F492069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1239 | 928 | 659 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300006948|Ga0099826_10000102|Ga0099826_1000010218 |
| Length | 416 |
| Sequence | MPKGGGLAIVISGAISGGTSGKGGSVVNPAAPIHFFEAKLPDFAFVCEGIRAYLSGKQTEVSSMELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSGGRAEIMAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAMGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVMNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQMAIGLMPHDQIMRGIELYGTKVAPLVRKELTGSADPVKATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 14 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 25 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 26 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 27 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 28 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 31 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 32 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 33 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 34 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 35 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 36 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 37 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 38 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 39 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 40 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 41 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 42 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 43 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 44 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 45 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 46 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 47 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 48 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 49 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 50 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 51 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 52 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 53 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 54 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 55 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 56 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 57 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 58 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 59 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 60 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 61 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 62 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 63 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 64 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 65 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 66 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 67 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 68 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 69 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 70 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 71 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 72 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 73 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 74 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 75 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 76 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 77 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 78 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 79 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 80 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 81 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 82 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 83 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 84 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 85 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 86 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 87 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 88 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 89 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 90 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 91 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 92 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 93 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 94 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 95 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 96 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 97 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 98 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 99 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 100 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 101 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 102 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 103 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 104 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 105 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 106 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 107 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 108 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 109 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 110 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 111 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 112 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 113 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 114 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 115 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 116 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 117 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 118 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 119 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 120 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 121 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 122 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 123 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 124 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 125 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 126 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 127 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 128 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 129 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 130 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 131 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 132 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 133 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 134 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 135 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 136 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 137 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 138 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 139 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 140 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 141 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 142 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 143 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 144 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 145 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 146 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 147 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 148 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 149 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 150 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 151 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 152 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 153 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 154 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 155 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 156 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 157 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 158 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 159 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 160 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 161 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 162 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 163 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 164 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 165 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 166 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 167 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 168 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 169 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 170 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 171 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 172 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 173 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 174 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 175 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 176 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 177 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 178 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 179 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 180 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 181 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 182 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 183 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 184 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 185 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 186 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 187 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 188 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 189 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 190 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 191 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 192 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 193 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 194 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 195 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 196 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 197 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 198 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 199 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 200 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 201 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 202 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 203 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 204 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 205 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 206 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 207 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 208 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 209 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 210 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 211 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 212 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 213 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 214 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 215 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 216 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 217 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 218 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 219 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 220 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 221 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 222 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 223 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 224 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 225 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 226 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 227 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 228 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 229 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 230 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 231 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 232 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 233 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 234 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 235 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 236 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 237 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 238 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 239 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 240 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 241 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 242 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 243 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 244 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 245 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 246 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 247 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 248 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 249 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 250 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 251 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 252 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 253 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 254 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 255 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 256 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 257 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 258 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 259 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 260 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 261 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 262 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 263 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 264 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 265 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 266 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 267 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 268 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 269 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 270 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 271 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 272 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 273 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 274 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 275 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 276 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 277 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 278 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 279 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 280 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 281 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 282 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 283 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 284 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 285 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 286 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 287 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 288 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 289 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 290 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 291 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 292 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 293 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 294 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 295 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 296 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 297 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 298 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 299 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 300 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 301 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 302 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 303 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 304 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 305 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 306 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 307 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 308 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 309 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 310 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 311 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 312 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 313 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 314 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 315 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 316 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 317 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 318 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 319 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 320 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 321 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 322 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 323 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 324 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 325 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 326 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 327 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 328 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 329 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 330 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 331 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 332 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 333 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 334 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 335 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 336 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 337 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 338 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 339 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 340 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 341 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 342 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 343 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 344 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 345 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 346 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 347 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 348 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 349 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 350 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 351 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 352 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 353 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 354 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 355 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 356 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 357 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 358 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 359 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 360 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 361 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 362 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 363 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 364 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 365 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 366 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 367 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 368 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 369 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 370 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 371 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 372 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 373 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 374 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 375 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 376 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 377 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 378 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 379 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 380 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 381 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 382 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 383 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 384 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 385 