F492069

General Info

Members Datasets Scaffolds Average Seq Length
1239 928 659 349

Family's Representative Sequence

Representative Sequence 3300006948|Ga0099826_10000102|Ga0099826_1000010218
Length 416
Sequence MPKGGGLAIVISGAISGGTSGKGGSVVNPAAPIHFFEAKLPDFAFVCEGIRAYLSGKQTEVSSMELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSGGRAEIMAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAMGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVMNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQMAIGLMPHDQIMRGIELYGTKVAPLVRKELTGSADPVKATA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875024 Mesorhizobium loti R88b Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
25 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
34 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
35 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2516143018 Ensifer sp. BR816 Isolate Nodule
43 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
44 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
45 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
46 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
47 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
48 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
49 2519899620 Rhizobium sp. Pop5 Isolate Nodule
50 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
51 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
54 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
55 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
56 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
57 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
58 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
61 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
70 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
71 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
72 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
75 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
76 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
77 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
78 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
79 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
80 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
81 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
82 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
83 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
84 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
85 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
86 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
87 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
88 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
89 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
90 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
91 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
92 2643221557 Ensifer sp. Root558 Isolate Unclassified
93 2643221558 Rhizobium sp. Root149 Isolate Unclassified
94 2643221568 Rhizobium sp. Root564 Isolate Unclassified
95 2643221582 Rhizobium sp. Root651 Isolate Unclassified
96 2643221599 Rhizobium sp. Root708 Isolate Unclassified
97 2643221607 Rhizobium sp. Root73 Isolate Unclassified
98 2643221610 Ensifer sp. Root74 Isolate Unclassified
99 2643221618 Ensifer sp. Root231 Isolate Unclassified
100 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
101 2643221626 Ensifer sp. Root31 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
105 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
106 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
107 2643221655 Ensifer sp. Root1252 Isolate Unclassified
108 2643221659 Ensifer sp. Root127 Isolate Unclassified
109 2643221668 Ensifer sp. Root423 Isolate Unclassified
110 2643221675 Ensifer sp. Root1298 Isolate Unclassified
111 2643221680 Ensifer sp. Root1312 Isolate Unclassified
112 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
113 2643221688 Rhizobium sp. Root482 Isolate Unclassified
114 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
115 2643221693 Rhizobium sp. Root491 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221718 Rhizobium sp. Root268 Isolate Unclassified
119 2643221719 Rhizobium sp. Root274 Isolate Unclassified
120 2643221723 Ensifer sp. Root278 Isolate Unclassified
121 2643221726 Ensifer sp. Root954 Isolate Unclassified
122 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
123 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
124 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
125 2718217882 Rhizobium sp. N741 Isolate Nodule
126 2718217927 Rhizobium sp. N324 Isolate Nodule
127 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
128 2718218009 Rhizobium sp. N561 Isolate Nodule
129 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
130 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
131 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
132 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
133 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
134 2718218363 Rhizobium sp. N113 Isolate Nodule
135 2718218365 Rhizobium sp. N731 Isolate Nodule
136 2718218366 Rhizobium sp. N621 Isolate Nodule
137 2718218423 Rhizobium sp. N941 Isolate Nodule
138 2721755514 Rhizobium sp. N6212 Isolate Nodule
139 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
140 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
141 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
142 2721755809 Rhizobium sp. N541 Isolate Nodule
143 2721755810 Rhizobium sp. N871 Isolate Nodule
144 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
145 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
146 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
147 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
148 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
149 2728369365 Rhizobium sp. N1341 Isolate Nodule
150 2728369397 Rhizobium sp. N1314 Isolate Nodule
151 2738541293 Rhizobium sp. GV031 Isolate Unclassified
152 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
153 2738543024 Aminobacter sp. AP02 Isolate Unclassified
154 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
155 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
156 2773857925 Microvirga vignae BR3299 Isolate Unclassified
157 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
158 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
159 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
160 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
161 2791355256 Rhizobium sp. M10 Isolate Nodule
162 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
163 2791355260 Rhizobium sp. L9 Isolate Nodule
164 2791355261 Rhizobium sp. J15 Isolate Nodule
165 2791355262 Rhizobium sp. M1 Isolate Nodule
166 2791355263 Rhizobium chutanense C5 Isolate Nodule
167 2791355264 Rhizobium sp. S9 Isolate Nodule
168 2791355265 Rhizobium sp. H4 Isolate Nodule
169 2791355266 Rhizobium sp. L43 Isolate Nodule
170 2791355267 Rhizobium sp. L18 Isolate Nodule
171 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
172 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
173 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
174 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
175 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
176 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
177 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
178 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
179 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
180 2802429633 Rhizobium anhuiense J3 Isolate Nodule
181 2802429634 Rhizobium anhuiense S10 Isolate Nodule
182 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
183 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
184 2802429637 Rhizobium anhuiense C15 Isolate Nodule
185 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
186 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
187 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
188 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
189 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
190 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
191 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
192 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
193 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
194 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
195 2838048938 Rhizobium pisi 27/80 Isolate Nodule
196 2838061910 Rhizobium phaseoli L15 Isolate Nodule
197 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
198 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
199 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
200 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
201 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
202 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
203 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
204 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
205 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
206 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
207 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
208 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
209 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
210 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
211 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
212 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
213 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
214 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
215 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
216 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
217 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
218 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
219 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
220 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
221 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
222 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
223 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
224 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
225 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
226 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
227 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
228 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
229 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
230 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
231 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
232 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
233 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
234 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
235 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
236 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
237 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
238 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
239 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
240 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
241 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
242 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
243 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
244 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
245 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
246 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
247 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
248 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
249 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
250 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
251 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
252 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
253 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
254 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
255 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
256 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
257 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
258 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
259 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
260 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
261 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
262 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
263 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
264 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
265 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
266 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
267 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
268 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
269 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
270 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
271 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
272 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
273 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
274 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
275 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
276 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
277 2844163670 Ensifer sp. 1H6 Isolate Unclassified
278 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
279 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
280 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
281 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
282 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
283 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
284 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
285 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
286 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
287 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
288 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
289 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
290 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
291 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
292 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
293 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
294 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
295 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
296 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
297 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
298 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
299 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
300 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
301 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
302 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
303 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
304 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
305 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
306 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
307 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
308 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
309 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
310 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
311 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
312 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
313 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
314 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
315 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
316 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
317 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
318 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
319 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
320 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
321 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
322 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
323 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
324 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
325 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
326 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
327 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
328 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
329 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
330 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
331 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
332 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
333 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
334 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
335 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
336 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
337 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
338 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
339 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
340 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
341 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
342 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
343 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
344 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
345 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
346 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
347 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
348 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
349 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
350 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
351 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
352 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
353 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
354 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
355 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
356 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
357 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
358 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
359 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
360 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
361 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
362 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
363 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
364 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
365 2933599457 Rhizobium phaseoli M3 Isolate Nodule
366 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
367 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
368 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
369 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
370 2936381700 Rhizobium chutanense C16 Isolate Unclassified
371 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
372 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
373 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
374 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
