | Ga0207694_10035413 | |||
| 1952 | Ga0207694_10296265 | |||
| 1953 | Ga0207650_10031899 | |||
| 1954 | Ga0207650_10285523 | |||
| 1955 | Ga0207650_10396212 | |||
| 1956 | Ga0207650_11537498 | |||
| 1957 | Ga0207659_10019893 | |||
| 1958 | Ga0207659_10120728 | |||
| 1959 | Ga0207659_10313362 | |||
| 1960 | Ga0207659_10338370 | |||
| 1961 | Ga0207659_10340544 | |||
| 1962 | Ga0207659_10388755 | |||
| 1963 | Ga0207659_10900294 | |||
| 1964 | Ga0207687_10009310 | |||
| 1965 | Ga0207687_10015895 | |||
| 1966 | Ga0207687_10159489 | |||
| 1967 | Ga0207700_10004110 | |||
| 1968 | Ga0207700_10007176 | |||
| 1969 | Ga0207700_10023400 | |||
| 1970 | Ga0207700_11751088 | |||
| 1971 | Ga0207664_10005108 | |||
| 1972 | Ga0207664_10074554 | |||
| 1973 | Ga0207664_10629597 | |||
| 1974 | Ga0207644_10323941 | |||
| 1975 | Ga0207644_10415181 | |||
| 1976 | Ga0207644_10554629 | |||
| 1977 | Ga0207690_10022088 | |||
| 1978 | Ga0207690_10096945 | |||
| 1979 | Ga0207706_10000005 | |||
| 1980 | Ga0207706_10089812 | |||
| 1981 | Ga0207706_10100039 | |||
| 1982 | Ga0207706_10555830 | |||
| 1983 | Ga0207686_10000129 | |||
| 1984 | Ga0207686_10015891 | |||
| 1985 | Ga0207686_10048338 | |||
| 1986 | Ga0207686_10069020 | |||
| 1987 | Ga0207686_10141900 | |||
| 1988 | Ga0207686_10303509 | |||
| 1989 | Ga0207686_10387988 | |||
| 1990 | Ga0207686_10518106 | |||
| 1991 | Ga0207686_10570417 | |||
| 1992 | Ga0207686_11019235 | |||
| 1993 | Ga0207709_10024554 | |||
| 1994 | Ga0207709_10433733 | |||
| 1995 | Ga0207709_10619399 | |||
| 1996 | Ga0207709_10853550 | |||
| 1997 | Ga0207670_10047154 | |||
| 1998 | Ga0207670_10544985 | |||
| 1999 | Ga0207670_11784162 | |||
| 2000 | Ga0207669_10000265 | |||
| 2001 | Ga0207669_10762600 | |||
| 2002 | Ga0207669_10895059 | |||
| 2003 | Ga0207704_10010291 | |||
| 2004 | Ga0207704_10034138 | |||
| 2005 | Ga0207704_10101986 | |||
| 2006 | Ga0207704_10413888 | |||
| 2007 | Ga0207665_10000774 | |||
| 2008 | Ga0207665_10001443 | |||
| 2009 | Ga0207665_10021115 | |||
| 2010 | Ga0207665_10026660 | |||
| 2011 | Ga0207665_10068894 | |||
| 2012 | Ga0207665_10073524 | |||
| 2013 | Ga0207665_10200049 | |||
| 2014 | Ga0207691_10052968 | |||
| 2015 | Ga0207691_10097596 | |||
| 2016 | Ga0207691_10170697 | |||
| 2017 | Ga0207691_10834196 | |||
| 2018 | Ga0207711_10008760 | |||
| 2019 | Ga0207711_10025232 | |||
| 2020 | Ga0207711_10078407 | |||
| 2021 | Ga0207711_10531984 | |||
| 2022 | Ga0207711_11749166 | |||
| 2023 | Ga0207711_12075465 | |||
| 2024 | Ga0207689_10004128 | |||
| 2025 | Ga0207689_10070463 | |||
| 2026 | Ga0207689_10569872 | |||
| 2027 | Ga0207689_10595969 | |||
| 2028 | Ga0207661_10000775 | |||
| 2029 | Ga0207661_10024100 | |||
| 2030 | Ga0207661_10032909 | |||
| 2031 | Ga0207661_10052253 | |||
| 2032 | Ga0207661_10107807 | |||
| 2033 | Ga0207661_10370116 | |||