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 386 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 387 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 388 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 389 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 390 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 391 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 392 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 393 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 394 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 395 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 396 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 397 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 398 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 399 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 400 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 401 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 402 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 403 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 404 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 405 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 406 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 407 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 408 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 409 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 410 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 411 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 412 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 413 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 414 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 415 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 416 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 417 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 418 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 419 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 420 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 421 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 422 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 423 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 424 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 425 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 426 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 427 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 428 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 429 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 430 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 431 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 432 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 433 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 434 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 435 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 436 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 437 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 438 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 439 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 440 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 441 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 442 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 443 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 444 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 445 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 446 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 447 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 448 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 449 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 450 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 451 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 452 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 453 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 454 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 455 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 456 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 457 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 458 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 459 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 460 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 461 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 462 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 463 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 464 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 465 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 466 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 467 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 468 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 469 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 470 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 471 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 472 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 473 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 474 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 475 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 476 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 477 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 478 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 479 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 480 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 481 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 482 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 483 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 484 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 485 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 486 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 487 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 488 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 489 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 490 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 491 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 492 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 493 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 494 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 495 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 496 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 497 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 498 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 499 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 500 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 501 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 502 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 503 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 504 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 505 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 506 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 507 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 508 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 509 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 510 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 511 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 512 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 513 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 514 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 515 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 516 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 517 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 518 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 519 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 520 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 521 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 522 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 523 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 524 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 525 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 526 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 527 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 528 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 529 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 530 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 531 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 532 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 533 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 534 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 535 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 536 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 537 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 538 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 539 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 540 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 541 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 542 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 543 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 544 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 545 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 546 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 547 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 548 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 549 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 550 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 551 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 552 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 553 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 554 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 555 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 556 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 557 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 558 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 559 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 560 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 561 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 562 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 563 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 564 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 565 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 566 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 567 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 568 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 569 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 570 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 571 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 572 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 573 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 574 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 575 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 576 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 577 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 578 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 579 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 580 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 581 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 582 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 583 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 584 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 585 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 586 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 587 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 588 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 589 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 590 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 591 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 592 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 593 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 594 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 595 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 596 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 598 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 599 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 600 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 602 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 603 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 604 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 605 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 606 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 607 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 608 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 609 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 610 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 611 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 612 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 613 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 614 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 615 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 616 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 617 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 618 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 619 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 620 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 621 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 622 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 623 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 624 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 625 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 626 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 627 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 628 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 629 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 630 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 631 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 632 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 633 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 634 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 635 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 636 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 637 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 638 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 639 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 640 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 641 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 642 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 643 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 644 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 645 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 646 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 647 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 648 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 649 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 650 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 651 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 652 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 653 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 655 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 657 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 658 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 659 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 661 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 663 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 664 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 665 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 666 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 668 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 684 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 687 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 692 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 693 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 694 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 695 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 696 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 697 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 698 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 699 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 700 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 701 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 702 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 703 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 704 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 705 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 706 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 707 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 708 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 709 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 710 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 711 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 712 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 713 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 714 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 715 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 716 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 717 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 718 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 719 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 720 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 721 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 722 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 723 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 724 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 725 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 726 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 727 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 728 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 729 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 730 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 731 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 732 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 733 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 734 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 735 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 736 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 737 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 738 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 739 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 740 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 741 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 742 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 743 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 744 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 806 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 807 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 808 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 809 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 810 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 811 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 812 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 813 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 814 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 815 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 816 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 817 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 818 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 819 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 820 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 821 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 822 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 823 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 824 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 825 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 826 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 827 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 829 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 830 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 831 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 832 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 833 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 834 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 835 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 836 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 837 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 839 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 840 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 841 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 842 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 843 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 844 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 