375 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
376 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
377 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
378 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
379 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
380 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
381 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
382 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
383 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
384 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
385 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
386 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
387 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
388 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
389 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
390 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
391 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
392 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
393 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
394 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
395 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
396 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
397 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
398 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
399 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
400 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
401 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
402 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
403 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
404 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
405 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
406 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
407 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
408 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
409 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
410 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
411 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
412 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
413 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
414 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
415 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
416 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
417 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
418 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
419 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
420 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
421 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
422 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
423 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
424 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
425 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
426 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
427 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
428 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
429 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
430 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
431 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
432 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
433 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
434 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
435 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
436 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
437 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
438 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
439 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
440 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
441 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
442 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
443 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
444 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
445 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
446 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
447 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
448 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
449 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
450 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
451 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
452 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
453 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
454 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
455 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
456 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
457 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
458 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
459 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
460 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
461 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
462 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
463 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
464 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
465 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
466 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
467 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
468 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
469 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
470 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
471 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
472 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
473 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
474 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
475 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
476 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
477 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
478 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
479 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
480 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
481 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
482 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
483 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
484 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
485 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
486 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
487 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
488 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
489 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
490 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
491 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
492 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
493 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
494 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
495 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
496 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
497 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
498 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
499 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
500 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
501 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
502 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
503 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
504 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
505 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
506 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
507 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
508 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
509 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
510 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
511 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
512 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
513 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
514 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
515 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
516 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
517 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
518 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
519 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
520 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
521 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
522 2996887358 Rhizobium sp. R711 Isolate Nodule
523 2996893221 Rhizobium sp. R635 Isolate Nodule
524 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
525 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
526 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
527 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
528 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
529 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
530 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
531 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
532 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
533 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
534 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
535 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
536 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
537 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
538 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
539 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
540 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
541 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
542 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
543 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
544 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
545 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
546 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
547 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
548 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
549 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
550 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
551 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
552 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
553 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
554 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
555 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
556 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
557 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
558 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
559 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
560 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
561 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
562 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
563 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
564 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
565 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
566 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
567 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
568 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
569 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
570 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
571 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
572 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
573 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
574 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
575 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
576 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
577 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
578 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
579 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
580 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
581 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
582 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
583 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
584 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
585 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
586 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
587 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
588 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
589 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
590 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
591 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
592 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
593 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
594 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
595 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
596 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
597 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
598 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
599 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
600 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
601 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
602 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
603 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
604 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
605 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
606 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
607 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
608 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
609 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
610 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
611 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
612 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
613 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
614 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
615 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
616 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
617 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
618 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
619 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
620 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
621 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
622 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
623 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
624 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
625 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
626 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
627 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
628 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
629 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
630 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
631 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
632 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
633 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
634 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
635 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
636 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
637 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
638 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
639 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
640 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
641 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
642 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
643 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
644 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
645 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
646 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
647 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
648 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
649 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
650 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
651 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
652 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
653 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
660 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
663 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
674 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
675 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
676 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
678 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
679 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
680 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
681 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
682 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
683 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
684 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
685 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
686 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
687 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
688 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
689 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
691 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
692 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
693 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
694 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
695 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
696 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
697 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
698 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
699 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
700 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
701 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
702 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
703 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
704 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
705 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
706 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
707 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
708 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
709 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
710 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
711 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
712 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
713 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
714 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
715 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
716 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
717 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
718 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