| 2034 | Ga0207661_11084850 | |||
| 2035 | Ga0207661_11553535 | |||
| 2036 | Ga0207679_10002634 | |||
| 2037 | Ga0207679_10055132 | |||
| 2038 | Ga0207679_10096386 | |||
| 2039 | Ga0207679_10412963 | |||
| 2040 | Ga0207679_10757948 | |||
| 2041 | Ga0207667_10001778 | |||
| 2042 | Ga0207667_10006264 | |||
| 2043 | Ga0207667_10031871 | |||
| 2044 | Ga0207667_10355302 | |||
| 2045 | Ga0207651_10016817 | |||
| 2046 | Ga0207651_10100878 | |||
| 2047 | Ga0207651_10314819 | |||
| 2048 | Ga0207651_10339517 | |||
| 2049 | Ga0207651_11186565 | |||
| 2050 | Ga0207712_10008358 | |||
| 2051 | Ga0207712_10437427 | |||
| 2052 | Ga0207712_11762547 | |||
| 2053 | Ga0207668_10198145 | |||
| 2054 | Ga0207640_10166220 | |||
| 2055 | Ga0207640_10340379 | |||
| 2056 | Ga0207658_10098706 | |||
| 2057 | Ga0207658_10147642 | |||
| 2058 | Ga0207658_10646336 | |||
| 2059 | Ga0207658_11178154 | |||
| 2060 | Ga0207677_10022009 | |||
| 2061 | Ga0207677_10072466 | |||
| 2062 | Ga0207677_11017327 | |||
| 2063 | Ga0207677_11777976 | |||
| 2064 | Ga0207703_10023203 | |||
| 2065 | Ga0207703_10061300 | |||
| 2066 | Ga0207703_10071335 | |||
| 2067 | Ga0207703_10128768 | |||
| 2068 | Ga0207703_10479799 | |||
| 2069 | Ga0207703_10494422 | |||
| 2070 | Ga0207703_10754669 | |||
| 2071 | Ga0207703_11149899 | |||
| 2072 | Ga0207639_10075777 | |||
| 2073 | Ga0207639_10118028 | |||
| 2074 | Ga0207639_10210403 | |||
| 2075 | Ga0207639_10323222 | |||
| 2076 | Ga0207639_10589023 | |||
| 2077 | Ga0207639_10617432 | |||
| 2078 | Ga0207639_10926411 | |||
| 2079 | Ga0207678_10539142 | |||
| 2080 | Ga0207708_10078604 | |||
| 2081 | Ga0207708_10083233 | |||
| 2082 | Ga0207708_10153065 | |||
| 2083 | Ga0207708_10172815 | |||
| 2084 | Ga0207708_10296831 | |||
| 2085 | Ga0207708_11328099 | |||
| 2086 | Ga0207702_10111347 | |||
| 2087 | Ga0207702_10249655 | |||
| 2088 | Ga0207702_10337824 | |||
| 2089 | Ga0207702_10487815 | |||
| 2090 | Ga0207702_10595702 | |||
| 2091 | Ga0207702_11294824 | |||
| 2092 | Ga0207641_10000673 | |||
| 2093 | Ga0207641_10072292 | |||
| 2094 | Ga0207641_10110027 | |||
| 2095 | Ga0207641_10561495 | |||
| 2096 | Ga0207641_10566005 | |||
| 2097 | Ga0207641_10572548 | |||
| 2098 | Ga0207641_10810587 | |||
| 2099 | Ga0207641_11527415 | |||
| 2100 | Ga0207641_12103622 | |||
| 2101 | Ga0207648_10000021 | |||
| 2102 | Ga0207648_10044955 | |||
| 2103 | Ga0207648_10233660 | |||
| 2104 | Ga0207648_10377700 | |||
| 2105 | Ga0207648_10857427 | |||
| 2106 | Ga0207648_11041158 | |||
| 2107 | Ga0207648_12109408 | |||
| 2108 | Ga0207676_10008617 | |||
| 2109 | Ga0207676_10184017 | |||
| 2110 | Ga0207676_10288859 | |||
| 2111 | Ga0207676_10332777 | |||
| 2112 | Ga0207676_10814793 | |||
| 2113 | Ga0207674_10001486 | |||
| 2114 | Ga0207674_10002911 | |||
| 2115 | Ga0207674_10005071 | |||
| 2116 | Ga0207674_10011599 | |||
| 2117 | Ga0207674_10434205 | |||