845 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 846 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 847 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 848 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 849 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 850 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 851 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 852 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 853 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 854 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 855 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 856 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 857 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 858 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 859 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 860 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 861 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 862 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 863 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 864 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 865 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 866 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 867 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 868 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 869 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 870 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 871 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 872 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 873 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 874 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 875 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 876 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 877 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 878 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 879 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 880 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 881 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 882 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 883 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 884 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 885 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 886 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 887 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 888 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 889 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 890 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 891 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 892 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 893 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 894 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 895 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 896 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 897 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 898 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 899 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 900 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 901 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 902 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 903 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 904 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 905 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 906 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 907 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 908 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 909 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 910 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 911 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 912 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 913 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 914 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 915 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 916 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 917 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 918 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 919 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 920 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 921 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 922 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 923 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 924 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 925 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 926 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 927 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 928 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.19 |
| Metatranscriptomes | 0 |
| Isolates | 46.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 15.98 |
| Nodule | 35.92 |
| Rhizoplane | 1.53 |
| Rhizosphere | 31.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000277 | 3300001989 | Bacteria | 17174 |
| 2 | JGI24739J22299_10005239 | 3300001989 | Bacteria | 4940 |
| 3 | JGI24737J22298_10000371 | 3300001990 | Bacteria | 15252 |
| 4 | JGI24735J21928_10000001 | 3300002067 | Bacteria | 650042 |
| 5 | JGI25154J39366_1000003 | 3300002738 | Bacteria | 397627 |
| 6 | JGI25158J39367_1000065 | 3300002739 | Bacteria | 23421 |
| 7 | JGI25157J39369_1004789 | 3300002741 | Bacteria | 2355 |
| 8 | JGI25152J39213_1002465 | 3300002773 | Bacteria | 7020 |
| 9 | JGI25152J39213_1009322 | 3300002773 | Bacteria | 2341 |
| 10 | JGI25150J39212_1004958 | 3300002774 | Bacteria | 2890 |
| 11 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 12 | JGI25159J45721_1000928 | 3300002987 | Bacteria | 12764 |
| 13 | JGI25151J46595_10000146 | 3300003187 | Bacteria | 93373 |
| 14 | JGI25151J46595_10000976 | 3300003187 | Bacteria | 21680 |
| 15 | JGI25151J46595_10003097 | 3300003187 | Bacteria | 9370 |
| 16 | JGI25151J46595_10015560 | 3300003187 | Bacteria | 3348 |
| 17 | JGI25151J46595_10029243 | 3300003187 | Bacteria | 2184 |
| 18 | JGI25153J46596_10000337 | 3300003215 | Bacteria | 33514 |
| 19 | JGI25153J46596_10000698 | 3300003215 | Bacteria | 20531 |
| 20 | JGI25153J46596_10001913 | 3300003215 | Bacteria | 12351 |
| 21 | JGI25153J46596_10006900 | 3300003215 | Bacteria | 5670 |
| 22 | JGI25153J46596_10006915 | 3300003215 | Bacteria | 5661 |
| 23 | JGI25153J46596_10016380 | 3300003215 | Bacteria | 2971 |
| 24 | JGI25153J46596_10017234 | 3300003215 | Unclassified | 2854 |
| 25 | JGI25153J46596_10018304 | 3300003215 | Bacteria | 2727 |
| 26 | rootH1_10027007 | 3300003316 | Bacteria | 15971 |
| 27 | rootH2_10188461 | 3300003320 | Unclassified | 3802 |
| 28 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 29 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 30 | JGI25160J50197_1005161 | 3300003354 | Bacteria | 5483 |
| 31 | JGI25160J50197_1006679 | 3300003354 | Unclassified | 4637 |
| 32 | JGI25160J50197_1017667 | 3300003354 | Bacteria | 2250 |
| 33 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 34 | JGI25161J50226_1000370 | 3300003374 | Bacteria | 22840 |
| 35 | JGI25161J50226_1000458 | 3300003374 | Bacteria | 18817 |
| 36 | Ga0055526_1002521 | 3300003771 | Bacteria | 12312 |
| 37 | Ga0055526_1002639 | 3300003771 | Bacteria | 11980 |
| 38 | Ga0055526_1005973 | 3300003771 | Bacteria | 6774 |
| 39 | Ga0055526_1007839 | 3300003771 | Bacteria | 5461 |
| 40 | Ga0055526_1017995 | 3300003771 | Bacteria | 2663 |
| 41 | Ga0055524_1000572 | 3300003775 | Bacteria | 27327 |
| 42 | Ga0055524_1003096 | 3300003775 | Bacteria | 8211 |
| 43 | Ga0055524_1004469 | 3300003775 | Bacteria | 6456 |
| 44 | Ga0055524_1006818 | 3300003775 | Bacteria | 4926 |
| 45 | Ga0055524_1008955 | 3300003775 | Bacteria | 4115 |
| 46 | Ga0055524_1011136 | 3300003775 | Bacteria | 3535 |
| 47 | Ga0055536_1003722 | 3300003781 | Bacteria | 8086 |
| 48 | Ga0055536_1004179 | 3300003781 | Bacteria | 7472 |
| 49 | Ga0055528_1000158 | 3300003790 | Bacteria | 56769 |
| 50 | Ga0055528_1000180 | 3300003790 | Bacteria | 53597 |
| 51 | Ga0055528_1001038 | 3300003790 | Bacteria | 18353 |
| 52 | Ga0055528_1001879 | 3300003790 | Bacteria | 11962 |
| 53 | Ga0055528_1002874 | 3300003790 | Bacteria | 8966 |
| 54 | Ga0055528_1008297 | 3300003790 | Bacteria | 4476 |
| 55 | Ga0055528_1011400 | 3300003790 | Bacteria | 3535 |
| 56 | Ga0055540_1000372 | 3300003792 | Bacteria | 37511 |
| 57 | Ga0055540_1001786 | 3300003792 | Bacteria | 12225 |
| 58 | Ga0055540_1004137 | 3300003792 | Bacteria | 6705 |
| 59 | Ga0055540_1008283 | 3300003792 | Bacteria | 3763 |
| 60 | Ga0055531_10002645 | 3300003794 | Bacteria | 11834 |
| 61 | Ga0055531_10029590 | 3300003794 | Bacteria | 1862 |
| 62 | Ga0058692_1000498 | 3300003856 | Bacteria | 17446 |
| 63 | Ga0058692_1001790 | 3300003856 | Bacteria | 7598 |
| 64 | Ga0055543_1000060 | 3300004625 | Bacteria | 98330 |
| 65 | Ga0055543_1000102 | 3300004625 | Bacteria | 73861 |
| 66 | Ga0055543_1000216 | 3300004625 | Bacteria | 46311 |
| 67 | Ga0055543_1002223 | 3300004625 | Bacteria | 6614 |
| 68 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 69 | Ga0065165_1000019 | 3300005262 | Bacteria | 271815 |
| 70 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 71 | Ga0065165_1006399 | 3300005262 | Bacteria | 6192 |
| 72 | Ga0065165_1019094 | 3300005262 | Bacteria | 2460 |
| 73 | Ga0065165_1037365 | 3300005262 | Bacteria | 1472 |
| 74 | Ga0065714_10077644 | 3300005288 | Bacteria | 2660 |
| 75 | Ga0070658_10000398 | 3300005327 | Bacteria | 37864 |
| 76 | Ga0070676_10000458 | 3300005328 | Bacteria | 19490 |
| 77 | Ga0068869_100058510 | 3300005334 | Bacteria | 2818 |
| 78 | Ga0070666_10000272 | 3300005335 | Bacteria | 34340 |
| 79 | Ga0070680_100013171 | 3300005336 | Bacteria | 6438 |
| 80 | Ga0068868_100000493 | 3300005338 | Bacteria | 26280 |
| 81 | Ga0068868_100013963 | 3300005338 | Bacteria | 5908 |
| 82 | Ga0068868_100094595 | 3300005338 | Bacteria | 2411 |
| 83 | Ga0070668_100000154 | 3300005347 | Bacteria | 43788 |
| 84 | Ga0070668_100158490 | 3300005347 | Bacteria | 1835 |
| 85 | Ga0070669_100091562 | 3300005353 | Bacteria | 2281 |
| 86 | Ga0070673_100006253 | 3300005364 | Bacteria | 7723 |
| 87 | Ga0070667_100001281 | 3300005367 | Bacteria | 22751 |
| 88 | Ga0070667_100005388 | 3300005367 | Bacteria | 10686 |
| 89 | Ga0070662_100023334 | 3300005457 | Bacteria | 4248 |
| 90 | Ga0070681_10096322 | 3300005458 | Bacteria | 2907 |
| 91 | Ga0070681_10173837 | 3300005458 | Bacteria | 2075 |
| 92 | Ga0070685_10009406 | 3300005466 | Bacteria | 5049 |
| 93 | Ga0070707_100087505 | 3300005468 | Bacteria | 3013 |
| 94 | Ga0070698_100000606 | 3300005471 | Bacteria | 38432 |
| 95 | Ga0070699_100043988 | 3300005518 | Bacteria | 3865 |
| 96 | Ga0070679_100025511 | 3300005530 | Bacteria | 5801 |
| 97 | Ga0070697_100262384 | 3300005536 | Bacteria | 1479 |
| 98 | Ga0068853_100003715 | 3300005539 | Bacteria | 11719 |
| 99 | Ga0068853_100294490 | 3300005539 | Bacteria | 1499 |
| 100 | Ga0070672_100000048 | 3300005543 | Bacteria | 52547 |
| 101 | Ga0070686_100000679 | 3300005544 | Bacteria | 19745 |
| 102 | Ga0070665_100001032 | 3300005548 | Bacteria | 34883 |
| 103 | Ga0070665_100077525 | 3300005548 | Bacteria | 3330 |
| 104 | Ga0068855_100016945 | 3300005563 | Bacteria | 8763 |
| 105 | Ga0070664_100005066 | 3300005564 | Bacteria | 10568 |
| 106 | Ga0068857_100052928 | 3300005577 | Bacteria | 3601 |
| 107 | Ga0068852_100058588 | 3300005616 | Unclassified | 3337 |
| 108 | Ga0068859_100001403 | 3300005617 | Bacteria | 24458 |
| 109 | Ga0068864_100000537 | 3300005618 | Bacteria | 32549 |
| 110 | Ga0068866_10086467 | 3300005718 | Bacteria | 1697 |
| 111 | Ga0068851_10004984 | 3300005834 | Bacteria | 6014 |
| 112 | Ga0068863_100000750 | 3300005841 | Bacteria | 32439 |
| 113 | Ga0068863_100005596 | 3300005841 | Bacteria | 12347 |
| 114 | Ga0068858_100001076 | 3300005842 | Bacteria | 28272 |
| 115 | Ga0068860_100010234 | 3300005843 | Bacteria | 9282 |
| 116 | Ga0068860_100062626 | 3300005843 | Bacteria | 3534 |
| 117 | Ga0075365_10002434 | 3300006038 | Bacteria | 9130 |
| 118 | Ga0075365_10037564 | 3300006038 | Bacteria | 3145 |
| 119 | Ga0075365_10109818 | 3300006038 | Bacteria | 1895 |
| 120 | Ga0075368_10047152 | 3300006042 | Bacteria | 1705 |
| 121 | Ga0075363_100061774 | 3300006048 | Bacteria | 2020 |
| 122 | Ga0075364_10011050 | 3300006051 | Bacteria | 5478 |
| 123 | Ga0075362_10001162 | 3300006177 | Bacteria | 8232 |
| 124 | Ga0075367_10003454 | 3300006178 | Bacteria | 7538 |
| 125 | Ga0075367_10007596 | 3300006178 | Bacteria | 5565 |
| 126 | Ga0075367_10023563 | 3300006178 | Bacteria | 3465 |
| 127 | Ga0075366_10001492 | 3300006195 | Bacteria | 11684 |
| 128 | Ga0097621_100002050 | 3300006237 | Bacteria | 13791 |
| 129 | Ga0075370_10000198 | 3300006353 | Bacteria | 21215 |
| 130 | Ga0075370_10014170 | 3300006353 | Bacteria | 4247 |
| 131 | Ga0068871_100003589 | 3300006358 | Bacteria | 10659 |
| 132 | Ga0068865_100096726 | 3300006881 | Bacteria | 2153 |
| 133 | Ga0097620_100001403 | 3300006931 | Bacteria | 24458 |
| 134 | Ga0079104_1000015 | 3300006946 | Bacteria | 321803 |
| 135 | Ga0079104_1008483 | 3300006946 | Bacteria | 3590 |
| 136 | Ga0099826_10000102 | 3300006948 | Bacteria | 40381 |
| 137 | Ga0099826_10028569 | 3300006948 | Bacteria | 4075 |
| 138 | Ga0105251_10039881 | 3300009011 | Bacteria | 2291 |
| 139 | Ga0105240_10097464 | 3300009093 | Unclassified | 3583 |
| 140 | Ga0105243_10013713 | 3300009148 | Bacteria | 6131 |
| 141 | Ga0105243_10017730 | 3300009148 | Bacteria | 5385 |
| 142 | Ga0105248_10016027 | 3300009177 | Bacteria | 8248 |
| 143 | Ga0105238_10104207 | 3300009551 | Bacteria | 2818 |
| 144 | Ga0105238_10452763 | 3300009551 | Bacteria | 1280 |
| 145 | Ga0123341_1049145 | 3300009765 | Bacteria | 2434 |
| 146 | Ga0123342_1006302 | 3300009766 | Bacteria | 16546 |
| 147 | Ga0123342_1033809 | 3300009766 | Bacteria | 2293 |
| 148 | Ga0105239_10042603 | 3300010375 | Unclassified | 4974 |
| 149 | Ga0105239_10054482 | 3300010375 | Bacteria | 4387 |
| 150 | Ga0105246_10061054 | 3300011119 | Bacteria | 2621 |
| 151 | Ga0105246_10150319 | 3300011119 | Bacteria | 1762 |
| 152 | Ga0157373_10095382 | 3300013100 | Bacteria | 2094 |
| 153 | Ga0157373_10265606 | 3300013100 | Bacteria | 1215 |
| 154 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 155 | Ga0157371_10008491 | 3300013102 | Bacteria | 8175 |
| 156 | Ga0157371_10201799 | 3300013102 | Bacteria | 1426 |
| 157 | Ga0157371_10275051 | 3300013102 | Unclassified | 1216 |
| 158 | Ga0157370_10001031 | 3300013104 | Bacteria | 35059 |
| 159 | Ga0157370_10002249 | 3300013104 | Bacteria | 23463 |
| 160 | Ga0157369_10020112 | 3300013105 | Bacteria | 7466 |
| 161 | Ga0157369_10099100 | 3300013105 | Bacteria | 3107 |
| 162 | Ga0157369_10478317 | 3300013105 | Bacteria | 1289 |
| 163 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 164 | Ga0157374_10000314 | 3300013296 | Bacteria | 44972 |
| 165 | Ga0157374_10098396 | 3300013296 | Bacteria | 2801 |
| 166 | Ga0157378_10029584 | 3300013297 | Bacteria | 4837 |
| 167 | Ga0157378_10084572 | 3300013297 | Bacteria | 2873 |
| 168 | Ga0163162_10000231 | 3300013306 | Bacteria | 51138 |
| 169 | Ga0163162_10002781 | 3300013306 | Bacteria | 16627 |
| 170 | Ga0163162_10006648 | 3300013306 | Bacteria | 11210 |
| 171 | Ga0157372_10002540 | 3300013307 | Bacteria | 19795 |
| 172 | Ga0157372_10043474 | 3300013307 | Bacteria | 4974 |
| 173 | Ga0157375_10000272 | 3300013308 | Bacteria | 46932 |
| 174 | Ga0163163_10000347 | 3300014325 | Bacteria | 44548 |
| 175 | Ga0163163_10093145 | 3300014325 | Bacteria | 3029 |
| 176 | Ga0157380_10508957 | 3300014326 | Bacteria | 1171 |
| 177 | Ga0182008_10052667 | 3300014497 | Bacteria | 2016 |
| 178 | Ga0157379_10000120 | 3300014968 | Bacteria | 54605 |
| 179 | Ga0157376_10000271 | 3300014969 | Bacteria | 35219 |
| 180 | Ga0157376_10016605 | 3300014969 | Bacteria | 5593 |
| 181 | Ga0157376_10028647 | 3300014969 | Unclassified | 4429 |
| 182 | Ga0157376_10286613 | 3300014969 | Unclassified | 1553 |
| 183 | Ga0182005_1000248 | 3300015265 | Bacteria | 34381 |
| 184 | Ga0183363_1098 | 3300015690 | Bacteria | 24674 |
| 185 | Ga0214544_1000110 | 3300021320 | Bacteria | 113143 |
| 186 | Ga0214542_1000268 | 3300021321 | Bacteria | 87082 |
| 187 | Ga0214542_1017541 | 3300021321 | Bacteria | 6416 |
| 188 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 189 | Ga0214543_1000219 | 3300021327 | Bacteria | 87102 |
| 190 | Ga0228711_1000911 | 3300022739 | Bacteria | 40698 |
| 191 | Ga0228710_1001018 | 3300022740 | Bacteria | 40304 |
| 192 | Ga0209436_100081 | 3300025208 | Bacteria | 48215 |
| 193 | Ga0209436_107254 | 3300025208 | Unclassified | 2338 |
| 194 | Ga0209566_100115 | 3300025225 | Bacteria | 107765 |
| 195 | Ga0209563_102163 | 3300025230 | Bacteria | 4590 |
| 196 | Ga0207425_1000046 | 3300025245 | Bacteria | 189433 |
| 197 | Ga0207425_1000884 | 3300025245 | Bacteria | 14567 |
| 198 | Ga0207425_1004836 | 3300025245 | Bacteria | 3953 |
| 199 | Ga0209646_1000004 | 3300025246 | Bacteria | 786587 |
| 200 | Ga0209026_1000495 | 3300025250 | Bacteria | 28866 |
| 201 | Ga0209129_1000171 | 3300025258 | Bacteria | 95724 |
| 202 | Ga0209129_1000324 | 3300025258 | Bacteria | 42226 |
| 203 | Ga0209129_1001769 | 3300025258 | Bacteria | 11548 |
| 204 | Ga0209129_1001856 | 3300025258 | Bacteria | 11178 |
| 205 | Ga0209129_1008779 | 3300025258 | Bacteria | 2759 |
| 206 | Ga0209129_1008780 | 3300025258 | Bacteria | 2759 |
| 207 | Ga0209129_1009902 | 3300025258 | Bacteria | 2444 |
| 208 | Ga0209129_1012601 | 3300025258 | Bacteria | 1927 |
| 209 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 210 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 211 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 212 | Ga0209673_1000112 | 3300025273 | Bacteria | 179676 |
| 213 | Ga0209673_1000637 | 3300025273 | Bacteria | 53013 |
| 214 | Ga0209673_1001842 | 3300025273 | Bacteria | 17316 |
| 215 | Ga0209673_1003328 | 3300025273 | Bacteria | 9614 |
| 216 | Ga0209673_1005399 | 3300025273 | Bacteria | 6441 |
| 217 | Ga0209673_1013806 | 3300025273 | Bacteria | 3167 |
| 218 | Ga0209673_1031347 | 3300025273 | Unclassified | 1656 |
| 219 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 220 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 221 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 222 | Ga0209675_1016053 | 3300025291 | Bacteria | 2197 |
| 223 | Ga0209676_1002445 | 3300025292 | Bacteria | 13179 |
| 224 | Ga0209676_1007475 | 3300025292 | Bacteria | 5116 |
| 225 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 226 | Ga0209025_1000137 | 3300025294 | Bacteria | 190136 |
| 227 | Ga0209025_1000154 | 3300025294 | Bacteria | 170288 |
| 228 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 229 | Ga0209025_1002028 | 3300025294 | Bacteria | 23124 |
| 230 | Ga0209025_1009293 | 3300025294 | Bacteria | 6882 |
| 231 | Ga0209025_1010302 | 3300025294 | Bacteria | 6351 |
| 232 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 233 | Ga0209564_1000265 | 3300025295 | Bacteria | 110606 |
| 234 | Ga0209564_1000672 | 3300025295 | Bacteria | 50497 |
| 235 | Ga0209564_1000840 | 3300025295 | Bacteria | 41373 |
| 236 | Ga0209564_1001534 | 3300025295 | Bacteria | 22927 |
| 237 | Ga0209564_1003122 | 3300025295 | Bacteria | 11698 |
| 238 | Ga0209564_1004207 | 3300025295 | Bacteria | 8973 |
| 239 | Ga0209564_1004488 | 3300025295 | Bacteria | 8515 |
| 240 | Ga0209564_1011760 | 3300025295 | Bacteria | 3887 |
| 241 | Ga0209758_1000058 | 3300025297 | Bacteria | 331603 |
| 242 | Ga0209758_1000123 | 3300025297 | Bacteria | 190136 |
| 243 | Ga0209758_1001003 | 3300025297 | Bacteria | 37543 |
| 244 | Ga0209758_1001710 | 3300025297 | Bacteria | 24605 |
| 245 | Ga0209758_1002357 | 3300025297 | Bacteria | 19473 |
| 246 | Ga0209758_1005872 | 3300025297 | Bacteria | 9161 |
| 247 | Ga0209758_1006337 | 3300025297 | Bacteria | 8573 |
| 248 | Ga0209758_1013729 | 3300025297 | Bacteria | 4386 |
| 249 | Ga0209758_1015542 | 3300025297 | Bacteria | 3929 |
| 250 | Ga0209758_1015814 | 3300025297 | Bacteria | 3879 |
| 251 | Ga0209758_1017385 | 3300025297 | Bacteria | 3585 |
| 252 | Ga0209758_1059928 | 3300025297 | Bacteria | 1263 |
| 253 | Ga0209050_1000308 | 3300025298 | Bacteria | 99516 |
| 254 | Ga0209050_1003968 | 3300025298 | Bacteria | 10436 |
| 255 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 256 | Ga0209256_1000704 | 3300025299 | Bacteria | 44504 |
| 257 | Ga0209256_1000914 | 3300025299 | Bacteria | 36121 |
| 258 | Ga0209256_1001905 | 3300025299 | Bacteria | 19079 |
| 259 | Ga0209256_1002433 | 3300025299 | Bacteria | 15221 |
| 260 | Ga0209256_1002591 | 3300025299 | Bacteria | 14395 |
| 261 | Ga0209256_1003390 | 3300025299 | Bacteria | 11244 |
| 262 | Ga0209256_1011848 | 3300025299 | Bacteria | 3426 |
| 263 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 264 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 265 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 266 | Ga0207426_1000344 | 3300025302 | Bacteria | 85912 |
| 267 | Ga0207426_1000442 | 3300025302 | Bacteria | 66642 |
| 268 | Ga0207426_1000645 | 3300025302 | Bacteria | 43355 |
| 269 | Ga0207426_1000727 | 3300025302 | Bacteria | 37813 |
| 270 | Ga0207426_1000934 | 3300025302 | Bacteria | 29145 |