719 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
720 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
721 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
722 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
723 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
724 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
725 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
726 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
727 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
728 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
729 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
730 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
731 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
732 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
733 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
734 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
735 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
736 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
737 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
738 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
739 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
740 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
741 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
742 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
743 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
744 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
745 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
746 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
747 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
748 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
749 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
750 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
751 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
752 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
753 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
754 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
755 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
756 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
757 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
758 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
759 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
760 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
761 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
762 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
763 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
764 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
765 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
766 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
767 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
768 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
769 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
770 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
771 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
772 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
773 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
774 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
775 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
776 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
777 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
778 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
779 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
780 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
781 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
782 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
783 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
784 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
785 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
786 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
787 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
788 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
789 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
790 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
791 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
792 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
793 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
794 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
795 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
796 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
797 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
798 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
799 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
800 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
801 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
802 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
803 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
804 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
805 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
806 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
807 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
808 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
809 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
810 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
811 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
812 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
813 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
814 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
815 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
816 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
817 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
818 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
819 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
820 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
821 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
822 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
823 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
824 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
825 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
826 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
827 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
828 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
829 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
830 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
831 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
832 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
833 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
834 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
835 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
836 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
837 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
838 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
839 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
840 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
841 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
842 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
843 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
844 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
845 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
846 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
847 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
848 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
849 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
850 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
851 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
852 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
853 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
854 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
855 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
856 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
857 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
858 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
859 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
860 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
861 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
862 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
863 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
864 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
865 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
866 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
867 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
868 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
869 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
870 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
871 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
872 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
873 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
874 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
875 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
876 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
877 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
878 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
879 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
880 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
881 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
882 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
883 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
884 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
885 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
886 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
887 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
888 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
889 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
890 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
891 8005258706 Rhizobium sp. R693 Isolate Nodule
892 8005275841 Rhizobium sp. N4311 Isolate Nodule
893 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
894 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
895 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
896 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
897 8005321885 Rhizobium sp. R72 Isolate Nodule
898 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
899 8005382845 Rhizobium sp. R634 Isolate Nodule
900 8005395548 Rhizobium sp. R339 Isolate Nodule
901 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
902 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
903 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
904 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
905 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
906 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
907 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
908 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
909 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
910 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
911 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
912 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
913 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
914 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
915 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
916 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
917 8018176218 Rhizobium sp. N122 Isolate Nodule
918 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
919 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
920 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
921 8024501048 Rhizobium sp. H4 Isolate Nodule
922 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
923 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
924 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
925 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
926 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
927 8056382006 Rhizobium croatiense 13T Isolate Nodule
928 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 53.19
Metatranscriptomes 0
Isolates 46.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 15.98
Nodule 35.92
Rhizoplane 1.53
Rhizosphere 31.88
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000277 3300001989 Bacteria 17174
2 JGI24739J22299_10005239 3300001989 Bacteria 4940
3 JGI24737J22298_10000371 3300001990 Bacteria 15252
4 JGI24735J21928_10000001 3300002067 Bacteria 650042
5 JGI25154J39366_1000003 3300002738 Bacteria 397627
6 JGI25158J39367_1000065 3300002739 Bacteria 23421
7 JGI25157J39369_1004789 3300002741 Bacteria 2355
8 JGI25152J39213_1002465 3300002773 Bacteria 7020
9 JGI25152J39213_1009322 3300002773 Bacteria 2341
10 JGI25150J39212_1004958 3300002774 Bacteria 2890
11 JGI25159J45721_1000004 3300002987 Bacteria 215789
12 JGI25159J45721_1000928 3300002987 Bacteria 12764
13 JGI25151J46595_10000146 3300003187 Bacteria 93373
14 JGI25151J46595_10000976 3300003187 Bacteria 21680
15 JGI25151J46595_10003097 3300003187 Bacteria 9370
16 JGI25151J46595_10015560 3300003187 Bacteria 3348
17 JGI25151J46595_10029243 3300003187 Bacteria 2184
18 JGI25153J46596_10000337 3300003215 Bacteria 33514
19 JGI25153J46596_10000698 3300003215 Bacteria 20531
20 JGI25153J46596_10001913 3300003215 Bacteria 12351
21 JGI25153J46596_10006900 3300003215 Bacteria 5670
22 JGI25153J46596_10006915 3300003215 Bacteria 5661
23 JGI25153J46596_10016380 3300003215 Bacteria 2971
24 JGI25153J46596_10017234 3300003215 Unclassified 2854
25 JGI25153J46596_10018304 3300003215 Bacteria 2727
26 rootH1_10027007 3300003316 Bacteria 15971
27 rootH2_10188461 3300003320 Unclassified 3802
28 JGI25160J50197_1000001 3300003354 Bacteria 782301
29 JGI25160J50197_1000021 3300003354 Bacteria 215789
30 JGI25160J50197_1005161 3300003354 Bacteria 5483
31 JGI25160J50197_1006679 3300003354 Unclassified 4637
32 JGI25160J50197_1017667 3300003354 Bacteria 2250
33 JGI25161J50226_1000001 3300003374 Bacteria 655036
34 JGI25161J50226_1000370 3300003374 Bacteria 22840
35 JGI25161J50226_1000458 3300003374 Bacteria 18817
36 Ga0055526_1002521 3300003771 Bacteria 12312
37 Ga0055526_1002639 3300003771 Bacteria 11980
38 Ga0055526_1005973 3300003771 Bacteria 6774
39 Ga0055526_1007839 3300003771 Bacteria 5461
40 Ga0055526_1017995 3300003771 Bacteria 2663
41 Ga0055524_1000572 3300003775 Bacteria 27327
42 Ga0055524_1003096 3300003775 Bacteria 8211
43 Ga0055524_1004469 3300003775 Bacteria 6456
44 Ga0055524_1006818 3300003775 Bacteria 4926
45 Ga0055524_1008955 3300003775 Bacteria 4115
46 Ga0055524_1011136 3300003775 Bacteria 3535
47 Ga0055536_1003722 3300003781 Bacteria 8086
48 Ga0055536_1004179 3300003781 Bacteria 7472
49 Ga0055528_1000158 3300003790 Bacteria 56769
50 Ga0055528_1000180 3300003790 Bacteria 53597
51 Ga0055528_1001038 3300003790 Bacteria 18353
52 Ga0055528_1001879 3300003790 Bacteria 11962
53 Ga0055528_1002874 3300003790 Bacteria 8966
54 Ga0055528_1008297 3300003790 Bacteria 4476
55 Ga0055528_1011400 3300003790 Bacteria 3535
56 Ga0055540_1000372 3300003792 Bacteria 37511
57 Ga0055540_1001786 3300003792 Bacteria 12225
58 Ga0055540_1004137 3300003792 Bacteria 6705
59 Ga0055540_1008283 3300003792 Bacteria 3763
60 Ga0055531_10002645 3300003794 Bacteria 11834
61 Ga0055531_10029590 3300003794 Bacteria 1862
62 Ga0058692_1000498 3300003856 Bacteria 17446
63 Ga0058692_1001790 3300003856 Bacteria 7598
64 Ga0055543_1000060 3300004625 Bacteria 98330
65 Ga0055543_1000102 3300004625 Bacteria 73861
66 Ga0055543_1000216 3300004625 Bacteria 46311
67 Ga0055543_1002223 3300004625 Bacteria 6614
68 Ga0065165_1000008 3300005262 Bacteria 334429
69 Ga0065165_1000019 3300005262 Bacteria 271815
70 Ga0065165_1000033 3300005262 Bacteria 215827
71 Ga0065165_1006399 3300005262 Bacteria 6192
72 Ga0065165_1019094 3300005262 Bacteria 2460
73 Ga0065165_1037365 3300005262 Bacteria 1472
74 Ga0065714_10077644 3300005288 Bacteria 2660
75 Ga0070658_10000398 3300005327 Bacteria 37864
76 Ga0070676_10000458 3300005328 Bacteria 19490
77 Ga0068869_100058510 3300005334 Bacteria 2818
78 Ga0070666_10000272 3300005335 Bacteria 34340
79 Ga0070680_100013171 3300005336 Bacteria 6438
80 Ga0068868_100000493 3300005338 Bacteria 26280
81 Ga0068868_100013963 3300005338 Bacteria 5908
82 Ga0068868_100094595 3300005338 Bacteria 2411
83 Ga0070668_100000154 3300005347 Bacteria 43788
84 Ga0070668_100158490 3300005347 Bacteria 1835
85 Ga0070669_100091562 3300005353 Bacteria 2281
86 Ga0070673_100006253 3300005364 Bacteria 7723
87 Ga0070667_100001281 3300005367 Bacteria 22751
88 Ga0070667_100005388 3300005367 Bacteria 10686
89 Ga0070662_100023334 3300005457 Bacteria 4248
90 Ga0070681_10096322 3300005458 Bacteria 2907
91 Ga0070681_10173837 3300005458 Bacteria 2075
92 Ga0070685_10009406 3300005466 Bacteria 5049
93 Ga0070707_100087505 3300005468 Bacteria 3013
94 Ga0070698_100000606 3300005471 Bacteria 38432
95 Ga0070699_100043988 3300005518 Bacteria 3865
96 Ga0070679_100025511 3300005530 Bacteria 5801
97 Ga0070697_100262384 3300005536 Bacteria 1479
98 Ga0068853_100003715 3300005539 Bacteria 11719
99 Ga0068853_100294490 3300005539 Bacteria 1499
100 Ga0070672_100000048 3300005543 Bacteria 52547
101 Ga0070686_100000679 3300005544 Bacteria 19745
102 Ga0070665_100001032 3300005548 Bacteria 34883
103 Ga0070665_100077525 3300005548 Bacteria 3330
104 Ga0068855_100016945 3300005563 Bacteria 8763
105 Ga0070664_100005066 3300005564 Bacteria 10568
106 Ga0068857_100052928 3300005577 Bacteria 3601
107 Ga0068852_100058588 3300005616 Unclassified 3337
108 Ga0068859_100001403 3300005617 Bacteria 24458
109 Ga0068864_100000537 3300005618 Bacteria 32549
110 Ga0068866_10086467 3300005718 Bacteria 1697
111 Ga0068851_10004984 3300005834 Bacteria 6014
112 Ga0068863_100000750 3300005841 Bacteria 32439
113 Ga0068863_100005596 3300005841 Bacteria 12347
114 Ga0068858_100001076 3300005842 Bacteria 28272
115 Ga0068860_100010234 3300005843 Bacteria 9282
116 Ga0068860_100062626 3300005843 Bacteria 3534
117 Ga0075365_10002434 3300006038 Bacteria 9130
118 Ga0075365_10037564 3300006038 Bacteria 3145
119 Ga0075365_10109818 3300006038 Bacteria 1895
120 Ga0075368_10047152 3300006042 Bacteria 1705
121 Ga0075363_100061774 3300006048 Bacteria 2020
122 Ga0075364_10011050 3300006051 Bacteria 5478
123 Ga0075362_10001162 3300006177 Bacteria 8232
124 Ga0075367_10003454 3300006178 Bacteria 7538
125 Ga0075367_10007596 3300006178 Bacteria 5565
126 Ga0075367_10023563 3300006178 Bacteria 3465
127 Ga0075366_10001492 3300006195 Bacteria 11684
128 Ga0097621_100002050 3300006237 Bacteria 13791
129 Ga0075370_10000198 3300006353 Bacteria 21215
130 Ga0075370_10014170 3300006353 Bacteria 4247
131 Ga0068871_100003589 3300006358 Bacteria 10659
132 Ga0068865_100096726 3300006881 Bacteria 2153
133 Ga0097620_100001403 3300006931 Bacteria 24458