| 2118 | Ga0207674_11208357 | |||
| 2119 | Ga0207674_11915252 | |||
| 2120 | Ga0207675_100003902 | |||
| 2121 | Ga0207675_100127101 | |||
| 2122 | Ga0207675_100579130 | |||
| 2123 | Ga0207683_10007609 | |||
| 2124 | Ga0207683_10393740 | |||
| 2125 | Ga0207683_11316141 | |||
| 2126 | Ga0207698_10180882 | |||
| 2127 | Ga0207698_10453997 | |||
| 2128 | Ga0207698_10699514 | |||
| 2129 | Ga0209588_1006055 | |||
| 2130 | Ga0209588_1022012 | |||
| 2131 | Ga0209588_1025551 | |||
| 2132 | Ga0209588_1028705 | |||
| 2133 | Ga0209588_1169127 | |||
| 2134 | Ga0209588_1282704 | |||
| 2135 | Ga0209974_10053294 | |||
| 2136 | Ga0207428_10025646 | |||
| 2137 | Ga0207428_10174566 | |||
| 2138 | Ga0207428_10544966 | |||
| 2139 | Ga0268266_10000416 | |||
| 2140 | Ga0268266_10362091 | |||
| 2141 | Ga0268265_10685855 | |||
| 2142 | Ga0268265_10791829 | |||
| 2143 | Ga0268264_10003798 | |||
| 2144 | Ga0268264_10023927 | |||
| 2145 | Ga0268264_10089263 | |||
| 2146 | Ga0268264_10206511 | |||
| 2147 | Ga0268264_10386957 | |||
| 2148 | Ga0268264_12258030 | |||
| 2149 | Ga0265334_10231006 | |||
| 2150 | Ga0265338_10002463 | |||
| 2151 | Ga0265338_10003852 | |||
| 2152 | Ga0265762_1121964 | |||
| 2153 | Ga0265760_10014729 | |||
| 2154 | Ga0265332_10025074 | |||
| 2155 | Ga0265328_10007859 | |||
| 2156 | Ga0265325_10057759 | |||
| 2157 | Ga0265325_10127924 | |||
| 2158 | Ga0265339_10006275 | |||
| 2159 | Ga0265331_10203088 | |||
| 2160 | Ga0265316_10786295 | |||
| 2161 | Ga0307408_100966364 | |||
| 2162 | Ga0265313_10006814 | |||
| 2163 | Ga0307508_10025945 | |||
| 2164 | Ga0265342_10565423 | |||
| 2165 | Ga0307405_10237438 | |||
| 2166 | Ga0307413_10385075 | |||
| 2167 | Ga0307413_10690405 | |||
| 2168 | Ga0307406_10088706 | |||
| 2169 | Ga0307412_10187589 | |||
| 2170 | Ga0307416_103820882 | |||
| 2171 | Ga0307411_10474832 | |||
| 2172 | Ga0373926_0005187 | |||
| 2173 | Ga0373929_0077551 | |||
| 2174 | Ga0373934_0008592 | |||
| 2175 | Ga0373934_0351900 | |||
| 2176 | Ga0373944_0169004 | |||
| 2177 | Ga0373923_0299102 | |||
| 2178 | Ga0373923_0549474 | |||
| 2179 | Ga0373936_0123277 | |||
| 2180 | Ga0373936_0363546 | |||
| 2181 | Ga0373939_0010509 | |||
| 2182 | Ga0373939_0539439 | |||
| 2183 | Ga0373941_0000825 | |||
| 2184 | Ga0373945_0192724 | |||
| 2185 | Ga0373953_0054053 | |||
| 2186 | Ga0373954_0030861 | |||
| 2187 | Ga0373954_0200590 | |||
| 2188 | Ga0373954_0308744 | |||
| 2189 | Ga0373956_0001187 | |||
| 2190 | Ga0373956_0029447 | |||
| 2191 | Ga0373957_0041710 | |||
| 2192 | Ga0373957_0049429 | |||
| 2193 | Ga0373943_0412876 | |||
| 2194 | Ga0373943_0820203 | |||
| 2195 | Ga0373946_0051503 | |||
| 2196 | Ga0373955_0001637 | |||
| 2197 | Ga0373955_0054160 | |||
| 2198 | Ga0373955_0084056 | |||
| 2199 | Ga0373955_0163689 | |||
| 2200 | Ga0373955_0406524 | |||
| 2201 | Ga0373942_0119782 | |||