| 271 | Ga0209051_1000462 | 3300025303 | Bacteria | 53349 |
| 272 | Ga0209051_1000900 | 3300025303 | Bacteria | 29687 |
| 273 | Ga0209051_1001776 | 3300025303 | Bacteria | 17118 |
| 274 | Ga0209051_1001806 | 3300025303 | Bacteria | 16957 |
| 275 | Ga0209051_1024469 | 3300025303 | Bacteria | 2482 |
| 276 | Ga0209257_1001059 | 3300025304 | Bacteria | 36382 |
| 277 | Ga0209257_1002539 | 3300025304 | Bacteria | 17877 |
| 278 | Ga0209257_1005864 | 3300025304 | Bacteria | 8305 |
| 279 | Ga0209257_1015317 | 3300025304 | Bacteria | 3204 |
| 280 | Ga0207656_10001075 | 3300025321 | Bacteria | 8932 |
| 281 | Ga0207680_10000165 | 3300025903 | Bacteria | 32266 |
| 282 | Ga0207699_10146827 | 3300025906 | Bacteria | 1556 |
| 283 | Ga0207645_10027863 | 3300025907 | Bacteria | 3648 |
| 284 | Ga0207705_10000725 | 3300025909 | Bacteria | 27178 |
| 285 | Ga0207684_10031226 | 3300025910 | Bacteria | 4532 |
| 286 | Ga0207707_10000688 | 3300025912 | Bacteria | 33606 |
| 287 | Ga0207660_10086378 | 3300025917 | Bacteria | 2316 |
| 288 | Ga0207652_10017278 | 3300025921 | Bacteria | 5902 |
| 289 | Ga0207646_10001966 | 3300025922 | Bacteria | 24656 |
| 290 | Ga0207650_10051538 | 3300025925 | Bacteria | 3046 |
| 291 | Ga0207706_10038695 | 3300025933 | Bacteria | 4231 |
| 292 | Ga0207709_10038454 | 3300025935 | Bacteria | 2850 |
| 293 | Ga0207704_10002738 | 3300025938 | Bacteria | 7949 |
| 294 | Ga0207691_10000245 | 3300025940 | Bacteria | 53608 |
| 295 | Ga0207689_10058189 | 3300025942 | Bacteria | 3179 |
| 296 | Ga0207667_10059502 | 3300025949 | Bacteria | 4001 |
| 297 | Ga0207651_10071465 | 3300025960 | Bacteria | 2460 |
| 298 | Ga0207668_10000184 | 3300025972 | Bacteria | 42493 |
| 299 | Ga0207668_10157451 | 3300025972 | Bacteria | 1766 |
| 300 | Ga0207658_10000452 | 3300025986 | Bacteria | 38428 |
| 301 | Ga0207677_10000876 | 3300026023 | Bacteria | 17026 |
| 302 | Ga0207677_10156607 | 3300026023 | Bacteria | 1765 |
| 303 | Ga0207703_10000388 | 3300026035 | Bacteria | 47169 |
| 304 | Ga0207639_10007920 | 3300026041 | Bacteria | 7260 |
| 305 | Ga0207678_10097616 | 3300026067 | Bacteria | 2511 |
| 306 | Ga0207641_10001293 | 3300026088 | Bacteria | 24895 |
| 307 | Ga0207648_10003392 | 3300026089 | Bacteria | 16725 |
| 308 | Ga0207676_10001932 | 3300026095 | Bacteria | 15128 |
| 309 | Ga0207674_10057508 | 3300026116 | Bacteria | 3942 |
| 310 | Ga0207675_100140814 | 3300026118 | Bacteria | 2291 |
| 311 | Ga0207698_10062463 | 3300026142 | Unclassified | 2909 |
| 312 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 313 | Ga0209281_1000190 | 3300027111 | Bacteria | 140658 |
| 314 | Ga0209281_1000314 | 3300027111 | Bacteria | 86424 |
| 315 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 316 | Ga0209371_1002629 | 3300027312 | Bacteria | 9830 |
| 317 | Ga0209999_1002293 | 3300027543 | Bacteria | 3367 |
| 318 | Ga0209282_1000068 | 3300027666 | Bacteria | 85817 |
| 319 | Ga0209282_1000233 | 3300027666 | Bacteria | 28668 |
| 320 | Ga0209282_1098979 | 3300027666 | Bacteria | 1506 |
| 321 | Ga0209966_1000731 | 3300027695 | Bacteria | 6893 |
| 322 | Ga0209998_10000251 | 3300027717 | Bacteria | 17585 |
| 323 | Ga0268266_10000928 | 3300028379 | Bacteria | 37520 |
| 324 | Ga0268266_10055968 | 3300028379 | Bacteria | 3392 |
| 325 | Ga0268264_10024669 | 3300028381 | Bacteria | 4911 |
| 326 | Ga0268264_10049337 | 3300028381 | Bacteria | 3502 |
| 327 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 328 | Ga0307515_10000285 | 3300028794 | Bacteria | 124535 |
| 329 | Ga0307515_10017812 | 3300028794 | Bacteria | 12912 |
| 330 | Ga0265338_10234998 | 3300028800 | Bacteria | 1361 |
| 331 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 332 | Ga0268256_1004182 | 3300030500 | Bacteria | 6101 |
| 333 | Ga0307512_10006312 | 3300030522 | Bacteria | 12035 |
| 334 | Ga0307408_100065712 | 3300031548 | Bacteria | 2661 |
| 335 | Ga0307408_100086047 | 3300031548 | Bacteria | 2362 |
| 336 | Ga0307408_100197882 | 3300031548 | Bacteria | 1624 |
| 337 | Ga0307408_100271501 | 3300031548 | Bacteria | 1408 |
| 338 | Ga0307516_10238587 | 3300031730 | Bacteria | 1518 |
| 339 | Ga0307405_10002098 | 3300031731 | Bacteria | 8696 |
| 340 | Ga0307413_10020785 | 3300031824 | Bacteria | 3500 |
| 341 | Ga0307413_10078842 | 3300031824 | Bacteria | 2103 |
| 342 | Ga0307410_10274153 | 3300031852 | Bacteria | 1321 |
| 343 | Ga0307407_10084226 | 3300031903 | Bacteria | 1931 |
| 344 | Ga0307412_10081170 | 3300031911 | Bacteria | 2242 |
| 345 | Ga0307412_10113041 | 3300031911 | Bacteria | 1942 |
| 346 | Ga0315914_1000937 | 3300031967 | Bacteria | 41175 |
| 347 | Ga0307409_100056996 | 3300031995 | Bacteria | 3024 |
| 348 | Ga0307409_100080716 | 3300031995 | Bacteria | 2626 |
| 349 | Ga0307409_100098443 | 3300031995 | Bacteria | 2419 |
| 350 | Ga0307409_100179030 | 3300031995 | Bacteria | 1875 |
| 351 | Ga0307409_100195568 | 3300031995 | Bacteria | 1804 |
| 352 | Ga0307409_100206688 | 3300031995 | Bacteria | 1761 |
| 353 | Ga0307416_100068230 | 3300032002 | Bacteria | 2937 |
| 354 | Ga0307416_100105576 | 3300032002 | Bacteria | 2466 |
| 355 | Ga0307416_100109528 | 3300032002 | Bacteria | 2429 |
| 356 | Ga0307416_100206252 | 3300032002 | Bacteria | 1870 |
| 357 | Ga0307416_100349632 | 3300032002 | Bacteria | 1495 |
| 358 | Ga0307414_10020828 | 3300032004 | Bacteria | 4096 |
| 359 | Ga0307414_10329729 | 3300032004 | Bacteria | 1302 |
| 360 | Ga0307411_10027659 | 3300032005 | Bacteria | 3435 |
| 361 | Ga0307411_10038005 | 3300032005 | Bacteria | 3032 |
| 362 | Ga0315913_1000094 | 3300033430 | Bacteria | 51134 |
| 363 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 364 | Ga0373926_0041892 | 3300035083 | Bacteria | 1637 |
| 365 | Ga0373944_0015510 | 3300035089 | Bacteria | 2139 |
| 366 | Ga0373945_0041233 | 3300035116 | Bacteria | 1668 |
| 367 | Ga0373943_0000121 | 3300035170 | Bacteria | 29176 |
| 368 | Ga0373935_0046820 | 3300035692 | Bacteria | 2733 |
| 369 | Ga0373935_0174324 | 3300035692 | Bacteria | 1473 |
| 370 | Ga0373927_0000191 | 3300035695 | Bacteria | 48913 |
| 371 | Ga0373927_0035521 | 3300035695 | Bacteria | 3241 |
| 372 | Ga0373937_0058126 | 3300036401 | Bacteria | 3553 |
| 373 | Ga0373937_0115077 | 3300036401 | Bacteria | 2504 |
| 374 | Ga0373925_0000937 | 3300037068 | Bacteria | 26571 |
| 375 | Ga0373925_0003720 | 3300037068 | Bacteria | 11711 |
| 376 | Ga0395905_0064353 | 3300037471 | Bacteria | 3431 |
| 377 | Ga0395901_0200479 | 3300038443 | Bacteria | 2092 |
| 378 | Ga0439436_0006315 | 3300041404 | Bacteria | 3641 |
| 379 | Ga0439439_0023435 | 3300041406 | Bacteria | 1546 |
| 380 | Ga0439465_0002280 | 3300041413 | Bacteria | 6303 |
| 381 | Ga0439465_0003936 | 3300041413 | Bacteria | 4844 |
| 382 | Ga0451835_0555271 | 3300041492 | Bacteria | 2554 |
| 383 | Ga0451839_1437888 | 3300041496 | Bacteria | 1882 |
| 384 | Ga0451841_0096366 | 3300041498 | Bacteria | 2409 |
| 385 | Ga0451845_0328363 | 3300041501 | Bacteria | 4581 |
| 386 | Ga0451845_0847798 | 3300041501 | Bacteria | 1737 |
| 387 | Ga0451847_0116577 | 3300041503 | Bacteria | 3669 |
| 388 | Ga0451847_0892452 | 3300041503 | Bacteria | 3755 |
| 389 | Ga0451851_1182826 | 3300041507 | Bacteria | 1963 |
| 390 | Ga0451855_1291386 | 3300041511 | Bacteria | 1218 |
| 391 | Ga0451853_0687444 | 3300041512 | Bacteria | 8213 |
| 392 | Ga0439431_0000193 | 3300041997 | Bacteria | 11897 |
| 393 | Ga0439449_0052275 | 3300042007 | Bacteria | 1511 |
| 394 | Ga0439446_0030897 | 3300042156 | Bacteria | 1549 |
| 395 | Ga0450909_005545 | 3300042185 | Bacteria | 1815 |
| 396 | Ga0466972_0025855 | 3300044658 | Bacteria | 2908 |
| 397 | Ga0466965_0018260 | 3300044683 | Bacteria | 3360 |
| 398 | Ga0466961_0005611 | 3300044693 | Bacteria | 7929 |
| 399 | Ga0466971_0000268 | 3300044719 | Bacteria | 19970 |
| 400 | Ga0466968_0024899 | 3300044735 | Bacteria | 2449 |
| 401 | Ga0466957_0001675 | 3300044842 | Bacteria | 11646 |
| 402 | Ga0466960_0044086 | 3300044901 | Bacteria | 2125 |
| 403 | Ga0466959_0001701 | 3300045049 | Bacteria | 13668 |
| 404 | Ga0466958_0002672 | 3300045836 | Bacteria | 9025 |
| 405 | Ga0466967_0001415 | 3300045976 | Bacteria | 13886 |
| 406 | Ga0466967_0087284 | 3300045976 | Bacteria | 2828 |
| 407 | Ga0495603_0023346 | 3300046455 | Bacteria | 3744 |
| 408 | Ga0495629_0001138 | 3300046459 | Bacteria | 20986 |
| 409 | Ga0495629_0213185 | 3300046459 | Bacteria | 1333 |
| 410 | Ga0495638_0000790 | 3300046460 | Bacteria | 33426 |
| 411 | Ga0495638_0006177 | 3300046460 | Bacteria | 8748 |
| 412 | Ga0495638_0011748 | 3300046460 | Bacteria | 6028 |
| 413 | Ga0495638_0076128 | 3300046460 | Bacteria | 2044 |
| 414 | Ga0495638_0170738 | 3300046460 | Bacteria | 1248 |
| 415 | Ga0495641_0001166 | 3300046461 | Bacteria | 22610 |
| 416 | Ga0495651_0257146 | 3300046462 | Bacteria | 1190 |
| 417 | Ga0495653_0024287 | 3300046463 | Bacteria | 4887 |
| 418 | Ga0495650_0042525 | 3300046471 | Bacteria | 1934 |
| 419 | Ga0495580_0056954 | 3300046472 | Unclassified | 2752 |
| 420 | Ga0495582_0000476 | 3300046473 | Bacteria | 21966 |
| 421 | Ga0495582_0087453 | 3300046473 | Bacteria | 1735 |
| 422 | Ga0495605_0000994 | 3300046474 | Bacteria | 19214 |
| 423 | Ga0495605_0037505 | 3300046474 | Bacteria | 2437 |
| 424 | Ga0495639_0015678 | 3300046475 | Bacteria | 3286 |
| 425 | Ga0495662_0004536 | 3300046476 | Bacteria | 6964 |
| 426 | Ga0495662_0032939 | 3300046476 | Bacteria | 2503 |
| 427 | Ga0495585_0000158 | 3300046492 | Bacteria | 72351 |
| 428 | Ga0495585_0003595 | 3300046492 | Bacteria | 10396 |
| 429 | Ga0495585_0012991 | 3300046492 | Bacteria | 4889 |
| 430 | Ga0495594_0064001 | 3300046499 | Bacteria | 2038 |
| 431 | Ga0495594_0115828 | 3300046499 | Bacteria | 1513 |
| 432 | Ga0495607_0060841 | 3300046501 | Bacteria | 2148 |
| 433 | Ga0495607_0132613 | 3300046501 | Bacteria | 1294 |
| 434 | Ga0495583_0008220 | 3300046506 | Bacteria | 6402 |
| 435 | Ga0495583_0009072 | 3300046506 | Bacteria | 5991 |
| 436 | Ga0495606_0000241 | 3300046507 | Bacteria | 96663 |
| 437 | Ga0495606_0019565 | 3300046507 | Bacteria | 5030 |
| 438 | Ga0495606_0027184 | 3300046507 | Bacteria | 4062 |
| 439 | Ga0495606_0044000 | 3300046507 | Bacteria | 2972 |
| 440 | Ga0495606_0059419 | 3300046507 | Bacteria | 2452 |
| 441 | Ga0495608_0101256 | 3300046511 | Bacteria | 1857 |
| 442 | Ga0495610_0001190 | 3300046512 | Bacteria | 23538 |
| 443 | Ga0495610_0001917 | 3300046512 | Bacteria | 17945 |
| 444 | Ga0495610_0020299 | 3300046512 | Bacteria | 3691 |
| 445 | Ga0495616_0006637 | 3300046513 | Bacteria | 6990 |
| 446 | Ga0495618_0054244 | 3300046514 | Bacteria | 2536 |
| 447 | Ga0495630_0028517 | 3300046517 | Bacteria | 4147 |
| 448 | Ga0495630_0217797 | 3300046517 | Bacteria | 1457 |
| 449 | Ga0495630_0314493 | 3300046517 | Bacteria | 1197 |
| 450 | Ga0495631_0000751 | 3300046518 | Bacteria | 20776 |
| 451 | Ga0495632_0024689 | 3300046519 | Bacteria | 3189 |
| 452 | Ga0495643_0021519 | 3300046522 | Bacteria | 3698 |
| 453 | Ga0495643_0055688 | 3300046522 | Bacteria | 2113 |
| 454 | Ga0495648_0005978 | 3300046524 | Bacteria | 10002 |
| 455 | Ga0495648_0065343 | 3300046524 | Bacteria | 2139 |
| 456 | Ga0495666_0001680 | 3300046526 | Bacteria | 10925 |
| 457 | Ga0495652_0186522 | 3300046529 | Bacteria | 1587 |
| 458 | Ga0495654_0018394 | 3300046530 | Bacteria | 3663 |
| 459 | Ga0495640_0016563 | 3300046533 | Bacteria | 5511 |
| 460 | Ga0495597_0006901 | 3300046542 | Bacteria | 5827 |
| 461 | Ga0495622_0002319 | 3300046557 | Bacteria | 9264 |
| 462 | Ga0495633_0004196 | 3300046558 | Bacteria | 9241 |
| 463 | Ga0495667_0060754 | 3300046559 | Bacteria | 2478 |
| 464 | Ga0495667_0138210 | 3300046559 | Bacteria | 1570 |
| 465 | Ga0495668_0003152 | 3300046616 | Bacteria | 12722 |
| 466 | Ga0495634_0010271 | 3300046642 | Bacteria | 6860 |
| 467 | Ga0495611_0000756 | 3300046648 | Bacteria | 18200 |
| 468 | Ga0495611_0092837 | 3300046648 | Bacteria | 1396 |
| 469 | Ga0495625_0000003 | 3300046660 | Bacteria | 686847 |
| 470 | Ga0495625_0001467 | 3300046660 | Bacteria | 28584 |
| 471 | Ga0495625_0050481 | 3300046660 | Bacteria | 2985 |
| 472 | Ga0495625_0054729 | 3300046660 | Bacteria | 2849 |
| 473 | Ga0495625_0074150 | 3300046660 | Bacteria | 2384 |
| 474 | Ga0495625_0176073 | 3300046660 | Bacteria | 1425 |
| 475 | Ga0495635_0134033 | 3300046663 | Bacteria | 1688 |
| 476 | Ga0495588_0063031 | 3300046674 | Bacteria | 1922 |
| 477 | Ga0495588_0119993 | 3300046674 | Bacteria | 1386 |
| 478 | Ga0495599_0101414 | 3300046678 | Bacteria | 1794 |
| 479 | Ga0495623_0182370 | 3300046679 | Unclassified | 1219 |
| 480 | Ga0495646_0104955 | 3300046680 | Bacteria | 1615 |
| 481 | Ga0495647_0041919 | 3300046681 | Bacteria | 1746 |
| 482 | Ga0495658_0047651 | 3300046683 | Bacteria | 2414 |
| 483 | Ga0495658_0052166 | 3300046683 | Bacteria | 2318 |
| 484 | Ga0495613_0000618 | 3300046689 | Bacteria | 28357 |
| 485 | Ga0495670_0020764 | 3300046691 | Bacteria | 3239 |
| 486 | Ga0495649_0000002 | 3300046694 | Bacteria | 1093458 |
| 487 | Ga0495600_0068475 | 3300046809 | Bacteria | 2319 |
| 488 | Ga0495600_0082151 | 3300046809 | Bacteria | 2102 |
| 489 | Ga0495660_0016507 | 3300046810 | Bacteria | 4257 |
| 490 | Ga0495660_0135315 | 3300046810 | Bacteria | 1232 |
| 491 | Ga0495581_0000478 | 3300047315 | Bacteria | 20395 |
| 492 | Ga0495604_0006302 | 3300047317 | Bacteria | 9415 |
| 493 | Ga0495604_0130352 | 3300047317 | Bacteria | 1808 |
| 494 | Ga0495674_0053175 | 3300047319 | Bacteria | 3561 |
| 495 | Ga0495674_0295006 | 3300047319 | Bacteria | 1325 |
| 496 | Ga0495676_0001540 | 3300047321 | Bacteria | 19962 |
| 497 | Ga0495680_0039413 | 3300047322 | Bacteria | 3770 |
| 498 | Ga0495687_021450 | 3300047443 | Bacteria | 3123 |
| 499 | Ga0495684_0006886 | 3300047471 | Bacteria | 8827 |
| 500 | Ga0495684_0038552 | 3300047471 | Bacteria | 3663 |
| 501 | Ga0495686_0000011 | 3300047472 | Bacteria | 514750 |
| 502 | Ga0495686_0000267 | 3300047472 | Bacteria | 93355 |
| 503 | Ga0495686_0031014 | 3300047472 | Bacteria | 3469 |
| 504 | Ga0495593_0004413 | 3300047673 | Bacteria | 8359 |
| 505 | Ga0495602_0355112 | 3300048088 | Bacteria | 1057 |
| 506 | Ga0495614_0006088 | 3300048089 | Bacteria | 5424 |
| 507 | Ga0496104_0124386 | 3300048907 | Bacteria | 2476 |
| 508 | Ga0496105_0106729 | 3300048908 | Bacteria | 2312 |
| 509 | Ga0496106_0002934 | 3300048909 | Bacteria | 12695 |
| 510 | Ga0496106_0192332 | 3300048909 | Bacteria | 1623 |
| 511 | Ga0496107_0127580 | 3300048910 | Bacteria | 1877 |
| 512 | Ga0496108_0064883 | 3300048911 | Bacteria | 3077 |
| 513 | Ga0496109_0154338 | 3300048912 | Bacteria | 2150 |
| 514 | Ga0496111_0124082 | 3300048914 | Bacteria | 1908 |
| 515 | Ga0496112_0116753 | 3300048915 | Bacteria | 2639 |
| 516 | Ga0496113_0284132 | 3300048916 | Bacteria | 1323 |
| 517 | Ga0496114_0144375 | 3300048917 | Bacteria | 2063 |
| 518 | Ga0496115_0084110 | 3300048918 | Bacteria | 2594 |
| 519 | Ga0496116_0000105 | 3300048919 | Bacteria | 192704 |
| 520 | Ga0496116_0007158 | 3300048919 | Bacteria | 9973 |
| 521 | Ga0496116_0008210 | 3300048919 | Bacteria | 9101 |
| 522 | Ga0496116_0023268 | 3300048919 | Bacteria | 4618 |
| 523 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 524 | Ga0496117_0002241 | 3300048920 | Bacteria | 24957 |
| 525 | Ga0496117_0026624 | 3300048920 | Bacteria | 4522 |
| 526 | Ga0496117_0070697 | 3300048920 | Bacteria | 2343 |
| 527 | Ga0496118_0000566 | 3300048921 | Bacteria | 61208 |
| 528 | Ga0496118_0011165 | 3300048921 | Bacteria | 8797 |
| 529 | Ga0496119_0016503 | 3300048922 | Bacteria | 5616 |
| 530 | Ga0496120_0000309 | 3300048923 | Bacteria | 81375 |
| 531 | Ga0496120_0002673 | 3300048923 | Bacteria | 17544 |
| 532 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 533 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 534 | Ga0496121_0003530 | 3300048924 | Bacteria | 22195 |
| 535 | Ga0496121_0011327 | 3300048924 | Bacteria | 9924 |
| 536 | Ga0496121_0015733 | 3300048924 | Bacteria | 7885 |
| 537 | Ga0496121_0018854 | 3300048924 | Bacteria | 6925 |
| 538 | Ga0496121_0019001 | 3300048924 | Bacteria | 6894 |
| 539 | Ga0496121_0023979 | 3300048924 | Bacteria | 5850 |
| 540 | Ga0496121_0026584 | 3300048924 | Bacteria | 5446 |
| 541 | Ga0496121_0042752 | 3300048924 | Bacteria | 3936 |
| 542 | Ga0496121_0165280 | 3300048924 | Bacteria | 1614 |
| 543 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 544 | Ga0496122_0000414 | 3300048925 | Bacteria | 90664 |
| 545 | Ga0496122_0000462 | 3300048925 | Bacteria | 84546 |
| 546 | Ga0496122_0028634 | 3300048925 | Bacteria | 4720 |
| 547 | Ga0496122_0050450 | 3300048925 | Bacteria | 3173 |
| 548 | Ga0496122_0051771 | 3300048925 | Bacteria | 3116 |
| 549 | Ga0496122_0173927 | 3300048925 | Bacteria | 1293 |
| 550 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 551 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 552 | Ga0496123_0000147 | 3300048926 | Bacteria | 143834 |
| 553 | Ga0496123_0023196 | 3300048926 | Bacteria | 4756 |
| 554 | Ga0496123_0120031 | 3300048926 | Bacteria | 1481 |
| 555 | Ga0496124_0000067 | 3300048927 | Bacteria | 222576 |
| 556 | Ga0496124_0000348 | 3300048927 | Bacteria | 84728 |
| 557 | Ga0496124_0003742 | 3300048927 | Bacteria | 18334 |
| 558 | Ga0496124_0023679 | 3300048927 | Bacteria | 5600 |
| 559 | Ga0496124_0033203 | 3300048927 | Bacteria | 4542 |
| 560 | Ga0496124_0041410 | 3300048927 | Bacteria | 3974 |
| 561 | Ga0496124_0042790 | 3300048927 | Bacteria | 3897 |
| 562 | Ga0496124_0052030 | 3300048927 | Bacteria | 3481 |
| 563 | Ga0496124_0068340 | 3300048927 | Bacteria | 2953 |
| 564 | Ga0496125_0001144 | 3300048928 | Bacteria | 40287 |
| 565 | Ga0496125_0001465 | 3300048928 | Bacteria | 34178 |
| 566 | Ga0496125_0015823 | 3300048928 | Bacteria | 7269 |
| 567 | Ga0496125_0028117 | 3300048928 | Bacteria | 5084 |
| 568 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 569 | Ga0496126_0000879 | 3300048929 | Bacteria | 52860 |
| 570 | Ga0496126_0045881 | 3300048929 | Bacteria | 4013 |
| 571 | Ga0496126_0069879 | 3300048929 | Bacteria | 3130 |
| 572 | Ga0496126_0136493 | 3300048929 | Bacteria | 2115 |
| 573 | Ga0496126_0151881 | 3300048929 | Bacteria | 1984 |
| 574 | Ga0496126_0199317 | 3300048929 | Bacteria | 1691 |
| 575 | Ga0496126_0292526 | 3300048929 | Bacteria | 1346 |
| 576 | Ga0495678_020259 | 3300049459 | Bacteria | 2950 |
| 577 | Ga0501031_0028878 | 3300049568 | Bacteria | 3615 |
| 578 | Ga0501032_0007875 | 3300049569 | Bacteria | 7761 |
| 579 | Ga0501032_0127677 | 3300049569 | Bacteria | 1679 |
| 580 | Ga0501033_0001531 | 3300049570 | Bacteria | 20426 |
| 581 | Ga0501033_0065411 | 3300049570 | Bacteria | 2675 |
| 582 | Ga0501033_0118333 | 3300049570 | Bacteria | 1924 |
| 583 | Ga0501033_0129635 | 3300049570 | Bacteria | 1828 |
| 584 | Ga0501036_0174831 | 3300049572 | Bacteria | 1808 |
| 585 | Ga0501037_0019346 | 3300049573 | Bacteria | 5022 |
| 586 | Ga0501037_0040253 | 3300049573 | Bacteria | 3439 |
| 587 | Ga0501038_0012257 | 3300049574 | Bacteria | 7829 |
| 588 | Ga0501038_0201014 | 3300049574 | Bacteria | 1599 |
| 589 | Ga0501039_0038160 | 3300049575 | Bacteria | 3711 |
| 590 | Ga0501039_0162628 | 3300049575 | Bacteria | 1755 |
| 591 | Ga0501043_0062632 | 3300049579 | Bacteria | 2920 |
| 592 | Ga0501043_0085546 | 3300049579 | Bacteria | 2478 |
| 593 | Ga0501048_0058573 | 3300049582 | Bacteria | 2730 |
| 594 | Ga0501068_0117037 | 3300049584 | Bacteria | 1660 |
| 595 | Ga0501069_0016480 | 3300049585 | Bacteria | 3971 |
| 596 | Ga0501070_0027171 | 3300049586 | Bacteria | 4800 |
| 597 | Ga0501070_0036858 | 3300049586 | Bacteria | 4083 |
| 598 | Ga0501073_0025037 | 3300049589 | Bacteria | 4283 |
| 599 | Ga0501073_0038112 | 3300049589 | Bacteria | 3411 |
| 600 | Ga0501073_0120282 | 3300049589 | Bacteria | 1820 |
| 601 | Ga0501074_0236053 | 3300049590 | Bacteria | 1301 |
| 602 | Ga0501202_001871 | 3300049652 | Bacteria | 3451 |
| 603 | Ga0501216_006033 | 3300049660 | Bacteria | 1845 |
| 604 | Ga0501217_005039 | 3300049661 | Bacteria | 2744 |
| 605 | Ga0501235_002828 | 3300049669 | Bacteria | 3733 |
| 606 | Ga0501221_001373 | 3300049704 | Bacteria | 4003 |
| 607 | Ga0501225_0007861 | 3300049705 | Bacteria | 3077 |
| 608 | Ga0501083_0010437 | 3300049744 | Bacteria | 6539 |
| 609 | Ga0501266_003015 | 3300049763 | Bacteria | 2098 |
| 610 | Ga0501272_005348 | 3300049769 | Bacteria | 1350 |
| 611 | Ga0501035_0000597 | 3300049822 | Bacteria | 39766 |
| 612 | Ga0501035_0014570 | 3300049822 | Bacteria | 7257 |
| 613 | Ga0501035_0119206 | 3300049822 | Bacteria | 2308 |
| 614 | Ga0501044_0024439 | 3300049823 | Bacteria | 6412 |
| 615 | Ga0501044_0089511 | 3300049823 | Bacteria | 3106 |
| 616 | Ga0501045_0251122 | 3300049824 | Bacteria | 1316 |
| 617 | nmdc:mga03683_476_c1 | 3300050489 | Bacteria | 11566 |
| 618 | nmdc:mga00v17_13475_c1 | 3300050491 | Bacteria | 4542 |
| 619 | nmdc:mga00v17_213_c1 | 3300050491 | Bacteria | 34903 |
| 620 | nmdc:mga00v17_7_c1 | 3300050491 | Bacteria | 167228 |
| 621 | nmdc:mga0yw44_144512_c1 | 3300050492 | Bacteria | 1548 |
| 622 | nmdc:mga0yw44_83977_c1 | 3300050492 | Bacteria | 2001 |
| 623 | nmdc:mga0k408_28719_c1 | 3300050493 | Bacteria | 3163 |
| 624 | nmdc:mga07m45_4102_c1 | 3300050496 | Bacteria | 5174 |
| 625 | nmdc:mga0sz30_115_c1 | 3300050516 | Bacteria | 30158 |
| 626 | nmdc:mga0sz30_14176_c1 | 3300050516 | Bacteria | 3133 |
| 627 | nmdc:mga0sz30_49354_c1 | 3300050516 | Bacteria | 1783 |
| 628 | Ga0495612_0018829 | 3300053078 | Bacteria | 2765 |
| 629 | Ga0500610_0019102 | 3300053079 | Bacteria | 3326 |