134 Ga0079104_1000015 3300006946 Bacteria 321803
135 Ga0079104_1008483 3300006946 Bacteria 3590
136 Ga0099826_10000102 3300006948 Bacteria 40381
137 Ga0099826_10028569 3300006948 Bacteria 4075
138 Ga0105251_10039881 3300009011 Bacteria 2291
139 Ga0105240_10097464 3300009093 Unclassified 3583
140 Ga0105243_10013713 3300009148 Bacteria 6131
141 Ga0105243_10017730 3300009148 Bacteria 5385
142 Ga0105248_10016027 3300009177 Bacteria 8248
143 Ga0105238_10104207 3300009551 Bacteria 2818
144 Ga0105238_10452763 3300009551 Bacteria 1280
145 Ga0123341_1049145 3300009765 Bacteria 2434
146 Ga0123342_1006302 3300009766 Bacteria 16546
147 Ga0123342_1033809 3300009766 Bacteria 2293
148 Ga0105239_10042603 3300010375 Unclassified 4974
149 Ga0105239_10054482 3300010375 Bacteria 4387
150 Ga0105246_10061054 3300011119 Bacteria 2621
151 Ga0105246_10150319 3300011119 Bacteria 1762
152 Ga0157373_10095382 3300013100 Bacteria 2094
153 Ga0157373_10265606 3300013100 Bacteria 1215
154 Ga0157371_10000017 3300013102 Bacteria 320830
155 Ga0157371_10008491 3300013102 Bacteria 8175
156 Ga0157371_10201799 3300013102 Bacteria 1426
157 Ga0157371_10275051 3300013102 Unclassified 1216
158 Ga0157370_10001031 3300013104 Bacteria 35059
159 Ga0157370_10002249 3300013104 Bacteria 23463
160 Ga0157369_10020112 3300013105 Bacteria 7466
161 Ga0157369_10099100 3300013105 Bacteria 3107
162 Ga0157369_10478317 3300013105 Bacteria 1289
163 Ga0171463_1007 3300013249 Bacteria 301198
164 Ga0157374_10000314 3300013296 Bacteria 44972
165 Ga0157374_10098396 3300013296 Bacteria 2801
166 Ga0157378_10029584 3300013297 Bacteria 4837
167 Ga0157378_10084572 3300013297 Bacteria 2873
168 Ga0163162_10000231 3300013306 Bacteria 51138
169 Ga0163162_10002781 3300013306 Bacteria 16627
170 Ga0163162_10006648 3300013306 Bacteria 11210
171 Ga0157372_10002540 3300013307 Bacteria 19795
172 Ga0157372_10043474 3300013307 Bacteria 4974
173 Ga0157375_10000272 3300013308 Bacteria 46932
174 Ga0163163_10000347 3300014325 Bacteria 44548
175 Ga0163163_10093145 3300014325 Bacteria 3029
176 Ga0157380_10508957 3300014326 Bacteria 1171
177 Ga0182008_10052667 3300014497 Bacteria 2016
178 Ga0157379_10000120 3300014968 Bacteria 54605
179 Ga0157376_10000271 3300014969 Bacteria 35219
180 Ga0157376_10016605 3300014969 Bacteria 5593
181 Ga0157376_10028647 3300014969 Unclassified 4429
182 Ga0157376_10286613 3300014969 Unclassified 1553
183 Ga0182005_1000248 3300015265 Bacteria 34381
184 Ga0183363_1098 3300015690 Bacteria 24674
185 Ga0214544_1000110 3300021320 Bacteria 113143
186 Ga0214542_1000268 3300021321 Bacteria 87082
187 Ga0214542_1017541 3300021321 Bacteria 6416
188 Ga0214543_1000022 3300021327 Bacteria 241930
189 Ga0214543_1000219 3300021327 Bacteria 87102
190 Ga0228711_1000911 3300022739 Bacteria 40698
191 Ga0228710_1001018 3300022740 Bacteria 40304
192 Ga0209436_100081 3300025208 Bacteria 48215
193 Ga0209436_107254 3300025208 Unclassified 2338
194 Ga0209566_100115 3300025225 Bacteria 107765
195 Ga0209563_102163 3300025230 Bacteria 4590
196 Ga0207425_1000046 3300025245 Bacteria 189433
197 Ga0207425_1000884 3300025245 Bacteria 14567
198 Ga0207425_1004836 3300025245 Bacteria 3953
199 Ga0209646_1000004 3300025246 Bacteria 786587
200 Ga0209026_1000495 3300025250 Bacteria 28866
201 Ga0209129_1000171 3300025258 Bacteria 95724
202 Ga0209129_1000324 3300025258 Bacteria 42226
203 Ga0209129_1001769 3300025258 Bacteria 11548
204 Ga0209129_1001856 3300025258 Bacteria 11178
205 Ga0209129_1008779 3300025258 Bacteria 2759
206 Ga0209129_1008780 3300025258 Bacteria 2759
207 Ga0209129_1009902 3300025258 Bacteria 2444
208 Ga0209129_1012601 3300025258 Bacteria 1927
209 Ga0209673_1000010 3300025273 Bacteria 596656
210 Ga0209673_1000025 3300025273 Bacteria 404572
211 Ga0209673_1000042 3300025273 Bacteria 300704
212 Ga0209673_1000112 3300025273 Bacteria 179676
213 Ga0209673_1000637 3300025273 Bacteria 53013
214 Ga0209673_1001842 3300025273 Bacteria 17316
215 Ga0209673_1003328 3300025273 Bacteria 9614
216 Ga0209673_1005399 3300025273 Bacteria 6441
217 Ga0209673_1013806 3300025273 Bacteria 3167
218 Ga0209673_1031347 3300025273 Unclassified 1656
219 Ga0209130_1000003 3300025284 Bacteria 677988
220 Ga0209130_1000017 3300025284 Bacteria 388431
221 Ga0209130_1000023 3300025284 Bacteria 359355
222 Ga0209675_1016053 3300025291 Bacteria 2197
223 Ga0209676_1002445 3300025292 Bacteria 13179
224 Ga0209676_1007475 3300025292 Bacteria 5116
225 Ga0209025_1000091 3300025294 Bacteria 250401
226 Ga0209025_1000137 3300025294 Bacteria 190136
227 Ga0209025_1000154 3300025294 Bacteria 170288
228 Ga0209025_1000161 3300025294 Bacteria 166506
229 Ga0209025_1002028 3300025294 Bacteria 23124
230 Ga0209025_1009293 3300025294 Bacteria 6882
231 Ga0209025_1010302 3300025294 Bacteria 6351
232 Ga0209564_1000013 3300025295 Bacteria 775755
233 Ga0209564_1000265 3300025295 Bacteria 110606
234 Ga0209564_1000672 3300025295 Bacteria 50497
235 Ga0209564_1000840 3300025295 Bacteria 41373
236 Ga0209564_1001534 3300025295 Bacteria 22927
237 Ga0209564_1003122 3300025295 Bacteria 11698
238 Ga0209564_1004207 3300025295 Bacteria 8973
239 Ga0209564_1004488 3300025295 Bacteria 8515
240 Ga0209564_1011760 3300025295 Bacteria 3887
241 Ga0209758_1000058 3300025297 Bacteria 331603
242 Ga0209758_1000123 3300025297 Bacteria 190136
243 Ga0209758_1001003 3300025297 Bacteria 37543
244 Ga0209758_1001710 3300025297 Bacteria 24605
245 Ga0209758_1002357 3300025297 Bacteria 19473
246 Ga0209758_1005872 3300025297 Bacteria 9161
247 Ga0209758_1006337 3300025297 Bacteria 8573
248 Ga0209758_1013729 3300025297 Bacteria 4386
249 Ga0209758_1015542 3300025297 Bacteria 3929
250 Ga0209758_1015814 3300025297 Bacteria 3879
251 Ga0209758_1017385 3300025297 Bacteria 3585
252 Ga0209758_1059928 3300025297 Bacteria 1263
253 Ga0209050_1000308 3300025298 Bacteria 99516
254 Ga0209050_1003968 3300025298 Bacteria 10436
255 Ga0209256_1000153 3300025299 Bacteria 144736
256 Ga0209256_1000704 3300025299 Bacteria 44504
257 Ga0209256_1000914 3300025299 Bacteria 36121
258 Ga0209256_1001905 3300025299 Bacteria 19079
259 Ga0209256_1002433 3300025299 Bacteria 15221
260 Ga0209256_1002591 3300025299 Bacteria 14395
261 Ga0209256_1003390 3300025299 Bacteria 11244
262 Ga0209256_1011848 3300025299 Bacteria 3426
263 Ga0207426_1000006 3300025302 Bacteria 1025969
264 Ga0207426_1000008 3300025302 Bacteria 848730
265 Ga0207426_1000011 3300025302 Bacteria 791203
266 Ga0207426_1000344 3300025302 Bacteria 85912
267 Ga0207426_1000442 3300025302 Bacteria 66642
268 Ga0207426_1000645 3300025302 Bacteria 43355
269 Ga0207426_1000727 3300025302 Bacteria 37813
270 Ga0207426_1000934 3300025302 Bacteria 29145
271 Ga0209051_1000462 3300025303 Bacteria 53349
272 Ga0209051_1000900 3300025303 Bacteria 29687
273 Ga0209051_1001776 3300025303 Bacteria 17118
274 Ga0209051_1001806 3300025303 Bacteria 16957
275 Ga0209051_1024469 3300025303 Bacteria 2482
276 Ga0209257_1001059 3300025304 Bacteria 36382
277 Ga0209257_1002539 3300025304 Bacteria 17877
278 Ga0209257_1005864 3300025304 Bacteria 8305
279 Ga0209257_1015317 3300025304 Bacteria 3204
280 Ga0207656_10001075 3300025321 Bacteria 8932
281 Ga0207680_10000165 3300025903 Bacteria 32266
282 Ga0207699_10146827 3300025906 Bacteria 1556
283 Ga0207645_10027863 3300025907 Bacteria 3648
284 Ga0207705_10000725 3300025909 Bacteria 27178
285 Ga0207684_10031226 3300025910 Bacteria 4532
286 Ga0207707_10000688 3300025912 Bacteria 33606
287 Ga0207660_10086378 3300025917 Bacteria 2316
288 Ga0207652_10017278 3300025921 Bacteria 5902
289 Ga0207646_10001966 3300025922 Bacteria 24656
290 Ga0207650_10051538 3300025925 Bacteria 3046
291 Ga0207706_10038695 3300025933 Bacteria 4231
292 Ga0207709_10038454 3300025935 Bacteria 2850
293 Ga0207704_10002738 3300025938 Bacteria 7949
294 Ga0207691_10000245 3300025940 Bacteria 53608
295 Ga0207689_10058189 3300025942 Bacteria 3179
296 Ga0207667_10059502 3300025949 Bacteria 4001
297 Ga0207651_10071465 3300025960 Bacteria 2460
298 Ga0207668_10000184 3300025972 Bacteria 42493
299 Ga0207668_10157451 3300025972 Bacteria 1766
300 Ga0207658_10000452 3300025986 Bacteria 38428
301 Ga0207677_10000876 3300026023 Bacteria 17026
302 Ga0207677_10156607 3300026023 Bacteria 1765
303 Ga0207703_10000388 3300026035 Bacteria 47169
304 Ga0207639_10007920 3300026041 Bacteria 7260
305 Ga0207678_10097616 3300026067 Bacteria 2511
306 Ga0207641_10001293 3300026088 Bacteria 24895
307 Ga0207648_10003392 3300026089 Bacteria 16725
308 Ga0207676_10001932 3300026095 Bacteria 15128
309 Ga0207674_10057508 3300026116 Bacteria 3942
310 Ga0207675_100140814 3300026118 Bacteria 2291
311 Ga0207698_10062463 3300026142 Unclassified 2909
312 Ga0209281_1000034 3300027111 Bacteria 382562
313 Ga0209281_1000190 3300027111 Bacteria 140658
314 Ga0209281_1000314 3300027111 Bacteria 86424
315 Ga0209371_1000022 3300027312 Bacteria 536342
316 Ga0209371_1002629 3300027312 Bacteria 9830
317 Ga0209999_1002293 3300027543 Bacteria 3367
318 Ga0209282_1000068 3300027666 Bacteria 85817
319 Ga0209282_1000233 3300027666 Bacteria 28668
320 Ga0209282_1098979 3300027666 Bacteria 1506
321 Ga0209966_1000731 3300027695 Bacteria 6893
322 Ga0209998_10000251 3300027717 Bacteria 17585
323 Ga0268266_10000928 3300028379 Bacteria 37520
324 Ga0268266_10055968 3300028379 Bacteria 3392
325 Ga0268264_10024669 3300028381 Bacteria 4911
326 Ga0268264_10049337 3300028381 Bacteria 3502
327 Ga0307515_10000017 3300028794 Bacteria 550465
328 Ga0307515_10000285 3300028794 Bacteria 124535
329 Ga0307515_10017812 3300028794 Bacteria 12912
330 Ga0265338_10234998 3300028800 Bacteria 1361
331 Ga0268256_1000019 3300030500 Bacteria 587949
332 Ga0268256_1004182 3300030500 Bacteria 6101
333 Ga0307512_10006312 3300030522 Bacteria 12035
334 Ga0307408_100065712 3300031548 Bacteria 2661
335 Ga0307408_100086047 3300031548 Bacteria 2362
336 Ga0307408_100197882 3300031548 Bacteria 1624
337 Ga0307408_100271501 3300031548 Bacteria 1408
338 Ga0307516_10238587 3300031730 Bacteria 1518
339 Ga0307405_10002098 3300031731 Bacteria 8696
340 Ga0307413_10020785 3300031824 Bacteria 3500
341 Ga0307413_10078842 3300031824 Bacteria 2103
342 Ga0307410_10274153 3300031852 Bacteria 1321
343 Ga0307407_10084226 3300031903 Bacteria 1931
344 Ga0307412_10081170 3300031911 Bacteria 2242
345 Ga0307412_10113041 3300031911 Bacteria 1942
346 Ga0315914_1000937 3300031967 Bacteria 41175
347 Ga0307409_100056996 3300031995 Bacteria 3024
348 Ga0307409_100080716 3300031995 Bacteria 2626
349 Ga0307409_100098443 3300031995 Bacteria 2419
350 Ga0307409_100179030 3300031995 Bacteria 1875
351 Ga0307409_100195568 3300031995 Bacteria 1804
352 Ga0307409_100206688 3300031995 Bacteria 1761
353 Ga0307416_100068230 3300032002 Bacteria 2937
354 Ga0307416_100105576 3300032002 Bacteria 2466
355 Ga0307416_100109528 3300032002 Bacteria 2429
356 Ga0307416_100206252 3300032002 Bacteria 1870
357 Ga0307416_100349632 3300032002 Bacteria 1495
358 Ga0307414_10020828 3300032004 Bacteria 4096
359 Ga0307414_10329729 3300032004 Bacteria 1302
360 Ga0307411_10027659 3300032005 Bacteria 3435
361 Ga0307411_10038005 3300032005 Bacteria 3032
362 Ga0315913_1000094 3300033430 Bacteria 51134
363 Ga0315915_1000007 3300033464 Bacteria 319225
364 Ga0373926_0041892 3300035083 Bacteria 1637
365 Ga0373944_0015510 3300035089 Bacteria 2139
366 Ga0373945_0041233 3300035116 Bacteria 1668
367 Ga0373943_0000121 3300035170 Bacteria 29176
368 Ga0373935_0046820 3300035692 Bacteria 2733
369 Ga0373935_0174324 3300035692 Bacteria 1473
370 Ga0373927_0000191 3300035695 Bacteria 48913
371 Ga0373927_0035521 3300035695 Bacteria 3241
372 Ga0373937_0058126 3300036401 Bacteria 3553
373 Ga0373937_0115077 3300036401 Bacteria 2504
374 Ga0373925_0000937 3300037068 Bacteria 26571
375 Ga0373925_0003720 3300037068 Bacteria 11711
376 Ga0395905_0064353 3300037471 Bacteria 3431
377 Ga0395901_0200479 3300038443 Bacteria 2092
378 Ga0439436_0006315 3300041404 Bacteria 3641
379 Ga0439439_0023435 3300041406 Bacteria 1546
380 Ga0439465_0002280 3300041413 Bacteria 6303
381 Ga0439465_0003936 3300041413 Bacteria 4844
382 Ga0451835_0555271 3300041492 Bacteria 2554
383 Ga0451839_1437888 3300041496 Bacteria 1882
384 Ga0451841_0096366 3300041498 Bacteria 2409
385 Ga0451845_0328363 3300041501 Bacteria 4581
386 Ga0451845_0847798 3300041501 Bacteria 1737
387 Ga0451847_0116577 3300041503 Bacteria 3669
388 Ga0451847_0892452 3300041503 Bacteria 3755
389 Ga0451851_1182826 3300041507 Bacteria 1963
390 Ga0451855_1291386 3300041511 Bacteria 1218
391 Ga0451853_0687444 3300041512 Bacteria 8213
392 Ga0439431_0000193 3300041997 Bacteria 11897
393 Ga0439449_0052275 3300042007 Bacteria 1511
394 Ga0439446_0030897 3300042156 Bacteria 1549
395 Ga0450909_005545 3300042185 Bacteria 1815
396 Ga0466972_0025855 3300044658 Bacteria 2908
397 Ga0466965_0018260 3300044683 Bacteria 3360
398 Ga0466961_0005611 3300044693 Bacteria 7929
399 Ga0466971_0000268 3300044719 Bacteria 19970
400 Ga0466968_0024899 3300044735 Bacteria 2449
401 Ga0466957_0001675 3300044842 Bacteria 11646
402 Ga0466960_0044086 3300044901 Bacteria 2125
403 Ga0466959_0001701 3300045049 Bacteria 13668
404 Ga0466958_0002672 3300045836 Bacteria 9025
405 Ga0466967_0001415 3300045976 Bacteria 13886
406 Ga0466967_0087284 3300045976 Bacteria 2828
407 Ga0495603_0023346 3300046455 Bacteria 3744
408 Ga0495629_0001138 3300046459 Bacteria 20986
409 Ga0495629_0213185 3300046459 Bacteria 1333
410 Ga0495638_0000790 3300046460 Bacteria 33426
411 Ga0495638_0006177 3300046460 Bacteria 8748
412 Ga0495638_0011748 3300046460 Bacteria 6028
413 Ga0495638_0076128 3300046460 Bacteria 2044
414 Ga0495638_0170738 3300046460 Bacteria 1248
415 Ga0495641_0001166 3300046461 Bacteria 22610
416 Ga0495651_0257146 3300046462 Bacteria 1190
417 Ga0495653_0024287 3300046463 Bacteria 4887
418 Ga0495650_0042525 3300046471 Bacteria 1934
419 Ga0495580_0056954 3300046472 Unclassified 2752
420 Ga0495582_0000476 3300046473 Bacteria 21966
421 Ga0495582_0087453 3300046473 Bacteria 1735
422 Ga0495605_0000994 3300046474 Bacteria 19214
423 Ga0495605_0037505 3300046474 Bacteria 2437
424 Ga0495639_0015678 3300046475 Bacteria 3286
425 Ga0495662_0004536 3300046476 Bacteria 6964
426 Ga0495662_0032939 3300046476 Bacteria 2503
427 Ga0495585_0000158 3300046492 Bacteria 72351
428 Ga0495585_0003595 3300046492 Bacteria 10396
429 Ga0495585_0012991 3300046492 Bacteria 4889
430 Ga0495594_0064001 3300046499 Bacteria 2038
431 Ga0495594_0115828 3300046499 Bacteria 1513
432 Ga0495607_0060841 3300046501 Bacteria 2148
433 Ga0495607_0132613 3300046501 Bacteria 1294
434 Ga0495583_0008220 3300046506 Bacteria 6402
435 Ga0495583_0009072 3300046506 Bacteria 5991
436 Ga0495606_0000241 3300046507 Bacteria 96663
437 Ga0495606_0019565 3300046507 Bacteria 5030
438 Ga0495606_0027184 3300046507 Bacteria 4062
439 Ga0495606_0044000 3300046507 Bacteria 2972
440 Ga0495606_0059419 3300046507 Bacteria 2452
441 Ga0495608_0101256 3300046511 Bacteria 1857
442 Ga0495610_0001190 3300046512 Bacteria 23538
443 Ga0495610_0001917 3300046512 Bacteria 17945
444 Ga0495610_0020299 3300046512 Bacteria 3691
445 Ga0495616_0006637 3300046513 Bacteria 6990
446 Ga0495618_0054244 3300046514 Bacteria 2536
447 Ga0495630_0028517 3300046517 Bacteria 4147
448 Ga0495630_0217797 3300046517 Bacteria 1457
449 Ga0495630_0314493 3300046517 Bacteria 1197
450 Ga0495631_0000751 3300046518 Bacteria 20776
451 Ga0495632_0024689 3300046519 Bacteria 3189
452 Ga0495643_0021519 3300046522 Bacteria 3698
453 Ga0495643_0055688 3300046522 Bacteria 2113
454 Ga0495648_0005978 3300046524 Bacteria 10002
455 Ga0495648_0065343 3300046524 Bacteria 2139
456 Ga0495666_0001680 3300046526 Bacteria 10925
457 Ga0495652_0186522 3300046529 Bacteria 1587
458 Ga0495654_0018394 3300046530 Bacteria 3663
459 Ga0495640_0016563 3300046533 Bacteria 5511
460 Ga0495597_0006901 3300046542 Bacteria 5827
461 Ga0495622_0002319 3300046557 Bacteria 9264
462 Ga0495633_0004196 3300046558 Bacteria 9241
463 Ga0495667_0060754 3300046559 Bacteria 2478
464 Ga0495667_0138210 3300046559 Bacteria 1570
465 Ga0495668_0003152 3300046616 Bacteria 12722
466 Ga0495634_0010271 3300046642 Bacteria 6860
467 Ga0495611_0000756 3300046648 Bacteria 18200
468 Ga0495611_0092837 3300046648 Bacteria 1396
469 Ga0495625_0000003 3300046660 Bacteria 686847
470 Ga0495625_0001467 3300046660 Bacteria 28584
471 Ga0495625_0050481 3300046660 Bacteria 2985
472 Ga0495625_0054729 3300046660 Bacteria 2849
473 Ga0495625_0074150 3300046660 Bacteria 2384
474 Ga0495625_0176073 3300046660 Bacteria 1425
475 Ga0495635_0134033 3300046663 Bacteria 1688
476 Ga0495588_0063031 3300046674 Bacteria 1922
477 Ga0495588_0119993 3300046674 Bacteria 1386
478 Ga0495599_0101414 3300046678 Bacteria 1794
479 Ga0495623_0182370 3300046679 Unclassified 1219
480 Ga0495646_0104955 3300046680 Bacteria 1615
481 Ga0495647_0041919 3300046681 Bacteria 1746
482 Ga0495658_0047651 3300046683 Bacteria 2414
483 Ga0495658_0052166 3300046683 Bacteria 2318
484 Ga0495613_0000618 3300046689 Bacteria 28357
485 Ga0495670_0020764 3300046691 Bacteria 3239
486 Ga0495649_0000002 3300046694 Bacteria 1093458
487 Ga0495600_0068475 3300046809 Bacteria 2319
488 Ga0495600_0082151 3300046809 Bacteria 2102
489 Ga0495660_0016507 3300046810 Bacteria 4257
490 Ga0495660_0135315 3300046810 Bacteria 1232
491 Ga0495581_0000478 3300047315 Bacteria 20395
492 Ga0495604_0006302 3300047317 Bacteria 9415
493 Ga0495604_0130352 3300047317 Bacteria 1808
494 Ga0495674_0053175 3300047319 Bacteria 3561
495 Ga0495674_0295006 3300047319 Bacteria 1325
496 Ga0495676_0001540 3300047321 Bacteria 19962
497 Ga0495680_0039413 3300047322 Bacteria 3770
498 Ga0495687_021450 3300047443 Bacteria 3123
499 Ga0495684_0006886 3300047471 Bacteria 8827
500 Ga0495684_0038552 3300047471 Bacteria 3663
501 Ga0495686_0000011 3300047472 Bacteria 514750
502 Ga0495686_0000267 3300047472 Bacteria 93355
503 Ga0495686_0031014 3300047472 Bacteria 3469
504 Ga0495593_0004413 3300047673 Bacteria 8359
505 Ga0495602_0355112 3300048088 Bacteria 1057
506 Ga0495614_0006088 3300048089 Bacteria 5424
507 Ga0496104_0124386 3300048907 Bacteria 2476
508 Ga0496105_0106729 3300048908 Bacteria 2312
509 Ga0496106_0002934 3300048909 Bacteria 12695
510 Ga0496106_0192332 3300048909 Bacteria 1623
511 Ga0496107_0127580 3300048910 Bacteria 1877
512 Ga0496108_0064883 3300048911 Bacteria 3077
513 Ga0496109_0154338 3300048912 Bacteria 2150
514 Ga0496111_0124082 3300048914 Bacteria 1908
515 Ga0496112_0116753 3300048915 Bacteria 2639
516 Ga0496113_0284132 3300048916 Bacteria 1323
517 Ga0496114_0144375 3300048917 Bacteria 2063
518 Ga0496115_0084110 3300048918 Bacteria 2594
519 Ga0496116_0000105 3300048919 Bacteria 192704
520 Ga0496116_0007158 3300048919 Bacteria 9973
521 Ga0496116_0008210 3300048919 Bacteria 9101
522 Ga0496116_0023268 3300048919 Bacteria 4618
523 Ga0496117_0000002 3300048920 Bacteria 2483758
524 Ga0496117_0002241 3300048920 Bacteria 24957
525 Ga0496117_0026624 3300048920 Bacteria 4522