| 2202 | Ga0373961_0003589 | |||
| 2203 | Ga0373961_0037868 | |||
| 2204 | Ga0373924_0070118 | |||
| 2205 | Ga0373924_0122233 | |||
| 2206 | Ga0373931_0088264 | |||
| 2207 | Ga0373935_0063167 | |||
| 2208 | Ga0373935_0227245 | |||
| 2209 | Ga0373935_0373873 | |||
| 2210 | Ga0373927_0244470 | |||
| 2211 | Ga0373927_0331813 | |||
| 2212 | Ga0373933_0000428 | |||
| 2213 | Ga0373947_0010931 | |||
| 2214 | Ga0373947_0183509 | |||
| 2215 | Ga0373947_0187022 | |||
| 2216 | Ga0373947_0192950 | |||
| 2217 | Ga0373947_0592983 | |||
| 2218 | Ga0373937_0000735 | |||
| 2219 | Ga0373937_0020117 | |||
| 2220 | Ga0373937_0032472 | |||
| 2221 | Ga0373937_0032953 | |||
| 2222 | Ga0373937_0048000 | |||
| 2223 | Ga0373937_0223940 | |||
| 2224 | Ga0373937_0285503 | |||
| 2225 | Ga0373937_0325479 | |||
| 2226 | Ga0373937_0439969 | |||
| 2227 | Ga0373937_1416070 | |||
| 2228 | Ga0373925_0022994 | |||
| 2229 | Ga0373925_0024902 | |||
| 2230 | Ga0373925_0171271 | |||
| 2231 | Ga0395898_1140120 | |||
| 2232 | Ga0395905_0755381 | |||
| 2233 | Ga0436364_0124008 | |||
| 2234 | Ga0436364_1437153 | |||
| 2235 | Ga0395901_0731418 | |||
| 2236 | Ga0395901_1155840 | |||
| 2237 | Ga0436365_0013084 | |||
| 2238 | Ga0436365_0066995 | |||
| 2239 | Ga0436365_0535749 | |||
| 2240 | Ga0436365_1390038 | |||
| 2241 | Ga0436362_0272322 | |||
| 2242 | Ga0436362_0439696 | |||
| 2243 | Ga0439461_0006092 | |||
| 2244 | Ga0451839_0610758 | |||
| 2245 | Ga0439431_0062334 | |||
| 2246 | Ga0450923_067617 | |||
| 2247 | Ga0450896_008177 | |||
| 2248 | Ga0439446_0206060 | |||
| 2249 | Ga0439434_0058549 | |||
| 2250 | Ga0451577_0055478 | |||
| 2251 | Ga0451577_0954053 | |||
| 2252 | Ga0453683_0003964 | |||
| 2253 | Ga0453683_0005264 | |||
| 2254 | Ga0453683_0669781 | |||
| 2255 | Ga0453684_0032308 | |||
| 2256 | Ga0453684_0503350 | |||
| 2257 | Ga0453684_0630053 | |||
| 2258 | Ga0451576_0014367 | |||
| 2259 | Ga0451576_0114334 | |||
| 2260 | Ga0451576_0246638 | |||
| 2261 | Ga0451576_1808278 | |||
| 2262 | Ga0495592_0003544 | |||
| 2263 | Ga0495592_0327493 | |||
| 2264 | Ga0495592_0375387 | |||
| 2265 | Ga0495592_0429184 | |||
| 2266 | Ga0495592_0448698 | |||
| 2267 | Ga0495603_0009349 | |||
| 2268 | Ga0495603_0138888 | |||
| 2269 | Ga0495603_0216269 | |||
| 2270 | Ga0495651_0108315 | |||
| 2271 | Ga0495651_0250184 | |||
| 2272 | Ga0495651_0322569 | |||
| 2273 | Ga0495653_0189030 | |||
| 2274 | Ga0495653_0738766 | |||
| 2275 | Ga0495580_0005913 | |||
| 2276 | Ga0495580_0010116 | |||
| 2277 | Ga0495580_0262120 | |||
| 2278 | Ga0495580_0421143 | |||
| 2279 | Ga0495580_0625456 | |||
| 2280 | Ga0495582_0001064 | |||
| 2281 | Ga0495582_0199049 | |||
| 2282 | Ga0495582_0200620 | |||
| 2283 | Ga0495582_0897481 | |||
| 2284 | Ga0495639_0058266 | |||
| 2285 | Ga0495662_0019110 | |||
| 2286 | Ga0495662_0065243 | |||
| 2287 | Ga0495594_0447520 | |||