| 630 | Ga0495619_0002232 | 3300053085 | Bacteria | 12806 |
| 631 | Ga0495619_0003103 | 3300053085 | Bacteria | 10782 |
| 632 | Ga0495619_0122504 | 3300053085 | Bacteria | 1783 |
| 633 | Ga0495619_0195783 | 3300053085 | Bacteria | 1399 |
| 634 | Ga0500560_019545 | 3300053107 | Bacteria | 1908 |
| 635 | Ga0500594_0000853 | 3300053118 | Bacteria | 6527 |
| 636 | Ga0500608_037404 | 3300053122 | Bacteria | 2319 |
| 637 | Ga0500618_000050 | 3300053125 | Bacteria | 105238 |
| 638 | Ga0500618_001049 | 3300053125 | Bacteria | 13764 |
| 639 | Ga0500658_0000323 | 3300053134 | Bacteria | 21124 |
| 640 | Ga0500658_0026149 | 3300053134 | Bacteria | 2247 |
| 641 | Ga0500559_0026351 | 3300053136 | Bacteria | 2475 |
| 642 | Ga0500568_0001419 | 3300053139 | Bacteria | 15537 |
| 643 | Ga0500568_0001573 | 3300053139 | Bacteria | 14435 |
| 644 | Ga0500568_0114582 | 3300053139 | Bacteria | 1006 |
| 645 | Ga0500573_0003303 | 3300053140 | Bacteria | 8326 |
| 646 | Ga0500590_000218 | 3300053148 | Bacteria | 17347 |
| 647 | Ga0500616_0000798 | 3300053153 | Bacteria | 36041 |
| 648 | Ga0500616_0003746 | 3300053153 | Bacteria | 11341 |
| 649 | Ga0500616_0017076 | 3300053153 | Bacteria | 4120 |
| 650 | Ga0500622_0000241 | 3300053156 | Bacteria | 56799 |
| 651 | Ga0500622_0000597 | 3300053156 | Bacteria | 32786 |
| 652 | Ga0500624_000239 | 3300053157 | Bacteria | 19500 |
| 653 | Ga0500627_0105400 | 3300053158 | Bacteria | 1267 |
| 654 | Ga0500633_0005572 | 3300053160 | Bacteria | 3005 |
| 655 | Ga0500634_0012891 | 3300053161 | Bacteria | 4367 |
| 656 | Ga0500636_0000003 | 3300053177 | Bacteria | 240189 |
| 657 | Ga0500636_0003175 | 3300053177 | Bacteria | 9199 |
| 658 | Ga0501082_0025756 | 3300060353 | Bacteria | 5068 |
| 659 | Ga0501082_0201211 | 3300060353 | Bacteria | 1733 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046648 | Ga0495611_0092837 | Ga0495611_0092837_521_1375 | 281 |
| 2 | 3300046462 | Ga0495651_0257146 | Ga0495651_0257146_270_1160 | 296 |
| 3 | 3300046460 | Ga0495638_0076128 | Ga0495638_0076128_705_1661 | 299 |
| 4 | 3300038443 | Ga0395901_0200479 | Ga0395901_0200479_12_995 | 311 |
| 5 | 3300046559 | Ga0495667_0138210 | Ga0495667_0138210_24_986 | 315 |
| 6 | 3300048088 | Ga0495602_0355112 | Ga0495602_0355112_18_980 | 315 |
| 7 | 3300048908 | Ga0496105_0106729 | Ga0496105_0106729_23_985 | 315 |
| 8 | 3300053078 | Ga0495612_0018829 | Ga0495612_0018829_1778_2740 | 315 |
| 9 | 3300014325 | Ga0163163_10093145 | Ga0163163_100931454 | 319 |
| 10 | 3300053139 | Ga0500568_0114582 | Ga0500568_0114582_12_992 | 319 |
| 11 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001355 | 327 |
| 12 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001405 | 327 |
| 13 | 3300004625 | Ga0055543_1000216 | Ga0055543_100021632 | 327 |
| 14 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008100 | 327 |
| 15 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003420 | 327 |
| 16 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011356 | 327 |
| 17 | 3300047443 | Ga0495687_021450 | Ga0495687_021450_272_1333 | 327 |
| 18 | 3300048915 | Ga0496112_0116753 | Ga0496112_0116753_996_1979 | 327 |
| 19 | 3300048917 | Ga0496114_0144375 | Ga0496114_0144375_1020_2003 | 327 |
| 20 | 3300048924 | Ga0496121_0042752 | Ga0496121_0042752_2541_3602 | 327 |
| 21 | 3300002774 | JGI25150J39212_1004958 | JGI25150J39212_10049582 | 328 |
| 22 | 3300025245 | Ga0207425_1004836 | Ga0207425_10048364 | 328 |
| 23 | 3300025258 | Ga0209129_1008780 | Ga0209129_10087804 | 328 |
| 24 | 3300025297 | Ga0209758_1006337 | Ga0209758_10063379 | 328 |
| 25 | 3300049570 | Ga0501033_0129635 | Ga0501033_0129635_290_1384 | 329 |
| 26 | 3300049574 | Ga0501038_0201014 | Ga0501038_0201014_351_1469 | 329 |
| 27 | 3300049589 | Ga0501073_0120282 | Ga0501073_0120282_306_1424 | 329 |
| 28 | 3300049823 | Ga0501044_0024439 | Ga0501044_0024439_5112_6230 | 329 |
| 29 | 3300046501 | Ga0495607_0132613 | Ga0495607_0132613_69_1130 | 330 |
| 30 | 3300046660 | Ga0495625_0176073 | Ga0495625_0176073_125_1186 | 330 |
| 31 | 3300048909 | Ga0496106_0192332 | Ga0496106_0192332_387_1451 | 330 |
| 32 | 3300053158 | Ga0500627_0105400 | Ga0500627_0105400_205_1242 | 332 |
| 33 | 3300006353 | Ga0075370_10014170 | Ga0075370_100141704 | 333 |
| 34 | 3300009551 | Ga0105238_10452763 | Ga0105238_104527632 | 333 |
| 35 | 3300014326 | Ga0157380_10508957 | Ga0157380_105089571 | 333 |
| 36 | 3300025906 | Ga0207699_10146827 | Ga0207699_101468271 | 333 |
| 37 | 3300046507 | Ga0495606_0027184 | Ga0495606_0027184_1403_2434 | 333 |
| 38 | 3300035083 | Ga0373926_0041892 | Ga0373926_0041892_132_1151 | 334 |
| 39 | 3300035089 | Ga0373944_0015510 | Ga0373944_0015510_595_1614 | 334 |
| 40 | 3300035116 | Ga0373945_0041233 | Ga0373945_0041233_140_1159 | 334 |
| 41 | 3300035170 | Ga0373943_0000121 | Ga0373943_0000121_12090_13109 | 334 |
| 42 | 3300035695 | Ga0373927_0035521 | Ga0373927_0035521_2013_3032 | 334 |
| 43 | 3300037068 | Ga0373925_0000937 | Ga0373925_0000937_13718_14737 | 334 |
| 44 | 3300046455 | Ga0495603_0023346 | Ga0495603_0023346_1577_2596 | 334 |
| 45 | 3300046459 | Ga0495629_0001138 | Ga0495629_0001138_19475_20494 | 334 |
| 46 | 3300046461 | Ga0495641_0001166 | Ga0495641_0001166_18647_19666 | 334 |
| 47 | 3300046463 | Ga0495653_0024287 | Ga0495653_0024287_3202_4221 | 334 |
| 48 | 3300046473 | Ga0495582_0000476 | Ga0495582_0000476_6628_7647 | 334 |
| 49 | 3300046475 | Ga0495639_0015678 | Ga0495639_0015678_1244_2263 | 334 |
| 50 | 3300046476 | Ga0495662_0004536 | Ga0495662_0004536_1852_2871 | 334 |
| 51 | 3300046499 | Ga0495594_0064001 | Ga0495594_0064001_722_1741 | 334 |
| 52 | 3300046511 | Ga0495608_0101256 | Ga0495608_0101256_455_1474 | 334 |
| 53 | 3300046517 | Ga0495630_0028517 | Ga0495630_0028517_1356_2375 | 334 |
| 54 | 3300046526 | Ga0495666_0001680 | Ga0495666_0001680_4551_5570 | 334 |
| 55 | 3300046533 | Ga0495640_0016563 | Ga0495640_0016563_749_1768 | 334 |
| 56 | 3300046559 | Ga0495667_0060754 | Ga0495667_0060754_966_1985 | 334 |
| 57 | 3300046642 | Ga0495634_0010271 | Ga0495634_0010271_3717_4736 | 334 |
| 58 | 3300046660 | Ga0495625_0050481 | Ga0495625_0050481_352_1515 | 334 |
| 59 | 3300046663 | Ga0495635_0134033 | Ga0495635_0134033_457_1476 | 334 |
| 60 | 3300046678 | Ga0495599_0101414 | Ga0495599_0101414_443_1462 | 334 |
| 61 | 3300046680 | Ga0495646_0104955 | Ga0495646_0104955_553_1572 | 334 |
| 62 | 3300046681 | Ga0495647_0041919 | Ga0495647_0041919_646_1665 | 334 |
| 63 | 3300046683 | Ga0495658_0052166 | Ga0495658_0052166_740_1759 | 334 |
| 64 | 3300046689 | Ga0495613_0000618 | Ga0495613_0000618_9481_10500 | 334 |
| 65 | 3300046809 | Ga0495600_0068475 | Ga0495600_0068475_529_1548 | 334 |
| 66 | 3300047315 | Ga0495581_0000478 | Ga0495581_0000478_551_1570 | 334 |
| 67 | 3300047317 | Ga0495604_0130352 | Ga0495604_0130352_604_1623 | 334 |
| 68 | 3300047319 | Ga0495674_0053175 | Ga0495674_0053175_1789_2808 | 334 |
| 69 | 3300047321 | Ga0495676_0001540 | Ga0495676_0001540_6969_7988 | 334 |
| 70 | 3300047322 | Ga0495680_0039413 | Ga0495680_0039413_1813_2832 | 334 |
| 71 | 3300047471 | Ga0495684_0006886 | Ga0495684_0006886_1944_2963 | 334 |
| 72 | 3300047471 | Ga0495684_0038552 | Ga0495684_0038552_2174_3193 | 334 |
| 73 | 3300047673 | Ga0495593_0004413 | Ga0495593_0004413_4918_5937 | 334 |
| 74 | 3300048089 | Ga0495614_0006088 | Ga0495614_0006088_3837_4856 | 334 |
| 75 | 3300048918 | Ga0496115_0084110 | Ga0496115_0084110_502_1545 | 334 |
| 76 | 3300048928 | Ga0496125_0001465 | Ga0496125_0001465_15077_16138 | 334 |
| 77 | 3300053085 | Ga0495619_0002232 | Ga0495619_0002232_2512_3531 | 334 |
| 78 | 3300053085 | Ga0495619_0003103 | Ga0495619_0003103_493_1512 | 334 |
| 79 | iso_pu_bacteria | 2551306089 | 2551709575 | 334 |
| 80 | 3300046507 | Ga0495606_0019565 | Ga0495606_0019565_415_1455 | 335 |
| 81 | 3300048920 | Ga0496117_0002241 | Ga0496117_0002241_20214_21275 | 335 |
| 82 | 3300048925 | Ga0496122_0000414 | Ga0496122_0000414_38089_39150 | 335 |
| 83 | 3300048926 | Ga0496123_0000147 | Ga0496123_0000147_114359_115420 | 335 |
| 84 | 3300048927 | Ga0496124_0000348 | Ga0496124_0000348_44508_45569 | 335 |
| 85 | 3300048929 | Ga0496126_0000879 | Ga0496126_0000879_23864_24925 | 335 |
| 86 | iso_pu_bacteria | 3003930520 | 3003934497 | 335 |
| 87 | 3300003187 | JGI25151J46595_10000146 | JGI25151J46595_1000014644 | 336 |
| 88 | 3300003215 | JGI25153J46596_10000698 | JGI25153J46596_100006988 | 336 |
| 89 | 3300003792 | Ga0055540_1000372 | Ga0055540_100037226 | 336 |
| 90 | 3300005367 | Ga0070667_100005388 | Ga0070667_1000053885 | 336 |
| 91 | 3300005617 | Ga0068859_100001403 | Ga0068859_10000140319 | 336 |
| 92 | 3300005843 | Ga0068860_100010234 | Ga0068860_1000102349 | 336 |
| 93 | 3300006038 | Ga0075365_10037564 | Ga0075365_100375643 | 336 |
| 94 | 3300006178 | Ga0075367_10003454 | Ga0075367_100034545 | 336 |
| 95 | 3300006931 | Ga0097620_100001403 | Ga0097620_10000140319 | 336 |
| 96 | 3300009765 | Ga0123341_1049145 | Ga0123341_10491452 | 336 |
| 97 | 3300009766 | Ga0123342_1006302 | Ga0123342_100630216 | 336 |
| 98 | 3300009766 | Ga0123342_1033809 | Ga0123342_10338092 | 336 |
| 99 | 3300013100 | Ga0157373_10095382 | Ga0157373_100953822 | 336 |
| 100 | 3300013105 | Ga0157369_10020112 | Ga0157369_100201125 | 336 |
| 101 | 3300025245 | Ga0207425_1000046 | Ga0207425_100004640 | 336 |
| 102 | 3300025258 | Ga0209129_1000171 | Ga0209129_100017162 | 336 |
| 103 | 3300025273 | Ga0209673_1000637 | Ga0209673_100063717 | 336 |
| 104 | 3300025273 | Ga0209673_1005399 | Ga0209673_10053993 | 336 |
| 105 | 3300025294 | Ga0209025_1000137 | Ga0209025_1000137151 | 336 |
| 106 | 3300025294 | Ga0209025_1009293 | Ga0209025_10092937 | 336 |
| 107 | 3300025297 | Ga0209758_1000123 | Ga0209758_1000123151 | 336 |
| 108 | 3300025297 | Ga0209758_1015542 | Ga0209758_10155424 | 336 |
| 109 | 3300025303 | Ga0209051_1000462 | Ga0209051_100046213 | 336 |
| 110 | 3300025304 | Ga0209257_1005864 | Ga0209257_10058644 | 336 |
| 111 | 3300028381 | Ga0268264_10024669 | Ga0268264_100246693 | 336 |
| 112 | 3300031548 | Ga0307408_100065712 | Ga0307408_1000657122 | 336 |
| 113 | 3300031731 | Ga0307405_10002098 | Ga0307405_1000209811 | 336 |
| 114 | 3300031824 | Ga0307413_10078842 | Ga0307413_100788422 | 336 |
| 115 | 3300031995 | Ga0307409_100195568 | Ga0307409_1001955682 | 336 |
| 116 | 3300032002 | Ga0307416_100068230 | Ga0307416_1000682302 | 336 |
| 117 | 3300032004 | Ga0307414_10020828 | Ga0307414_100208283 | 336 |
| 118 | 3300032005 | Ga0307411_10027659 | Ga0307411_100276593 | 336 |
| 119 | 3300041492 | Ga0451835_0555271 | Ga0451835_0555271_340_1503 | 336 |
| 120 | 3300041496 | Ga0451839_1437888 | Ga0451839_1437888_536_1699 | 336 |
| 121 | 3300041501 | Ga0451845_0328363 | Ga0451845_0328363_837_2000 | 336 |
| 122 | 3300041503 | Ga0451847_0892452 | Ga0451847_0892452_1595_2758 | 336 |
| 123 | 3300046460 | Ga0495638_0000790 | Ga0495638_0000790_22048_23109 | 336 |
| 124 | 3300046474 | Ga0495605_0000994 | Ga0495605_0000994_7820_9046 | 336 |
| 125 | 3300046474 | Ga0495605_0037505 | Ga0495605_0037505_1258_2421 | 336 |
| 126 | 3300046492 | Ga0495585_0003595 | Ga0495585_0003595_7710_8966 | 336 |
| 127 | 3300046492 | Ga0495585_0012991 | Ga0495585_0012991_3508_4578 | 336 |
| 128 | 3300046506 | Ga0495583_0009072 | Ga0495583_0009072_2891_4147 | 336 |
| 129 | 3300046512 | Ga0495610_0001917 | Ga0495610_0001917_3746_4816 | 336 |
| 130 | 3300046518 | Ga0495631_0000751 | Ga0495631_0000751_3627_4883 | 336 |
| 131 | 3300046519 | Ga0495632_0024689 | Ga0495632_0024689_134_1360 | 336 |
| 132 | 3300046524 | Ga0495648_0005978 | Ga0495648_0005978_4415_5578 | 336 |
| 133 | 3300046530 | Ga0495654_0018394 | Ga0495654_0018394_2131_3192 | 336 |
| 134 | 3300046616 | Ga0495668_0003152 | Ga0495668_0003152_1885_3141 | 336 |
| 135 | 3300046660 | Ga0495625_0001467 | Ga0495625_0001467_14276_15532 | 336 |
| 136 | 3300048919 | Ga0496116_0007158 | Ga0496116_0007158_3489_4559 | 336 |
| 137 | 3300048919 | Ga0496116_0008210 | Ga0496116_0008210_1584_2654 | 336 |
| 138 | 3300048924 | Ga0496121_0015733 | Ga0496121_0015733_5808_6914 | 336 |
| 139 | 3300048924 | Ga0496121_0018854 | Ga0496121_0018854_5768_6838 | 336 |
| 140 | 3300048924 | Ga0496121_0165280 | Ga0496121_0165280_458_1528 | 336 |
| 141 | 3300048925 | Ga0496122_0173927 | Ga0496122_0173927_176_1246 | 336 |
| 142 | 3300048927 | Ga0496124_0003742 | Ga0496124_0003742_1630_2700 | 336 |
| 143 | 3300048927 | Ga0496124_0023679 | Ga0496124_0023679_1294_2364 | 336 |
| 144 | 3300048927 | Ga0496124_0042790 | Ga0496124_0042790_2241_3302 | 336 |
| 145 | 3300048928 | Ga0496125_0015823 | Ga0496125_0015823_4260_5330 | 336 |
| 146 | 3300048929 | Ga0496126_0045881 | Ga0496126_0045881_2772_3842 | 336 |
| 147 | 3300049459 | Ga0495678_020259 | Ga0495678_020259_44_1270 | 336 |
| 148 | 3300049589 | Ga0501073_0025037 | Ga0501073_0025037_2942_4009 | 336 |
| 149 | 3300053118 | Ga0500594_0000853 | Ga0500594_0000853_847_2103 | 336 |
| 150 | 3300053134 | Ga0500658_0026149 | Ga0500658_0026149_1137_2207 | 336 |
| 151 | 3300053139 | Ga0500568_0001419 | Ga0500568_0001419_6792_7853 | 336 |
| 152 | 3300053153 | Ga0500616_0003746 | Ga0500616_0003746_5637_6698 | 336 |
| 153 | 3300005353 | Ga0070669_100091562 | Ga0070669_1000915621 | 337 |
| 154 | 3300014497 | Ga0182008_10052667 | Ga0182008_100526672 | 337 |
| 155 | 3300048925 | Ga0496122_0051771 | Ga0496122_0051771_2008_3042 | 337 |
| 156 | 3300048929 | Ga0496126_0069879 | Ga0496126_0069879_46_1107 | 337 |
| 157 | 3300049570 | Ga0501033_0118333 | Ga0501033_0118333_353_1387 | 337 |
| 158 | 3300049572 | Ga0501036_0174831 | Ga0501036_0174831_382_1416 | 337 |
| 159 | 3300049573 | Ga0501037_0040253 | Ga0501037_0040253_1301_2335 | 337 |
| 160 | 3300049579 | Ga0501043_0085546 | Ga0501043_0085546_270_1316 | 337 |
| 161 | 3300049822 | Ga0501035_0119206 | Ga0501035_0119206_268_1302 | 337 |
| 162 | 3300049823 | Ga0501044_0089511 | Ga0501044_0089511_244_1278 | 337 |
| 163 | 3300053122 | Ga0500608_037404 | Ga0500608_037404_1013_2062 | 337 |
| 164 | 3300027111 | Ga0209281_1000190 | Ga0209281_100019099 | 338 |
| 165 | 3300031852 | Ga0307410_10274153 | Ga0307410_102741531 | 338 |
| 166 | 3300031995 | Ga0307409_100098443 | Ga0307409_1000984432 | 338 |
| 167 | 3300036401 | Ga0373937_0058126 | Ga0373937_0058126_1550_2566 | 338 |
| 168 | 3300042007 | Ga0439449_0052275 | Ga0439449_0052275_163_1206 | 338 |
| 169 | 3300044683 | Ga0466965_0018260 | Ga0466965_0018260_1859_3100 | 338 |
| 170 | 3300044693 | Ga0466961_0005611 | Ga0466961_0005611_4521_5762 | 338 |
| 171 | 3300044719 | Ga0466971_0000268 | Ga0466971_0000268_12651_13892 | 338 |
| 172 | 3300044842 | Ga0466957_0001675 | Ga0466957_0001675_10344_11585 | 338 |
| 173 | 3300045049 | Ga0466959_0001701 | Ga0466959_0001701_488_1729 | 338 |
| 174 | 3300045836 | Ga0466958_0002672 | Ga0466958_0002672_6834_8075 | 338 |
| 175 | 3300045976 | Ga0466967_0001415 | Ga0466967_0001415_1280_2521 | 338 |
| 176 | 3300048924 | Ga0496121_0011327 | Ga0496121_0011327_8723_9766 | 338 |
| 177 | 3300049568 | Ga0501031_0028878 | Ga0501031_0028878_1424_2449 | 338 |
| 178 | 3300049569 | Ga0501032_0007875 | Ga0501032_0007875_5563_6588 | 338 |
| 179 | 3300049570 | Ga0501033_0065411 | Ga0501033_0065411_93_1118 | 338 |
| 180 | 3300049573 | Ga0501037_0019346 | Ga0501037_0019346_2836_3861 | 338 |
| 181 | 3300049574 | Ga0501038_0012257 | Ga0501038_0012257_5533_6558 | 338 |
| 182 | 3300049575 | Ga0501039_0038160 | Ga0501039_0038160_149_1174 | 338 |
| 183 | 3300049579 | Ga0501043_0062632 | Ga0501043_0062632_394_1419 | 338 |
| 184 | 3300049582 | Ga0501048_0058573 | Ga0501048_0058573_550_1575 | 338 |
| 185 | 3300049584 | Ga0501068_0117037 | Ga0501068_0117037_183_1208 | 338 |
| 186 | 3300049585 | Ga0501069_0016480 | Ga0501069_0016480_2524_3549 | 338 |
| 187 | 3300049586 | Ga0501070_0027171 | Ga0501070_0027171_1672_2697 | 338 |
| 188 | 3300049589 | Ga0501073_0038112 | Ga0501073_0038112_2022_3047 | 338 |
| 189 | 3300049744 | Ga0501083_0010437 | Ga0501083_0010437_4302_5327 | 338 |
| 190 | 3300049822 | Ga0501035_0014570 | Ga0501035_0014570_4186_5211 | 338 |
| 191 | 3300049824 | Ga0501045_0251122 | Ga0501045_0251122_145_1170 | 338 |
| 192 | 3300060353 | Ga0501082_0025756 | Ga0501082_0025756_967_1992 | 338 |
| 193 | iso_pu_bacteria | 2508501050 | 2508732986 | 338 |
| 194 | iso_pu_bacteria | 2889010040 | 2889014961 | 338 |
| 195 | iso_pu_bacteria | 2894232714 | 2894242801 | 338 |
| 196 | iso_pu_bacteria | 2987652177 | 2987654442 | 338 |
| 197 | iso_pu_bacteria | 8004640170 | 8004643869 | 338 |
| 198 | 3300005338 | Ga0068868_100013963 | Ga0068868_1000139632 | 339 |
| 199 | 3300005364 | Ga0070673_100006253 | Ga0070673_1000062533 | 339 |
| 200 | 3300005466 | Ga0070685_10009406 | Ga0070685_100094062 | 339 |
| 201 | 3300005841 | Ga0068863_100005596 | Ga0068863_10000559612 | 339 |
| 202 | 3300013296 | Ga0157374_10098396 | Ga0157374_100983962 | 339 |
| 203 | 3300013297 | Ga0157378_10029584 | Ga0157378_100295842 | 339 |
| 204 | 3300014969 | Ga0157376_10016605 | Ga0157376_100166053 | 339 |
| 205 | 3300025925 | Ga0207650_10051538 | Ga0207650_100515383 | 339 |
| 206 | 3300025960 | Ga0207651_10071465 | Ga0207651_100714652 | 339 |
| 207 | 3300035692 | Ga0373935_0046820 | Ga0373935_0046820_281_1318 | 339 |
| 208 | 3300035692 | Ga0373935_0174324 | Ga0373935_0174324_57_1076 | 339 |
| 209 | 3300035695 | Ga0373927_0000191 | Ga0373927_0000191_5220_6257 | 339 |
| 210 | 3300036401 | Ga0373937_0115077 | Ga0373937_0115077_500_1519 | 339 |
| 211 | 3300037068 | Ga0373925_0003720 | Ga0373925_0003720_2814_3851 | 339 |
| 212 | 3300037471 | Ga0395905_0064353 | Ga0395905_0064353_1046_2086 | 339 |
| 213 | 3300046459 | Ga0495629_0213185 | Ga0495629_0213185_189_1208 | 339 |
| 214 | 3300046472 | Ga0495580_0056954 | Ga0495580_0056954_535_1554 | 339 |
| 215 | 3300046473 | Ga0495582_0087453 | Ga0495582_0087453_669_1688 | 339 |
| 216 | 3300046517 | Ga0495630_0217797 | Ga0495630_0217797_424_1443 | 339 |
| 217 | 3300046517 | Ga0495630_0314493 | Ga0495630_0314493_57_1076 | 339 |
| 218 | 3300046529 | Ga0495652_0186522 | Ga0495652_0186522_419_1438 | 339 |
| 219 | 3300046679 | Ga0495623_0182370 | Ga0495623_0182370_100_1119 | 339 |
| 220 | 3300046683 | Ga0495658_0047651 | Ga0495658_0047651_201_1220 | 339 |
| 221 | 3300046691 | Ga0495670_0020764 | Ga0495670_0020764_1832_2851 | 339 |
| 222 | 3300047319 | Ga0495674_0295006 | Ga0495674_0295006_107_1126 | 339 |
| 223 | 3300053085 | Ga0495619_0195783 | Ga0495619_0195783_229_1248 | 339 |
| 224 | 3300053136 | Ga0500559_0026351 | Ga0500559_0026351_153_1196 | 339 |
| 225 | 3300053156 | Ga0500622_0000241 | Ga0500622_0000241_42242_43288 | 339 |
| 226 | iso_pu_bacteria | 2509276022 | 2509393406 | 339 |
| 227 | iso_pu_bacteria | 2510461069 | 2510840933 | 339 |
| 228 | iso_pu_bacteria | 2512875024 | 2512962214 | 339 |
| 229 | iso_pu_bacteria | 2558860983 | 2561469249 | 339 |
| 230 | iso_pu_bacteria | 2643221623 | 2644133590 | 339 |
| 231 | iso_pu_bacteria | 2643221653 | 2644298941 | 339 |
| 232 | iso_pu_bacteria | 2643221719 | 2644657169 | 339 |
| 233 | iso_pu_bacteria | 2738543024 | 2739308451 | 339 |
| 234 | iso_pu_bacteria | 2818991272 | 2819241047 | 339 |
| 235 | iso_pu_bacteria | 2869278585 | 2869280705 | 339 |
| 236 | iso_pu_bacteria | 2874139085 | 2874143141 | 339 |
| 237 | iso_pu_bacteria | 2878738818 | 2878740794 | 339 |
| 238 | iso_pu_bacteria | 2888337043 | 2888343165 | 339 |
| 239 | iso_pu_bacteria | 2924718760 | 2924722755 | 339 |
| 240 | iso_pu_bacteria | 2924776078 | 2924778395 | 339 |
| 241 | iso_pu_bacteria | 2937822353 | 2937822682 | 339 |
| 242 | iso_pu_bacteria | 2937877337 | 2937880056 | 339 |
| 243 | iso_pu_bacteria | 2937972304 | 2937980089 | 339 |
| 244 | iso_pu_bacteria | 2958034702 | 2958036578 | 339 |
| 245 | iso_pu_bacteria | 2958041894 | 2958046534 | 339 |
| 246 | iso_pu_bacteria | 2958084443 | 2958086120 | 339 |
| 247 | iso_pu_bacteria | 2958144490 | 2958145639 | 339 |
| 248 | iso_pu_bacteria | 2960597568 | 2960598494 | 339 |
| 249 | iso_pu_bacteria | 2968016561 | 2968023125 | 339 |
| 250 | iso_pu_bacteria | 2970469710 | 2970475709 | 339 |
| 251 | iso_pu_bacteria | 2970593180 | 2970595428 | 339 |
| 252 | iso_pu_bacteria | 2989776772 | 2989779506 | 339 |
| 253 | iso_pu_bacteria | 2996348954 | 2996355664 | 339 |
| 254 | iso_pu_bacteria | 3004275668 | 3004282090 | 339 |
| 255 | iso_pu_bacteria | 3004289098 | 3004293525 | 339 |
| 256 | iso_pu_bacteria | 8002285264 | 8002291247 | 339 |
| 257 | iso_pu_bacteria | 8005246636 | 8005249882 | 339 |
| 258 | iso_pu_bacteria | 8005658619 | 8005658822 | 339 |
| 259 | iso_pu_bacteria | 8054460903 | 8054463173 | 339 |
| 260 | 3300003187 | JGI25151J46595_10029243 | JGI25151J46595_100292431 | 340 |
| 261 | 3300005327 | Ga0070658_10000398 | Ga0070658_100003989 | 340 |
| 262 | 3300005328 | Ga0070676_10000458 | Ga0070676_100004582 | 340 |
| 263 | 3300005334 | Ga0068869_100058510 | Ga0068869_1000585102 | 340 |
| 264 | 3300005335 | Ga0070666_10000272 | Ga0070666_1000027213 | 340 |
| 265 | 3300005338 | Ga0068868_100000493 | Ga0068868_1000004938 | 340 |
| 266 | 3300005338 | Ga0068868_100094595 | Ga0068868_1000945951 | 340 |
| 267 | 3300005347 | Ga0070668_100000154 | Ga0070668_10000015426 | 340 |
| 268 | 3300005367 | Ga0070667_100001281 | Ga0070667_10000128113 | 340 |
| 269 | 3300005457 | Ga0070662_100023334 | Ga0070662_1000233344 | 340 |
| 270 | 3300005539 | Ga0068853_100003715 | Ga0068853_1000037155 | 340 |
| 271 | 3300005543 | Ga0070672_100000048 | Ga0070672_10000004819 | 340 |
| 272 | 3300005548 | Ga0070665_100001032 | Ga0070665_10000103218 | 340 |