526 Ga0496117_0070697 3300048920 Bacteria 2343
527 Ga0496118_0000566 3300048921 Bacteria 61208
528 Ga0496118_0011165 3300048921 Bacteria 8797
529 Ga0496119_0016503 3300048922 Bacteria 5616
530 Ga0496120_0000309 3300048923 Bacteria 81375
531 Ga0496120_0002673 3300048923 Bacteria 17544
532 Ga0496121_0000003 3300048924 Bacteria 1191431
533 Ga0496121_0000007 3300048924 Bacteria 942516
534 Ga0496121_0003530 3300048924 Bacteria 22195
535 Ga0496121_0011327 3300048924 Bacteria 9924
536 Ga0496121_0015733 3300048924 Bacteria 7885
537 Ga0496121_0018854 3300048924 Bacteria 6925
538 Ga0496121_0019001 3300048924 Bacteria 6894
539 Ga0496121_0023979 3300048924 Bacteria 5850
540 Ga0496121_0026584 3300048924 Bacteria 5446
541 Ga0496121_0042752 3300048924 Bacteria 3936
542 Ga0496121_0165280 3300048924 Bacteria 1614
543 Ga0496122_0000004 3300048925 Bacteria 645283
544 Ga0496122_0000414 3300048925 Bacteria 90664
545 Ga0496122_0000462 3300048925 Bacteria 84546
546 Ga0496122_0028634 3300048925 Bacteria 4720
547 Ga0496122_0050450 3300048925 Bacteria 3173
548 Ga0496122_0051771 3300048925 Bacteria 3116
549 Ga0496122_0173927 3300048925 Bacteria 1293
550 Ga0496123_0000007 3300048926 Bacteria 645283
551 Ga0496123_0000048 3300048926 Bacteria 244152
552 Ga0496123_0000147 3300048926 Bacteria 143834
553 Ga0496123_0023196 3300048926 Bacteria 4756
554 Ga0496123_0120031 3300048926 Bacteria 1481
555 Ga0496124_0000067 3300048927 Bacteria 222576
556 Ga0496124_0000348 3300048927 Bacteria 84728
557 Ga0496124_0003742 3300048927 Bacteria 18334
558 Ga0496124_0023679 3300048927 Bacteria 5600
559 Ga0496124_0033203 3300048927 Bacteria 4542
560 Ga0496124_0041410 3300048927 Bacteria 3974
561 Ga0496124_0042790 3300048927 Bacteria 3897
562 Ga0496124_0052030 3300048927 Bacteria 3481
563 Ga0496124_0068340 3300048927 Bacteria 2953
564 Ga0496125_0001144 3300048928 Bacteria 40287
565 Ga0496125_0001465 3300048928 Bacteria 34178
566 Ga0496125_0015823 3300048928 Bacteria 7269
567 Ga0496125_0028117 3300048928 Bacteria 5084
568 Ga0496126_0000188 3300048929 Bacteria 139625
569 Ga0496126_0000879 3300048929 Bacteria 52860
570 Ga0496126_0045881 3300048929 Bacteria 4013
571 Ga0496126_0069879 3300048929 Bacteria 3130
572 Ga0496126_0136493 3300048929 Bacteria 2115
573 Ga0496126_0151881 3300048929 Bacteria 1984
574 Ga0496126_0199317 3300048929 Bacteria 1691
575 Ga0496126_0292526 3300048929 Bacteria 1346
576 Ga0495678_020259 3300049459 Bacteria 2950
577 Ga0501031_0028878 3300049568 Bacteria 3615
578 Ga0501032_0007875 3300049569 Bacteria 7761
579 Ga0501032_0127677 3300049569 Bacteria 1679
580 Ga0501033_0001531 3300049570 Bacteria 20426
581 Ga0501033_0065411 3300049570 Bacteria 2675
582 Ga0501033_0118333 3300049570 Bacteria 1924
583 Ga0501033_0129635 3300049570 Bacteria 1828
584 Ga0501036_0174831 3300049572 Bacteria 1808
585 Ga0501037_0019346 3300049573 Bacteria 5022
586 Ga0501037_0040253 3300049573 Bacteria 3439
587 Ga0501038_0012257 3300049574 Bacteria 7829
588 Ga0501038_0201014 3300049574 Bacteria 1599
589 Ga0501039_0038160 3300049575 Bacteria 3711
590 Ga0501039_0162628 3300049575 Bacteria 1755
591 Ga0501043_0062632 3300049579 Bacteria 2920
592 Ga0501043_0085546 3300049579 Bacteria 2478
593 Ga0501048_0058573 3300049582 Bacteria 2730
594 Ga0501068_0117037 3300049584 Bacteria 1660
595 Ga0501069_0016480 3300049585 Bacteria 3971
596 Ga0501070_0027171 3300049586 Bacteria 4800
597 Ga0501070_0036858 3300049586 Bacteria 4083
598 Ga0501073_0025037 3300049589 Bacteria 4283
599 Ga0501073_0038112 3300049589 Bacteria 3411
600 Ga0501073_0120282 3300049589 Bacteria 1820
601 Ga0501074_0236053 3300049590 Bacteria 1301
602 Ga0501202_001871 3300049652 Bacteria 3451
603 Ga0501216_006033 3300049660 Bacteria 1845
604 Ga0501217_005039 3300049661 Bacteria 2744
605 Ga0501235_002828 3300049669 Bacteria 3733
606 Ga0501221_001373 3300049704 Bacteria 4003
607 Ga0501225_0007861 3300049705 Bacteria 3077
608 Ga0501083_0010437 3300049744 Bacteria 6539
609 Ga0501266_003015 3300049763 Bacteria 2098
610 Ga0501272_005348 3300049769 Bacteria 1350
611 Ga0501035_0000597 3300049822 Bacteria 39766
612 Ga0501035_0014570 3300049822 Bacteria 7257
613 Ga0501035_0119206 3300049822 Bacteria 2308
614 Ga0501044_0024439 3300049823 Bacteria 6412
615 Ga0501044_0089511 3300049823 Bacteria 3106
616 Ga0501045_0251122 3300049824 Bacteria 1316
617 nmdc:mga03683_476_c1 3300050489 Bacteria 11566
618 nmdc:mga00v17_13475_c1 3300050491 Bacteria 4542
619 nmdc:mga00v17_213_c1 3300050491 Bacteria 34903
620 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
621 nmdc:mga0yw44_144512_c1 3300050492 Bacteria 1548
622 nmdc:mga0yw44_83977_c1 3300050492 Bacteria 2001
623 nmdc:mga0k408_28719_c1 3300050493 Bacteria 3163
624 nmdc:mga07m45_4102_c1 3300050496 Bacteria 5174
625 nmdc:mga0sz30_115_c1 3300050516 Bacteria 30158
626 nmdc:mga0sz30_14176_c1 3300050516 Bacteria 3133
627 nmdc:mga0sz30_49354_c1 3300050516 Bacteria 1783
628 Ga0495612_0018829 3300053078 Bacteria 2765
629 Ga0500610_0019102 3300053079 Bacteria 3326
630 Ga0495619_0002232 3300053085 Bacteria 12806
631 Ga0495619_0003103 3300053085 Bacteria 10782
632 Ga0495619_0122504 3300053085 Bacteria 1783
633 Ga0495619_0195783 3300053085 Bacteria 1399
634 Ga0500560_019545 3300053107 Bacteria 1908
635 Ga0500594_0000853 3300053118 Bacteria 6527
636 Ga0500608_037404 3300053122 Bacteria 2319
637 Ga0500618_000050 3300053125 Bacteria 105238
638 Ga0500618_001049 3300053125 Bacteria 13764
639 Ga0500658_0000323 3300053134 Bacteria 21124
640 Ga0500658_0026149 3300053134 Bacteria 2247
641 Ga0500559_0026351 3300053136 Bacteria 2475
642 Ga0500568_0001419 3300053139 Bacteria 15537
643 Ga0500568_0001573 3300053139 Bacteria 14435
644 Ga0500568_0114582 3300053139 Bacteria 1006
645 Ga0500573_0003303 3300053140 Bacteria 8326
646 Ga0500590_000218 3300053148 Bacteria 17347
647 Ga0500616_0000798 3300053153 Bacteria 36041
648 Ga0500616_0003746 3300053153 Bacteria 11341
649 Ga0500616_0017076 3300053153 Bacteria 4120
650 Ga0500622_0000241 3300053156 Bacteria 56799
651 Ga0500622_0000597 3300053156 Bacteria 32786
652 Ga0500624_000239 3300053157 Bacteria 19500
653 Ga0500627_0105400 3300053158 Bacteria 1267
654 Ga0500633_0005572 3300053160 Bacteria 3005
655 Ga0500634_0012891 3300053161 Bacteria 4367
656 Ga0500636_0000003 3300053177 Bacteria 240189
657 Ga0500636_0003175 3300053177 Bacteria 9199
658 Ga0501082_0025756 3300060353 Bacteria 5068
659 Ga0501082_0201211 3300060353 Bacteria 1733

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046648 Ga0495611_0092837 Ga0495611_0092837_521_1375 281
2 3300046462 Ga0495651_0257146 Ga0495651_0257146_270_1160 296
3 3300046460 Ga0495638_0076128 Ga0495638_0076128_705_1661 299
4 3300038443 Ga0395901_0200479 Ga0395901_0200479_12_995 311
5 3300046559 Ga0495667_0138210 Ga0495667_0138210_24_986 315
6 3300048088 Ga0495602_0355112 Ga0495602_0355112_18_980 315
7 3300048908 Ga0496105_0106729 Ga0496105_0106729_23_985 315
8 3300053078 Ga0495612_0018829 Ga0495612_0018829_1778_2740 315
9 3300014325 Ga0163163_10093145 Ga0163163_100931454 319
10 3300053139 Ga0500568_0114582 Ga0500568_0114582_12_992 319
11 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001355 327
12 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001405 327
13 3300004625 Ga0055543_1000216 Ga0055543_100021632 327
14 3300005262 Ga0065165_1000008 Ga0065165_1000008100 327
15 3300025284 Ga0209130_1000003 Ga0209130_1000003420 327
16 3300025302 Ga0207426_1000011 Ga0207426_1000011356 327
17 3300047443 Ga0495687_021450 Ga0495687_021450_272_1333 327
18 3300048915 Ga0496112_0116753 Ga0496112_0116753_996_1979 327
19 3300048917 Ga0496114_0144375 Ga0496114_0144375_1020_2003 327
20 3300048924 Ga0496121_0042752 Ga0496121_0042752_2541_3602 327
21 3300002774 JGI25150J39212_1004958 JGI25150J39212_10049582 328
22 3300025245 Ga0207425_1004836 Ga0207425_10048364 328
23 3300025258 Ga0209129_1008780 Ga0209129_10087804 328
24 3300025297 Ga0209758_1006337 Ga0209758_10063379 328
25 3300049570 Ga0501033_0129635 Ga0501033_0129635_290_1384 329
26 3300049574 Ga0501038_0201014 Ga0501038_0201014_351_1469 329
27 3300049589 Ga0501073_0120282 Ga0501073_0120282_306_1424 329
28 3300049823 Ga0501044_0024439 Ga0501044_0024439_5112_6230 329
29 3300046501 Ga0495607_0132613 Ga0495607_0132613_69_1130 330
30 3300046660 Ga0495625_0176073 Ga0495625_0176073_125_1186 330
31 3300048909 Ga0496106_0192332 Ga0496106_0192332_387_1451 330
32 3300053158 Ga0500627_0105400 Ga0500627_0105400_205_1242 332
33 3300006353 Ga0075370_10014170 Ga0075370_100141704 333
34 3300009551 Ga0105238_10452763 Ga0105238_104527632 333
35 3300014326 Ga0157380_10508957 Ga0157380_105089571 333
36 3300025906 Ga0207699_10146827 Ga0207699_101468271 333
37 3300046507 Ga0495606_0027184 Ga0495606_0027184_1403_2434 333
38 3300035083 Ga0373926_0041892 Ga0373926_0041892_132_1151 334
39 3300035089 Ga0373944_0015510 Ga0373944_0015510_595_1614 334
40 3300035116 Ga0373945_0041233 Ga0373945_0041233_140_1159 334
41 3300035170 Ga0373943_0000121 Ga0373943_0000121_12090_13109 334
42 3300035695 Ga0373927_0035521 Ga0373927_0035521_2013_3032 334
43 3300037068 Ga0373925_0000937 Ga0373925_0000937_13718_14737 334
44 3300046455 Ga0495603_0023346 Ga0495603_0023346_1577_2596 334
45 3300046459 Ga0495629_0001138 Ga0495629_0001138_19475_20494 334
46 3300046461 Ga0495641_0001166 Ga0495641_0001166_18647_19666 334
47 3300046463 Ga0495653_0024287 Ga0495653_0024287_3202_4221 334
48 3300046473 Ga0495582_0000476 Ga0495582_0000476_6628_7647 334
49 3300046475 Ga0495639_0015678 Ga0495639_0015678_1244_2263 334
50 3300046476 Ga0495662_0004536 Ga0495662_0004536_1852_2871 334
51 3300046499 Ga0495594_0064001 Ga0495594_0064001_722_1741 334
52 3300046511 Ga0495608_0101256 Ga0495608_0101256_455_1474 334
53 3300046517 Ga0495630_0028517 Ga0495630_0028517_1356_2375 334
54 3300046526 Ga0495666_0001680 Ga0495666_0001680_4551_5570 334
55 3300046533 Ga0495640_0016563 Ga0495640_0016563_749_1768 334
56 3300046559 Ga0495667_0060754 Ga0495667_0060754_966_1985 334
57 3300046642 Ga0495634_0010271 Ga0495634_0010271_3717_4736 334
58 3300046660 Ga0495625_0050481 Ga0495625_0050481_352_1515 334
59 3300046663 Ga0495635_0134033 Ga0495635_0134033_457_1476 334
60 3300046678 Ga0495599_0101414 Ga0495599_0101414_443_1462 334
61 3300046680 Ga0495646_0104955 Ga0495646_0104955_553_1572 334
62 3300046681 Ga0495647_0041919 Ga0495647_0041919_646_1665 334
63 3300046683 Ga0495658_0052166 Ga0495658_0052166_740_1759 334
64 3300046689 Ga0495613_0000618 Ga0495613_0000618_9481_10500 334
65 3300046809 Ga0495600_0068475 Ga0495600_0068475_529_1548 334
66 3300047315 Ga0495581_0000478 Ga0495581_0000478_551_1570 334
67 3300047317 Ga0495604_0130352 Ga0495604_0130352_604_1623 334
68 3300047319 Ga0495674_0053175 Ga0495674_0053175_1789_2808 334
69 3300047321 Ga0495676_0001540 Ga0495676_0001540_6969_7988 334
70 3300047322 Ga0495680_0039413 Ga0495680_0039413_1813_2832 334
71 3300047471 Ga0495684_0006886 Ga0495684_0006886_1944_2963 334
72 3300047471 Ga0495684_0038552 Ga0495684_0038552_2174_3193 334
73 3300047673 Ga0495593_0004413 Ga0495593_0004413_4918_5937 334
74 3300048089 Ga0495614_0006088 Ga0495614_0006088_3837_4856 334
75 3300048918 Ga0496115_0084110 Ga0496115_0084110_502_1545 334
76 3300048928 Ga0496125_0001465 Ga0496125_0001465_15077_16138 334
77 3300053085 Ga0495619_0002232 Ga0495619_0002232_2512_3531 334
78 3300053085 Ga0495619_0003103 Ga0495619_0003103_493_1512 334
79 iso_pu_bacteria 2551306089 2551709575 334
80 3300046507 Ga0495606_0019565 Ga0495606_0019565_415_1455 335
81 3300048920 Ga0496117_0002241 Ga0496117_0002241_20214_21275 335
82 3300048925 Ga0496122_0000414 Ga0496122_0000414_38089_39150 335
83 3300048926 Ga0496123_0000147 Ga0496123_0000147_114359_115420 335
84 3300048927 Ga0496124_0000348 Ga0496124_0000348_44508_45569 335
85 3300048929 Ga0496126_0000879 Ga0496126_0000879_23864_24925 335
86 iso_pu_bacteria 3003930520 3003934497 335
87 3300003187 JGI25151J46595_10000146 JGI25151J46595_1000014644 336
88 3300003215 JGI25153J46596_10000698 JGI25153J46596_100006988 336
89 3300003792 Ga0055540_1000372 Ga0055540_100037226 336
90 3300005367 Ga0070667_100005388 Ga0070667_1000053885 336
91 3300005617 Ga0068859_100001403 Ga0068859_10000140319 336
92 3300005843 Ga0068860_100010234 Ga0068860_1000102349 336
93 3300006038 Ga0075365_10037564 Ga0075365_100375643 336
94 3300006178 Ga0075367_10003454 Ga0075367_100034545 336
95 3300006931 Ga0097620_100001403 Ga0097620_10000140319 336
96 3300009765 Ga0123341_1049145 Ga0123341_10491452 336
97 3300009766 Ga0123342_1006302 Ga0123342_100630216 336
98 3300009766 Ga0123342_1033809 Ga0123342_10338092 336
99 3300013100 Ga0157373_10095382 Ga0157373_100953822 336
100 3300013105 Ga0157369_10020112 Ga0157369_100201125 336
101 3300025245 Ga0207425_1000046 Ga0207425_100004640 336
102 3300025258 Ga0209129_1000171 Ga0209129_100017162 336
103 3300025273 Ga0209673_1000637 Ga0209673_100063717 336
104 3300025273 Ga0209673_1005399 Ga0209673_10053993 336
105 3300025294 Ga0209025_1000137 Ga0209025_1000137151 336
106 3300025294 Ga0209025_1009293 Ga0209025_10092937 336
107 3300025297 Ga0209758_1000123 Ga0209758_1000123151 336
108 3300025297 Ga0209758_1015542 Ga0209758_10155424 336
109 3300025303 Ga0209051_1000462 Ga0209051_100046213 336
110 3300025304 Ga0209257_1005864 Ga0209257_10058644 336
111 3300028381 Ga0268264_10024669 Ga0268264_100246693 336
112 3300031548 Ga0307408_100065712 Ga0307408_1000657122 336
113 3300031731 Ga0307405_10002098 Ga0307405_1000209811 336
114 3300031824 Ga0307413_10078842 Ga0307413_100788422 336
115 3300031995 Ga0307409_100195568 Ga0307409_1001955682 336
116 3300032002 Ga0307416_100068230 Ga0307416_1000682302 336
117 3300032004 Ga0307414_10020828 Ga0307414_100208283 336
118 3300032005 Ga0307411_10027659 Ga0307411_100276593 336
119 3300041492 Ga0451835_0555271 Ga0451835_0555271_340_1503 336
120 3300041496 Ga0451839_1437888 Ga0451839_1437888_536_1699 336
121 3300041501 Ga0451845_0328363 Ga0451845_0328363_837_2000 336
122 3300041503 Ga0451847_0892452 Ga0451847_0892452_1595_2758 336
123 3300046460 Ga0495638_0000790 Ga0495638_0000790_22048_23109 336
124 3300046474 Ga0495605_0000994 Ga0495605_0000994_7820_9046 336
125 3300046474 Ga0495605_0037505 Ga0495605_0037505_1258_2421 336
126 3300046492 Ga0495585_0003595 Ga0495585_0003595_7710_8966 336
127 3300046492 Ga0495585_0012991 Ga0495585_0012991_3508_4578 336
128 3300046506 Ga0495583_0009072 Ga0495583_0009072_2891_4147 336
129 3300046512 Ga0495610_0001917 Ga0495610_0001917_3746_4816 336
130 3300046518 Ga0495631_0000751 Ga0495631_0000751_3627_4883 336
131 3300046519 Ga0495632_0024689 Ga0495632_0024689_134_1360 336
132 3300046524 Ga0495648_0005978 Ga0495648_0005978_4415_5578 336
133 3300046530 Ga0495654_0018394 Ga0495654_0018394_2131_3192 336
134 3300046616 Ga0495668_0003152 Ga0495668_0003152_1885_3141 336
135 3300046660 Ga0495625_0001467 Ga0495625_0001467_14276_15532 336
136 3300048919 Ga0496116_0007158 Ga0496116_0007158_3489_4559 336
137 3300048919 Ga0496116_0008210 Ga0496116_0008210_1584_2654 336
138 3300048924 Ga0496121_0015733 Ga0496121_0015733_5808_6914 336
139 3300048924 Ga0496121_0018854 Ga0496121_0018854_5768_6838 336
140 3300048924 Ga0496121_0165280 Ga0496121_0165280_458_1528 336
141 3300048925 Ga0496122_0173927 Ga0496122_0173927_176_1246 336
142 3300048927 Ga0496124_0003742 Ga0496124_0003742_1630_2700 336
143 3300048927 Ga0496124_0023679 Ga0496124_0023679_1294_2364 336
144 3300048927 Ga0496124_0042790 Ga0496124_0042790_2241_3302 336
145 3300048928 Ga0496125_0015823 Ga0496125_0015823_4260_5330 336
146 3300048929 Ga0496126_0045881 Ga0496126_0045881_2772_3842 336
147 3300049459 Ga0495678_020259 Ga0495678_020259_44_1270 336
148 3300049589 Ga0501073_0025037 Ga0501073_0025037_2942_4009 336
149 3300053118 Ga0500594_0000853 Ga0500594_0000853_847_2103 336
150 3300053134 Ga0500658_0026149 Ga0500658_0026149_1137_2207 336
151 3300053139 Ga0500568_0001419 Ga0500568_0001419_6792_7853 336
152 3300053153 Ga0500616_0003746 Ga0500616_0003746_5637_6698 336
153 3300005353 Ga0070669_100091562 Ga0070669_1000915621 337
154 3300014497 Ga0182008_10052667 Ga0182008_100526672 337
155 3300048925 Ga0496122_0051771 Ga0496122_0051771_2008_3042 337
156 3300048929 Ga0496126_0069879 Ga0496126_0069879_46_1107 337
157 3300049570 Ga0501033_0118333 Ga0501033_0118333_353_1387 337
158 3300049572 Ga0501036_0174831 Ga0501036_0174831_382_1416 337
159 3300049573 Ga0501037_0040253 Ga0501037_0040253_1301_2335 337
160 3300049579 Ga0501043_0085546 Ga0501043_0085546_270_1316 337
161 3300049822 Ga0501035_0119206 Ga0501035_0119206_268_1302 337
162 3300049823 Ga0501044_0089511 Ga0501044_0089511_244_1278 337
163 3300053122 Ga0500608_037404 Ga0500608_037404_1013_2062 337
164 3300027111 Ga0209281_1000190 Ga0209281_100019099 338
165 3300031852 Ga0307410_10274153 Ga0307410_102741531 338
166 3300031995 Ga0307409_100098443 Ga0307409_1000984432 338
167 3300036401 Ga0373937_0058126 Ga0373937_0058126_1550_2566 338
168 3300042007 Ga0439449_0052275 Ga0439449_0052275_163_1206 338
169 3300044683 Ga0466965_0018260 Ga0466965_0018260_1859_3100 338
170 3300044693 Ga0466961_0005611 Ga0466961_0005611_4521_5762 338
171 3300044719 Ga0466971_0000268 Ga0466971_0000268_12651_13892 338
172 3300044842 Ga0466957_0001675 Ga0466957_0001675_10344_11585 338
173 3300045049 Ga0466959_0001701 Ga0466959_0001701_488_1729 338
174 3300045836 Ga0466958_0002672 Ga0466958_0002672_6834_8075 338
175 3300045976 Ga0466967_0001415 Ga0466967_0001415_1280_2521 338
176 3300048924 Ga0496121_0011327 Ga0496121_0011327_8723_9766 338
177 3300049568 Ga0501031_0028878 Ga0501031_0028878_1424_2449 338
178 3300049569 Ga0501032_0007875 Ga0501032_0007875_5563_6588 338
179 3300049570 Ga0501033_0065411 Ga0501033_0065411_93_1118 338
180 3300049573 Ga0501037_0019346 Ga0501037_0019346_2836_3861 338
181 3300049574 Ga0501038_0012257 Ga0501038_0012257_5533_6558 338
182 3300049575 Ga0501039_0038160 Ga0501039_0038160_149_1174 338
183 3300049579 Ga0501043_0062632 Ga0501043_0062632_394_1419 338
184 3300049582 Ga0501048_0058573 Ga0501048_0058573_550_1575 338
185 3300049584 Ga0501068_0117037 Ga0501068_0117037_183_1208 338
186 3300049585 Ga0501069_0016480 Ga0501069_0016480_2524_3549 338
187 3300049586 Ga0501070_0027171 Ga0501070_0027171_1672_2697 338
188 3300049589 Ga0501073_0038112 Ga0501073_0038112_2022_3047 338
189 3300049744 Ga0501083_0010437 Ga0501083_0010437_4302_5327 338
190 3300049822 Ga0501035_0014570 Ga0501035_0014570_4186_5211 338
191 3300049824 Ga0501045_0251122 Ga0501045_0251122_145_1170 338
192 3300060353 Ga0501082_0025756 Ga0501082_0025756_967_1992 338
193 iso_pu_bacteria 2508501050 2508732986 338
194 iso_pu_bacteria 2889010040 2889014961 338
195 iso_pu_bacteria 2894232714 2894242801 338
196 iso_pu_bacteria 2987652177 2987654442 338
197 iso_pu_bacteria 8004640170 8004643869 338
198 3300005338 Ga0068868_100013963 Ga0068868_1000139632 339
199 3300005364 Ga0070673_100006253 Ga0070673_1000062533 339
200 3300005466 Ga0070685_10009406 Ga0070685_100094062 339