| 2288 | Ga0495594_0553363 | |||
| 2289 | Ga0495608_0043618 | |||
| 2290 | Ga0495608_0064936 | |||
| 2291 | Ga0495608_0071018 | |||
| 2292 | Ga0495608_0223595 | |||
| 2293 | Ga0495608_0298769 | |||
| 2294 | Ga0495608_0468759 | |||
| 2295 | Ga0495618_0064474 | |||
| 2296 | Ga0495618_0094260 | |||
| 2297 | Ga0495618_0321524 | |||
| 2298 | Ga0495628_0041259 | |||
| 2299 | Ga0495628_0049916 | |||
| 2300 | Ga0495628_0118858 | |||
| 2301 | Ga0495628_0332290 | |||
| 2302 | Ga0495628_0339162 | |||
| 2303 | Ga0495630_0023609 | |||
| 2304 | Ga0495630_0221085 | |||
| 2305 | Ga0495652_0021691 | |||
| 2306 | Ga0495652_0114360 | |||
| 2307 | Ga0495652_0210109 | |||
| 2308 | Ga0495652_0256204 | |||
| 2309 | Ga0495652_0262551 | |||
| 2310 | Ga0495665_0035209 | |||
| 2311 | Ga0495665_0362878 | |||
| 2312 | Ga0495640_0101161 | |||
| 2313 | Ga0495640_0185896 | |||
| 2314 | Ga0495586_0038229 | |||
| 2315 | Ga0495586_0076562 | |||
| 2316 | Ga0495586_0424435 | |||
| 2317 | Ga0495586_0452361 | |||
| 2318 | Ga0495587_0010174 | |||
| 2319 | Ga0495587_0014404 | |||
| 2320 | Ga0495587_0212217 | |||
| 2321 | Ga0495587_0323548 | |||
| 2322 | Ga0495645_0006585 | |||
| 2323 | Ga0495622_0293695 | |||
| 2324 | Ga0495633_0444916 | |||
| 2325 | Ga0495667_0006357 | |||
| 2326 | Ga0495667_0082503 | |||
| 2327 | Ga0495667_0117690 | |||
| 2328 | Ga0495667_0133095 | |||
| 2329 | Ga0495667_0436186 | |||
| 2330 | Ga0495634_0024089 | |||
| 2331 | Ga0495634_0165183 | |||
| 2332 | Ga0495635_0026015 | |||
| 2333 | Ga0495635_0043114 | |||
| 2334 | Ga0495635_0133839 | |||
| 2335 | Ga0495635_0167866 | |||
| 2336 | Ga0495635_0176846 | |||
| 2337 | Ga0495635_1015810 | |||
| 2338 | Ga0495659_0047981 | |||
| 2339 | Ga0495659_0220044 | |||
| 2340 | Ga0495659_0311890 | |||
| 2341 | Ga0495588_0047061 | |||
| 2342 | Ga0495657_0000539 | |||
| 2343 | Ga0495657_0041324 | |||
| 2344 | Ga0495657_0143874 | |||
| 2345 | Ga0495599_0103294 | |||
| 2346 | Ga0495599_0283763 | |||
| 2347 | Ga0495599_0391501 | |||
| 2348 | Ga0495599_0444140 | |||
| 2349 | Ga0495623_0014375 | |||
| 2350 | Ga0495623_0605347 | |||
| 2351 | Ga0495646_0120810 | |||
| 2352 | Ga0495658_0013189 | |||
| 2353 | Ga0495658_0131679 | |||
| 2354 | Ga0495658_0440491 | |||
| 2355 | Ga0495658_0995877 | |||
| 2356 | Ga0495613_0132732 | |||
| 2357 | Ga0495624_0172098 | |||
| 2358 | Ga0495624_0214858 | |||
| 2359 | Ga0495600_0374470 | |||
| 2360 | Ga0495600_0602624 | |||
| 2361 | Ga0495581_0203251 | |||
| 2362 | Ga0495604_0002913 | |||
| 2363 | Ga0495604_0200860 | |||
| 2364 | Ga0495604_0247111 | |||
| 2365 | Ga0495604_0320980 | |||
| 2366 | Ga0495636_0425041 | |||
| 2367 | Ga0495674_0114602 | |||
| 2368 | Ga0495674_0202235 | |||
| 2369 | Ga0495674_0401023 | |||
| 2370 | Ga0495674_0956934 | |||
| 2371 | Ga0495676_0378679 | |||
| 2372 | Ga0495676_0391430 | |||