| 273 | 3300005616 | Ga0068852_100058588 | Ga0068852_1000585882 | 340 |
| 274 | 3300005618 | Ga0068864_100000537 | Ga0068864_10000053714 | 340 |
| 275 | 3300005834 | Ga0068851_10004984 | Ga0068851_100049843 | 340 |
| 276 | 3300005841 | Ga0068863_100000750 | Ga0068863_10000075011 | 340 |
| 277 | 3300005842 | Ga0068858_100001076 | Ga0068858_1000010763 | 340 |
| 278 | 3300005843 | Ga0068860_100062626 | Ga0068860_1000626262 | 340 |
| 279 | 3300006237 | Ga0097621_100002050 | Ga0097621_1000020502 | 340 |
| 280 | 3300006358 | Ga0068871_100003589 | Ga0068871_1000035893 | 340 |
| 281 | 3300006881 | Ga0068865_100096726 | Ga0068865_1000967262 | 340 |
| 282 | 3300009093 | Ga0105240_10097464 | Ga0105240_100974642 | 340 |
| 283 | 3300009177 | Ga0105248_10016027 | Ga0105248_100160278 | 340 |
| 284 | 3300009551 | Ga0105238_10104207 | Ga0105238_101042072 | 340 |
| 285 | 3300010375 | Ga0105239_10042603 | Ga0105239_100426031 | 340 |
| 286 | 3300011119 | Ga0105246_10061054 | Ga0105246_100610543 | 340 |
| 287 | 3300011119 | Ga0105246_10150319 | Ga0105246_101503192 | 340 |
| 288 | 3300013296 | Ga0157374_10000314 | Ga0157374_1000031414 | 340 |
| 289 | 3300013306 | Ga0163162_10000231 | Ga0163162_1000023126 | 340 |
| 290 | 3300013306 | Ga0163162_10002781 | Ga0163162_1000278114 | 340 |
| 291 | 3300013308 | Ga0157375_10000272 | Ga0157375_1000027214 | 340 |
| 292 | 3300014325 | Ga0163163_10000347 | Ga0163163_1000034713 | 340 |
| 293 | 3300014968 | Ga0157379_10000120 | Ga0157379_1000012028 | 340 |
| 294 | 3300014969 | Ga0157376_10000271 | Ga0157376_1000027114 | 340 |
| 295 | 3300014969 | Ga0157376_10028647 | Ga0157376_100286474 | 340 |
| 296 | 3300014969 | Ga0157376_10286613 | Ga0157376_102866131 | 340 |
| 297 | 3300025225 | Ga0209566_100115 | Ga0209566_10011576 | 340 |
| 298 | 3300025321 | Ga0207656_10001075 | Ga0207656_100010757 | 340 |
| 299 | 3300025903 | Ga0207680_10000165 | Ga0207680_100001657 | 340 |
| 300 | 3300025907 | Ga0207645_10027863 | Ga0207645_100278633 | 340 |
| 301 | 3300025909 | Ga0207705_10000725 | Ga0207705_1000072512 | 340 |
| 302 | 3300025933 | Ga0207706_10038695 | Ga0207706_100386954 | 340 |
| 303 | 3300025938 | Ga0207704_10002738 | Ga0207704_100027387 | 340 |
| 304 | 3300025940 | Ga0207691_10000245 | Ga0207691_1000024526 | 340 |
| 305 | 3300025942 | Ga0207689_10058189 | Ga0207689_100581892 | 340 |
| 306 | 3300025972 | Ga0207668_10000184 | Ga0207668_1000018426 | 340 |
| 307 | 3300025986 | Ga0207658_10000452 | Ga0207658_1000045218 | 340 |
| 308 | 3300026023 | Ga0207677_10000876 | Ga0207677_1000087611 | 340 |
| 309 | 3300026023 | Ga0207677_10156607 | Ga0207677_101566072 | 340 |
| 310 | 3300026035 | Ga0207703_10000388 | Ga0207703_1000038825 | 340 |
| 311 | 3300026041 | Ga0207639_10007920 | Ga0207639_100079205 | 340 |
| 312 | 3300026088 | Ga0207641_10001293 | Ga0207641_1000129318 | 340 |
| 313 | 3300026089 | Ga0207648_10003392 | Ga0207648_100033922 | 340 |
| 314 | 3300026095 | Ga0207676_10001932 | Ga0207676_1000193212 | 340 |
| 315 | 3300026118 | Ga0207675_100140814 | Ga0207675_1001408141 | 340 |
| 316 | 3300026142 | Ga0207698_10062463 | Ga0207698_100624632 | 340 |
| 317 | 3300028379 | Ga0268266_10000928 | Ga0268266_1000092814 | 340 |
| 318 | 3300028381 | Ga0268264_10049337 | Ga0268264_100493372 | 340 |
| 319 | 3300041512 | Ga0451853_0687444 | Ga0451853_0687444_4529_5560 | 340 |
| 320 | 3300048910 | Ga0496107_0127580 | Ga0496107_0127580_418_1482 | 340 |
| 321 | 3300048911 | Ga0496108_0064883 | Ga0496108_0064883_711_1775 | 340 |
| 322 | 3300048912 | Ga0496109_0154338 | Ga0496109_0154338_466_1530 | 340 |
| 323 | iso_pu_bacteria | 2508501122 | 2509108127 | 340 |
| 324 | iso_pu_bacteria | 2509276019 | 2509376698 | 340 |
| 325 | iso_pu_bacteria | 2510917026 | 2511175489 | 340 |
| 326 | iso_pu_bacteria | 2511231027 | 2511392964 | 340 |
| 327 | iso_pu_bacteria | 2511231052 | 2511497807 | 340 |
| 328 | iso_pu_bacteria | 2512047086 | 2512528817 | 340 |
| 329 | iso_pu_bacteria | 2512875026 | 2512969561 | 340 |
| 330 | iso_pu_bacteria | 2513237086 | 2513584538 | 340 |
| 331 | iso_pu_bacteria | 2513237089 | 2513606215 | 340 |
| 332 | iso_pu_bacteria | 2513237091 | 2513616448 | 340 |
| 333 | iso_pu_bacteria | 2513237140 | 2513885308 | 340 |
| 334 | iso_pu_bacteria | 2513237143 | 2513901983 | 340 |
| 335 | iso_pu_bacteria | 2513237156 | 2513985076 | 340 |
| 336 | iso_pu_bacteria | 2513237160 | 2514007930 | 340 |
| 337 | iso_pu_bacteria | 2515154107 | 2515612047 | 340 |
| 338 | iso_pu_bacteria | 2516143018 | 2516206168 | 340 |
| 339 | iso_pu_bacteria | 2516653046 | 2516896546 | 340 |
| 340 | iso_pu_bacteria | 2517487022 | 2517565561 | 340 |
| 341 | iso_pu_bacteria | 2524023207 | 2524452065 | 340 |
| 342 | iso_pu_bacteria | 2551306084 | 2551681400 | 340 |
| 343 | iso_pu_bacteria | 2551306085 | 2551686221 | 340 |
| 344 | iso_pu_bacteria | 2558860100 | 2558863939 | 340 |
| 345 | iso_pu_bacteria | 2585427633 | 2585996721 | 340 |
| 346 | iso_pu_bacteria | 2599185184 | 2599477241 | 340 |
| 347 | iso_pu_bacteria | 2599185236 | 2599721656 | 340 |
| 348 | iso_pu_bacteria | 2599185352 | 2600194875 | 340 |
| 349 | iso_pu_bacteria | 2643221557 | 2643804171 | 340 |
| 350 | iso_pu_bacteria | 2643221610 | 2644065055 | 340 |
| 351 | iso_pu_bacteria | 2643221618 | 2644105234 | 340 |
| 352 | iso_pu_bacteria | 2643221626 | 2644145690 | 340 |
| 353 | iso_pu_bacteria | 2643221655 | 2644309647 | 340 |
| 354 | iso_pu_bacteria | 2643221659 | 2644331185 | 340 |
| 355 | iso_pu_bacteria | 2643221668 | 2644376536 | 340 |
| 356 | iso_pu_bacteria | 2643221675 | 2644416728 | 340 |
| 357 | iso_pu_bacteria | 2643221680 | 2644449768 | 340 |
| 358 | iso_pu_bacteria | 2643221698 | 2644543376 | 340 |
| 359 | iso_pu_bacteria | 2643221712 | 2644616171 | 340 |
| 360 | iso_pu_bacteria | 2643221723 | 2644675794 | 340 |
| 361 | iso_pu_bacteria | 2643221726 | 2644689900 | 340 |
| 362 | iso_pu_bacteria | 2657244999 | 2657681753 | 340 |
| 363 | iso_pu_bacteria | 2675903059 | 2676484500 | 340 |
| 364 | iso_pu_bacteria | 2690316117 | 2692315261 | 340 |
| 365 | iso_pu_bacteria | 2751185821 | 2753462382 | 340 |
| 366 | iso_pu_bacteria | 2775507049 | 2776914231 | 340 |
| 367 | iso_pu_bacteria | 2791355091 | 2792620557 | 340 |
| 368 | iso_pu_bacteria | 2791355092 | 2792625916 | 340 |
| 369 | iso_pu_bacteria | 2791355094 | 2792638856 | 340 |
| 370 | iso_pu_bacteria | 2802428858 | 2802715991 | 340 |
| 371 | iso_pu_bacteria | 2802428859 | 2802722985 | 340 |
| 372 | iso_pu_bacteria | 2802428860 | 2802728882 | 340 |
| 373 | iso_pu_bacteria | 2802428861 | 2802735249 | 340 |
| 374 | iso_pu_bacteria | 2802428862 | 2802742147 | 340 |
| 375 | iso_pu_bacteria | 2802428863 | 2802748594 | 340 |
| 376 | iso_pu_bacteria | 2802429268 | 2804752938 | 340 |
| 377 | iso_pu_bacteria | 2818991461 | 2819685188 | 340 |
| 378 | iso_pu_bacteria | 2821123053 | 2821125779 | 340 |
| 379 | iso_pu_bacteria | 2838074704 | 2838079766 | 340 |
| 380 | iso_pu_bacteria | 2838736955 | 2838737771 | 340 |
| 381 | iso_pu_bacteria | 2840764183 | 2840767717 | 340 |
| 382 | iso_pu_bacteria | 2841840854 | 2841841860 | 340 |
| 383 | iso_pu_bacteria | 2842140634 | 2842141639 | 340 |
| 384 | iso_pu_bacteria | 2842871566 | 2842872478 | 340 |
| 385 | iso_pu_bacteria | 2842922631 | 2842924365 | 340 |
| 386 | iso_pu_bacteria | 2844163670 | 2844163992 | 340 |
| 387 | iso_pu_bacteria | 2847417321 | 2847419681 | 340 |
| 388 | iso_pu_bacteria | 2848992105 | 2848994683 | 340 |
| 389 | iso_pu_bacteria | 2850079185 | 2850081699 | 340 |
| 390 | iso_pu_bacteria | 2854896431 | 2854901387 | 340 |
| 391 | iso_pu_bacteria | 2854916844 | 2854918998 | 340 |
| 392 | iso_pu_bacteria | 2855825444 | 2855828626 | 340 |
| 393 | iso_pu_bacteria | 2855872281 | 2855877197 | 340 |
| 394 | iso_pu_bacteria | 2857531043 | 2857532340 | 340 |
| 395 | iso_pu_bacteria | 2858800743 | 2858807008 | 340 |
| 396 | iso_pu_bacteria | 2891373044 | 2891373613 | 340 |
| 397 | iso_pu_bacteria | 2896384573 | 2896391119 | 340 |
| 398 | iso_pu_bacteria | 2899803654 | 2899806181 | 340 |
| 399 | iso_pu_bacteria | 2911138879 | 2911142471 | 340 |
| 400 | iso_pu_bacteria | 2913295892 | 2913296144 | 340 |
| 401 | iso_pu_bacteria | 2915980308 | 2915983656 | 340 |
| 402 | iso_pu_bacteria | 2915986958 | 2915988488 | 340 |
| 403 | iso_pu_bacteria | 2915993759 | 2915994235 | 340 |
| 404 | iso_pu_bacteria | 2916000859 | 2916006250 | 340 |
| 405 | iso_pu_bacteria | 2916007675 | 2916011332 | 340 |
| 406 | iso_pu_bacteria | 2916014648 | 2916021525 | 340 |
| 407 | iso_pu_bacteria | 2916021584 | 2916028153 | 340 |
| 408 | iso_pu_bacteria | 2916028427 | 2916035069 | 340 |
| 409 | iso_pu_bacteria | 2916035215 | 2916038257 | 340 |
| 410 | iso_pu_bacteria | 2916041962 | 2916044971 | 340 |
| 411 | iso_pu_bacteria | 2916048683 | 2916054539 | 340 |
| 412 | iso_pu_bacteria | 2916055098 | 2916061156 | 340 |
| 413 | iso_pu_bacteria | 2916061851 | 2916065355 | 340 |
| 414 | iso_pu_bacteria | 2916068649 | 2916070769 | 340 |
| 415 | iso_pu_bacteria | 2916076590 | 2916082940 | 340 |
| 416 | iso_pu_bacteria | 2919171160 | 2919173014 | 340 |
| 417 | iso_pu_bacteria | 2920760137 | 2920761289 | 340 |
| 418 | iso_pu_bacteria | 2920822456 | 2920825514 | 340 |
| 419 | iso_pu_bacteria | 2921201388 | 2921203213 | 340 |
| 420 | iso_pu_bacteria | 2921208531 | 2921210111 | 340 |
| 421 | iso_pu_bacteria | 2921237296 | 2921240582 | 340 |
| 422 | iso_pu_bacteria | 2921244191 | 2921245785 | 340 |
| 423 | iso_pu_bacteria | 2921250672 | 2921256895 | 340 |
| 424 | iso_pu_bacteria | 2921257292 | 2921260097 | 340 |
| 425 | iso_pu_bacteria | 2921263974 | 2921269989 | 340 |
| 426 | iso_pu_bacteria | 2921282425 | 2921283073 | 340 |
| 427 | iso_pu_bacteria | 2921289301 | 2921296777 | 340 |
| 428 | iso_pu_bacteria | 2924144063 | 2924148505 | 340 |
| 429 | iso_pu_bacteria | 2924150972 | 2924154710 | 340 |
| 430 | iso_pu_bacteria | 2924158325 | 2924164384 | 340 |
| 431 | iso_pu_bacteria | 2924165586 | 2924168387 | 340 |
| 432 | iso_pu_bacteria | 2924172951 | 2924178764 | 340 |
| 433 | iso_pu_bacteria | 2924179722 | 2924182088 | 340 |
| 434 | iso_pu_bacteria | 2924186466 | 2924188963 | 340 |
| 435 | iso_pu_bacteria | 2924193448 | 2924195814 | 340 |
| 436 | iso_pu_bacteria | 2924200457 | 2924202915 | 340 |
| 437 | iso_pu_bacteria | 2924207177 | 2924209949 | 340 |
| 438 | iso_pu_bacteria | 2924214083 | 2924217328 | 340 |
| 439 | iso_pu_bacteria | 2924221636 | 2924228290 | 340 |
| 440 | iso_pu_bacteria | 2924228884 | 2924235353 | 340 |
| 441 | iso_pu_bacteria | 2928078545 | 2928079157 | 340 |
| 442 | iso_pu_bacteria | 2928147474 | 2928148472 | 340 |
| 443 | iso_pu_bacteria | 2928521798 | 2928523434 | 340 |
| 444 | iso_pu_bacteria | 2932082852 | 2932085769 | 340 |
| 445 | iso_pu_bacteria | 2936996657 | 2937001521 | 340 |
| 446 | iso_pu_bacteria | 2937002841 | 2937005828 | 340 |
| 447 | iso_pu_bacteria | 2937009748 | 2937014335 | 340 |
| 448 | iso_pu_bacteria | 2937016420 | 2937021938 | 340 |
| 449 | iso_pu_bacteria | 2937023124 | 2937023994 | 340 |
| 450 | iso_pu_bacteria | 2937029754 | 2937035008 | 340 |
| 451 | iso_pu_bacteria | 2937036028 | 2937039239 | 340 |
| 452 | iso_pu_bacteria | 2937042894 | 2937049007 | 340 |
| 453 | iso_pu_bacteria | 2937049772 | 2937056425 | 340 |
| 454 | iso_pu_bacteria | 2937056579 | 2937056891 | 340 |
| 455 | iso_pu_bacteria | 2937063883 | 2937066048 | 340 |
| 456 | iso_pu_bacteria | 2937071275 | 2937075363 | 340 |
| 457 | iso_pu_bacteria | 2937078374 | 2937084348 | 340 |
| 458 | iso_pu_bacteria | 2937084907 | 2937087386 | 340 |
| 459 | iso_pu_bacteria | 2937091812 | 2937092606 | 340 |
| 460 | iso_pu_bacteria | 2937098957 | 2937100487 | 340 |
| 461 | iso_pu_bacteria | 2937106411 | 2937110488 | 340 |
| 462 | iso_pu_bacteria | 2937113482 | 2937118801 | 340 |
| 463 | iso_pu_bacteria | 2937119839 | 2937125854 | 340 |
| 464 | iso_pu_bacteria | 2937126314 | 2937131019 | 340 |
| 465 | iso_pu_bacteria | 2941499720 | 2941504704 | 340 |
| 466 | iso_pu_bacteria | 2954011201 | 2954015705 | 340 |
| 467 | iso_pu_bacteria | 2957375807 | 2957379076 | 340 |
| 468 | iso_pu_bacteria | 2957382221 | 2957383040 | 340 |
| 469 | iso_pu_bacteria | 2957388812 | 2957391998 | 340 |
| 470 | iso_pu_bacteria | 2957395598 | 2957396227 | 340 |
| 471 | iso_pu_bacteria | 2957402308 | 2957402908 | 340 |
| 472 | iso_pu_bacteria | 2957408893 | 2957410680 | 340 |
| 473 | iso_pu_bacteria | 2957415311 | 2957416034 | 340 |
| 474 | iso_pu_bacteria | 2957430029 | 2957430499 | 340 |
| 475 | iso_pu_bacteria | 2957437181 | 2957438842 | 340 |
| 476 | iso_pu_bacteria | 2957443900 | 2957445247 | 340 |
| 477 | iso_pu_bacteria | 2957450854 | 2957454935 | 340 |
| 478 | iso_pu_bacteria | 2957457609 | 2957461771 | 340 |
| 479 | iso_pu_bacteria | 2957464669 | 2957464802 | 340 |
| 480 | iso_pu_bacteria | 2957471148 | 2957477912 | 340 |
| 481 | iso_pu_bacteria | 2957478035 | 2957484351 | 340 |
| 482 | iso_pu_bacteria | 2957484790 | 2957489981 | 340 |
| 483 | iso_pu_bacteria | 2957491536 | 2957491666 | 340 |
| 484 | iso_pu_bacteria | 2957498199 | 2957501669 | 340 |
| 485 | iso_pu_bacteria | 2957505466 | 2957510291 | 340 |
| 486 | iso_pu_bacteria | 2960584000 | 2960585051 | 340 |
| 487 | iso_pu_bacteria | 2960591022 | 2960595287 | 340 |
| 488 | iso_pu_bacteria | 2960603979 | 2960604560 | 340 |
| 489 | iso_pu_bacteria | 2960610863 | 2960614275 | 340 |
| 490 | iso_pu_bacteria | 2960617483 | 2960621860 | 340 |
| 491 | iso_pu_bacteria | 2960624210 | 2960630388 | 340 |
| 492 | iso_pu_bacteria | 2960631154 | 2960634376 | 340 |
| 493 | iso_pu_bacteria | 2960637947 | 2960642839 | 340 |
| 494 | iso_pu_bacteria | 2960645483 | 2960645616 | 340 |
| 495 | iso_pu_bacteria | 2960652885 | 2960660088 | 340 |
| 496 | iso_pu_bacteria | 2960660292 | 2960661962 | 340 |
| 497 | iso_pu_bacteria | 2960667422 | 2960669798 | 340 |
| 498 | iso_pu_bacteria | 2960674078 | 2960677787 | 340 |
| 499 | iso_pu_bacteria | 2960680706 | 2960683396 | 340 |
| 500 | iso_pu_bacteria | 2960687367 | 2960692957 | 340 |
| 501 | iso_pu_bacteria | 2960693952 | 2960695247 | 340 |
| 502 | iso_pu_bacteria | 2964607997 | 2964610737 | 340 |
| 503 | iso_pu_bacteria | 2964615318 | 2964621680 | 340 |
| 504 | iso_pu_bacteria | 2964621998 | 2964624231 | 340 |
| 505 | iso_pu_bacteria | 2964628898 | 2964629901 | 340 |
| 506 | iso_pu_bacteria | 2964636051 | 2964639514 | 340 |
| 507 | iso_pu_bacteria | 2964643177 | 2964647935 | 340 |
| 508 | iso_pu_bacteria | 2964649959 | 2964655543 | 340 |
| 509 | iso_pu_bacteria | 2964656573 | 2964657980 | 340 |
| 510 | iso_pu_bacteria | 2964663802 | 2964664643 | 340 |
| 511 | iso_pu_bacteria | 2964670856 | 2964674143 | 340 |
| 512 | iso_pu_bacteria | 2964678106 | 2964678424 | 340 |
| 513 | iso_pu_bacteria | 2964691889 | 2964696081 | 340 |
| 514 | iso_pu_bacteria | 2964698721 | 2964704969 | 340 |
| 515 | iso_pu_bacteria | 2964705432 | 2964709616 | 340 |
| 516 | iso_pu_bacteria | 2964712639 | 2964717584 | 340 |
| 517 | iso_pu_bacteria | 2964719344 | 2964720978 | 340 |
| 518 | iso_pu_bacteria | 2967664464 | 2967665647 | 340 |
| 519 | iso_pu_bacteria | 2967671571 | 2967677111 | 340 |
| 520 | iso_pu_bacteria | 2967678726 | 2967685680 | 340 |
| 521 | iso_pu_bacteria | 2967686174 | 2967687969 | 340 |
| 522 | iso_pu_bacteria | 2967693043 | 2967697855 | 340 |
| 523 | iso_pu_bacteria | 2967699805 | 2967704428 | 340 |
| 524 | iso_pu_bacteria | 2967706974 | 2967714135 | 340 |
| 525 | iso_pu_bacteria | 2967714385 | 2967720918 | 340 |
| 526 | iso_pu_bacteria | 2967721400 | 2967725151 | 340 |
| 527 | iso_pu_bacteria | 2967728569 | 2967732687 | 340 |
| 528 | iso_pu_bacteria | 2967735183 | 2967741852 | 340 |
| 529 | iso_pu_bacteria | 2967742019 | 2967748918 | 340 |
| 530 | iso_pu_bacteria | 2967748971 | 2967750884 | 340 |
| 531 | iso_pu_bacteria | 2967755722 | 2967761713 | 340 |
| 532 | iso_pu_bacteria | 2967762386 | 2967765984 | 340 |
| 533 | iso_pu_bacteria | 2967769361 | 2967772251 | 340 |
| 534 | iso_pu_bacteria | 2967775926 | 2967781985 | 340 |
| 535 | iso_pu_bacteria | 2970019648 | 2970023584 | 340 |
| 536 | iso_pu_bacteria | 2970026789 | 2970028890 | 340 |
| 537 | iso_pu_bacteria | 2970033650 | 2970038286 | 340 |
| 538 | iso_pu_bacteria | 2970040964 | 2970042171 | 340 |
| 539 | iso_pu_bacteria | 2970047711 | 2970054850 | 340 |
| 540 | iso_pu_bacteria | 2970054988 | 2970061231 | 340 |
| 541 | iso_pu_bacteria | 2970061556 | 2970062945 | 340 |
| 542 | iso_pu_bacteria | 2970068827 | 2970071333 | 340 |
| 543 | iso_pu_bacteria | 2970076120 | 2970080285 | 340 |
| 544 | iso_pu_bacteria | 2970082768 | 2970085739 | 340 |
| 545 | iso_pu_bacteria | 2970088815 | 2970094715 | 340 |
| 546 | iso_pu_bacteria | 2970095765 | 2970097317 | 340 |
| 547 | iso_pu_bacteria | 2970102677 | 2970105872 | 340 |
| 548 | iso_pu_bacteria | 2970109326 | 2970116117 | 340 |
| 549 | iso_pu_bacteria | 2970116247 | 2970119646 | 340 |
| 550 | iso_pu_bacteria | 2970122695 | 2970126613 | 340 |
| 551 | iso_pu_bacteria | 2970129317 | 2970134899 | 340 |
| 552 | iso_pu_bacteria | 2970136068 | 2970140920 | 340 |
| 553 | iso_pu_bacteria | 2970143518 | 2970148428 | 340 |
| 554 | iso_pu_bacteria | 2970149975 | 2970153153 | 340 |
| 555 | iso_pu_bacteria | 2970156795 | 2970162985 | 340 |
| 556 | iso_pu_bacteria | 2970164137 | 2970164679 | 340 |
| 557 | iso_pu_bacteria | 2970170962 | 2970174345 | 340 |
| 558 | iso_pu_bacteria | 2970177841 | 2970182393 | 340 |
| 559 | iso_pu_bacteria | 2970184632 | 2970191265 | 340 |
| 560 | iso_pu_bacteria | 2970191845 | 2970194709 | 340 |
| 561 | iso_pu_bacteria | 2977516862 | 2977518764 | 340 |
| 562 | iso_pu_bacteria | 2977523885 | 2977526659 | 340 |
| 563 | iso_pu_bacteria | 2977530762 | 2977533894 | 340 |
| 564 | iso_pu_bacteria | 2977537788 | 2977541288 | 340 |
| 565 | iso_pu_bacteria | 2977544691 | 2977547982 | 340 |
| 566 | iso_pu_bacteria | 2977551784 | 2977557894 | 340 |
| 567 | iso_pu_bacteria | 2977558990 | 2977559536 | 340 |
| 568 | iso_pu_bacteria | 2977565890 | 2977569180 | 340 |
| 569 | iso_pu_bacteria | 2977572785 | 2977578690 | 340 |
| 570 | iso_pu_bacteria | 2977579622 | 2977585635 | 340 |
| 571 | iso_pu_bacteria | 2989349275 | 2989350092 | 340 |
| 572 | iso_pu_bacteria | 2989771324 | 2989773237 | 340 |
| 573 | iso_pu_bacteria | 3002141150 | 3002144396 | 340 |
| 574 | iso_pu_bacteria | 648276728 | 648740960 | 340 |
| 575 | iso_pu_bacteria | 8003151029 | 8003154761 | 340 |
| 576 | iso_pu_bacteria | 8003992118 | 8003996307 | 340 |
| 577 | iso_pu_bacteria | 8003999396 | 8004004038 | 340 |
| 578 | iso_pu_bacteria | 8054558443 | 8054559154 | 340 |
| 579 | iso_pu_bacteria | 8055431914 | 8055432370 | 340 |
| 580 | iso_pu_bacteria | 8056875544 | 8056875816 | 340 |
| 581 | 3300030522 | Ga0307512_10006312 | Ga0307512_100063125 | 341 |
| 582 | 3300046460 | Ga0495638_0170738 | Ga0495638_0170738_76_1140 | 341 |
| 583 | 3300046499 | Ga0495594_0115828 | Ga0495594_0115828_343_1407 | 341 |
| 584 | iso_pu_bacteria | 2508501114 | 2509074254 | 341 |
| 585 | iso_pu_bacteria | 2509276021 | 2509391764 | 341 |
| 586 | iso_pu_bacteria | 2509276033 | 2509447375 | 341 |
| 587 | iso_pu_bacteria | 2510461076 | 2510895650 | 341 |
| 588 | iso_pu_bacteria | 2510917028 | 2511182445 | 341 |
| 589 | iso_pu_bacteria | 2510917030 | 2511199295 | 341 |
| 590 | iso_pu_bacteria | 2513237088 | 2513597644 | 341 |
| 591 | iso_pu_bacteria | 2513237138 | 2513865952 | 341 |
| 592 | iso_pu_bacteria | 2513237144 | 2513908509 | 341 |
| 593 | iso_pu_bacteria | 2513237146 | 2513925148 | 341 |
| 594 | iso_pu_bacteria | 2513237159 | 2513997651 | 341 |
| 595 | iso_pu_bacteria | 2513237162 | 2514018039 | 341 |
| 596 | iso_pu_bacteria | 2515154113 | 2515635099 | 341 |
| 597 | iso_pu_bacteria | 2515154114 | 2515645541 | 341 |
| 598 | iso_pu_bacteria | 2515154116 | 2515655079 | 341 |
| 599 | iso_pu_bacteria | 2519899620 | 2520377008 | 341 |
| 600 | iso_pu_bacteria | 2524023209 | 2524458886 | 341 |
| 601 | iso_pu_bacteria | 2529292951 | 2530646536 | 341 |
| 602 | iso_pu_bacteria | 2534681796 | 2535517131 | 341 |
| 603 | iso_pu_bacteria | 2537561587 | 2537877183 | 341 |
| 604 | iso_pu_bacteria | 2554235003 | 2554248424 | 341 |
| 605 | iso_pu_bacteria | 2558860242 | 2559295540 | 341 |
| 606 | iso_pu_bacteria | 2582581283 | 2585167476 | 341 |
| 607 | iso_pu_bacteria | 2582581294 | 2585201971 | 341 |
| 608 | iso_pu_bacteria | 2582581298 | 2585225373 | 341 |
| 609 | iso_pu_bacteria | 2582581299 | 2585228546 | 341 |
| 610 | iso_pu_bacteria | 2582581304 | 2585258240 | 341 |
| 611 | iso_pu_bacteria | 2582581306 | 2585265697 | 341 |
| 612 | iso_pu_bacteria | 2582581307 | 2585271381 | 341 |
| 613 | iso_pu_bacteria | 2582581865 | 2585388903 | 341 |
| 614 | iso_pu_bacteria | 2582581866 | 2585395398 | 341 |
| 615 | iso_pu_bacteria | 2582581867 | 2585400984 | 341 |
| 616 | iso_pu_bacteria | 2585427529 | 2585547929 | 341 |
| 617 | iso_pu_bacteria | 2585427531 | 2585559124 | 341 |
| 618 | iso_pu_bacteria | 2585427590 | 2585822114 | 341 |
| 619 | iso_pu_bacteria | 2585427594 | 2585843504 | 341 |
| 620 | iso_pu_bacteria | 2585427608 | 2585898505 | 341 |
| 621 | iso_pu_bacteria | 2585427609 | 2585903930 | 341 |
| 622 | iso_pu_bacteria | 2585428125 | 2587980952 | 341 |
| 623 | iso_pu_bacteria | 2599185170 | 2599417054 | 341 |
| 624 | iso_pu_bacteria | 2599185210 | 2599601861 | 341 |
| 625 | iso_pu_bacteria | 2600255279 | 2601609884 | 341 |
| 626 | iso_pu_bacteria | 2600255308 | 2601746659 | 341 |
| 627 | iso_pu_bacteria | 2615840624 | 2616293104 | 341 |
| 628 | iso_pu_bacteria | 2643221558 | 2643811284 | 341 |