201 3300005841 Ga0068863_100005596 Ga0068863_10000559612 339
202 3300013296 Ga0157374_10098396 Ga0157374_100983962 339
203 3300013297 Ga0157378_10029584 Ga0157378_100295842 339
204 3300014969 Ga0157376_10016605 Ga0157376_100166053 339
205 3300025925 Ga0207650_10051538 Ga0207650_100515383 339
206 3300025960 Ga0207651_10071465 Ga0207651_100714652 339
207 3300035692 Ga0373935_0046820 Ga0373935_0046820_281_1318 339
208 3300035692 Ga0373935_0174324 Ga0373935_0174324_57_1076 339
209 3300035695 Ga0373927_0000191 Ga0373927_0000191_5220_6257 339
210 3300036401 Ga0373937_0115077 Ga0373937_0115077_500_1519 339
211 3300037068 Ga0373925_0003720 Ga0373925_0003720_2814_3851 339
212 3300037471 Ga0395905_0064353 Ga0395905_0064353_1046_2086 339
213 3300046459 Ga0495629_0213185 Ga0495629_0213185_189_1208 339
214 3300046472 Ga0495580_0056954 Ga0495580_0056954_535_1554 339
215 3300046473 Ga0495582_0087453 Ga0495582_0087453_669_1688 339
216 3300046517 Ga0495630_0217797 Ga0495630_0217797_424_1443 339
217 3300046517 Ga0495630_0314493 Ga0495630_0314493_57_1076 339
218 3300046529 Ga0495652_0186522 Ga0495652_0186522_419_1438 339
219 3300046679 Ga0495623_0182370 Ga0495623_0182370_100_1119 339
220 3300046683 Ga0495658_0047651 Ga0495658_0047651_201_1220 339
221 3300046691 Ga0495670_0020764 Ga0495670_0020764_1832_2851 339
222 3300047319 Ga0495674_0295006 Ga0495674_0295006_107_1126 339
223 3300053085 Ga0495619_0195783 Ga0495619_0195783_229_1248 339
224 3300053136 Ga0500559_0026351 Ga0500559_0026351_153_1196 339
225 3300053156 Ga0500622_0000241 Ga0500622_0000241_42242_43288 339
226 iso_pu_bacteria 2509276022 2509393406 339
227 iso_pu_bacteria 2510461069 2510840933 339
228 iso_pu_bacteria 2512875024 2512962214 339
229 iso_pu_bacteria 2558860983 2561469249 339
230 iso_pu_bacteria 2643221623 2644133590 339
231 iso_pu_bacteria 2643221653 2644298941 339
232 iso_pu_bacteria 2643221719 2644657169 339
233 iso_pu_bacteria 2738543024 2739308451 339
234 iso_pu_bacteria 2818991272 2819241047 339
235 iso_pu_bacteria 2869278585 2869280705 339
236 iso_pu_bacteria 2874139085 2874143141 339
237 iso_pu_bacteria 2878738818 2878740794 339
238 iso_pu_bacteria 2888337043 2888343165 339
239 iso_pu_bacteria 2924718760 2924722755 339
240 iso_pu_bacteria 2924776078 2924778395 339
241 iso_pu_bacteria 2937822353 2937822682 339
242 iso_pu_bacteria 2937877337 2937880056 339
243 iso_pu_bacteria 2937972304 2937980089 339
244 iso_pu_bacteria 2958034702 2958036578 339
245 iso_pu_bacteria 2958041894 2958046534 339
246 iso_pu_bacteria 2958084443 2958086120 339
247 iso_pu_bacteria 2958144490 2958145639 339
248 iso_pu_bacteria 2960597568 2960598494 339
249 iso_pu_bacteria 2968016561 2968023125 339
250 iso_pu_bacteria 2970469710 2970475709 339
251 iso_pu_bacteria 2970593180 2970595428 339
252 iso_pu_bacteria 2989776772 2989779506 339
253 iso_pu_bacteria 2996348954 2996355664 339
254 iso_pu_bacteria 3004275668 3004282090 339
255 iso_pu_bacteria 3004289098 3004293525 339
256 iso_pu_bacteria 8002285264 8002291247 339
257 iso_pu_bacteria 8005246636 8005249882 339
258 iso_pu_bacteria 8005658619 8005658822 339
259 iso_pu_bacteria 8054460903 8054463173 339
260 3300003187 JGI25151J46595_10029243 JGI25151J46595_100292431 340
261 3300005327 Ga0070658_10000398 Ga0070658_100003989 340
262 3300005328 Ga0070676_10000458 Ga0070676_100004582 340
263 3300005334 Ga0068869_100058510 Ga0068869_1000585102 340
264 3300005335 Ga0070666_10000272 Ga0070666_1000027213 340
265 3300005338 Ga0068868_100000493 Ga0068868_1000004938 340
266 3300005338 Ga0068868_100094595 Ga0068868_1000945951 340
267 3300005347 Ga0070668_100000154 Ga0070668_10000015426 340
268 3300005367 Ga0070667_100001281 Ga0070667_10000128113 340
269 3300005457 Ga0070662_100023334 Ga0070662_1000233344 340
270 3300005539 Ga0068853_100003715 Ga0068853_1000037155 340
271 3300005543 Ga0070672_100000048 Ga0070672_10000004819 340
272 3300005548 Ga0070665_100001032 Ga0070665_10000103218 340
273 3300005616 Ga0068852_100058588 Ga0068852_1000585882 340
274 3300005618 Ga0068864_100000537 Ga0068864_10000053714 340
275 3300005834 Ga0068851_10004984 Ga0068851_100049843 340
276 3300005841 Ga0068863_100000750 Ga0068863_10000075011 340
277 3300005842 Ga0068858_100001076 Ga0068858_1000010763 340
278 3300005843 Ga0068860_100062626 Ga0068860_1000626262 340
279 3300006237 Ga0097621_100002050 Ga0097621_1000020502 340
280 3300006358 Ga0068871_100003589 Ga0068871_1000035893 340
281 3300006881 Ga0068865_100096726 Ga0068865_1000967262 340
282 3300009093 Ga0105240_10097464 Ga0105240_100974642 340
283 3300009177 Ga0105248_10016027 Ga0105248_100160278 340
284 3300009551 Ga0105238_10104207 Ga0105238_101042072 340
285 3300010375 Ga0105239_10042603 Ga0105239_100426031 340
286 3300011119 Ga0105246_10061054 Ga0105246_100610543 340
287 3300011119 Ga0105246_10150319 Ga0105246_101503192 340
288 3300013296 Ga0157374_10000314 Ga0157374_1000031414 340
289 3300013306 Ga0163162_10000231 Ga0163162_1000023126 340
290 3300013306 Ga0163162_10002781 Ga0163162_1000278114 340
291 3300013308 Ga0157375_10000272 Ga0157375_1000027214 340
292 3300014325 Ga0163163_10000347 Ga0163163_1000034713 340
293 3300014968 Ga0157379_10000120 Ga0157379_1000012028 340
294 3300014969 Ga0157376_10000271 Ga0157376_1000027114 340
295 3300014969 Ga0157376_10028647 Ga0157376_100286474 340
296 3300014969 Ga0157376_10286613 Ga0157376_102866131 340
297 3300025225 Ga0209566_100115 Ga0209566_10011576 340
298 3300025321 Ga0207656_10001075 Ga0207656_100010757 340
299 3300025903 Ga0207680_10000165 Ga0207680_100001657 340
300 3300025907 Ga0207645_10027863 Ga0207645_100278633 340
301 3300025909 Ga0207705_10000725 Ga0207705_1000072512 340
302 3300025933 Ga0207706_10038695 Ga0207706_100386954 340
303 3300025938 Ga0207704_10002738 Ga0207704_100027387 340
304 3300025940 Ga0207691_10000245 Ga0207691_1000024526 340
305 3300025942 Ga0207689_10058189 Ga0207689_100581892 340
306 3300025972 Ga0207668_10000184 Ga0207668_1000018426 340
307 3300025986 Ga0207658_10000452 Ga0207658_1000045218 340
308 3300026023 Ga0207677_10000876 Ga0207677_1000087611 340
309 3300026023 Ga0207677_10156607 Ga0207677_101566072 340
310 3300026035 Ga0207703_10000388 Ga0207703_1000038825 340
311 3300026041 Ga0207639_10007920 Ga0207639_100079205 340
312 3300026088 Ga0207641_10001293 Ga0207641_1000129318 340
313 3300026089 Ga0207648_10003392 Ga0207648_100033922 340
314 3300026095 Ga0207676_10001932 Ga0207676_1000193212 340
315 3300026118 Ga0207675_100140814 Ga0207675_1001408141 340
316 3300026142 Ga0207698_10062463 Ga0207698_100624632 340
317 3300028379 Ga0268266_10000928 Ga0268266_1000092814 340
318 3300028381 Ga0268264_10049337 Ga0268264_100493372 340
319 3300041512 Ga0451853_0687444 Ga0451853_0687444_4529_5560 340
320 3300048910 Ga0496107_0127580 Ga0496107_0127580_418_1482 340
321 3300048911 Ga0496108_0064883 Ga0496108_0064883_711_1775 340
322 3300048912 Ga0496109_0154338 Ga0496109_0154338_466_1530 340
323 iso_pu_bacteria 2508501122 2509108127 340
324 iso_pu_bacteria 2509276019 2509376698 340
325 iso_pu_bacteria 2510917026 2511175489 340
326 iso_pu_bacteria 2511231027 2511392964 340
327 iso_pu_bacteria 2511231052 2511497807 340
328 iso_pu_bacteria 2512047086 2512528817 340
329 iso_pu_bacteria 2512875026 2512969561 340
330 iso_pu_bacteria 2513237086 2513584538 340
331 iso_pu_bacteria 2513237089 2513606215 340
332 iso_pu_bacteria 2513237091 2513616448 340
333 iso_pu_bacteria 2513237140 2513885308 340
334 iso_pu_bacteria 2513237143 2513901983 340
335 iso_pu_bacteria 2513237156 2513985076 340
336 iso_pu_bacteria 2513237160 2514007930 340
337 iso_pu_bacteria 2515154107 2515612047 340
338 iso_pu_bacteria 2516143018 2516206168 340
339 iso_pu_bacteria 2516653046 2516896546 340
340 iso_pu_bacteria 2517487022 2517565561 340
341 iso_pu_bacteria 2524023207 2524452065 340
342 iso_pu_bacteria 2551306084 2551681400 340
343 iso_pu_bacteria 2551306085 2551686221 340
344 iso_pu_bacteria 2558860100 2558863939 340
345 iso_pu_bacteria 2585427633 2585996721 340
346 iso_pu_bacteria 2599185184 2599477241 340
347 iso_pu_bacteria 2599185236 2599721656 340
348 iso_pu_bacteria 2599185352 2600194875 340
349 iso_pu_bacteria 2643221557 2643804171 340
350 iso_pu_bacteria 2643221610 2644065055 340
351 iso_pu_bacteria 2643221618 2644105234 340
352 iso_pu_bacteria 2643221626 2644145690 340
353 iso_pu_bacteria 2643221655 2644309647 340
354 iso_pu_bacteria 2643221659 2644331185 340
355 iso_pu_bacteria 2643221668 2644376536 340
356 iso_pu_bacteria 2643221675 2644416728 340
357 iso_pu_bacteria 2643221680 2644449768 340
358 iso_pu_bacteria 2643221698 2644543376 340
359 iso_pu_bacteria 2643221712 2644616171 340
360 iso_pu_bacteria 2643221723 2644675794 340
361 iso_pu_bacteria 2643221726 2644689900 340
362 iso_pu_bacteria 2657244999 2657681753 340
363 iso_pu_bacteria 2675903059 2676484500 340
364 iso_pu_bacteria 2690316117 2692315261 340
365 iso_pu_bacteria 2751185821 2753462382 340
366 iso_pu_bacteria 2775507049 2776914231 340
367 iso_pu_bacteria 2791355091 2792620557 340
368 iso_pu_bacteria 2791355092 2792625916 340
369 iso_pu_bacteria 2791355094 2792638856 340
370 iso_pu_bacteria 2802428858 2802715991 340
371 iso_pu_bacteria 2802428859 2802722985 340
372 iso_pu_bacteria 2802428860 2802728882 340
373 iso_pu_bacteria 2802428861 2802735249 340
374 iso_pu_bacteria 2802428862 2802742147 340
375 iso_pu_bacteria 2802428863 2802748594 340
376 iso_pu_bacteria 2802429268 2804752938 340
377 iso_pu_bacteria 2818991461 2819685188 340
378 iso_pu_bacteria 2821123053 2821125779 340
379 iso_pu_bacteria 2838074704 2838079766 340
380 iso_pu_bacteria 2838736955 2838737771 340
381 iso_pu_bacteria 2840764183 2840767717 340
382 iso_pu_bacteria 2841840854 2841841860 340
383 iso_pu_bacteria 2842140634 2842141639 340
384 iso_pu_bacteria 2842871566 2842872478 340
385 iso_pu_bacteria 2842922631 2842924365 340
386 iso_pu_bacteria 2844163670 2844163992 340
387 iso_pu_bacteria 2847417321 2847419681 340
388 iso_pu_bacteria 2848992105 2848994683 340
389 iso_pu_bacteria 2850079185 2850081699 340
390 iso_pu_bacteria 2854896431 2854901387 340
391 iso_pu_bacteria 2854916844 2854918998 340
392 iso_pu_bacteria 2855825444 2855828626 340
393 iso_pu_bacteria 2855872281 2855877197 340
394 iso_pu_bacteria 2857531043 2857532340 340
395 iso_pu_bacteria 2858800743 2858807008 340
396 iso_pu_bacteria 2891373044 2891373613 340
397 iso_pu_bacteria 2896384573 2896391119 340
398 iso_pu_bacteria 2899803654 2899806181 340
399 iso_pu_bacteria 2911138879 2911142471 340
400 iso_pu_bacteria 2913295892 2913296144 340
401 iso_pu_bacteria 2915980308 2915983656 340
402 iso_pu_bacteria 2915986958 2915988488 340
403 iso_pu_bacteria 2915993759 2915994235 340
404 iso_pu_bacteria 2916000859 2916006250 340
405 iso_pu_bacteria 2916007675 2916011332 340
406 iso_pu_bacteria 2916014648 2916021525 340
407 iso_pu_bacteria 2916021584 2916028153 340
408 iso_pu_bacteria 2916028427 2916035069 340
409 iso_pu_bacteria 2916035215 2916038257 340
410 iso_pu_bacteria 2916041962 2916044971 340
411 iso_pu_bacteria 2916048683 2916054539 340
412 iso_pu_bacteria 2916055098 2916061156 340
413 iso_pu_bacteria 2916061851 2916065355 340
414 iso_pu_bacteria 2916068649 2916070769 340
415 iso_pu_bacteria 2916076590 2916082940 340
416 iso_pu_bacteria 2919171160 2919173014 340
417 iso_pu_bacteria 2920760137 2920761289 340
418 iso_pu_bacteria 2920822456 2920825514 340
419 iso_pu_bacteria 2921201388 2921203213 340
420 iso_pu_bacteria 2921208531 2921210111 340
421 iso_pu_bacteria 2921237296 2921240582 340
422 iso_pu_bacteria 2921244191 2921245785 340
423 iso_pu_bacteria 2921250672 2921256895 340
424 iso_pu_bacteria 2921257292 2921260097 340
425 iso_pu_bacteria 2921263974 2921269989 340
426 iso_pu_bacteria 2921282425 2921283073 340
427 iso_pu_bacteria 2921289301 2921296777 340
428 iso_pu_bacteria 2924144063 2924148505 340
429 iso_pu_bacteria 2924150972 2924154710 340
430 iso_pu_bacteria 2924158325 2924164384 340
431 iso_pu_bacteria 2924165586 2924168387 340
432 iso_pu_bacteria 2924172951 2924178764 340
433 iso_pu_bacteria 2924179722 2924182088 340
434 iso_pu_bacteria 2924186466 2924188963 340
435 iso_pu_bacteria 2924193448 2924195814 340
436 iso_pu_bacteria 2924200457 2924202915 340
437 iso_pu_bacteria 2924207177 2924209949 340
438 iso_pu_bacteria 2924214083 2924217328 340
439 iso_pu_bacteria 2924221636 2924228290 340
440 iso_pu_bacteria 2924228884 2924235353 340
441 iso_pu_bacteria 2928078545 2928079157 340
442 iso_pu_bacteria 2928147474 2928148472 340
443 iso_pu_bacteria 2928521798 2928523434 340
444 iso_pu_bacteria 2932082852 2932085769 340
445 iso_pu_bacteria 2936996657 2937001521 340
446 iso_pu_bacteria 2937002841 2937005828 340
447 iso_pu_bacteria 2937009748 2937014335 340
448 iso_pu_bacteria 2937016420 2937021938 340
449 iso_pu_bacteria 2937023124 2937023994 340
450 iso_pu_bacteria 2937029754 2937035008 340
451 iso_pu_bacteria 2937036028 2937039239 340
452 iso_pu_bacteria 2937042894 2937049007 340
453 iso_pu_bacteria 2937049772 2937056425 340
454 iso_pu_bacteria 2937056579 2937056891 340
455 iso_pu_bacteria 2937063883 2937066048 340
456 iso_pu_bacteria 2937071275 2937075363 340
457 iso_pu_bacteria 2937078374 2937084348 340
458 iso_pu_bacteria 2937084907 2937087386 340
459 iso_pu_bacteria 2937091812 2937092606 340
460 iso_pu_bacteria 2937098957 2937100487 340
461 iso_pu_bacteria 2937106411 2937110488 340
462 iso_pu_bacteria 2937113482 2937118801 340
463 iso_pu_bacteria 2937119839 2937125854 340
464 iso_pu_bacteria 2937126314 2937131019 340
465 iso_pu_bacteria 2941499720 2941504704 340
466 iso_pu_bacteria 2954011201 2954015705 340
467 iso_pu_bacteria 2957375807 2957379076 340
468 iso_pu_bacteria 2957382221 2957383040 340
469 iso_pu_bacteria 2957388812 2957391998 340
470 iso_pu_bacteria 2957395598 2957396227 340
471 iso_pu_bacteria 2957402308 2957402908 340
472 iso_pu_bacteria 2957408893 2957410680 340
473 iso_pu_bacteria 2957415311 2957416034 340
474 iso_pu_bacteria 2957430029 2957430499 340
475 iso_pu_bacteria 2957437181 2957438842 340
476 iso_pu_bacteria 2957443900 2957445247 340
477 iso_pu_bacteria 2957450854 2957454935 340
478 iso_pu_bacteria 2957457609 2957461771 340
479 iso_pu_bacteria 2957464669 2957464802 340
480 iso_pu_bacteria 2957471148 2957477912 340
481 iso_pu_bacteria 2957478035 2957484351 340
482 iso_pu_bacteria 2957484790 2957489981 340
483 iso_pu_bacteria 2957491536 2957491666 340
484 iso_pu_bacteria 2957498199 2957501669 340
485 iso_pu_bacteria 2957505466 2957510291 340
486 iso_pu_bacteria 2960584000 2960585051 340
487 iso_pu_bacteria 2960591022 2960595287 340
488 iso_pu_bacteria 2960603979 2960604560 340
489 iso_pu_bacteria 2960610863 2960614275 340
490 iso_pu_bacteria 2960617483 2960621860 340
491 iso_pu_bacteria 2960624210 2960630388 340
492 iso_pu_bacteria 2960631154 2960634376 340
493 iso_pu_bacteria 2960637947 2960642839 340
494 iso_pu_bacteria 2960645483 2960645616 340
495 iso_pu_bacteria 2960652885 2960660088 340
496 iso_pu_bacteria 2960660292 2960661962 340
497 iso_pu_bacteria 2960667422 2960669798 340
498 iso_pu_bacteria 2960674078 2960677787 340
499 iso_pu_bacteria 2960680706 2960683396 340
500 iso_pu_bacteria 2960687367 2960692957 340
501 iso_pu_bacteria 2960693952 2960695247 340
502 iso_pu_bacteria 2964607997 2964610737 340
503 iso_pu_bacteria 2964615318 2964621680 340
504 iso_pu_bacteria 2964621998 2964624231 340
505 iso_pu_bacteria 2964628898 2964629901 340
506 iso_pu_bacteria 2964636051 2964639514 340
507 iso_pu_bacteria 2964643177 2964647935 340
508 iso_pu_bacteria 2964649959 2964655543 340
509 iso_pu_bacteria 2964656573 2964657980 340
510 iso_pu_bacteria 2964663802 2964664643 340
511 iso_pu_bacteria 2964670856 2964674143 340
512 iso_pu_bacteria 2964678106 2964678424 340
513 iso_pu_bacteria 2964691889 2964696081 340
514 iso_pu_bacteria 2964698721 2964704969 340
515 iso_pu_bacteria 2964705432 2964709616 340
516 iso_pu_bacteria 2964712639 2964717584 340
517 iso_pu_bacteria 2964719344 2964720978 340
518 iso_pu_bacteria 2967664464 2967665647 340
519 iso_pu_bacteria 2967671571 2967677111 340
520 iso_pu_bacteria 2967678726 2967685680 340
521 iso_pu_bacteria 2967686174 2967687969 340
522 iso_pu_bacteria 2967693043 2967697855 340
523 iso_pu_bacteria 2967699805 2967704428 340
524 iso_pu_bacteria 2967706974 2967714135 340
525 iso_pu_bacteria 2967714385 2967720918 340
526 iso_pu_bacteria 2967721400 2967725151 340
527 iso_pu_bacteria 2967728569 2967732687 340
528 iso_pu_bacteria 2967735183 2967741852 340
529 iso_pu_bacteria 2967742019 2967748918 340
530 iso_pu_bacteria 2967748971 2967750884 340
531 iso_pu_bacteria 2967755722 2967761713 340
532 iso_pu_bacteria 2967762386 2967765984 340
533 iso_pu_bacteria 2967769361 2967772251 340
534 iso_pu_bacteria 2967775926 2967781985 340
535 iso_pu_bacteria 2970019648 2970023584 340
536 iso_pu_bacteria 2970026789 2970028890 340
537 iso_pu_bacteria 2970033650 2970038286 340
538 iso_pu_bacteria 2970040964 2970042171 340
539 iso_pu_bacteria 2970047711 2970054850 340
540 iso_pu_bacteria 2970054988 2970061231 340
541 iso_pu_bacteria 2970061556 2970062945 340
542 iso_pu_bacteria 2970068827 2970071333 340
543 iso_pu_bacteria 2970076120 2970080285 340
544 iso_pu_bacteria 2970082768 2970085739 340
545 iso_pu_bacteria 2970088815 2970094715 340
546 iso_pu_bacteria 2970095765 2970097317 340
547 iso_pu_bacteria 2970102677 2970105872 340
548 iso_pu_bacteria 2970109326 2970116117 340
549 iso_pu_bacteria 2970116247 2970119646 340
550 iso_pu_bacteria 2970122695 2970126613 340
551 iso_pu_bacteria 2970129317 2970134899 340
552 iso_pu_bacteria 2970136068 2970140920 340
553 iso_pu_bacteria 2970143518 2970148428 340
554 iso_pu_bacteria 2970149975 2970153153 340
555 iso_pu_bacteria 2970156795 2970162985 340
556 iso_pu_bacteria 2970164137 2970164679 340
557 iso_pu_bacteria 2970170962 2970174345 340
558 iso_pu_bacteria 2970177841 2970182393 340
559 iso_pu_bacteria 2970184632 2970191265 340
560 iso_pu_bacteria 2970191845 2970194709 340
561 iso_pu_bacteria 2977516862 2977518764 340
562 iso_pu_bacteria 2977523885 2977526659 340
563 iso_pu_bacteria 2977530762 2977533894 340
564 iso_pu_bacteria 2977537788 2977541288 340
565 iso_pu_bacteria 2977544691 2977547982 340
566 iso_pu_bacteria 2977551784 2977557894 340
567 iso_pu_bacteria 2977558990 2977559536 340
568 iso_pu_bacteria 2977565890 2977569180 340
569 iso_pu_bacteria 2977572785 2977578690 340
570 iso_pu_bacteria 2977579622 2977585635 340
571 iso_pu_bacteria 2989349275 2989350092 340
572 iso_pu_bacteria 2989771324 2989773237 340
573 iso_pu_bacteria 3002141150 3002144396 340
574 iso_pu_bacteria 648276728 648740960 340
575 iso_pu_bacteria 8003151029 8003154761 340
576 iso_pu_bacteria 8003992118 8003996307 340
577 iso_pu_bacteria 8003999396 8004004038 340
578 iso_pu_bacteria 8054558443 8054559154 340
579 iso_pu_bacteria 8055431914 8055432370 340
580 iso_pu_bacteria 8056875544 8056875816 340
581 3300030522 Ga0307512_10006312 Ga0307512_100063125 341