| 2373 | Ga0495680_0047415 | |||
| 2374 | Ga0495680_0135667 | |||
| 2375 | Ga0495680_0199788 | |||
| 2376 | Ga0495680_1066105 | |||
| 2377 | Ga0495675_0244439 | |||
| 2378 | Ga0495675_0362775 | |||
| 2379 | Ga0495675_0390319 | |||
| 2380 | Ga0495684_0007510 | |||
| 2381 | Ga0495684_0101795 | |||
| 2382 | Ga0495684_0158516 | |||
| 2383 | Ga0495593_0260162 | |||
| 2384 | Ga0495602_0000583 | |||
| 2385 | Ga0495602_0029966 | |||
| 2386 | Ga0495602_0054169 | |||
| 2387 | Ga0495602_0104674 | |||
| 2388 | Ga0495602_0268785 | |||
| 2389 | Ga0495602_1176322 | |||
| 2390 | Ga0495614_0182961 | |||
| 2391 | Ga0496100_0407811 | |||
| 2392 | Ga0496101_0043618 | |||
| 2393 | Ga0496102_0015454 | |||
| 2394 | Ga0496102_0679139 | |||
| 2395 | Ga0496104_0027768 | |||
| 2396 | Ga0496105_0036709 | |||
| 2397 | Ga0496105_0201208 | |||
| 2398 | Ga0496106_0072701 | |||
| 2399 | Ga0496106_0401392 | |||
| 2400 | Ga0496106_0933196 | |||
| 2401 | Ga0496107_0235702 | |||
| 2402 | Ga0496108_1166775 | |||
| 2403 | Ga0496109_0334550 | |||
| 2404 | Ga0496110_0078860 | |||
| 2405 | Ga0496112_0137698 | |||
| 2406 | Ga0496112_0221373 | |||
| 2407 | Ga0496112_0296572 | |||
| 2408 | Ga0496114_0000025 | |||
| 2409 | Ga0496114_0002088 | |||
| 2410 | Ga0496114_0004152 | |||
| 2411 | Ga0496114_0054027 | |||
| 2412 | Ga0496114_0083382 | |||
| 2413 | Ga0496114_0167735 | |||
| 2414 | Ga0496115_0001334 | |||
| 2415 | Ga0496115_0117121 | |||
| 2416 | Ga0501036_1515235 | |||
| 2417 | Ga0501042_1097048 | |||
| 2418 | Ga0501048_0349277 | |||
| 2419 | Ga0501048_0509429 | |||
| 2420 | Ga0501067_0125433 | |||
| 2421 | Ga0501073_0392857 | |||
| 2422 | Ga0501075_0471932 | |||
| 2423 | Ga0501075_1328049 | |||
| 2424 | Ga0501079_0623246 | |||
| 2425 | Ga0501081_0188569 | |||
| 2426 | Ga0501083_0022984 | |||
| 2427 | Ga0501263_044046 | |||
| 2428 | nmdc:mga05p37_174997_c1 | |||
| 2429 | nmdc:mga05p37_63741_c1 | |||
| 2430 | nmdc:mga09592_59488_c1 | |||
| 2431 | nmdc:mga0qj67_240696_c1 | |||
| 2432 | nmdc:mga0qj67_412560_c1 | |||
| 2433 | nmdc:mga0qj67_60488_c1 | |||
| 2434 | nmdc:mga06r32_114730_c1 | |||
| 2435 | nmdc:mga06r32_13443_c1 | |||
| 2436 | nmdc:mga06r32_35475_c1 | |||
| 2437 | nmdc:mga06r32_859510_c1 | |||
| 2438 | nmdc:mga08y16_1061544_c1 | |||
| 2439 | nmdc:mga08y16_364576_c1 | |||
| 2440 | nmdc:mga08y16_596887_c1 | |||
| 2441 | nmdc:mga0n895_1160753_c1 | |||
| 2442 | nmdc:mga0n895_1524598_c1 | |||
| 2443 | nmdc:mga0n895_3252_c1 | |||
| 2444 | nmdc:mga0n895_5364_c1 | |||
| 2445 | nmdc:mga0n895_54374_c1 | |||
| 2446 | nmdc:mga0n895_62191_c1 | |||
| 2447 | nmdc:mga0n895_76525_c1 | |||
| 2448 | nmdc:mga0n895_89907_c1 | |||
| 2449 | nmdc:mga0n895_9462_c1 | |||
| 2450 | nmdc:mga0rr50_1017270_c1 | |||
| 2451 | nmdc:mga0rr50_1330148_c1 | |||
| 2452 | nmdc:mga0rr50_16768_c1 | |||
| 2453 | nmdc:mga0rr50_302875_c1 | |||
| 2454 | nmdc:mga0rr50_37228_c1 | |||