| 629 | iso_pu_bacteria | 2643221568 | 2643856553 | 341 |
| 630 | iso_pu_bacteria | 2643221582 | 2643920141 | 341 |
| 631 | iso_pu_bacteria | 2643221599 | 2644007009 | 341 |
| 632 | iso_pu_bacteria | 2643221607 | 2644050203 | 341 |
| 633 | iso_pu_bacteria | 2643221634 | 2644191795 | 341 |
| 634 | iso_pu_bacteria | 2643221636 | 2644204736 | 341 |
| 635 | iso_pu_bacteria | 2643221637 | 2644208762 | 341 |
| 636 | iso_pu_bacteria | 2643221643 | 2644242589 | 341 |
| 637 | iso_pu_bacteria | 2643221686 | 2644483123 | 341 |
| 638 | iso_pu_bacteria | 2643221688 | 2644494282 | 341 |
| 639 | iso_pu_bacteria | 2643221689 | 2644497769 | 341 |
| 640 | iso_pu_bacteria | 2643221693 | 2644521765 | 341 |
| 641 | iso_pu_bacteria | 2643221718 | 2644652292 | 341 |
| 642 | iso_pu_bacteria | 2718217882 | 2719182051 | 341 |
| 643 | iso_pu_bacteria | 2718217927 | 2719386665 | 341 |
| 644 | iso_pu_bacteria | 2718217997 | 2719666413 | 341 |
| 645 | iso_pu_bacteria | 2718218009 | 2719732767 | 341 |
| 646 | iso_pu_bacteria | 2718218199 | 2720492833 | 341 |
| 647 | iso_pu_bacteria | 2718218232 | 2720614301 | 341 |
| 648 | iso_pu_bacteria | 2718218233 | 2720621070 | 341 |
| 649 | iso_pu_bacteria | 2718218235 | 2720632394 | 341 |
| 650 | iso_pu_bacteria | 2718218269 | 2720776122 | 341 |
| 651 | iso_pu_bacteria | 2718218363 | 2721148142 | 341 |
| 652 | iso_pu_bacteria | 2718218365 | 2721159594 | 341 |
| 653 | iso_pu_bacteria | 2718218366 | 2721164978 | 341 |
| 654 | iso_pu_bacteria | 2718218423 | 2721400371 | 341 |
| 655 | iso_pu_bacteria | 2721755514 | 2722841148 | 341 |
| 656 | iso_pu_bacteria | 2721755556 | 2723027721 | 341 |
| 657 | iso_pu_bacteria | 2721755684 | 2723561349 | 341 |
| 658 | iso_pu_bacteria | 2721755685 | 2723567972 | 341 |
| 659 | iso_pu_bacteria | 2721755809 | 2724039184 | 341 |
| 660 | iso_pu_bacteria | 2721755810 | 2724045523 | 341 |
| 661 | iso_pu_bacteria | 2721755819 | 2724090729 | 341 |
| 662 | iso_pu_bacteria | 2721755822 | 2724105237 | 341 |
| 663 | iso_pu_bacteria | 2721755823 | 2724111064 | 341 |
| 664 | iso_pu_bacteria | 2728369352 | 2730108657 | 341 |
| 665 | iso_pu_bacteria | 2728369365 | 2730165286 | 341 |
| 666 | iso_pu_bacteria | 2728369397 | 2730299226 | 341 |
| 667 | iso_pu_bacteria | 2738541293 | 2738800351 | 341 |
| 668 | iso_pu_bacteria | 2773857925 | 2774869458 | 341 |
| 669 | iso_pu_bacteria | 2791355256 | 2793294176 | 341 |
| 670 | iso_pu_bacteria | 2791355259 | 2793319188 | 341 |
| 671 | iso_pu_bacteria | 2791355261 | 2793331985 | 341 |
| 672 | iso_pu_bacteria | 2791355262 | 2793335482 | 341 |
| 673 | iso_pu_bacteria | 2791355263 | 2793339530 | 341 |
| 674 | iso_pu_bacteria | 2791355264 | 2793346996 | 341 |
| 675 | iso_pu_bacteria | 2791355265 | 2793351582 | 341 |
| 676 | iso_pu_bacteria | 2791355267 | 2793367637 | 341 |
| 677 | iso_pu_bacteria | 2802429605 | 2805926816 | 341 |
| 678 | iso_pu_bacteria | 2802429606 | 2805932727 | 341 |
| 679 | iso_pu_bacteria | 2808606387 | 2808987725 | 341 |
| 680 | iso_pu_bacteria | 2818991439 | 2819559258 | 341 |
| 681 | iso_pu_bacteria | 2818991442 | 2819578193 | 341 |
| 682 | iso_pu_bacteria | 2821136567 | 2821139302 | 341 |
| 683 | iso_pu_bacteria | 2838016132 | 2838022403 | 341 |
| 684 | iso_pu_bacteria | 2838022645 | 2838023598 | 341 |
| 685 | iso_pu_bacteria | 2838035591 | 2838038740 | 341 |
| 686 | iso_pu_bacteria | 2838048938 | 2838053294 | 341 |
| 687 | iso_pu_bacteria | 2838061910 | 2838065411 | 341 |
| 688 | iso_pu_bacteria | 2838068647 | 2838069890 | 341 |
| 689 | iso_pu_bacteria | 2838661181 | 2838661337 | 341 |
| 690 | iso_pu_bacteria | 2838668709 | 2838670622 | 341 |
| 691 | iso_pu_bacteria | 2838675328 | 2838675570 | 341 |
| 692 | iso_pu_bacteria | 2838680041 | 2838683188 | 341 |
| 693 | iso_pu_bacteria | 2838686498 | 2838686783 | 341 |
| 694 | iso_pu_bacteria | 2838694306 | 2838697868 | 341 |
| 695 | iso_pu_bacteria | 2838701080 | 2838702993 | 341 |
| 696 | iso_pu_bacteria | 2838707686 | 2838710983 | 341 |
| 697 | iso_pu_bacteria | 2838714209 | 2838714452 | 341 |
| 698 | iso_pu_bacteria | 2838719591 | 2838721747 | 341 |
| 699 | iso_pu_bacteria | 2838724970 | 2838725212 | 341 |
| 700 | iso_pu_bacteria | 2838729681 | 2838730259 | 341 |
| 701 | iso_pu_bacteria | 2838742623 | 2838742726 | 341 |
| 702 | iso_pu_bacteria | 2841846520 | 2841848731 | 341 |
| 703 | iso_pu_bacteria | 2841851746 | 2841854611 | 341 |
| 704 | iso_pu_bacteria | 2841859092 | 2841862330 | 341 |
| 705 | iso_pu_bacteria | 2841864319 | 2841867217 | 341 |
| 706 | iso_pu_bacteria | 2842077413 | 2842079158 | 341 |
| 707 | iso_pu_bacteria | 2842110456 | 2842112998 | 341 |
| 708 | iso_pu_bacteria | 2842118031 | 2842118331 | 341 |
| 709 | iso_pu_bacteria | 2842124991 | 2842125238 | 341 |
| 710 | iso_pu_bacteria | 2842130223 | 2842130465 | 341 |
| 711 | iso_pu_bacteria | 2842146304 | 2842151884 | 341 |
| 712 | iso_pu_bacteria | 2842152218 | 2842154365 | 341 |
| 713 | iso_pu_bacteria | 2842156927 | 2842158369 | 341 |
| 714 | iso_pu_bacteria | 2842163707 | 2842168528 | 341 |
| 715 | iso_pu_bacteria | 2842170452 | 2842170694 | 341 |
| 716 | iso_pu_bacteria | 2842175837 | 2842177985 | 341 |
| 717 | iso_pu_bacteria | 2842180545 | 2842181985 | 341 |
| 718 | iso_pu_bacteria | 2842187318 | 2842187561 | 341 |
| 719 | iso_pu_bacteria | 2842192696 | 2842195795 | 341 |
| 720 | iso_pu_bacteria | 2842198810 | 2842199112 | 341 |
| 721 | iso_pu_bacteria | 2842205361 | 2842209552 | 341 |
| 722 | iso_pu_bacteria | 2842211629 | 2842211872 | 341 |
| 723 | iso_pu_bacteria | 2842224351 | 2842226509 | 341 |
| 724 | iso_pu_bacteria | 2842229732 | 2842230016 | 341 |
| 725 | iso_pu_bacteria | 2842237096 | 2842240245 | 341 |
| 726 | iso_pu_bacteria | 2842243621 | 2842243905 | 341 |
| 727 | iso_pu_bacteria | 2842250916 | 2842257094 | 341 |
| 728 | iso_pu_bacteria | 2842257432 | 2842258010 | 341 |
| 729 | iso_pu_bacteria | 2842264693 | 2842267810 | 341 |
| 730 | iso_pu_bacteria | 2842271015 | 2842271679 | 341 |
| 731 | iso_pu_bacteria | 2842278818 | 2842283006 | 341 |
| 732 | iso_pu_bacteria | 2842285085 | 2842285350 | 341 |
| 733 | iso_pu_bacteria | 2842291075 | 2842292820 | 341 |
| 734 | iso_pu_bacteria | 2842298080 | 2842298238 | 341 |
| 735 | iso_pu_bacteria | 2842311132 | 2842313962 | 341 |
| 736 | iso_pu_bacteria | 2842317721 | 2842319799 | 341 |
| 737 | iso_pu_bacteria | 2842341865 | 2842348110 | 341 |
| 738 | iso_pu_bacteria | 2842357229 | 2842360162 | 341 |
| 739 | iso_pu_bacteria | 2842363717 | 2842368356 | 341 |
| 740 | iso_pu_bacteria | 2842370503 | 2842373818 | 341 |
| 741 | iso_pu_bacteria | 2842377471 | 2842379217 | 341 |
| 742 | iso_pu_bacteria | 2842384541 | 2842384842 | 341 |
| 743 | iso_pu_bacteria | 2842395702 | 2842400083 | 341 |
| 744 | iso_pu_bacteria | 2842402390 | 2842402710 | 341 |
| 745 | iso_pu_bacteria | 2842409023 | 2842409919 | 341 |
| 746 | iso_pu_bacteria | 2842415677 | 2842416567 | 341 |
| 747 | iso_pu_bacteria | 2842422224 | 2842423504 | 341 |
| 748 | iso_pu_bacteria | 2842428310 | 2842430454 | 341 |
| 749 | iso_pu_bacteria | 2842434925 | 2842436734 | 341 |
| 750 | iso_pu_bacteria | 2842441272 | 2842443424 | 341 |
| 751 | iso_pu_bacteria | 2842447887 | 2842449295 | 341 |
| 752 | iso_pu_bacteria | 2842462802 | 2842466708 | 341 |
| 753 | iso_pu_bacteria | 2842469257 | 2842471396 | 341 |
| 754 | iso_pu_bacteria | 2842489311 | 2842493656 | 341 |
| 755 | iso_pu_bacteria | 2842495871 | 2842497811 | 341 |
| 756 | iso_pu_bacteria | 2842509118 | 2842514240 | 341 |
| 757 | iso_pu_bacteria | 2842515876 | 2842519114 | 341 |
| 758 | iso_pu_bacteria | 2842521101 | 2842522106 | 341 |
| 759 | iso_pu_bacteria | 2844454524 | 2844458080 | 341 |
| 760 | iso_pu_bacteria | 2852387548 | 2852390520 | 341 |
| 761 | iso_pu_bacteria | 2857516855 | 2857517156 | 341 |
| 762 | iso_pu_bacteria | 2883068021 | 2883068662 | 341 |
| 763 | iso_pu_bacteria | 2894232714 | 2894242049 | 341 |
| 764 | iso_pu_bacteria | 2899792073 | 2899794068 | 341 |
| 765 | iso_pu_bacteria | 2899845264 | 2899848802 | 341 |
| 766 | iso_pu_bacteria | 2904467357 | 2904473132 | 341 |
| 767 | iso_pu_bacteria | 2919100787 | 2919106187 | 341 |
| 768 | iso_pu_bacteria | 2919114240 | 2919114488 | 341 |
| 769 | iso_pu_bacteria | 2919166419 | 2919169524 | 341 |
| 770 | iso_pu_bacteria | 2923556063 | 2923561122 | 341 |
| 771 | iso_pu_bacteria | 2926754445 | 2926755503 | 341 |
| 772 | iso_pu_bacteria | 2926760298 | 2926762634 | 341 |
| 773 | iso_pu_bacteria | 2929138655 | 2929141056 | 341 |
| 774 | iso_pu_bacteria | 2933006813 | 2933009009 | 341 |
| 775 | iso_pu_bacteria | 2933011516 | 2933014713 | 341 |
| 776 | iso_pu_bacteria | 2933016740 | 2933017994 | 341 |
| 777 | iso_pu_bacteria | 2933594066 | 2933596395 | 341 |
| 778 | iso_pu_bacteria | 2933599457 | 2933600696 | 341 |
| 779 | iso_pu_bacteria | 2935894831 | 2935896747 | 341 |
| 780 | iso_pu_bacteria | 2936381700 | 2936387779 | 341 |
| 781 | iso_pu_bacteria | 2978969890 | 2978971925 | 341 |
| 782 | iso_pu_bacteria | 2979089926 | 2979092053 | 341 |
| 783 | iso_pu_bacteria | 2979095461 | 2979100558 | 341 |
| 784 | iso_pu_bacteria | 2979100975 | 2979104113 | 341 |
| 785 | iso_pu_bacteria | 2984509177 | 2984511317 | 341 |
| 786 | iso_pu_bacteria | 2984518228 | 2984522322 | 341 |
| 787 | iso_pu_bacteria | 2984537506 | 2984541624 | 341 |
| 788 | iso_pu_bacteria | 2984587000 | 2984590209 | 341 |
| 789 | iso_pu_bacteria | 2984601300 | 2984603897 | 341 |
| 790 | iso_pu_bacteria | 2996887358 | 2996892786 | 341 |
| 791 | iso_pu_bacteria | 3005409236 | 3005414302 | 341 |
| 792 | iso_pu_bacteria | 3005445848 | 3005448718 | 341 |
| 793 | iso_pu_bacteria | 3005452660 | 3005454948 | 341 |
| 794 | iso_pu_bacteria | 650716007 | 650740750 | 341 |
| 795 | iso_pu_bacteria | 8003570095 | 8003571827 | 341 |
| 796 | iso_pu_bacteria | 8005258706 | 8005259447 | 341 |
| 797 | iso_pu_bacteria | 8005275841 | 8005281475 | 341 |
| 798 | iso_pu_bacteria | 8005282627 | 8005284557 | 341 |
| 799 | iso_pu_bacteria | 8005289223 | 8005295775 | 341 |
| 800 | iso_pu_bacteria | 8005301065 | 8005303385 | 341 |
| 801 | iso_pu_bacteria | 8005321885 | 8005327313 | 341 |
| 802 | iso_pu_bacteria | 8005382845 | 8005388855 | 341 |
| 803 | iso_pu_bacteria | 8005395548 | 8005395838 | 341 |
| 804 | iso_pu_bacteria | 8005430974 | 8005437541 | 341 |
| 805 | iso_pu_bacteria | 8005497431 | 8005501156 | 341 |
| 806 | iso_pu_bacteria | 8005542996 | 8005545945 | 341 |
| 807 | iso_pu_bacteria | 8005619151 | 8005622522 | 341 |
| 808 | iso_pu_bacteria | 8005626139 | 8005630024 | 341 |
| 809 | iso_pu_bacteria | 8005668836 | 8005672574 | 341 |
| 810 | iso_pu_bacteria | 8005688590 | 8005691844 | 341 |
| 811 | iso_pu_bacteria | 8005695170 | 8005697672 | 341 |
| 812 | iso_pu_bacteria | 8018127388 | 8018127941 | 341 |
| 813 | iso_pu_bacteria | 8018150411 | 8018151303 | 341 |
| 814 | iso_pu_bacteria | 8018176218 | 8018179495 | 341 |
| 815 | iso_pu_bacteria | 8024486573 | 8024488293 | 341 |
| 816 | iso_pu_bacteria | 8024501048 | 8024504696 | 341 |
| 817 | iso_pu_bacteria | 8056375014 | 8056377582 | 341 |
| 818 | iso_pu_bacteria | 8056382006 | 8056387173 | 341 |
| 819 | 3300005468 | Ga0070707_100087505 | Ga0070707_1000875053 | 342 |
| 820 | 3300005471 | Ga0070698_100000606 | Ga0070698_10000060624 | 342 |
| 821 | 3300005518 | Ga0070699_100043988 | Ga0070699_1000439883 | 342 |
| 822 | 3300005536 | Ga0070697_100262384 | Ga0070697_1002623842 | 342 |
| 823 | 3300005544 | Ga0070686_100000679 | Ga0070686_10000067913 | 342 |
| 824 | 3300013102 | Ga0157371_10201799 | Ga0157371_102017991 | 342 |
| 825 | 3300013307 | Ga0157372_10043474 | Ga0157372_100434741 | 342 |
| 826 | 3300025910 | Ga0207684_10031226 | Ga0207684_100312262 | 342 |
| 827 | 3300025922 | Ga0207646_10001966 | Ga0207646_100019663 | 342 |
| 828 | 3300027543 | Ga0209999_1002293 | Ga0209999_10022932 | 342 |
| 829 | 3300027695 | Ga0209966_1000731 | Ga0209966_100073110 | 342 |
| 830 | 3300027717 | Ga0209998_10000251 | Ga0209998_100002513 | 342 |
| 831 | 3300031548 | Ga0307408_100197882 | Ga0307408_1001978822 | 342 |
| 832 | 3300031548 | Ga0307408_100271501 | Ga0307408_1002715011 | 342 |
| 833 | 3300031824 | Ga0307413_10020785 | Ga0307413_100207852 | 342 |
| 834 | 3300031903 | Ga0307407_10084226 | Ga0307407_100842263 | 342 |
| 835 | 3300031911 | Ga0307412_10081170 | Ga0307412_100811701 | 342 |
| 836 | 3300031995 | Ga0307409_100056996 | Ga0307409_1000569963 | 342 |
| 837 | 3300031995 | Ga0307409_100179030 | Ga0307409_1001790303 | 342 |
| 838 | 3300032002 | Ga0307416_100105576 | Ga0307416_1001055762 | 342 |
| 839 | 3300032002 | Ga0307416_100109528 | Ga0307416_1001095283 | 342 |
| 840 | 3300032002 | Ga0307416_100206252 | Ga0307416_1002062522 | 342 |
| 841 | 3300032004 | Ga0307414_10329729 | Ga0307414_103297291 | 342 |
| 842 | 3300032005 | Ga0307411_10038005 | Ga0307411_100380052 | 342 |
| 843 | 3300042156 | Ga0439446_0030897 | Ga0439446_0030897_300_1337 | 342 |
| 844 | 3300047472 | Ga0495686_0000011 | Ga0495686_0000011_294445_295491 | 342 |
| 845 | 3300047472 | Ga0495686_0031014 | Ga0495686_0031014_2193_3239 | 342 |
| 846 | 3300049652 | Ga0501202_001871 | Ga0501202_001871_1143_2189 | 342 |
| 847 | 3300049660 | Ga0501216_006033 | Ga0501216_006033_240_1286 | 342 |
| 848 | 3300049661 | Ga0501217_005039 | Ga0501217_005039_528_1574 | 342 |
| 849 | 3300049669 | Ga0501235_002828 | Ga0501235_002828_2675_3721 | 342 |
| 850 | 3300049704 | Ga0501221_001373 | Ga0501221_001373_2945_3991 | 342 |
| 851 | 3300049705 | Ga0501225_0007861 | Ga0501225_0007861_1068_2114 | 342 |
| 852 | 3300049763 | Ga0501266_003015 | Ga0501266_003015_344_1390 | 342 |
| 853 | 3300049769 | Ga0501272_005348 | Ga0501272_005348_210_1256 | 342 |
| 854 | iso_pu_bacteria | 2510065019 | 2510134214 | 342 |
| 855 | iso_pu_bacteria | 2513237084 | 2513567704 | 342 |
| 856 | iso_pu_bacteria | 2513237085 | 2513578047 | 342 |
| 857 | iso_pu_bacteria | 2513237093 | 2513631861 | 342 |
| 858 | iso_pu_bacteria | 2513237103 | 2513707885 | 342 |
| 859 | iso_pu_bacteria | 2515075009 | 2515113380 | 342 |
| 860 | iso_pu_bacteria | 2515154134 | 2515739747 | 342 |
| 861 | iso_pu_bacteria | 2516653077 | 2517036983 | 342 |
| 862 | iso_pu_bacteria | 2516653085 | 2517077343 | 342 |
| 863 | iso_pu_bacteria | 2517093000 | 2517096102 | 342 |
| 864 | iso_pu_bacteria | 2517287029 | 2517407723 | 342 |
| 865 | iso_pu_bacteria | 2585427526 | 2585524771 | 342 |
| 866 | iso_pu_bacteria | 2585427528 | 2585538454 | 342 |
| 867 | iso_pu_bacteria | 2585427593 | 2585836407 | 342 |
| 868 | iso_pu_bacteria | 2724679232 | 2725945362 | 342 |
| 869 | iso_pu_bacteria | 2738541333 | 2739033095 | 342 |
| 870 | iso_pu_bacteria | 2765235942 | 2766066139 | 342 |
| 871 | iso_pu_bacteria | 2791355260 | 2793319433 | 342 |
| 872 | iso_pu_bacteria | 2791355266 | 2793362513 | 342 |
| 873 | iso_pu_bacteria | 2802429633 | 2806045234 | 342 |
| 874 | iso_pu_bacteria | 2802429634 | 2806049971 | 342 |
| 875 | iso_pu_bacteria | 2802429635 | 2806056809 | 342 |
| 876 | iso_pu_bacteria | 2802429636 | 2806064190 | 342 |
| 877 | iso_pu_bacteria | 2802429637 | 2806071458 | 342 |
| 878 | iso_pu_bacteria | 2933586486 | 2933588945 | 342 |
| 879 | iso_pu_bacteria | 2935901341 | 2935901689 | 342 |
| 880 | iso_pu_bacteria | 2936367885 | 2936371777 | 342 |
| 881 | iso_pu_bacteria | 2936375103 | 2936379612 | 342 |
| 882 | iso_pu_bacteria | 8005307578 | 8005313862 | 342 |
| 883 | iso_pu_bacteria | 8005376324 | 8005381191 | 342 |
| 884 | iso_pu_bacteria | 8005460587 | 8005464063 | 342 |
| 885 | iso_pu_bacteria | 8005556819 | 8005561484 | 342 |
| 886 | iso_pu_bacteria | 8005570704 | 8005573200 | 342 |
| 887 | 3300005347 | Ga0070668_100158490 | Ga0070668_1001584901 | 343 |
| 888 | 3300005539 | Ga0068853_100294490 | Ga0068853_1002944901 | 343 |
| 889 | 3300005564 | Ga0070664_100005066 | Ga0070664_1000050666 | 343 |
| 890 | 3300005718 | Ga0068866_10086467 | Ga0068866_100864672 | 343 |
| 891 | 3300006042 | Ga0075368_10047152 | Ga0075368_100471521 | 343 |
| 892 | 3300009148 | Ga0105243_10017730 | Ga0105243_100177303 | 343 |
| 893 | 3300010375 | Ga0105239_10054482 | Ga0105239_100544822 | 343 |
| 894 | 3300013100 | Ga0157373_10265606 | Ga0157373_102656061 | 343 |
| 895 | 3300013104 | Ga0157370_10002249 | Ga0157370_100022492 | 343 |
| 896 | 3300013297 | Ga0157378_10084572 | Ga0157378_100845722 | 343 |
| 897 | 3300025297 | Ga0209758_1013729 | Ga0209758_10137293 | 343 |
| 898 | 3300025972 | Ga0207668_10157451 | Ga0207668_101574512 | 343 |
| 899 | 3300028800 | Ga0265338_10234998 | Ga0265338_102349982 | 343 |
| 900 | 3300044658 | Ga0466972_0025855 | Ga0466972_0025855_1317_2378 | 343 |
| 901 | 3300044735 | Ga0466968_0024899 | Ga0466968_0024899_1153_2214 | 343 |
| 902 | 3300044901 | Ga0466960_0044086 | Ga0466960_0044086_302_1363 | 343 |
| 903 | 3300045976 | Ga0466967_0087284 | Ga0466967_0087284_1049_2125 | 343 |
| 904 | 3300046460 | Ga0495638_0011748 | Ga0495638_0011748_3443_4504 | 343 |
| 905 | 3300046660 | Ga0495625_0074150 | Ga0495625_0074150_1235_2266 | 343 |
| 906 | 3300047472 | Ga0495686_0000267 | Ga0495686_0000267_39960_40997 | 343 |
| 907 | 3300048923 | Ga0496120_0002673 | Ga0496120_0002673_11015_12076 | 343 |
| 908 | 3300053079 | Ga0500610_0019102 | Ga0500610_0019102_1210_2271 | 343 |
| 909 | 3300053125 | Ga0500618_000050 | Ga0500618_000050_93680_94711 | 343 |
| 910 | iso_pu_bacteria | 2896085136 | 2896089234 | 343 |
| 911 | 3300001989 | JGI24739J22299_10005239 | JGI24739J22299_100052393 | 344 |
| 912 | 3300001990 | JGI24737J22298_10000371 | JGI24737J22298_100003715 | 344 |
| 913 | 3300002067 | JGI24735J21928_10000001 | JGI24735J21928_10000001387 | 344 |
| 914 | 3300002738 | JGI25154J39366_1000003 | JGI25154J39366_1000003299 | 344 |
| 915 | 3300002741 | JGI25157J39369_1004789 | JGI25157J39369_10047891 | 344 |
| 916 | 3300002987 | JGI25159J45721_1000004 | JGI25159J45721_100000435 | 344 |
| 917 | 3300003187 | JGI25151J46595_10015560 | JGI25151J46595_100155602 | 344 |
| 918 | 3300003215 | JGI25153J46596_10000337 | JGI25153J46596_1000033712 | 344 |
| 919 | 3300003215 | JGI25153J46596_10016380 | JGI25153J46596_100163801 | 344 |
| 920 | 3300003316 | rootH1_10027007 | rootH1_100270074 | 344 |
| 921 | 3300003354 | JGI25160J50197_1000021 | JGI25160J50197_1000021174 | 344 |
| 922 | 3300003354 | JGI25160J50197_1006679 | JGI25160J50197_10066794 | 344 |
| 923 | 3300003374 | JGI25161J50226_1000458 | JGI25161J50226_100045814 | 344 |
| 924 | 3300003775 | Ga0055524_1000572 | Ga0055524_100057227 | 344 |
| 925 | 3300003781 | Ga0055536_1003722 | Ga0055536_10037223 | 344 |
| 926 | 3300003781 | Ga0055536_1004179 | Ga0055536_10041793 | 344 |
| 927 | 3300003792 | Ga0055540_1004137 | Ga0055540_10041372 | 344 |
| 928 | 3300003794 | Ga0055531_10002645 | Ga0055531_1000264512 | 344 |
| 929 | 3300004625 | Ga0055543_1000102 | Ga0055543_100010235 | 344 |
| 930 | 3300005262 | Ga0065165_1000033 | Ga0065165_1000033174 | 344 |
| 931 | 3300005262 | Ga0065165_1006399 | Ga0065165_10063997 | 344 |
| 932 | 3300005288 | Ga0065714_10077644 | Ga0065714_100776442 | 344 |
| 933 | 3300005458 | Ga0070681_10173837 | Ga0070681_101738372 | 344 |
| 934 | 3300005530 | Ga0070679_100025511 | Ga0070679_1000255113 | 344 |
| 935 | 3300005563 | Ga0068855_100016945 | Ga0068855_1000169455 | 344 |
| 936 | 3300005577 | Ga0068857_100052928 | Ga0068857_1000529283 | 344 |
| 937 | 3300006051 | Ga0075364_10011050 | Ga0075364_100110504 | 344 |
| 938 | 3300006946 | Ga0079104_1000015 | Ga0079104_100001542 | 344 |
| 939 | 3300006946 | Ga0079104_1008483 | Ga0079104_10084832 | 344 |
| 940 | 3300013102 | Ga0157371_10008491 | Ga0157371_100084913 | 344 |
| 941 | 3300013105 | Ga0157369_10099100 | Ga0157369_100991003 | 344 |
| 942 | 3300013249 | Ga0171463_1007 | Ga0171463_100772 | 344 |
| 943 | 3300013306 | Ga0163162_10006648 | Ga0163162_100066483 | 344 |
| 944 | 3300013307 | Ga0157372_10002540 | Ga0157372_100025409 | 344 |
| 945 | 3300015690 | Ga0183363_1098 | Ga0183363_10988 | 344 |
| 946 | 3300021320 | Ga0214544_1000110 | Ga0214544_100011053 | 344 |
| 947 | 3300021321 | Ga0214542_1000268 | Ga0214542_100026827 | 344 |
| 948 | 3300021321 | Ga0214542_1017541 | Ga0214542_10175416 | 344 |
| 949 | 3300021327 | Ga0214543_1000022 | Ga0214543_1000022122 | 344 |
| 950 | 3300021327 | Ga0214543_1000219 | Ga0214543_100021928 | 344 |
| 951 | 3300022739 | Ga0228711_1000911 | Ga0228711_100091110 | 344 |
| 952 | 3300022740 | Ga0228710_1001018 | Ga0228710_100101810 | 344 |
| 953 | 3300025230 | Ga0209563_102163 | Ga0209563_1021633 | 344 |
| 954 | 3300025246 | Ga0209646_1000004 | Ga0209646_100000440 | 344 |
| 955 | 3300025250 | Ga0209026_1000495 | Ga0209026_100049510 | 344 |
| 956 | 3300025258 | Ga0209129_1008779 | Ga0209129_10087794 | 344 |
| 957 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017209 | 344 |
| 958 | 3300025292 | Ga0209676_1002445 | Ga0209676_10024458 | 344 |
| 959 | 3300025292 | Ga0209676_1007475 | Ga0209676_10074754 | 344 |
| 960 | 3300025294 | Ga0209025_1000161 | Ga0209025_100016135 | 344 |
| 961 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013657 | 344 |
| 962 | 3300025295 | Ga0209564_1004207 | Ga0209564_10042077 | 344 |
| 963 | 3300025297 | Ga0209758_1000058 | Ga0209758_1000058107 | 344 |
| 964 | 3300025297 | Ga0209758_1001710 | Ga0209758_100171016 | 344 |
| 965 | 3300025297 | Ga0209758_1005872 | Ga0209758_100587210 | 344 |
| 966 | 3300025298 | Ga0209050_1003968 | Ga0209050_10039685 | 344 |
| 967 | 3300025299 | Ga0209256_1000153 | Ga0209256_1000153106 | 344 |
| 968 | 3300025299 | Ga0209256_1001905 | Ga0209256_10019054 | 344 |