582 3300046460 Ga0495638_0170738 Ga0495638_0170738_76_1140 341
583 3300046499 Ga0495594_0115828 Ga0495594_0115828_343_1407 341
584 iso_pu_bacteria 2508501114 2509074254 341
585 iso_pu_bacteria 2509276021 2509391764 341
586 iso_pu_bacteria 2509276033 2509447375 341
587 iso_pu_bacteria 2510461076 2510895650 341
588 iso_pu_bacteria 2510917028 2511182445 341
589 iso_pu_bacteria 2510917030 2511199295 341
590 iso_pu_bacteria 2513237088 2513597644 341
591 iso_pu_bacteria 2513237138 2513865952 341
592 iso_pu_bacteria 2513237144 2513908509 341
593 iso_pu_bacteria 2513237146 2513925148 341
594 iso_pu_bacteria 2513237159 2513997651 341
595 iso_pu_bacteria 2513237162 2514018039 341
596 iso_pu_bacteria 2515154113 2515635099 341
597 iso_pu_bacteria 2515154114 2515645541 341
598 iso_pu_bacteria 2515154116 2515655079 341
599 iso_pu_bacteria 2519899620 2520377008 341
600 iso_pu_bacteria 2524023209 2524458886 341
601 iso_pu_bacteria 2529292951 2530646536 341
602 iso_pu_bacteria 2534681796 2535517131 341
603 iso_pu_bacteria 2537561587 2537877183 341
604 iso_pu_bacteria 2554235003 2554248424 341
605 iso_pu_bacteria 2558860242 2559295540 341
606 iso_pu_bacteria 2582581283 2585167476 341
607 iso_pu_bacteria 2582581294 2585201971 341
608 iso_pu_bacteria 2582581298 2585225373 341
609 iso_pu_bacteria 2582581299 2585228546 341
610 iso_pu_bacteria 2582581304 2585258240 341
611 iso_pu_bacteria 2582581306 2585265697 341
612 iso_pu_bacteria 2582581307 2585271381 341
613 iso_pu_bacteria 2582581865 2585388903 341
614 iso_pu_bacteria 2582581866 2585395398 341
615 iso_pu_bacteria 2582581867 2585400984 341
616 iso_pu_bacteria 2585427529 2585547929 341
617 iso_pu_bacteria 2585427531 2585559124 341
618 iso_pu_bacteria 2585427590 2585822114 341
619 iso_pu_bacteria 2585427594 2585843504 341
620 iso_pu_bacteria 2585427608 2585898505 341
621 iso_pu_bacteria 2585427609 2585903930 341
622 iso_pu_bacteria 2585428125 2587980952 341
623 iso_pu_bacteria 2599185170 2599417054 341
624 iso_pu_bacteria 2599185210 2599601861 341
625 iso_pu_bacteria 2600255279 2601609884 341
626 iso_pu_bacteria 2600255308 2601746659 341
627 iso_pu_bacteria 2615840624 2616293104 341
628 iso_pu_bacteria 2643221558 2643811284 341
629 iso_pu_bacteria 2643221568 2643856553 341
630 iso_pu_bacteria 2643221582 2643920141 341
631 iso_pu_bacteria 2643221599 2644007009 341
632 iso_pu_bacteria 2643221607 2644050203 341
633 iso_pu_bacteria 2643221634 2644191795 341
634 iso_pu_bacteria 2643221636 2644204736 341
635 iso_pu_bacteria 2643221637 2644208762 341
636 iso_pu_bacteria 2643221643 2644242589 341
637 iso_pu_bacteria 2643221686 2644483123 341
638 iso_pu_bacteria 2643221688 2644494282 341
639 iso_pu_bacteria 2643221689 2644497769 341
640 iso_pu_bacteria 2643221693 2644521765 341
641 iso_pu_bacteria 2643221718 2644652292 341
642 iso_pu_bacteria 2718217882 2719182051 341
643 iso_pu_bacteria 2718217927 2719386665 341
644 iso_pu_bacteria 2718217997 2719666413 341
645 iso_pu_bacteria 2718218009 2719732767 341
646 iso_pu_bacteria 2718218199 2720492833 341
647 iso_pu_bacteria 2718218232 2720614301 341
648 iso_pu_bacteria 2718218233 2720621070 341
649 iso_pu_bacteria 2718218235 2720632394 341
650 iso_pu_bacteria 2718218269 2720776122 341
651 iso_pu_bacteria 2718218363 2721148142 341
652 iso_pu_bacteria 2718218365 2721159594 341
653 iso_pu_bacteria 2718218366 2721164978 341
654 iso_pu_bacteria 2718218423 2721400371 341
655 iso_pu_bacteria 2721755514 2722841148 341
656 iso_pu_bacteria 2721755556 2723027721 341
657 iso_pu_bacteria 2721755684 2723561349 341
658 iso_pu_bacteria 2721755685 2723567972 341
659 iso_pu_bacteria 2721755809 2724039184 341
660 iso_pu_bacteria 2721755810 2724045523 341
661 iso_pu_bacteria 2721755819 2724090729 341
662 iso_pu_bacteria 2721755822 2724105237 341
663 iso_pu_bacteria 2721755823 2724111064 341
664 iso_pu_bacteria 2728369352 2730108657 341
665 iso_pu_bacteria 2728369365 2730165286 341
666 iso_pu_bacteria 2728369397 2730299226 341
667 iso_pu_bacteria 2738541293 2738800351 341
668 iso_pu_bacteria 2773857925 2774869458 341
669 iso_pu_bacteria 2791355256 2793294176 341
670 iso_pu_bacteria 2791355259 2793319188 341
671 iso_pu_bacteria 2791355261 2793331985 341
672 iso_pu_bacteria 2791355262 2793335482 341
673 iso_pu_bacteria 2791355263 2793339530 341
674 iso_pu_bacteria 2791355264 2793346996 341
675 iso_pu_bacteria 2791355265 2793351582 341
676 iso_pu_bacteria 2791355267 2793367637 341
677 iso_pu_bacteria 2802429605 2805926816 341
678 iso_pu_bacteria 2802429606 2805932727 341
679 iso_pu_bacteria 2808606387 2808987725 341
680 iso_pu_bacteria 2818991439 2819559258 341
681 iso_pu_bacteria 2818991442 2819578193 341
682 iso_pu_bacteria 2821136567 2821139302 341
683 iso_pu_bacteria 2838016132 2838022403 341
684 iso_pu_bacteria 2838022645 2838023598 341
685 iso_pu_bacteria 2838035591 2838038740 341
686 iso_pu_bacteria 2838048938 2838053294 341
687 iso_pu_bacteria 2838061910 2838065411 341
688 iso_pu_bacteria 2838068647 2838069890 341
689 iso_pu_bacteria 2838661181 2838661337 341
690 iso_pu_bacteria 2838668709 2838670622 341
691 iso_pu_bacteria 2838675328 2838675570 341
692 iso_pu_bacteria 2838680041 2838683188 341
693 iso_pu_bacteria 2838686498 2838686783 341
694 iso_pu_bacteria 2838694306 2838697868 341
695 iso_pu_bacteria 2838701080 2838702993 341
696 iso_pu_bacteria 2838707686 2838710983 341
697 iso_pu_bacteria 2838714209 2838714452 341
698 iso_pu_bacteria 2838719591 2838721747 341
699 iso_pu_bacteria 2838724970 2838725212 341
700 iso_pu_bacteria 2838729681 2838730259 341
701 iso_pu_bacteria 2838742623 2838742726 341
702 iso_pu_bacteria 2841846520 2841848731 341
703 iso_pu_bacteria 2841851746 2841854611 341
704 iso_pu_bacteria 2841859092 2841862330 341
705 iso_pu_bacteria 2841864319 2841867217 341
706 iso_pu_bacteria 2842077413 2842079158 341
707 iso_pu_bacteria 2842110456 2842112998 341
708 iso_pu_bacteria 2842118031 2842118331 341
709 iso_pu_bacteria 2842124991 2842125238 341
710 iso_pu_bacteria 2842130223 2842130465 341
711 iso_pu_bacteria 2842146304 2842151884 341
712 iso_pu_bacteria 2842152218 2842154365 341
713 iso_pu_bacteria 2842156927 2842158369 341
714 iso_pu_bacteria 2842163707 2842168528 341
715 iso_pu_bacteria 2842170452 2842170694 341
716 iso_pu_bacteria 2842175837 2842177985 341
717 iso_pu_bacteria 2842180545 2842181985 341
718 iso_pu_bacteria 2842187318 2842187561 341
719 iso_pu_bacteria 2842192696 2842195795 341
720 iso_pu_bacteria 2842198810 2842199112 341
721 iso_pu_bacteria 2842205361 2842209552 341
722 iso_pu_bacteria 2842211629 2842211872 341
723 iso_pu_bacteria 2842224351 2842226509 341
724 iso_pu_bacteria 2842229732 2842230016 341
725 iso_pu_bacteria 2842237096 2842240245 341
726 iso_pu_bacteria 2842243621 2842243905 341
727 iso_pu_bacteria 2842250916 2842257094 341
728 iso_pu_bacteria 2842257432 2842258010 341
729 iso_pu_bacteria 2842264693 2842267810 341
730 iso_pu_bacteria 2842271015 2842271679 341
731 iso_pu_bacteria 2842278818 2842283006 341
732 iso_pu_bacteria 2842285085 2842285350 341
733 iso_pu_bacteria 2842291075 2842292820 341
734 iso_pu_bacteria 2842298080 2842298238 341
735 iso_pu_bacteria 2842311132 2842313962 341
736 iso_pu_bacteria 2842317721 2842319799 341
737 iso_pu_bacteria 2842341865 2842348110 341
738 iso_pu_bacteria 2842357229 2842360162 341
739 iso_pu_bacteria 2842363717 2842368356 341
740 iso_pu_bacteria 2842370503 2842373818 341
741 iso_pu_bacteria 2842377471 2842379217 341
742 iso_pu_bacteria 2842384541 2842384842 341
743 iso_pu_bacteria 2842395702 2842400083 341
744 iso_pu_bacteria 2842402390 2842402710 341
745 iso_pu_bacteria 2842409023 2842409919 341
746 iso_pu_bacteria 2842415677 2842416567 341
747 iso_pu_bacteria 2842422224 2842423504 341
748 iso_pu_bacteria 2842428310 2842430454 341
749 iso_pu_bacteria 2842434925 2842436734 341
750 iso_pu_bacteria 2842441272 2842443424 341
751 iso_pu_bacteria 2842447887 2842449295 341
752 iso_pu_bacteria 2842462802 2842466708 341
753 iso_pu_bacteria 2842469257 2842471396 341
754 iso_pu_bacteria 2842489311 2842493656 341
755 iso_pu_bacteria 2842495871 2842497811 341
756 iso_pu_bacteria 2842509118 2842514240 341
757 iso_pu_bacteria 2842515876 2842519114 341
758 iso_pu_bacteria 2842521101 2842522106 341
759 iso_pu_bacteria 2844454524 2844458080 341
760 iso_pu_bacteria 2852387548 2852390520 341
761 iso_pu_bacteria 2857516855 2857517156 341
762 iso_pu_bacteria 2883068021 2883068662 341
763 iso_pu_bacteria 2894232714 2894242049 341
764 iso_pu_bacteria 2899792073 2899794068 341
765 iso_pu_bacteria 2899845264 2899848802 341
766 iso_pu_bacteria 2904467357 2904473132 341
767 iso_pu_bacteria 2919100787 2919106187 341
768 iso_pu_bacteria 2919114240 2919114488 341
769 iso_pu_bacteria 2919166419 2919169524 341
770 iso_pu_bacteria 2923556063 2923561122 341
771 iso_pu_bacteria 2926754445 2926755503 341
772 iso_pu_bacteria 2926760298 2926762634 341
773 iso_pu_bacteria 2929138655 2929141056 341
774 iso_pu_bacteria 2933006813 2933009009 341
775 iso_pu_bacteria 2933011516 2933014713 341
776 iso_pu_bacteria 2933016740 2933017994 341
777 iso_pu_bacteria 2933594066 2933596395 341
778 iso_pu_bacteria 2933599457 2933600696 341
779 iso_pu_bacteria 2935894831 2935896747 341
780 iso_pu_bacteria 2936381700 2936387779 341
781 iso_pu_bacteria 2978969890 2978971925 341
782 iso_pu_bacteria 2979089926 2979092053 341
783 iso_pu_bacteria 2979095461 2979100558 341
784 iso_pu_bacteria 2979100975 2979104113 341
785 iso_pu_bacteria 2984509177 2984511317 341
786 iso_pu_bacteria 2984518228 2984522322 341
787 iso_pu_bacteria 2984537506 2984541624 341
788 iso_pu_bacteria 2984587000 2984590209 341
789 iso_pu_bacteria 2984601300 2984603897 341
790 iso_pu_bacteria 2996887358 2996892786 341
791 iso_pu_bacteria 3005409236 3005414302 341
792 iso_pu_bacteria 3005445848 3005448718 341
793 iso_pu_bacteria 3005452660 3005454948 341
794 iso_pu_bacteria 650716007 650740750 341
795 iso_pu_bacteria 8003570095 8003571827 341
796 iso_pu_bacteria 8005258706 8005259447 341
797 iso_pu_bacteria 8005275841 8005281475 341
798 iso_pu_bacteria 8005282627 8005284557 341
799 iso_pu_bacteria 8005289223 8005295775 341
800 iso_pu_bacteria 8005301065 8005303385 341
801 iso_pu_bacteria 8005321885 8005327313 341
802 iso_pu_bacteria 8005382845 8005388855 341
803 iso_pu_bacteria 8005395548 8005395838 341
804 iso_pu_bacteria 8005430974 8005437541 341
805 iso_pu_bacteria 8005497431 8005501156 341
806 iso_pu_bacteria 8005542996 8005545945 341
807 iso_pu_bacteria 8005619151 8005622522 341
808 iso_pu_bacteria 8005626139 8005630024 341
809 iso_pu_bacteria 8005668836 8005672574 341
810 iso_pu_bacteria 8005688590 8005691844 341
811 iso_pu_bacteria 8005695170 8005697672 341
812 iso_pu_bacteria 8018127388 8018127941 341
813 iso_pu_bacteria 8018150411 8018151303 341
814 iso_pu_bacteria 8018176218 8018179495 341
815 iso_pu_bacteria 8024486573 8024488293 341
816 iso_pu_bacteria 8024501048 8024504696 341
817 iso_pu_bacteria 8056375014 8056377582 341
818 iso_pu_bacteria 8056382006 8056387173 341
819 3300005468 Ga0070707_100087505 Ga0070707_1000875053 342
820 3300005471 Ga0070698_100000606 Ga0070698_10000060624 342
821 3300005518 Ga0070699_100043988 Ga0070699_1000439883 342
822 3300005536 Ga0070697_100262384 Ga0070697_1002623842 342
823 3300005544 Ga0070686_100000679 Ga0070686_10000067913 342
824 3300013102 Ga0157371_10201799 Ga0157371_102017991 342
825 3300013307 Ga0157372_10043474 Ga0157372_100434741 342
826 3300025910 Ga0207684_10031226 Ga0207684_100312262 342
827 3300025922 Ga0207646_10001966 Ga0207646_100019663 342
828 3300027543 Ga0209999_1002293 Ga0209999_10022932 342
829 3300027695 Ga0209966_1000731 Ga0209966_100073110 342
830 3300027717 Ga0209998_10000251 Ga0209998_100002513 342
831 3300031548 Ga0307408_100197882 Ga0307408_1001978822 342
832 3300031548 Ga0307408_100271501 Ga0307408_1002715011 342
833 3300031824 Ga0307413_10020785 Ga0307413_100207852 342
834 3300031903 Ga0307407_10084226 Ga0307407_100842263 342
835 3300031911 Ga0307412_10081170 Ga0307412_100811701 342
836 3300031995 Ga0307409_100056996 Ga0307409_1000569963 342
837 3300031995 Ga0307409_100179030 Ga0307409_1001790303 342
838 3300032002 Ga0307416_100105576 Ga0307416_1001055762 342
839 3300032002 Ga0307416_100109528 Ga0307416_1001095283 342
840 3300032002 Ga0307416_100206252 Ga0307416_1002062522 342
841 3300032004 Ga0307414_10329729 Ga0307414_103297291 342
842 3300032005 Ga0307411_10038005 Ga0307411_100380052 342
843 3300042156 Ga0439446_0030897 Ga0439446_0030897_300_1337 342
844 3300047472 Ga0495686_0000011 Ga0495686_0000011_294445_295491 342
845 3300047472 Ga0495686_0031014 Ga0495686_0031014_2193_3239 342
846 3300049652 Ga0501202_001871 Ga0501202_001871_1143_2189 342
847 3300049660 Ga0501216_006033 Ga0501216_006033_240_1286 342
848 3300049661 Ga0501217_005039 Ga0501217_005039_528_1574 342
849 3300049669 Ga0501235_002828 Ga0501235_002828_2675_3721 342
850 3300049704 Ga0501221_001373 Ga0501221_001373_2945_3991 342
851 3300049705 Ga0501225_0007861 Ga0501225_0007861_1068_2114 342
852 3300049763 Ga0501266_003015 Ga0501266_003015_344_1390 342
853 3300049769 Ga0501272_005348 Ga0501272_005348_210_1256 342
854 iso_pu_bacteria 2510065019 2510134214 342
855 iso_pu_bacteria 2513237084 2513567704 342
856 iso_pu_bacteria 2513237085 2513578047 342
857 iso_pu_bacteria 2513237093 2513631861 342
858 iso_pu_bacteria 2513237103 2513707885 342
859 iso_pu_bacteria 2515075009 2515113380 342
860 iso_pu_bacteria 2515154134 2515739747 342
861 iso_pu_bacteria 2516653077 2517036983 342
862 iso_pu_bacteria 2516653085 2517077343 342
863 iso_pu_bacteria 2517093000 2517096102 342
864 iso_pu_bacteria 2517287029 2517407723 342
865 iso_pu_bacteria 2585427526 2585524771 342
866 iso_pu_bacteria 2585427528 2585538454 342
867 iso_pu_bacteria 2585427593 2585836407 342
868 iso_pu_bacteria 2724679232 2725945362 342
869 iso_pu_bacteria 2738541333 2739033095 342
870 iso_pu_bacteria 2765235942 2766066139 342
871 iso_pu_bacteria 2791355260 2793319433 342
872 iso_pu_bacteria 2791355266 2793362513 342
873 iso_pu_bacteria 2802429633 2806045234 342
874 iso_pu_bacteria 2802429634 2806049971 342
875 iso_pu_bacteria 2802429635 2806056809 342
876 iso_pu_bacteria 2802429636 2806064190 342
877 iso_pu_bacteria 2802429637 2806071458 342
878 iso_pu_bacteria 2933586486 2933588945 342
879 iso_pu_bacteria 2935901341 2935901689 342
880 iso_pu_bacteria 2936367885 2936371777 342
881 iso_pu_bacteria 2936375103 2936379612 342
882 iso_pu_bacteria 8005307578 8005313862 342
883 iso_pu_bacteria 8005376324 8005381191 342
884 iso_pu_bacteria 8005460587 8005464063 342
885 iso_pu_bacteria 8005556819 8005561484 342
886 iso_pu_bacteria 8005570704 8005573200 342
887 3300005347 Ga0070668_100158490 Ga0070668_1001584901 343
888 3300005539 Ga0068853_100294490 Ga0068853_1002944901 343
889 3300005564 Ga0070664_100005066 Ga0070664_1000050666 343
890 3300005718 Ga0068866_10086467 Ga0068866_100864672 343
891 3300006042 Ga0075368_10047152 Ga0075368_100471521 343
892 3300009148 Ga0105243_10017730 Ga0105243_100177303 343
893 3300010375 Ga0105239_10054482 Ga0105239_100544822 343
894 3300013100 Ga0157373_10265606 Ga0157373_102656061 343
895 3300013104 Ga0157370_10002249 Ga0157370_100022492 343
896 3300013297 Ga0157378_10084572 Ga0157378_100845722 343
897 3300025297 Ga0209758_1013729 Ga0209758_10137293 343
898 3300025972 Ga0207668_10157451 Ga0207668_101574512 343
899 3300028800 Ga0265338_10234998 Ga0265338_102349982 343
900 3300044658 Ga0466972_0025855 Ga0466972_0025855_1317_2378 343
901 3300044735 Ga0466968_0024899 Ga0466968_0024899_1153_2214 343
902 3300044901 Ga0466960_0044086 Ga0466960_0044086_302_1363 343
903 3300045976 Ga0466967_0087284 Ga0466967_0087284_1049_2125 343
904 3300046460 Ga0495638_0011748 Ga0495638_0011748_3443_4504 343
905 3300046660 Ga0495625_0074150 Ga0495625_0074150_1235_2266 343
906 3300047472 Ga0495686_0000267 Ga0495686_0000267_39960_40997 343
907 3300048923 Ga0496120_0002673 Ga0496120_0002673_11015_12076 343
908 3300053079 Ga0500610_0019102 Ga0500610_0019102_1210_2271 343
909 3300053125 Ga0500618_000050 Ga0500618_000050_93680_94711 343
910 iso_pu_bacteria 2896085136 2896089234 343
911 3300001989 JGI24739J22299_10005239 JGI24739J22299_100052393 344
912 3300001990 JGI24737J22298_10000371 JGI24737J22298_100003715 344
913 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001387 344
914 3300002738 JGI25154J39366_1000003 JGI25154J39366_1000003299 344
915 3300002741 JGI25157J39369_1004789 JGI25157J39369_10047891 344
916 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000435 344
917 3300003187 JGI25151J46595_10015560 JGI25151J46595_100155602 344
918 3300003215 JGI25153J46596_10000337 JGI25153J46596_1000033712 344
919 3300003215 JGI25153J46596_10016380 JGI25153J46596_100163801 344
920 3300003316 rootH1_10027007 rootH1_100270074 344
921 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021174 344
922 3300003354 JGI25160J50197_1006679 JGI25160J50197_10066794 344
923 3300003374 JGI25161J50226_1000458 JGI25161J50226_100045814 344
924 3300003775 Ga0055524_1000572 Ga0055524_100057227 344
925 3300003781 Ga0055536_1003722 Ga0055536_10037223 344
926 3300003781 Ga0055536_1004179 Ga0055536_10041793 344
927 3300003792 Ga0055540_1004137 Ga0055540_10041372 344
928 3300003794 Ga0055531_10002645 Ga0055531_1000264512 344
929 3300004625 Ga0055543_1000102 Ga0055543_100010235 344
930 3300005262 Ga0065165_1000033 Ga0065165_1000033174 344
931 3300005262 Ga0065165_1006399 Ga0065165_10063997 344
932 3300005288 Ga0065714_10077644 Ga0065714_100776442 344
933 3300005458 Ga0070681_10173837 Ga0070681_101738372 344
934 3300005530 Ga0070679_100025511 Ga0070679_1000255113 344
935 3300005563 Ga0068855_100016945 Ga0068855_1000169455 344
936 3300005577 Ga0068857_100052928 Ga0068857_1000529283 344
937 3300006051 Ga0075364_10011050 Ga0075364_100110504 344
938 3300006946 Ga0079104_1000015 Ga0079104_100001542 344
939 3300006946 Ga0079104_1008483 Ga0079104_10084832 344
940 3300013102 Ga0157371_10008491 Ga0157371_100084913 344
941 3300013105 Ga0157369_10099100 Ga0157369_100991003 344
942 3300013249 Ga0171463_1007 Ga0171463_100772 344
943 3300013306 Ga0163162_10006648 Ga0163162_100066483 344
944 3300013307 Ga0157372_10002540 Ga0157372_100025409 344
945 3300015690 Ga0183363_1098 Ga0183363_10988 344
946 3300021320 Ga0214544_1000110 Ga0214544_100011053 344
947 3300021321 Ga0214542_1000268 Ga0214542_100026827 344
948 3300021321 Ga0214542_1017541 Ga0214542_10175416 344
949 3300021327 Ga0214543_1000022 Ga0214543_1000022122 344
950 3300021327 Ga0214543_1000219 Ga0214543_100021928 344
951 3300022739 Ga0228711_1000911 Ga0228711_100091110 344
952 3300022740 Ga0228710_1001018 Ga0228710_100101810 344
953 3300025230 Ga0209563_102163 Ga0209563_1021633 344
954 3300025246 Ga0209646_1000004 Ga0209646_100000440 344
955 3300025250 Ga0209026_1000495 Ga0209026_100049510 344
956 3300025258 Ga0209129_1008779 Ga0209129_10087794 344
957 3300025284 Ga0209130_1000017 Ga0209130_1000017209 344
958 3300025292 Ga0209676_1002445 Ga0209676_10024458 344
959 3300025292 Ga0209676_1007475 Ga0209676_10074754 344
960 3300025294 Ga0209025_1000161 Ga0209025_100016135 344
961 3300025295 Ga0209564_1000013 Ga0209564_1000013657 344
962 3300025295 Ga0209564_1004207 Ga0209564_10042077 344
963 3300025297 Ga0209758_1000058 Ga0209758_1000058107 344
964 3300025297 Ga0209758_1001710 Ga0209758_100171016 344
965 3300025297 Ga0209758_1005872 Ga0209758_100587210 344
966 3300025298 Ga0209050_1003968 Ga0209050_10039685 344
967 3300025299 Ga0209256_1000153 Ga0209256_1000153106 344
968 3300025299 Ga0209256_1001905 Ga0209256_10019054 344
969 3300025302 Ga0207426_1000006 Ga0207426_1000006208 344
970 3300025302 Ga0207426_1000645 Ga0207426_10006454 344
971 3300025303 Ga0209051_1001806 Ga0209051_10018068 344
972 3300025304 Ga0209257_1002539 Ga0209257_100253914 344
973 3300025304 Ga0209257_1015317 Ga0209257_10153172 344
974 3300025912 Ga0207707_10000688 Ga0207707_1000068816 344
975 3300025921 Ga0207652_10017278 Ga0207652_100172782 344
976 3300025949 Ga0207667_10059502 Ga0207667_100595022 344
977 3300026116 Ga0207674_10057508 Ga0207674_100575083 344
978 3300027111 Ga0209281_1000034 Ga0209281_1000034317 344
979 3300027111 Ga0209281_1000314 Ga0209281_100031431 344
980 3300027666 Ga0209282_1000068 Ga0209282_100006831 344
981 3300031967 Ga0315914_1000937 Ga0315914_100093710 344
982 3300033430 Ga0315913_1000094 Ga0315913_100009429 344
983 3300033464 Ga0315915_1000007 Ga0315915_1000007272 344
984 3300041404 Ga0439436_0006315 Ga0439436_0006315_117_1157 344
985 3300041997 Ga0439431_0000193 Ga0439431_0000193_6101_7135 344
986 3300046492 Ga0495585_0000158 Ga0495585_0000158_16594_17631 344
987 3300046507 Ga0495606_0000241 Ga0495606_0000241_24759_25796 344
988 3300046507 Ga0495606_0059419 Ga0495606_0059419_314_1357 344
989 3300046512 Ga0495610_0001190 Ga0495610_0001190_5355_6392 344
990 3300046513 Ga0495616_0006637 Ga0495616_0006637_5893_6930 344
991 3300046558 Ga0495633_0004196 Ga0495633_0004196_1798_2835 344
992 3300046648 Ga0495611_0000756 Ga0495611_0000756_6076_7110 344
993 3300046660 Ga0495625_0000003 Ga0495625_0000003_178760_179797 344
994 3300046694 Ga0495649_0000002 Ga0495649_0000002_827196_828233 344
995 3300046810 Ga0495660_0016507 Ga0495660_0016507_2660_3697 344
996 3300048914 Ga0496111_0124082 Ga0496111_0124082_606_1664 344
997 3300048924 Ga0496121_0003530 Ga0496121_0003530_7554_8615 344
998 3300048924 Ga0496121_0019001 Ga0496121_0019001_1642_2814 344
999 3300048925 Ga0496122_0000462 Ga0496122_0000462_5134_6207 344
1000 3300048926 Ga0496123_0000048 Ga0496123_0000048_78340_79413 344
1001 3300048927 Ga0496124_0033203 Ga0496124_0033203_1838_2911 344
1002 3300048929 Ga0496126_0136493 Ga0496126_0136493_820_1914 344
1003 3300049569 Ga0501032_0127677 Ga0501032_0127677_90_1127 344
1004 3300049570 Ga0501033_0001531 Ga0501033_0001531_5535_6572 344
1005 3300049822 Ga0501035_0000597 Ga0501035_0000597_8425_9462 344
1006 3300050491 nmdc:mga00v17_213_c1 nmdc:mga00v17_213_c1_31230_32291 344
1007 3300053125 Ga0500618_001049 Ga0500618_001049_6868_7917 344
1008 3300053153 Ga0500616_0000798 Ga0500616_0000798_18883_19977 344
1009 iso_pu_bacteria 2585427634 2586001244 344
1010 iso_pu_bacteria 639633055 639649436 344
1011 iso_pu_bacteria 643692032 643826576 344
1012 iso_pu_bacteria 8024479707 8024482599 344
1013 iso_pu_bacteria 8049293176 8049295547 344
1014 3300001989 JGI24739J22299_10000277 JGI24739J22299_1000027712 345
1015 3300002739 JGI25158J39367_1000065 JGI25158J39367_10000656 345
1016 3300002773 JGI25152J39213_1002465 JGI25152J39213_10024655 345
1017 3300002773 JGI25152J39213_1009322 JGI25152J39213_10093222 345
1018 3300002987 JGI25159J45721_1000928 JGI25159J45721_100092811 345
1019 3300003187 JGI25151J46595_10000976 JGI25151J46595_100009766 345
1020 3300003187 JGI25151J46595_10003097 JGI25151J46595_1000309711 345
1021 3300003215 JGI25153J46596_10001913 JGI25153J46596_100019138 345
1022 3300003215 JGI25153J46596_10006900 JGI25153J46596_100069001 345
1023 3300003215 JGI25153J46596_10006915 JGI25153J46596_100069153 345
1024 3300003215 JGI25153J46596_10017234 JGI25153J46596_100172341 345
1025 3300003215 JGI25153J46596_10018304 JGI25153J46596_100183042 345
1026 3300003320 rootH2_10188461 rootH2_101884612 345
1027 3300003354 JGI25160J50197_1005161 JGI25160J50197_10051613 345
1028 3300003354 JGI25160J50197_1017667 JGI25160J50197_10176672 345
1029 3300003374 JGI25161J50226_1000370 JGI25161J50226_100037021 345
1030 3300003771 Ga0055526_1002521 Ga0055526_10025214 345
1031 3300003771 Ga0055526_1002639 Ga0055526_10026396 345
1032 3300003771 Ga0055526_1005973 Ga0055526_10059731 345
1033 3300003771 Ga0055526_1007839 Ga0055526_10078397 345
1034 3300003771 Ga0055526_1017995 Ga0055526_10179952 345
1035 3300003775 Ga0055524_1003096 Ga0055524_10030963 345
1036 3300003775 Ga0055524_1004469 Ga0055524_10044695 345
1037 3300003775 Ga0055524_1006818 Ga0055524_10068183 345
1038 3300003775 Ga0055524_1008955 Ga0055524_10089552 345
1039 3300003775 Ga0055524_1011136 Ga0055524_10111364 345
1040 3300003790 Ga0055528_1000158 Ga0055528_100015819 345
1041 3300003790 Ga0055528_1000180 Ga0055528_100018036 345
1042 3300003790 Ga0055528_1001038 Ga0055528_10010388 345
1043 3300003790 Ga0055528_1001879 Ga0055528_100187913 345
1044 3300003790 Ga0055528_1002874 Ga0055528_10028743 345
1045 3300003790 Ga0055528_1008297 Ga0055528_10082972 345
1046 3300003790 Ga0055528_1011400 Ga0055528_10114001 345
1047 3300003792 Ga0055540_1001786 Ga0055540_100178610 345
1048 3300003792 Ga0055540_1008283 Ga0055540_10082833 345
1049 3300003794 Ga0055531_10029590 Ga0055531_100295902 345
1050 3300003856 Ga0058692_1000498 Ga0058692_10004982 345
1051 3300003856 Ga0058692_1001790 Ga0058692_10017906 345
1052 3300004625 Ga0055543_1000060 Ga0055543_100006035 345
1053 3300004625 Ga0055543_1002223 Ga0055543_10022234 345
1054 3300005262 Ga0065165_1000019 Ga0065165_1000019185 345
1055 3300005262 Ga0065165_1019094 Ga0065165_10190942 345
1056 3300005262 Ga0065165_1037365 Ga0065165_10373652 345
1057 3300005336 Ga0070680_100013171 Ga0070680_1000131715 345
1058 3300005458 Ga0070681_10096322 Ga0070681_100963222 345
1059 3300005548 Ga0070665_100077525 Ga0070665_1000775252 345
1060 3300006038 Ga0075365_10002434 Ga0075365_100024347 345
1061 3300006038 Ga0075365_10109818 Ga0075365_101098181 345
1062 3300006048 Ga0075363_100061774 Ga0075363_1000617743 345
1063 3300006177 Ga0075362_10001162 Ga0075362_100011626 345
1064 3300006178 Ga0075367_10007596 Ga0075367_100075964 345
1065 3300006178 Ga0075367_10023563 Ga0075367_100235632 345
1066 3300006195 Ga0075366_10001492 Ga0075366_100014924 345
1067 3300006353 Ga0075370_10000198 Ga0075370_100001984 345
1068 3300006948 Ga0099826_10000102 Ga0099826_1000010218 345
1069 3300006948 Ga0099826_10028569 Ga0099826_100285695 345
1070 3300009011 Ga0105251_10039881 Ga0105251_100398812 345
1071 3300009148 Ga0105243_10013713 Ga0105243_100137134 345
1072 3300013102 Ga0157371_10000017 Ga0157371_10000017257 345
1073 3300013102 Ga0157371_10275051 Ga0157371_102750511 345
1074 3300013104 Ga0157370_10001031 Ga0157370_100010312 345
1075 3300013105 Ga0157369_10478317 Ga0157369_104783171 345
1076 3300015265 Ga0182005_1000248 Ga0182005_100024818 345
1077 3300025208 Ga0209436_100081 Ga0209436_10008114 345
1078 3300025208 Ga0209436_107254 Ga0209436_1072541 345
1079 3300025245 Ga0207425_1000884 Ga0207425_10008842 345
1080 3300025258 Ga0209129_1000324 Ga0209129_100032425 345
1081 3300025258 Ga0209129_1001769 Ga0209129_10017696 345
1082 3300025258 Ga0209129_1001856 Ga0209129_10018568 345
1083 3300025258 Ga0209129_1009902 Ga0209129_10099023 345
1084 3300025258 Ga0209129_1012601 Ga0209129_10126012 345
1085 3300025273 Ga0209673_1000010 Ga0209673_1000010531 345
1086 3300025273 Ga0209673_1000025 Ga0209673_1000025168 345
1087 3300025273 Ga0209673_1000042 Ga0209673_100004298 345
1088 3300025273 Ga0209673_1000112 Ga0209673_100011248 345
1089 3300025273 Ga0209673_1001842 Ga0209673_100184213 345
1090 3300025273 Ga0209673_1003328 Ga0209673_100332810 345
1091 3300025273 Ga0209673_1013806 Ga0209673_10138064 345
1092 3300025273 Ga0209673_1031347 Ga0209673_10313472 345
1093 3300025284 Ga0209130_1000023 Ga0209130_100002323 345
1094 3300025291 Ga0209675_1016053 Ga0209675_10160532 345
1095 3300025294 Ga0209025_1000091 Ga0209025_1000091162 345
1096 3300025294 Ga0209025_1000154 Ga0209025_1000154108 345
1097 3300025294 Ga0209025_1002028 Ga0209025_100202825 345
1098 3300025294 Ga0209025_1010302 Ga0209025_10103024 345
1099 3300025295 Ga0209564_1000265 Ga0209564_1000265106 345
1100 3300025295 Ga0209564_1000672 Ga0209564_100067239 345
1101 3300025295 Ga0209564_1000840 Ga0209564_100084019 345
1102 3300025295 Ga0209564_1001534 Ga0209564_100153413 345
1103 3300025295 Ga0209564_1003122 Ga0209564_100312212 345
1104 3300025295 Ga0209564_1004488 Ga0209564_10044889 345
1105 3300025295 Ga0209564_1011760 Ga0209564_10117602 345
1106 3300025297 Ga0209758_1001003 Ga0209758_100100316 345
1107 3300025297 Ga0209758_1002357 Ga0209758_10023579 345
1108 3300025297 Ga0209758_1015814 Ga0209758_10158143 345
1109 3300025297 Ga0209758_1017385 Ga0209758_10173852 345
1110 3300025297 Ga0209758_1059928 Ga0209758_10599282 345
1111 3300025298 Ga0209050_1000308 Ga0209050_100030820 345
1112 3300025299 Ga0209256_1000704 Ga0209256_100070432 345
1113 3300025299 Ga0209256_1000914 Ga0209256_100091428 345
1114 3300025299 Ga0209256_1002433 Ga0209256_10024339 345
1115 3300025299 Ga0209256_1002591 Ga0209256_100259113 345
1116 3300025299 Ga0209256_1003390 Ga0209256_100339010 345
1117 3300025299 Ga0209256_1011848 Ga0209256_10118481 345
1118 3300025302 Ga0207426_1000008 Ga0207426_100000848 345
1119 3300025302 Ga0207426_1000344 Ga0207426_100034451 345
1120 3300025302 Ga0207426_1000442 Ga0207426_10004424 345
1121 3300025302 Ga0207426_1000727 Ga0207426_100072727 345
1122 3300025302 Ga0207426_1000934 Ga0207426_100093410 345
1123 3300025303 Ga0209051_1000900 Ga0209051_100090021 345
1124 3300025303 Ga0209051_1001776 Ga0209051_100177616 345
1125 3300025303 Ga0209051_1024469 Ga0209051_10244692 345
1126 3300025304 Ga0209257_1001059 Ga0209257_10010599 345
1127 3300025917 Ga0207660_10086378 Ga0207660_100863782 345
1128 3300025935 Ga0207709_10038454 Ga0207709_100384542 345
1129 3300026067 Ga0207678_10097616 Ga0207678_100976161 345
1130 3300027312 Ga0209371_1000022 Ga0209371_1000022285 345
1131 3300027312 Ga0209371_1002629 Ga0209371_10026298 345
1132 3300027666 Ga0209282_1000233 Ga0209282_10002334 345
1133 3300027666 Ga0209282_1098979 Ga0209282_10989792 345
1134 3300028379 Ga0268266_10055968 Ga0268266_100559684 345
1135 3300028794 Ga0307515_10000017 Ga0307515_10000017120 345
1136 3300028794 Ga0307515_10000285 Ga0307515_1000028565 345
1137 3300028794 Ga0307515_10017812 Ga0307515_100178128 345
1138 3300030500 Ga0268256_1000019 Ga0268256_1000019235 345
1139 3300030500 Ga0268256_1004182 Ga0268256_10041825 345
1140 3300031548 Ga0307408_100086047 Ga0307408_1000860473 345
1141 3300031730 Ga0307516_10238587 Ga0307516_102385872 345
1142 3300031911 Ga0307412_10113041 Ga0307412_101130412 345
1143 3300031995 Ga0307409_100080716 Ga0307409_1000807162 345
1144 3300031995 Ga0307409_100206688 Ga0307409_1002066881 345
1145 3300032002 Ga0307416_100349632 Ga0307416_1003496322 345
1146 3300041406 Ga0439439_0023435 Ga0439439_0023435_340_1398 345
1147 3300041413 Ga0439465_0002280 Ga0439465_0002280_1082_2140 345
1148 3300041413 Ga0439465_0003936 Ga0439465_0003936_94_1182 345
1149 3300041498 Ga0451841_0096366 Ga0451841_0096366_174_1337 345
1150 3300041501 Ga0451845_0847798 Ga0451845_0847798_398_1561 345
1151 3300041503 Ga0451847_0116577 Ga0451847_0116577_2050_3213 345
1152 3300041507 Ga0451851_1182826 Ga0451851_1182826_467_1630 345
1153 3300041511 Ga0451855_1291386 Ga0451855_1291386_57_1127 345
1154 3300042185 Ga0450909_005545 Ga0450909_005545_57_1115 345
1155 3300046460 Ga0495638_0006177 Ga0495638_0006177_1686_2747 345
1156 3300046471 Ga0495650_0042525 Ga0495650_0042525_620_1783 345
1157 3300046476 Ga0495662_0032939 Ga0495662_0032939_663_1700 345
1158 3300046501 Ga0495607_0060841 Ga0495607_0060841_898_1968 345
1159 3300046506 Ga0495583_0008220 Ga0495583_0008220_2145_3206 345
1160 3300046507 Ga0495606_0044000 Ga0495606_0044000_1624_2787 345
1161 3300046512 Ga0495610_0020299 Ga0495610_0020299_88_1158 345
1162 3300046514 Ga0495618_0054244 Ga0495618_0054244_1275_2312 345
1163 3300046522 Ga0495643_0021519 Ga0495643_0021519_1013_2176 345
1164 3300046522 Ga0495643_0055688 Ga0495643_0055688_226_1296 345
1165 3300046524 Ga0495648_0065343 Ga0495648_0065343_439_1476 345
1166 3300046542 Ga0495597_0006901 Ga0495597_0006901_4609_5772 345
1167 3300046557 Ga0495622_0002319 Ga0495622_0002319_7107_8144 345
1168 3300046660 Ga0495625_0054729 Ga0495625_0054729_80_1138 345
1169 3300046674 Ga0495588_0063031 Ga0495588_0063031_442_1500 345
1170 3300046674 Ga0495588_0119993 Ga0495588_0119993_169_1206 345
1171 3300046809 Ga0495600_0082151 Ga0495600_0082151_841_1878 345
1172 3300046810 Ga0495660_0135315 Ga0495660_0135315_24_1187 345
1173 3300047317 Ga0495604_0006302 Ga0495604_0006302_8112_9149 345
1174 3300048907 Ga0496104_0124386 Ga0496104_0124386_953_2203 345
1175 3300048909 Ga0496106_0002934 Ga0496106_0002934_10278_11348 345
1176 3300048916 Ga0496113_0284132 Ga0496113_0284132_122_1183 345
1177 3300048919 Ga0496116_0000105 Ga0496116_0000105_149948_151009 345
1178 3300048919 Ga0496116_0023268 Ga0496116_0023268_2846_3907 345
1179 3300048920 Ga0496117_0000002 Ga0496117_0000002_261342_262403 345
1180 3300048920 Ga0496117_0026624 Ga0496117_0026624_1576_2637 345
1181 3300048920 Ga0496117_0070697 Ga0496117_0070697_96_1166 345
1182 3300048921 Ga0496118_0000566 Ga0496118_0000566_18725_19786 345
1183 3300048921 Ga0496118_0011165 Ga0496118_0011165_6134_7318 345
1184 3300048922 Ga0496119_0016503 Ga0496119_0016503_835_1896 345
1185 3300048923 Ga0496120_0000309 Ga0496120_0000309_40894_41955 345
1186 3300048924 Ga0496121_0000003 Ga0496121_0000003_598811_599872 345
1187 3300048924 Ga0496121_0000007 Ga0496121_0000007_827892_828932 345
1188 3300048924 Ga0496121_0023979 Ga0496121_0023979_4256_5326 345
1189 3300048924 Ga0496121_0026584 Ga0496121_0026584_1880_2950 345
1190 3300048925 Ga0496122_0000004 Ga0496122_0000004_383273_384334 345
1191 3300048925 Ga0496122_0028634 Ga0496122_0028634_2107_3168 345
1192 3300048925 Ga0496122_0050450 Ga0496122_0050450_669_1730 345
1193 3300048926 Ga0496123_0000007 Ga0496123_0000007_383273_384334 345
1194 3300048926 Ga0496123_0023196 Ga0496123_0023196_321_1391 345
1195 3300048926 Ga0496123_0120031 Ga0496123_0120031_152_1213 345
1196 3300048927 Ga0496124_0000067 Ga0496124_0000067_162904_163965 345
1197 3300048927 Ga0496124_0041410 Ga0496124_0041410_1312_2373 345
1198 3300048927 Ga0496124_0052030 Ga0496124_0052030_1640_2701 345
1199 3300048927 Ga0496124_0068340 Ga0496124_0068340_1783_2844 345
1200 3300048928 Ga0496125_0001144 Ga0496125_0001144_33031_34092 345
1201 3300048928 Ga0496125_0028117 Ga0496125_0028117_3150_4400 345
1202 3300048929 Ga0496126_0000188 Ga0496126_0000188_96360_97421 345
1203 3300048929 Ga0496126_0151881 Ga0496126_0151881_832_1893 345
1204 3300048929 Ga0496126_0199317 Ga0496126_0199317_493_1554 345
1205 3300048929 Ga0496126_0292526 Ga0496126_0292526_19_1080 345
1206 3300049575 Ga0501039_0162628 Ga0501039_0162628_212_1309 345
1207 3300049586 Ga0501070_0036858 Ga0501070_0036858_2574_3689 345
1208 3300049590 Ga0501074_0236053 Ga0501074_0236053_13_1128 345
1209 3300050489 nmdc:mga03683_476_c1 nmdc:mga03683_476_c1_10270_11340 345
1210 3300050491 nmdc:mga00v17_13475_c1 nmdc:mga00v17_13475_c1_1372_2433 345
1211 3300050491 nmdc:mga00v17_7_c1 nmdc:mga00v17_7_c1_9255_10505 345
1212 3300050492 nmdc:mga0yw44_144512_c1 nmdc:mga0yw44_144512_c1_285_1355 345
1213 3300050492 nmdc:mga0yw44_83977_c1 nmdc:mga0yw44_83977_c1_137_1198 345
1214 3300050493 nmdc:mga0k408_28719_c1 nmdc:mga0k408_28719_c1_452_1522 345
1215 3300050496 nmdc:mga07m45_4102_c1 nmdc:mga07m45_4102_c1_2093_3163 345
1216 3300050516 nmdc:mga0sz30_115_c1 nmdc:mga0sz30_115_c1_1258_2508 345
1217 3300050516 nmdc:mga0sz30_14176_c1 nmdc:mga0sz30_14176_c1_234_1304 345
1218 3300050516 nmdc:mga0sz30_49354_c1 nmdc:mga0sz30_49354_c1_133_1194 345
1219 3300053085 Ga0495619_0122504 Ga0495619_0122504_338_1375 345
1220 3300053107 Ga0500560_019545 Ga0500560_019545_668_1729 345
1221 3300053134 Ga0500658_0000323 Ga0500658_0000323_12745_13815 345
1222 3300053139 Ga0500568_0001573 Ga0500568_0001573_2971_4041 345
1223 3300053140 Ga0500573_0003303 Ga0500573_0003303_6319_7380 345
1224 3300053148 Ga0500590_000218 Ga0500590_000218_9260_10297 345
1225 3300053153 Ga0500616_0017076 Ga0500616_0017076_622_1785 345
1226 3300053156 Ga0500622_0000597 Ga0500622_0000597_13946_15016 345
1227 3300053157 Ga0500624_000239 Ga0500624_000239_2303_3364 345
1228 3300053160 Ga0500633_0005572 Ga0500633_0005572_600_1670 345
1229 3300053161 Ga0500634_0012891 Ga0500634_0012891_3054_4115 345
1230 3300053177 Ga0500636_0000003 Ga0500636_0000003_40076_41137 345
1231 3300053177 Ga0500636_0003175 Ga0500636_0003175_1587_2648 345
1232 3300060353 Ga0501082_0201211 Ga0501082_0201211_59_1108 345
1233 iso_pu_bacteria 2842217011 2842218211 345
1234 iso_pu_bacteria 2842304105 2842305310 345
1235 iso_pu_bacteria 2933570622 2933571117 345
1236 iso_pu_bacteria 2996893221 2996897903 345
1237 iso_pu_bacteria 8005563573 8005568263 345
1238 iso_pu_bacteria 8018163183 8018164304 345
1239 iso_pu_bacteria 8023680758 8023682902 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

64

367

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.979 1 342
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9706 1 342
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8944 1 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8867 1 337
1luc-assembly1.cif.gz_A bacterial luciferase 0.8747 1 339
ID Description Score Start End Superfamily
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9765 1 342 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9708 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9398 1 343 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9265 1 343 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8474 1 339 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A4Q3SBL9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9913 1 304 GO:0004497
GO:0005829
GO:0016705
AF-A0A4Q3RN81-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9853 92 332 GO:0004497
GO:0005829
GO:0016705
AF-A0A4Q3SBL9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9848 1 304 GO:0004497
GO:0005829
GO:0016705
AF-A0A6J4T203-F1-model_v4 Oxidoreductase 0.9807 136 343 GO:0004497
GO:0005829
GO:0016705
AF-A0A4Q3B298-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9802 159 342 GO:0004497
GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
95.05 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map