| 2455 | nmdc:mga0rr50_374558_c1 | |||
| 2456 | nmdc:mga0rr50_517487_c1 | |||
| 2457 | nmdc:mga08x19_148765_c1 | |||
| 2458 | nmdc:mga08x19_158020_c1 | |||
| 2459 | nmdc:mga08x19_177920_c1 | |||
| 2460 | nmdc:mga08x19_18699_c1 | |||
| 2461 | nmdc:mga08x19_225722_c1 | |||
| 2462 | nmdc:mga08x19_266_c1 | |||
| 2463 | nmdc:mga08x19_48662_c1 | |||
| 2464 | nmdc:mga08x19_577979_c1 | |||
| 2465 | nmdc:mga08x19_99110_c1 | |||
| 2466 | nmdc:mga0a205_123605_c1 | |||
| 2467 | nmdc:mga0a205_173558_c1 | |||
| 2468 | nmdc:mga0a205_2373_c2 | |||
| 2469 | nmdc:mga0a205_3157_c2 | |||
| 2470 | nmdc:mga0a205_44121_c1 | |||
| 2471 | nmdc:mga0a205_485086_c1 | |||
| 2472 | nmdc:mga0a205_6811_c1 | |||
| 2473 | Ga0495601_0214659 | |||
| 2474 | Ga0495601_0401035 | |||
| 2475 | Ga0495601_0713217 | |||
| 2476 | Ga0495595_0704759 | |||
| 2477 | Ga0495619_0006716 | |||
| 2478 | Ga0495619_0082502 | |||
| 2479 | Ga0495619_0207169 | |||
| 2480 | Ga0500651_0188992 | |||
| 2481 | Ga0500599_013484 | |||
| 2482 | Ga0501084_0226190 | |||
| 2483 | Ga0501084_0303411 | |||
| 2484 | Ga0501084_0979560 | |||
| 2485 | Ga0587070_197265 | |||
| 2486 | Ga0587085_032354 | |||
| 2487 | Ga0501082_0401454 | |||
| 2488 | Ga0501082_0851096 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ub9-assembly1.cif.gz_A-2 | structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 | 0.9289 | 21 | 117 |
| 2mlg-assembly1.cif.gz_A | stf76 from the sulfolobus islandicus plasmid-virus pssvx | 0.9091 | 33 | 95 |
| 6wxq-assembly1.cif.gz_A | crystal structure of crispr-associated transcription factor csa3 complexed with ca4 | 0.9074 | 32 | 104 |
| 5hli-assembly1.cif.gz_A | structure of disulfide formed abfr | 0.8986 | 37 | 112 |
| 5hlh-assembly3.cif.gz_F | crystal structure of the overoxidized abfr bound to dna | 0.8969 | 36 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57874_1_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9385 | 30 | 113 | 1.10.10.10 |
| 1ub9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9289 | 21 | 117 | 1.10.10.10 |
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9173 | 30 | 97 | 1.10.10.10 |
| af_Q54FU1_288_364_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9129 | 33 | 95 | 1.10.10.10 |
| 2mlgA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9091 | 33 | 95 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4YCS1-F1-model_v4 | Helix-turn-helix domain-containing protein | 1 | 26 | 112 |
|
| AF-A0A523UZA1-F1-model_v4 | Transcriptional regulator | 0.9966 | 27 | 115 |
|
| AF-A0A1H4BP91-F1-model_v4 | Winged helix DNA-binding domain-containing protein | 0.9964 | 27 | 114 |
GO:0003677
GO:0005737 |
| AF-A0A2E9ZMA3-F1-model_v4 | Transcriptional regulator | 0.9963 | 30 | 120 |
|
| AF-A0A7V3ZWQ7-F1-model_v4 | ArsR family transcriptional regulator | 0.9962 | 27 | 118 |
GO:0003700
|