| 969 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006208 | 344 |
| 970 | 3300025302 | Ga0207426_1000645 | Ga0207426_10006454 | 344 |
| 971 | 3300025303 | Ga0209051_1001806 | Ga0209051_10018068 | 344 |
| 972 | 3300025304 | Ga0209257_1002539 | Ga0209257_100253914 | 344 |
| 973 | 3300025304 | Ga0209257_1015317 | Ga0209257_10153172 | 344 |
| 974 | 3300025912 | Ga0207707_10000688 | Ga0207707_1000068816 | 344 |
| 975 | 3300025921 | Ga0207652_10017278 | Ga0207652_100172782 | 344 |
| 976 | 3300025949 | Ga0207667_10059502 | Ga0207667_100595022 | 344 |
| 977 | 3300026116 | Ga0207674_10057508 | Ga0207674_100575083 | 344 |
| 978 | 3300027111 | Ga0209281_1000034 | Ga0209281_1000034317 | 344 |
| 979 | 3300027111 | Ga0209281_1000314 | Ga0209281_100031431 | 344 |
| 980 | 3300027666 | Ga0209282_1000068 | Ga0209282_100006831 | 344 |
| 981 | 3300031967 | Ga0315914_1000937 | Ga0315914_100093710 | 344 |
| 982 | 3300033430 | Ga0315913_1000094 | Ga0315913_100009429 | 344 |
| 983 | 3300033464 | Ga0315915_1000007 | Ga0315915_1000007272 | 344 |
| 984 | 3300041404 | Ga0439436_0006315 | Ga0439436_0006315_117_1157 | 344 |
| 985 | 3300041997 | Ga0439431_0000193 | Ga0439431_0000193_6101_7135 | 344 |
| 986 | 3300046492 | Ga0495585_0000158 | Ga0495585_0000158_16594_17631 | 344 |
| 987 | 3300046507 | Ga0495606_0000241 | Ga0495606_0000241_24759_25796 | 344 |
| 988 | 3300046507 | Ga0495606_0059419 | Ga0495606_0059419_314_1357 | 344 |
| 989 | 3300046512 | Ga0495610_0001190 | Ga0495610_0001190_5355_6392 | 344 |
| 990 | 3300046513 | Ga0495616_0006637 | Ga0495616_0006637_5893_6930 | 344 |
| 991 | 3300046558 | Ga0495633_0004196 | Ga0495633_0004196_1798_2835 | 344 |
| 992 | 3300046648 | Ga0495611_0000756 | Ga0495611_0000756_6076_7110 | 344 |
| 993 | 3300046660 | Ga0495625_0000003 | Ga0495625_0000003_178760_179797 | 344 |
| 994 | 3300046694 | Ga0495649_0000002 | Ga0495649_0000002_827196_828233 | 344 |
| 995 | 3300046810 | Ga0495660_0016507 | Ga0495660_0016507_2660_3697 | 344 |
| 996 | 3300048914 | Ga0496111_0124082 | Ga0496111_0124082_606_1664 | 344 |
| 997 | 3300048924 | Ga0496121_0003530 | Ga0496121_0003530_7554_8615 | 344 |
| 998 | 3300048924 | Ga0496121_0019001 | Ga0496121_0019001_1642_2814 | 344 |
| 999 | 3300048925 | Ga0496122_0000462 | Ga0496122_0000462_5134_6207 | 344 |
| 1000 | 3300048926 | Ga0496123_0000048 | Ga0496123_0000048_78340_79413 | 344 |
| 1001 | 3300048927 | Ga0496124_0033203 | Ga0496124_0033203_1838_2911 | 344 |
| 1002 | 3300048929 | Ga0496126_0136493 | Ga0496126_0136493_820_1914 | 344 |
| 1003 | 3300049569 | Ga0501032_0127677 | Ga0501032_0127677_90_1127 | 344 |
| 1004 | 3300049570 | Ga0501033_0001531 | Ga0501033_0001531_5535_6572 | 344 |
| 1005 | 3300049822 | Ga0501035_0000597 | Ga0501035_0000597_8425_9462 | 344 |
| 1006 | 3300050491 | nmdc:mga00v17_213_c1 | nmdc:mga00v17_213_c1_31230_32291 | 344 |
| 1007 | 3300053125 | Ga0500618_001049 | Ga0500618_001049_6868_7917 | 344 |
| 1008 | 3300053153 | Ga0500616_0000798 | Ga0500616_0000798_18883_19977 | 344 |
| 1009 | iso_pu_bacteria | 2585427634 | 2586001244 | 344 |
| 1010 | iso_pu_bacteria | 639633055 | 639649436 | 344 |
| 1011 | iso_pu_bacteria | 643692032 | 643826576 | 344 |
| 1012 | iso_pu_bacteria | 8024479707 | 8024482599 | 344 |
| 1013 | iso_pu_bacteria | 8049293176 | 8049295547 | 344 |
| 1014 | 3300001989 | JGI24739J22299_10000277 | JGI24739J22299_1000027712 | 345 |
| 1015 | 3300002739 | JGI25158J39367_1000065 | JGI25158J39367_10000656 | 345 |
| 1016 | 3300002773 | JGI25152J39213_1002465 | JGI25152J39213_10024655 | 345 |
| 1017 | 3300002773 | JGI25152J39213_1009322 | JGI25152J39213_10093222 | 345 |
| 1018 | 3300002987 | JGI25159J45721_1000928 | JGI25159J45721_100092811 | 345 |
| 1019 | 3300003187 | JGI25151J46595_10000976 | JGI25151J46595_100009766 | 345 |
| 1020 | 3300003187 | JGI25151J46595_10003097 | JGI25151J46595_1000309711 | 345 |
| 1021 | 3300003215 | JGI25153J46596_10001913 | JGI25153J46596_100019138 | 345 |
| 1022 | 3300003215 | JGI25153J46596_10006900 | JGI25153J46596_100069001 | 345 |
| 1023 | 3300003215 | JGI25153J46596_10006915 | JGI25153J46596_100069153 | 345 |
| 1024 | 3300003215 | JGI25153J46596_10017234 | JGI25153J46596_100172341 | 345 |
| 1025 | 3300003215 | JGI25153J46596_10018304 | JGI25153J46596_100183042 | 345 |
| 1026 | 3300003320 | rootH2_10188461 | rootH2_101884612 | 345 |
| 1027 | 3300003354 | JGI25160J50197_1005161 | JGI25160J50197_10051613 | 345 |
| 1028 | 3300003354 | JGI25160J50197_1017667 | JGI25160J50197_10176672 | 345 |
| 1029 | 3300003374 | JGI25161J50226_1000370 | JGI25161J50226_100037021 | 345 |
| 1030 | 3300003771 | Ga0055526_1002521 | Ga0055526_10025214 | 345 |
| 1031 | 3300003771 | Ga0055526_1002639 | Ga0055526_10026396 | 345 |
| 1032 | 3300003771 | Ga0055526_1005973 | Ga0055526_10059731 | 345 |
| 1033 | 3300003771 | Ga0055526_1007839 | Ga0055526_10078397 | 345 |
| 1034 | 3300003771 | Ga0055526_1017995 | Ga0055526_10179952 | 345 |
| 1035 | 3300003775 | Ga0055524_1003096 | Ga0055524_10030963 | 345 |
| 1036 | 3300003775 | Ga0055524_1004469 | Ga0055524_10044695 | 345 |
| 1037 | 3300003775 | Ga0055524_1006818 | Ga0055524_10068183 | 345 |
| 1038 | 3300003775 | Ga0055524_1008955 | Ga0055524_10089552 | 345 |
| 1039 | 3300003775 | Ga0055524_1011136 | Ga0055524_10111364 | 345 |
| 1040 | 3300003790 | Ga0055528_1000158 | Ga0055528_100015819 | 345 |
| 1041 | 3300003790 | Ga0055528_1000180 | Ga0055528_100018036 | 345 |
| 1042 | 3300003790 | Ga0055528_1001038 | Ga0055528_10010388 | 345 |
| 1043 | 3300003790 | Ga0055528_1001879 | Ga0055528_100187913 | 345 |
| 1044 | 3300003790 | Ga0055528_1002874 | Ga0055528_10028743 | 345 |
| 1045 | 3300003790 | Ga0055528_1008297 | Ga0055528_10082972 | 345 |
| 1046 | 3300003790 | Ga0055528_1011400 | Ga0055528_10114001 | 345 |
| 1047 | 3300003792 | Ga0055540_1001786 | Ga0055540_100178610 | 345 |
| 1048 | 3300003792 | Ga0055540_1008283 | Ga0055540_10082833 | 345 |
| 1049 | 3300003794 | Ga0055531_10029590 | Ga0055531_100295902 | 345 |
| 1050 | 3300003856 | Ga0058692_1000498 | Ga0058692_10004982 | 345 |
| 1051 | 3300003856 | Ga0058692_1001790 | Ga0058692_10017906 | 345 |
| 1052 | 3300004625 | Ga0055543_1000060 | Ga0055543_100006035 | 345 |
| 1053 | 3300004625 | Ga0055543_1002223 | Ga0055543_10022234 | 345 |
| 1054 | 3300005262 | Ga0065165_1000019 | Ga0065165_1000019185 | 345 |
| 1055 | 3300005262 | Ga0065165_1019094 | Ga0065165_10190942 | 345 |
| 1056 | 3300005262 | Ga0065165_1037365 | Ga0065165_10373652 | 345 |
| 1057 | 3300005336 | Ga0070680_100013171 | Ga0070680_1000131715 | 345 |
| 1058 | 3300005458 | Ga0070681_10096322 | Ga0070681_100963222 | 345 |
| 1059 | 3300005548 | Ga0070665_100077525 | Ga0070665_1000775252 | 345 |
| 1060 | 3300006038 | Ga0075365_10002434 | Ga0075365_100024347 | 345 |
| 1061 | 3300006038 | Ga0075365_10109818 | Ga0075365_101098181 | 345 |
| 1062 | 3300006048 | Ga0075363_100061774 | Ga0075363_1000617743 | 345 |
| 1063 | 3300006177 | Ga0075362_10001162 | Ga0075362_100011626 | 345 |
| 1064 | 3300006178 | Ga0075367_10007596 | Ga0075367_100075964 | 345 |
| 1065 | 3300006178 | Ga0075367_10023563 | Ga0075367_100235632 | 345 |
| 1066 | 3300006195 | Ga0075366_10001492 | Ga0075366_100014924 | 345 |
| 1067 | 3300006353 | Ga0075370_10000198 | Ga0075370_100001984 | 345 |
| 1068 | 3300006948 | Ga0099826_10000102 | Ga0099826_1000010218 | 345 |
| 1069 | 3300006948 | Ga0099826_10028569 | Ga0099826_100285695 | 345 |
| 1070 | 3300009011 | Ga0105251_10039881 | Ga0105251_100398812 | 345 |
| 1071 | 3300009148 | Ga0105243_10013713 | Ga0105243_100137134 | 345 |
| 1072 | 3300013102 | Ga0157371_10000017 | Ga0157371_10000017257 | 345 |
| 1073 | 3300013102 | Ga0157371_10275051 | Ga0157371_102750511 | 345 |
| 1074 | 3300013104 | Ga0157370_10001031 | Ga0157370_100010312 | 345 |
| 1075 | 3300013105 | Ga0157369_10478317 | Ga0157369_104783171 | 345 |
| 1076 | 3300015265 | Ga0182005_1000248 | Ga0182005_100024818 | 345 |
| 1077 | 3300025208 | Ga0209436_100081 | Ga0209436_10008114 | 345 |
| 1078 | 3300025208 | Ga0209436_107254 | Ga0209436_1072541 | 345 |
| 1079 | 3300025245 | Ga0207425_1000884 | Ga0207425_10008842 | 345 |
| 1080 | 3300025258 | Ga0209129_1000324 | Ga0209129_100032425 | 345 |
| 1081 | 3300025258 | Ga0209129_1001769 | Ga0209129_10017696 | 345 |
| 1082 | 3300025258 | Ga0209129_1001856 | Ga0209129_10018568 | 345 |
| 1083 | 3300025258 | Ga0209129_1009902 | Ga0209129_10099023 | 345 |
| 1084 | 3300025258 | Ga0209129_1012601 | Ga0209129_10126012 | 345 |
| 1085 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010531 | 345 |
| 1086 | 3300025273 | Ga0209673_1000025 | Ga0209673_1000025168 | 345 |
| 1087 | 3300025273 | Ga0209673_1000042 | Ga0209673_100004298 | 345 |
| 1088 | 3300025273 | Ga0209673_1000112 | Ga0209673_100011248 | 345 |
| 1089 | 3300025273 | Ga0209673_1001842 | Ga0209673_100184213 | 345 |
| 1090 | 3300025273 | Ga0209673_1003328 | Ga0209673_100332810 | 345 |
| 1091 | 3300025273 | Ga0209673_1013806 | Ga0209673_10138064 | 345 |
| 1092 | 3300025273 | Ga0209673_1031347 | Ga0209673_10313472 | 345 |
| 1093 | 3300025284 | Ga0209130_1000023 | Ga0209130_100002323 | 345 |
| 1094 | 3300025291 | Ga0209675_1016053 | Ga0209675_10160532 | 345 |
| 1095 | 3300025294 | Ga0209025_1000091 | Ga0209025_1000091162 | 345 |
| 1096 | 3300025294 | Ga0209025_1000154 | Ga0209025_1000154108 | 345 |
| 1097 | 3300025294 | Ga0209025_1002028 | Ga0209025_100202825 | 345 |
| 1098 | 3300025294 | Ga0209025_1010302 | Ga0209025_10103024 | 345 |
| 1099 | 3300025295 | Ga0209564_1000265 | Ga0209564_1000265106 | 345 |
| 1100 | 3300025295 | Ga0209564_1000672 | Ga0209564_100067239 | 345 |
| 1101 | 3300025295 | Ga0209564_1000840 | Ga0209564_100084019 | 345 |
| 1102 | 3300025295 | Ga0209564_1001534 | Ga0209564_100153413 | 345 |
| 1103 | 3300025295 | Ga0209564_1003122 | Ga0209564_100312212 | 345 |
| 1104 | 3300025295 | Ga0209564_1004488 | Ga0209564_10044889 | 345 |
| 1105 | 3300025295 | Ga0209564_1011760 | Ga0209564_10117602 | 345 |
| 1106 | 3300025297 | Ga0209758_1001003 | Ga0209758_100100316 | 345 |
| 1107 | 3300025297 | Ga0209758_1002357 | Ga0209758_10023579 | 345 |
| 1108 | 3300025297 | Ga0209758_1015814 | Ga0209758_10158143 | 345 |
| 1109 | 3300025297 | Ga0209758_1017385 | Ga0209758_10173852 | 345 |
| 1110 | 3300025297 | Ga0209758_1059928 | Ga0209758_10599282 | 345 |
| 1111 | 3300025298 | Ga0209050_1000308 | Ga0209050_100030820 | 345 |
| 1112 | 3300025299 | Ga0209256_1000704 | Ga0209256_100070432 | 345 |
| 1113 | 3300025299 | Ga0209256_1000914 | Ga0209256_100091428 | 345 |
| 1114 | 3300025299 | Ga0209256_1002433 | Ga0209256_10024339 | 345 |
| 1115 | 3300025299 | Ga0209256_1002591 | Ga0209256_100259113 | 345 |
| 1116 | 3300025299 | Ga0209256_1003390 | Ga0209256_100339010 | 345 |
| 1117 | 3300025299 | Ga0209256_1011848 | Ga0209256_10118481 | 345 |
| 1118 | 3300025302 | Ga0207426_1000008 | Ga0207426_100000848 | 345 |
| 1119 | 3300025302 | Ga0207426_1000344 | Ga0207426_100034451 | 345 |
| 1120 | 3300025302 | Ga0207426_1000442 | Ga0207426_10004424 | 345 |
| 1121 | 3300025302 | Ga0207426_1000727 | Ga0207426_100072727 | 345 |
| 1122 | 3300025302 | Ga0207426_1000934 | Ga0207426_100093410 | 345 |
| 1123 | 3300025303 | Ga0209051_1000900 | Ga0209051_100090021 | 345 |
| 1124 | 3300025303 | Ga0209051_1001776 | Ga0209051_100177616 | 345 |
| 1125 | 3300025303 | Ga0209051_1024469 | Ga0209051_10244692 | 345 |
| 1126 | 3300025304 | Ga0209257_1001059 | Ga0209257_10010599 | 345 |
| 1127 | 3300025917 | Ga0207660_10086378 | Ga0207660_100863782 | 345 |
| 1128 | 3300025935 | Ga0207709_10038454 | Ga0207709_100384542 | 345 |
| 1129 | 3300026067 | Ga0207678_10097616 | Ga0207678_100976161 | 345 |
| 1130 | 3300027312 | Ga0209371_1000022 | Ga0209371_1000022285 | 345 |
| 1131 | 3300027312 | Ga0209371_1002629 | Ga0209371_10026298 | 345 |
| 1132 | 3300027666 | Ga0209282_1000233 | Ga0209282_10002334 | 345 |
| 1133 | 3300027666 | Ga0209282_1098979 | Ga0209282_10989792 | 345 |
| 1134 | 3300028379 | Ga0268266_10055968 | Ga0268266_100559684 | 345 |
| 1135 | 3300028794 | Ga0307515_10000017 | Ga0307515_10000017120 | 345 |
| 1136 | 3300028794 | Ga0307515_10000285 | Ga0307515_1000028565 | 345 |
| 1137 | 3300028794 | Ga0307515_10017812 | Ga0307515_100178128 | 345 |
| 1138 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019235 | 345 |
| 1139 | 3300030500 | Ga0268256_1004182 | Ga0268256_10041825 | 345 |
| 1140 | 3300031548 | Ga0307408_100086047 | Ga0307408_1000860473 | 345 |
| 1141 | 3300031730 | Ga0307516_10238587 | Ga0307516_102385872 | 345 |
| 1142 | 3300031911 | Ga0307412_10113041 | Ga0307412_101130412 | 345 |
| 1143 | 3300031995 | Ga0307409_100080716 | Ga0307409_1000807162 | 345 |
| 1144 | 3300031995 | Ga0307409_100206688 | Ga0307409_1002066881 | 345 |
| 1145 | 3300032002 | Ga0307416_100349632 | Ga0307416_1003496322 | 345 |
| 1146 | 3300041406 | Ga0439439_0023435 | Ga0439439_0023435_340_1398 | 345 |
| 1147 | 3300041413 | Ga0439465_0002280 | Ga0439465_0002280_1082_2140 | 345 |
| 1148 | 3300041413 | Ga0439465_0003936 | Ga0439465_0003936_94_1182 | 345 |
| 1149 | 3300041498 | Ga0451841_0096366 | Ga0451841_0096366_174_1337 | 345 |
| 1150 | 3300041501 | Ga0451845_0847798 | Ga0451845_0847798_398_1561 | 345 |
| 1151 | 3300041503 | Ga0451847_0116577 | Ga0451847_0116577_2050_3213 | 345 |
| 1152 | 3300041507 | Ga0451851_1182826 | Ga0451851_1182826_467_1630 | 345 |
| 1153 | 3300041511 | Ga0451855_1291386 | Ga0451855_1291386_57_1127 | 345 |
| 1154 | 3300042185 | Ga0450909_005545 | Ga0450909_005545_57_1115 | 345 |
| 1155 | 3300046460 | Ga0495638_0006177 | Ga0495638_0006177_1686_2747 | 345 |
| 1156 | 3300046471 | Ga0495650_0042525 | Ga0495650_0042525_620_1783 | 345 |
| 1157 | 3300046476 | Ga0495662_0032939 | Ga0495662_0032939_663_1700 | 345 |
| 1158 | 3300046501 | Ga0495607_0060841 | Ga0495607_0060841_898_1968 | 345 |
| 1159 | 3300046506 | Ga0495583_0008220 | Ga0495583_0008220_2145_3206 | 345 |
| 1160 | 3300046507 | Ga0495606_0044000 | Ga0495606_0044000_1624_2787 | 345 |
| 1161 | 3300046512 | Ga0495610_0020299 | Ga0495610_0020299_88_1158 | 345 |
| 1162 | 3300046514 | Ga0495618_0054244 | Ga0495618_0054244_1275_2312 | 345 |
| 1163 | 3300046522 | Ga0495643_0021519 | Ga0495643_0021519_1013_2176 | 345 |
| 1164 | 3300046522 | Ga0495643_0055688 | Ga0495643_0055688_226_1296 | 345 |
| 1165 | 3300046524 | Ga0495648_0065343 | Ga0495648_0065343_439_1476 | 345 |
| 1166 | 3300046542 | Ga0495597_0006901 | Ga0495597_0006901_4609_5772 | 345 |
| 1167 | 3300046557 | Ga0495622_0002319 | Ga0495622_0002319_7107_8144 | 345 |
| 1168 | 3300046660 | Ga0495625_0054729 | Ga0495625_0054729_80_1138 | 345 |
| 1169 | 3300046674 | Ga0495588_0063031 | Ga0495588_0063031_442_1500 | 345 |
| 1170 | 3300046674 | Ga0495588_0119993 | Ga0495588_0119993_169_1206 | 345 |
| 1171 | 3300046809 | Ga0495600_0082151 | Ga0495600_0082151_841_1878 | 345 |
| 1172 | 3300046810 | Ga0495660_0135315 | Ga0495660_0135315_24_1187 | 345 |
| 1173 | 3300047317 | Ga0495604_0006302 | Ga0495604_0006302_8112_9149 | 345 |
| 1174 | 3300048907 | Ga0496104_0124386 | Ga0496104_0124386_953_2203 | 345 |
| 1175 | 3300048909 | Ga0496106_0002934 | Ga0496106_0002934_10278_11348 | 345 |
| 1176 | 3300048916 | Ga0496113_0284132 | Ga0496113_0284132_122_1183 | 345 |
| 1177 | 3300048919 | Ga0496116_0000105 | Ga0496116_0000105_149948_151009 | 345 |
| 1178 | 3300048919 | Ga0496116_0023268 | Ga0496116_0023268_2846_3907 | 345 |
| 1179 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_261342_262403 | 345 |
| 1180 | 3300048920 | Ga0496117_0026624 | Ga0496117_0026624_1576_2637 | 345 |
| 1181 | 3300048920 | Ga0496117_0070697 | Ga0496117_0070697_96_1166 | 345 |
| 1182 | 3300048921 | Ga0496118_0000566 | Ga0496118_0000566_18725_19786 | 345 |
| 1183 | 3300048921 | Ga0496118_0011165 | Ga0496118_0011165_6134_7318 | 345 |
| 1184 | 3300048922 | Ga0496119_0016503 | Ga0496119_0016503_835_1896 | 345 |
| 1185 | 3300048923 | Ga0496120_0000309 | Ga0496120_0000309_40894_41955 | 345 |
| 1186 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_598811_599872 | 345 |
| 1187 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_827892_828932 | 345 |
| 1188 | 3300048924 | Ga0496121_0023979 | Ga0496121_0023979_4256_5326 | 345 |
| 1189 | 3300048924 | Ga0496121_0026584 | Ga0496121_0026584_1880_2950 | 345 |
| 1190 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_383273_384334 | 345 |
| 1191 | 3300048925 | Ga0496122_0028634 | Ga0496122_0028634_2107_3168 | 345 |
| 1192 | 3300048925 | Ga0496122_0050450 | Ga0496122_0050450_669_1730 | 345 |
| 1193 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_383273_384334 | 345 |
| 1194 | 3300048926 | Ga0496123_0023196 | Ga0496123_0023196_321_1391 | 345 |
| 1195 | 3300048926 | Ga0496123_0120031 | Ga0496123_0120031_152_1213 | 345 |
| 1196 | 3300048927 | Ga0496124_0000067 | Ga0496124_0000067_162904_163965 | 345 |
| 1197 | 3300048927 | Ga0496124_0041410 | Ga0496124_0041410_1312_2373 | 345 |
| 1198 | 3300048927 | Ga0496124_0052030 | Ga0496124_0052030_1640_2701 | 345 |
| 1199 | 3300048927 | Ga0496124_0068340 | Ga0496124_0068340_1783_2844 | 345 |
| 1200 | 3300048928 | Ga0496125_0001144 | Ga0496125_0001144_33031_34092 | 345 |
| 1201 | 3300048928 | Ga0496125_0028117 | Ga0496125_0028117_3150_4400 | 345 |
| 1202 | 3300048929 | Ga0496126_0000188 | Ga0496126_0000188_96360_97421 | 345 |
| 1203 | 3300048929 | Ga0496126_0151881 | Ga0496126_0151881_832_1893 | 345 |
| 1204 | 3300048929 | Ga0496126_0199317 | Ga0496126_0199317_493_1554 | 345 |
| 1205 | 3300048929 | Ga0496126_0292526 | Ga0496126_0292526_19_1080 | 345 |
| 1206 | 3300049575 | Ga0501039_0162628 | Ga0501039_0162628_212_1309 | 345 |
| 1207 | 3300049586 | Ga0501070_0036858 | Ga0501070_0036858_2574_3689 | 345 |
| 1208 | 3300049590 | Ga0501074_0236053 | Ga0501074_0236053_13_1128 | 345 |
| 1209 | 3300050489 | nmdc:mga03683_476_c1 | nmdc:mga03683_476_c1_10270_11340 | 345 |
| 1210 | 3300050491 | nmdc:mga00v17_13475_c1 | nmdc:mga00v17_13475_c1_1372_2433 | 345 |
| 1211 | 3300050491 | nmdc:mga00v17_7_c1 | nmdc:mga00v17_7_c1_9255_10505 | 345 |
| 1212 | 3300050492 | nmdc:mga0yw44_144512_c1 | nmdc:mga0yw44_144512_c1_285_1355 | 345 |
| 1213 | 3300050492 | nmdc:mga0yw44_83977_c1 | nmdc:mga0yw44_83977_c1_137_1198 | 345 |
| 1214 | 3300050493 | nmdc:mga0k408_28719_c1 | nmdc:mga0k408_28719_c1_452_1522 | 345 |
| 1215 | 3300050496 | nmdc:mga07m45_4102_c1 | nmdc:mga07m45_4102_c1_2093_3163 | 345 |
| 1216 | 3300050516 | nmdc:mga0sz30_115_c1 | nmdc:mga0sz30_115_c1_1258_2508 | 345 |
| 1217 | 3300050516 | nmdc:mga0sz30_14176_c1 | nmdc:mga0sz30_14176_c1_234_1304 | 345 |
| 1218 | 3300050516 | nmdc:mga0sz30_49354_c1 | nmdc:mga0sz30_49354_c1_133_1194 | 345 |
| 1219 | 3300053085 | Ga0495619_0122504 | Ga0495619_0122504_338_1375 | 345 |
| 1220 | 3300053107 | Ga0500560_019545 | Ga0500560_019545_668_1729 | 345 |
| 1221 | 3300053134 | Ga0500658_0000323 | Ga0500658_0000323_12745_13815 | 345 |
| 1222 | 3300053139 | Ga0500568_0001573 | Ga0500568_0001573_2971_4041 | 345 |
| 1223 | 3300053140 | Ga0500573_0003303 | Ga0500573_0003303_6319_7380 | 345 |
| 1224 | 3300053148 | Ga0500590_000218 | Ga0500590_000218_9260_10297 | 345 |
| 1225 | 3300053153 | Ga0500616_0017076 | Ga0500616_0017076_622_1785 | 345 |
| 1226 | 3300053156 | Ga0500622_0000597 | Ga0500622_0000597_13946_15016 | 345 |
| 1227 | 3300053157 | Ga0500624_000239 | Ga0500624_000239_2303_3364 | 345 |
| 1228 | 3300053160 | Ga0500633_0005572 | Ga0500633_0005572_600_1670 | 345 |
| 1229 | 3300053161 | Ga0500634_0012891 | Ga0500634_0012891_3054_4115 | 345 |
| 1230 | 3300053177 | Ga0500636_0000003 | Ga0500636_0000003_40076_41137 | 345 |
| 1231 | 3300053177 | Ga0500636_0003175 | Ga0500636_0003175_1587_2648 | 345 |
| 1232 | 3300060353 | Ga0501082_0201211 | Ga0501082_0201211_59_1108 | 345 |
| 1233 | iso_pu_bacteria | 2842217011 | 2842218211 | 345 |
| 1234 | iso_pu_bacteria | 2842304105 | 2842305310 | 345 |
| 1235 | iso_pu_bacteria | 2933570622 | 2933571117 | 345 |
| 1236 | iso_pu_bacteria | 2996893221 | 2996897903 | 345 |
| 1237 | iso_pu_bacteria | 8005563573 | 8005568263 | 345 |
| 1238 | iso_pu_bacteria | 8018163183 | 8018164304 | 345 |
| 1239 | iso_pu_bacteria | 8023680758 | 8023682902 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.979 | 1 | 342 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9706 | 1 | 342 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8944 | 1 | 337 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8867 | 1 | 337 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8747 | 1 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9765 | 1 | 342 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9708 | 1 | 342 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9398 | 1 | 343 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9265 | 1 | 343 | 3.20.20.30 |
| af_I6X7W8_4_352_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8474 | 1 | 339 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3SBL9-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9913 | 1 | 304 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4Q3RN81-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9853 | 92 | 332 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4Q3SBL9-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9848 | 1 | 304 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A6J4T203-F1-model_v4 | Oxidoreductase | 0.9807 | 136 | 343 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4Q3B298-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9802 | 159 | 342 |
GO:0004497
GO:0005829 GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar