F491984
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1230 | 342 | 2460 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300025939|Ga0207665_10155696|Ga0207665_101556962 |
| Length | 385 |
| Sequence | MPSRRTILRRRFKAVSRAVRGAREIARALVSTEHPLLAHLIPIRRCNLACKYCNEFDDFSKPVPTETMFDRVDKLAELGTSVITISGGEPLLHPELDEIIRRIRKQRMIAGLITNGYLLTSERIQRLNKAGLEWLQISIDNVTPDDVSKKSLKVLDKKLQLLAEHADFHVNINSVVGGGVSNPQDALTIGKRALALGFSSTVGIIHDGEGQLQPLGEEERRVYHEMKSMEKRSFTRINSFQDNIAQGRPNQWRCRAGARYLYICEDGLVHYCSQQRGYPGIPLGKYTRADVRRDLFLIYKEALNNVARHGRGRSVDVSLSVDDQSLRLVVADDGVGFDPNRPDEGHGLSSMRRRADSRGGTCQIFSTVGRGTTVAVALPLAWARQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 122 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 123 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 124 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.08 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 94.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207665_10155696 | 3300025939 | Bacteria | 1640 |
| 2 | JGI24752J21851_1002068 | 3300001976 | Bacteria | 2678 |
| 3 | JGI24751J29686_10003788 | 3300002459 | Bacteria | 3051 |
| 4 | JGI25406J46586_10034602 | 3300003203 | Bacteria | 1852 |
| 5 | Ga0065715_10024703 | 3300005293 | Bacteria | 2351 |
| 6 | Ga0065715_10109151 | 3300005293 | Unclassified | 2677 |
| 7 | Ga0070676_10004945 | 3300005328 | Bacteria | 7058 |
| 8 | Ga0070683_100014106 | 3300005329 | Bacteria | 6978 |
| 9 | Ga0070683_100018324 | 3300005329 | Bacteria | 6199 |
| 10 | Ga0070683_100093089 | 3300005329 | Unclassified | 2831 |
| 11 | Ga0070690_100080585 | 3300005330 | Unclassified | 2129 |
| 12 | Ga0070690_100084349 | 3300005330 | Bacteria | 2083 |
| 13 | Ga0070690_100125602 | 3300005330 | Bacteria | 1727 |
| 14 | Ga0070670_100027685 | 3300005331 | Bacteria | 4876 |
| 15 | Ga0070677_10002404 | 3300005333 | Bacteria | 5970 |
| 16 | Ga0070677_10112352 | 3300005333 | Bacteria | 1218 |
| 17 | Ga0068869_100002204 | 3300005334 | Bacteria | 11719 |
| 18 | Ga0068869_100060896 | 3300005334 | Bacteria | 2767 |
| 19 | Ga0070666_10039335 | 3300005335 | Unclassified | 3151 |
| 20 | Ga0070666_10060631 | 3300005335 | Unclassified | 2561 |
| 21 | Ga0070680_100009419 | 3300005336 | Bacteria | 7503 |
| 22 | Ga0070680_100311319 | 3300005336 | Unclassified | 1336 |
| 23 | Ga0070682_100085761 | 3300005337 | Bacteria | 2049 |
| 24 | Ga0068868_100002500 | 3300005338 | Bacteria | 12765 |
| 25 | Ga0068868_100020989 | 3300005338 | Bacteria | 4918 |
| 26 | Ga0068868_100031685 | 3300005338 | Bacteria | 4064 |
| 27 | Ga0068868_100037736 | 3300005338 | Bacteria | 3747 |
| 28 | Ga0068868_100067399 | 3300005338 | Bacteria | 2849 |
| 29 | Ga0068868_100134220 | 3300005338 | Unclassified | 2027 |
| 30 | Ga0068868_100244423 | 3300005338 | Unclassified | 1509 |
| 31 | Ga0070660_100001412 | 3300005339 | Bacteria | 16343 |
| 32 | Ga0070660_100007536 | 3300005339 | Bacteria | 7586 |
| 33 | Ga0070660_100027967 | 3300005339 | Bacteria | 4214 |
| 34 | Ga0070660_100072828 | 3300005339 | Bacteria | 2685 |
| 35 | Ga0070689_100058793 | 3300005340 | Bacteria | 2986 |
| 36 | Ga0070689_100332832 | 3300005340 | Bacteria | 1270 |
| 37 | Ga0070687_100082758 | 3300005343 | Bacteria | 1756 |
| 38 | Ga0070661_100052129 | 3300005344 | Bacteria | 2994 |
| 39 | Ga0070661_100078580 | 3300005344 | Unclassified | 2434 |
| 40 | Ga0070661_100086054 | 3300005344 | Bacteria | 2323 |
| 41 | Ga0070661_100111483 | 3300005344 | Unclassified | 2043 |
| 42 | Ga0070661_100125765 | 3300005344 | Bacteria | 1923 |
| 43 | Ga0070661_100198415 | 3300005344 | Bacteria | 1532 |
| 44 | Ga0070692_10016814 | 3300005345 | Bacteria | 3486 |
| 45 | Ga0070668_100020879 | 3300005347 | Bacteria | 4946 |
| 46 | Ga0070668_100120630 | 3300005347 | Bacteria | 2095 |
| 47 | Ga0070668_100194552 | 3300005347 | Unclassified | 1662 |
| 48 | Ga0070669_100011802 | 3300005353 | Bacteria | 6198 |
| 49 | Ga0070669_100024500 | 3300005353 | Bacteria | 4326 |
| 50 | Ga0070675_100001298 | 3300005354 | Bacteria | 18269 |
| 51 | Ga0070671_100019223 | 3300005355 | Bacteria | 5558 |
| 52 | Ga0070671_100375081 | 3300005355 | Unclassified | 1215 |
| 53 | Ga0070674_100010264 | 3300005356 | Bacteria | 5651 |
| 54 | Ga0070673_100007525 | 3300005364 | Bacteria | 7195 |
| 55 | Ga0070673_100102555 | 3300005364 | Bacteria | 2359 |
| 56 | Ga0070688_100004440 | 3300005365 | Bacteria | 7302 |
| 57 | Ga0070688_100020808 | 3300005365 | Bacteria | 3821 |
| 58 | Ga0070659_100008991 | 3300005366 | Bacteria | 7325 |
| 59 | Ga0070659_100033480 | 3300005366 | Bacteria | 3991 |
| 60 | Ga0070659_100077887 | 3300005366 | Bacteria | 2644 |
| 61 | Ga0070659_100142906 | 3300005366 | Bacteria | 1949 |
| 62 | Ga0070659_100165530 | 3300005366 | Bacteria | 1809 |
| 63 | Ga0070659_100226139 | 3300005366 | Bacteria | 1545 |
| 64 | Ga0070667_100008426 | 3300005367 | Bacteria | 8551 |
| 65 | Ga0070709_10007704 | 3300005434 | Bacteria | 5911 |
| 66 | Ga0070709_10323902 | 3300005434 | Bacteria | 1132 |
| 67 | Ga0070714_100027657 | 3300005435 | Bacteria | 4698 |
| 68 | Ga0070714_100164710 | 3300005435 | Unclassified | 2008 |
| 69 | Ga0070714_100179455 | 3300005435 | Bacteria | 1926 |
| 70 | Ga0070713_100001466 | 3300005436 | Bacteria | 15072 |
| 71 | Ga0070713_100009249 | 3300005436 | Bacteria | 7040 |
| 72 | Ga0070713_100014676 | 3300005436 | Bacteria | 5826 |
| 73 | Ga0070713_100021771 | 3300005436 | Bacteria | 4940 |
| 74 | Ga0070713_100183302 | 3300005436 | Bacteria | 1882 |
| 75 | Ga0070713_100346675 | 3300005436 | Bacteria | 1377 |
| 76 | Ga0070710_10000918 | 3300005437 | Bacteria | 14041 |
| 77 | Ga0070710_10012743 | 3300005437 | Unclassified | 4185 |
| 78 | Ga0070711_100006476 | 3300005439 | Bacteria | 7062 |
| 79 | Ga0070711_100011115 | 3300005439 | Bacteria | 5585 |
| 80 | Ga0070711_100015697 | 3300005439 | Bacteria | 4796 |
| 81 | Ga0070711_100090348 | 3300005439 | Bacteria | 2205 |
| 82 | Ga0070711_100161070 | 3300005439 | Bacteria | 1701 |
| 83 | Ga0070705_100194435 | 3300005440 | Bacteria | 1386 |
| 84 | Ga0070705_100195893 | 3300005440 | Bacteria | 1381 |
| 85 | Ga0070708_100000611 | 3300005445 | Bacteria | 26919 |
| 86 | Ga0070708_100002494 | 3300005445 | Bacteria | 14209 |
| 87 | Ga0070708_100004519 | 3300005445 | Bacteria | 10952 |
| 88 | Ga0070708_100012329 | 3300005445 | Bacteria | 6972 |
| 89 | Ga0070708_100037562 | 3300005445 | Bacteria | 4226 |
| 90 | Ga0070708_100045758 | 3300005445 | Bacteria | 3858 |
| 91 | Ga0070708_100049462 | 3300005445 | Bacteria | 3719 |
| 92 | Ga0070708_100053252 | 3300005445 | Unclassified | 3590 |
| 93 | Ga0070708_100142421 | 3300005445 | Bacteria | 2224 |
| 94 | Ga0070663_100023777 | 3300005455 | Bacteria | 4112 |
| 95 | Ga0070663_100024610 | 3300005455 | Bacteria | 4055 |
| 96 | Ga0070678_100021849 | 3300005456 | Bacteria | 4229 |
| 97 | Ga0070678_100294366 | 3300005456 | Bacteria | 1377 |
| 98 | Ga0070662_100019596 | 3300005457 | Bacteria | 4594 |
| 99 | Ga0070662_100028095 | 3300005457 | Unclassified | 3912 |
| 100 | Ga0070662_100056588 | 3300005457 | Bacteria | 2847 |
| 101 | Ga0070681_10000134 | 3300005458 | Bacteria | 56209 |
| 102 | Ga0070681_10006449 | 3300005458 | Bacteria | 11418 |
| 103 | Ga0070681_10009100 | 3300005458 | Bacteria | 9759 |
| 104 | Ga0070681_10017743 | 3300005458 | Bacteria | 7113 |
| 105 | Ga0070681_10043723 | 3300005458 | Bacteria | 4485 |
| 106 | Ga0070681_10158863 | 3300005458 | Bacteria | 2184 |
| 107 | Ga0070681_10192779 | 3300005458 | Bacteria | 1957 |
| 108 | Ga0070681_10288148 | 3300005458 | Bacteria | 1552 |
| 109 | Ga0068867_100028639 | 3300005459 | Bacteria | 4011 |
| 110 | Ga0068867_100048259 | 3300005459 | Bacteria | 3132 |
| 111 | Ga0068867_100074897 | 3300005459 | Bacteria | 2538 |
| 112 | Ga0068867_100517812 | 3300005459 | Bacteria | 1028 |
| 113 | Ga0070706_100001823 | 3300005467 | Bacteria | 22086 |
| 114 | Ga0070706_100002374 | 3300005467 | Bacteria | 19022 |
| 115 | Ga0070706_100003656 | 3300005467 | Bacteria | 15050 |
| 116 | Ga0070706_100007208 | 3300005467 | Bacteria | 10449 |
| 117 | Ga0070706_100114735 | 3300005467 | Bacteria | 2508 |
| 118 | Ga0070706_100120393 | 3300005467 | Unclassified | 2446 |
| 119 | Ga0070706_100307065 | 3300005467 | Bacteria | 1480 |
| 120 | Ga0070707_100000161 | 3300005468 | Bacteria | 63936 |
| 121 | Ga0070707_100000278 | 3300005468 | Bacteria | 50450 |
| 122 | Ga0070707_100005702 | 3300005468 | Bacteria | 11621 |
| 123 | Ga0070707_100013421 | 3300005468 | Bacteria | 7664 |
| 124 | Ga0070707_100068823 | 3300005468 | Bacteria | 3407 |
| 125 | Ga0070707_100132821 | 3300005468 | Bacteria | 2421 |
| 126 | Ga0070707_100198721 | 3300005468 | Bacteria | 1954 |
| 127 | Ga0070707_100228174 | 3300005468 | Bacteria | 1813 |
| 128 | Ga0070698_100000203 | 3300005471 | Bacteria | 57165 |
| 129 | Ga0070698_100004684 | 3300005471 | Bacteria | 15027 |
| 130 | Ga0070698_100028386 | 3300005471 | Bacteria | 5812 |
| 131 | Ga0070698_100118542 | 3300005471 | Bacteria | 2608 |
| 132 | Ga0070699_100000177 | 3300005518 | Bacteria | 61679 |
| 133 | Ga0070699_100001034 | 3300005518 | Bacteria | 25839 |
| 134 | Ga0070699_100025461 | 3300005518 | Bacteria | 5100 |
| 135 | Ga0070699_100066879 | 3300005518 | Bacteria | 3121 |
| 136 | Ga0070699_100209745 | 3300005518 | Bacteria | 1734 |
| 137 | Ga0070679_100009205 | 3300005530 | Bacteria | 9330 |
| 138 | Ga0070679_100034387 | 3300005530 | Bacteria | 5023 |
| 139 | Ga0070679_100054379 | 3300005530 | Unclassified | 3985 |
| 140 | Ga0070679_100147860 | 3300005530 | Bacteria | 2327 |
| 141 | Ga0070679_100249212 | 3300005530 | Bacteria | 1732 |
| 142 | Ga0070679_100306261 | 3300005530 | Bacteria | 1539 |
| 143 | Ga0070679_100554707 | 3300005530 | Unclassified | 1093 |
| 144 | Ga0070684_100000115 | 3300005535 | Bacteria | 51829 |
| 145 | Ga0070684_100003345 | 3300005535 | Bacteria | 12009 |
| 146 | Ga0070684_100007884 | 3300005535 | Bacteria | 8306 |
| 147 | Ga0070684_100015096 | 3300005535 | Bacteria | 6278 |
| 148 | Ga0070684_100030457 | 3300005535 | Bacteria | 4584 |
| 149 | Ga0070684_100037127 | 3300005535 | Bacteria | 4177 |
| 150 | Ga0070684_100178706 | 3300005535 | Bacteria | 1929 |
| 151 | Ga0070684_100271920 | 3300005535 | Bacteria | 1551 |
| 152 | Ga0070684_100361451 | 3300005535 | Bacteria | 1336 |
| 153 | Ga0070697_100000375 | 3300005536 | Bacteria | 34936 |
| 154 | Ga0070697_100001730 | 3300005536 | Bacteria | 16675 |
| 155 | Ga0070697_100004705 | 3300005536 | Bacteria | 10460 |
| 156 | Ga0070697_100010820 | 3300005536 | Bacteria | 7125 |
| 157 | Ga0070697_100025499 | 3300005536 | Unclassified | 4716 |
| 158 | Ga0070697_100141217 | 3300005536 | Bacteria | 2026 |
| 159 | Ga0070697_100180247 | 3300005536 | Unclassified | 1790 |
| 160 | Ga0070697_100237324 | 3300005536 | Bacteria | 1556 |
| 161 | Ga0068853_100015287 | 3300005539 | Bacteria | 6308 |
| 162 | Ga0068853_100039653 | 3300005539 | Bacteria | 4018 |
| 163 | Ga0068853_100058982 | 3300005539 | Unclassified | 3315 |
| 164 | Ga0068853_100065296 | 3300005539 | Bacteria | 3158 |
| 165 | Ga0068853_100080658 | 3300005539 | Bacteria | 2848 |
| 166 | Ga0068853_100092585 | 3300005539 | Bacteria | 2660 |
| 167 | Ga0068853_100206965 | 3300005539 | Bacteria | 1787 |
| 168 | Ga0068853_100232463 | 3300005539 | Bacteria | 1687 |
| 169 | Ga0068853_100274093 | 3300005539 | Bacteria | 1554 |
| 170 | Ga0070672_100023140 | 3300005543 | Unclassified | 4576 |
| 171 | Ga0070672_100131779 | 3300005543 | Bacteria | 2055 |
| 172 | Ga0070686_100052240 | 3300005544 | Unclassified | 2605 |
| 173 | Ga0070696_100000202 | 3300005546 | Bacteria | 35448 |
| 174 | Ga0070696_100018135 | 3300005546 | Bacteria | 4755 |
| 175 | Ga0070696_100242265 | 3300005546 | Bacteria | 1361 |
| 176 | Ga0070693_100043953 | 3300005547 | Bacteria | 2525 |
| 177 | Ga0070665_100003957 | 3300005548 | Bacteria | 15626 |
| 178 | Ga0070665_100115173 | 3300005548 | Bacteria | 2691 |
| 179 | Ga0070665_100425699 | 3300005548 | Bacteria | 1336 |
| 180 | Ga0070704_100027151 | 3300005549 | Bacteria | 3793 |
| 181 | Ga0068855_100001610 | 3300005563 | Bacteria | 28331 |
| 182 | Ga0068855_100001802 | 3300005563 | Bacteria | 26758 |
| 183 | Ga0068855_100001938 | 3300005563 | Bacteria | 25699 |
| 184 | Ga0068855_100005500 | 3300005563 | Bacteria | 15460 |
| 185 | Ga0068855_100006862 | 3300005563 | Bacteria | 13812 |
| 186 | Ga0068855_100009417 | 3300005563 | Bacteria | 11796 |
| 187 | Ga0068855_100012497 | 3300005563 | Bacteria | 10249 |
| 188 | Ga0068855_100013448 | 3300005563 | Bacteria | 9867 |
| 189 | Ga0068855_100017232 | 3300005563 | Bacteria | 8693 |
| 190 | Ga0068855_100023744 | 3300005563 | Bacteria | 7345 |
| 191 | Ga0068855_100025908 | 3300005563 | Bacteria | 7014 |
| 192 | Ga0068855_100058499 | 3300005563 | Bacteria | 4514 |
| 193 | Ga0068855_100069512 | 3300005563 | Bacteria | 4098 |
| 194 | Ga0068855_100231622 | 3300005563 | Bacteria | 2068 |
| 195 | Ga0068855_100531844 | 3300005563 | Bacteria | 1274 |
| 196 | Ga0070664_100000499 | 3300005564 | Bacteria | 29728 |
| 197 | Ga0070664_100006593 | 3300005564 | Bacteria | 9360 |
| 198 | Ga0070664_100051359 | 3300005564 | Unclassified | 3491 |
| 199 | Ga0070664_100071370 | 3300005564 | Bacteria | 2976 |
| 200 | Ga0068857_100000884 | 3300005577 | Bacteria | 22647 |
| 201 | Ga0068857_100002702 | 3300005577 | Bacteria | 14552 |
| 202 | Ga0068857_100004174 | 3300005577 | Bacteria | 12166 |
| 203 | Ga0068857_100007990 | 3300005577 | Bacteria | 9131 |
| 204 | Ga0068857_100018004 | 3300005577 | Bacteria | 6196 |
| 205 | Ga0068857_100027347 | 3300005577 | Bacteria | 5032 |
| 206 | Ga0068857_100036054 | 3300005577 | Bacteria | 4382 |
| 207 | Ga0068857_100058361 | 3300005577 | Bacteria | 3427 |
| 208 | Ga0068857_100099880 | 3300005577 | Bacteria | 2603 |
| 209 | Ga0068857_100163120 | 3300005577 | Bacteria | 2023 |
| 210 | Ga0068854_100008746 | 3300005578 | Bacteria | 6518 |
| 211 | Ga0068854_100060620 | 3300005578 | Unclassified | 2738 |
| 212 | Ga0068854_100066029 | 3300005578 | Bacteria | 2632 |
| 213 | Ga0068854_100100176 | 3300005578 | Bacteria | 2171 |
| 214 | Ga0068856_100001233 | 3300005614 | Bacteria | 26823 |
| 215 | Ga0068856_100002050 | 3300005614 | Bacteria | 20895 |
| 216 | Ga0068856_100003730 | 3300005614 | Bacteria | 15271 |
| 217 | Ga0068856_100003905 | 3300005614 | Bacteria | 14948 |
| 218 | Ga0068856_100010421 | 3300005614 | Bacteria | 9026 |
| 219 | Ga0068856_100013027 | 3300005614 | Bacteria | 8052 |
| 220 | Ga0068856_100018796 | 3300005614 | Bacteria | 6701 |
| 221 | Ga0068856_100021486 | 3300005614 | Bacteria | 6273 |
| 222 | Ga0068856_100030837 | 3300005614 | Bacteria | 5243 |
| 223 | Ga0068856_100042666 | 3300005614 | Bacteria | 4462 |
| 224 | Ga0068856_100053309 | 3300005614 | Unclassified | 3987 |
| 225 | Ga0068856_100055393 | 3300005614 | Bacteria | 3913 |
| 226 | Ga0068856_100196198 | 3300005614 | Bacteria | 2033 |
| 227 | Ga0068856_100202616 | 3300005614 | Unclassified | 1999 |
| 228 | Ga0068856_100245160 | 3300005614 | Unclassified | 1807 |
| 229 | Ga0068856_100301638 | 3300005614 | Bacteria | 1620 |
| 230 | Ga0068852_100000816 | 3300005616 | Bacteria | 20570 |
| 231 | Ga0068852_100011156 | 3300005616 | Bacteria | 6749 |
| 232 | Ga0068852_100014842 | 3300005616 | Bacteria | 6019 |
| 233 | Ga0068852_100022648 | 3300005616 | Bacteria | 5043 |
| 234 | Ga0068852_100069354 | 3300005616 | Unclassified | 3090 |
| 235 | Ga0068852_100079235 | 3300005616 | Bacteria | 2909 |
| 236 | Ga0068852_100123125 | 3300005616 | Bacteria | 2377 |
| 237 | Ga0068859_100004449 | 3300005617 | Bacteria | 14303 |
| 238 | Ga0068859_100007294 | 3300005617 | Bacteria | 11215 |
| 239 | Ga0068859_100009277 | 3300005617 | Bacteria | 9934 |
| 240 | Ga0068859_100014487 | 3300005617 | Bacteria | 7916 |
| 241 | Ga0068859_100056588 | 3300005617 | Bacteria | 3948 |
| 242 | Ga0068859_100131664 | 3300005617 | Unclassified | 2573 |
| 243 | Ga0068864_100000671 | 3300005618 | Bacteria | 28565 |
| 244 | Ga0068864_100054754 | 3300005618 | Bacteria | 3443 |
| 245 | Ga0068864_100127589 | 3300005618 | Bacteria | 2281 |
| 246 | Ga0068864_100167173 | 3300005618 | Bacteria | 2003 |
| 247 | Ga0068864_100248679 | 3300005618 | Bacteria | 1650 |
| 248 | Ga0068866_10076147 | 3300005718 | Bacteria | 1788 |
| 249 | Ga0068866_10078232 | 3300005718 | Bacteria | 1769 |
| 250 | Ga0068866_10154667 | 3300005718 | Bacteria | 1332 |
| 251 | Ga0068861_100043251 | 3300005719 | Bacteria | 3380 |
| 252 | Ga0068861_100058352 | 3300005719 | Unclassified | 2951 |
| 253 | Ga0068861_100059942 | 3300005719 | Bacteria | 2915 |
| 254 | Ga0068861_100297038 | 3300005719 | Unclassified | 1397 |
| 255 | Ga0068861_100358082 | 3300005719 | Bacteria | 1282 |
| 256 | Ga0068851_10122850 | 3300005834 | Bacteria | 1397 |
| 257 | Ga0068863_100001213 | 3300005841 | Bacteria | 25777 |
| 258 | Ga0068863_100008903 | 3300005841 | Bacteria | 9800 |
| 259 | Ga0068863_100022134 | 3300005841 | Bacteria | 6068 |
| 260 | Ga0068863_100058107 | 3300005841 | Bacteria | 3661 |
| 261 | Ga0068863_100153220 | 3300005841 | Bacteria | 2206 |
| 262 | Ga0068858_100001221 | 3300005842 | Bacteria | 26605 |
| 263 | Ga0068858_100010124 | 3300005842 | Bacteria | 8952 |
| 264 | Ga0068858_100010190 | 3300005842 | Bacteria | 8922 |
| 265 | Ga0068858_100025559 | 3300005842 | Bacteria | 5494 |
| 266 | Ga0068858_100036648 | 3300005842 | Bacteria | 4547 |
| 267 | Ga0068860_100004364 | 3300005843 | Bacteria | 14444 |
| 268 | Ga0068860_100005498 | 3300005843 | Bacteria | 12835 |
| 269 | Ga0068860_100021845 | 3300005843 | Bacteria | 6191 |
| 270 | Ga0068860_100165878 | 3300005843 | Unclassified | 2132 |
| 271 | Ga0068862_100017239 | 3300005844 | Bacteria | 6011 |
| 272 | Ga0068862_100071958 | 3300005844 | Unclassified | 2986 |
| 273 | Ga0081455_10004058 | 3300005937 | Bacteria | 16595 |
| 274 | Ga0081539_10004502 | 3300005985 | Bacteria | 15324 |
| 275 | Ga0081539_10071357 | 3300005985 | Bacteria | 1860 |
| 276 | Ga0070717_10007177 | 3300006028 | Bacteria | 8258 |
| 277 | Ga0070717_10008742 | 3300006028 | Bacteria | 7578 |
| 278 | Ga0070717_10009346 | 3300006028 | Bacteria | 7367 |
| 279 | Ga0070717_10014111 | 3300006028 | Bacteria | 6140 |
| 280 | Ga0070717_10028405 | 3300006028 | Bacteria | 4477 |
| 281 | Ga0070717_10045872 | 3300006028 | Bacteria | 3574 |
| 282 | Ga0070717_10069424 | 3300006028 | Unclassified | 2935 |
| 283 | Ga0070717_10083645 | 3300006028 | Bacteria | 2684 |
| 284 | Ga0070717_10214515 | 3300006028 | Bacteria | 1690 |
| 285 | Ga0070717_10417332 | 3300006028 | Bacteria | 1207 |
| 286 | Ga0070716_100000492 | 3300006173 | Bacteria | 16423 |
| 287 | Ga0070716_100013677 | 3300006173 | Bacteria | 4141 |
| 288 | Ga0070716_100014511 | 3300006173 | Bacteria | 4035 |
| 289 | Ga0070716_100088062 | 3300006173 | Bacteria | 1872 |
| 290 | Ga0070712_100001995 | 3300006175 | Bacteria | 12494 |
| 291 | Ga0070712_100004983 | 3300006175 | Bacteria | 8217 |
| 292 | Ga0070712_100017275 | 3300006175 | Bacteria | 4668 |
| 293 | Ga0070712_100023272 | 3300006175 | Bacteria | 4091 |
| 294 | Ga0070712_100049714 | 3300006175 | Unclassified | 2913 |
| 295 | Ga0097621_100000429 | 3300006237 | Bacteria | 29289 |
| 296 | Ga0097621_100004346 | 3300006237 | Bacteria | 9853 |
| 297 | Ga0097621_100008381 | 3300006237 | Bacteria | 7441 |
| 298 | Ga0097621_100015622 | 3300006237 | Bacteria | 5720 |
| 299 | Ga0097621_100027845 | 3300006237 | Bacteria | 4449 |
| 300 | Ga0097621_100071374 | 3300006237 | Bacteria | 2870 |
| 301 | Ga0097621_100085534 | 3300006237 | Bacteria | 2630 |
| 302 | Ga0097621_100114210 | 3300006237 | Bacteria | 2284 |
| 303 | Ga0097621_100156816 | 3300006237 | Bacteria | 1954 |
| 304 | Ga0068871_100000253 | 3300006358 | Bacteria | 37196 |
| 305 | Ga0068871_100002905 | 3300006358 | Bacteria | 11753 |
| 306 | Ga0068871_100009225 | 3300006358 | Bacteria | 7137 |
| 307 | Ga0068871_100022924 | 3300006358 | Unclassified | 4820 |
| 308 | Ga0068871_100031711 | 3300006358 | Bacteria | 4170 |
| 309 | Ga0068871_100036856 | 3300006358 | Bacteria | 3896 |
| 310 | Ga0068871_100052344 | 3300006358 | Bacteria | 3306 |
| 311 | Ga0068871_100088363 | 3300006358 | Unclassified | 2578 |
| 312 | Ga0068871_100147997 | 3300006358 | Bacteria | 2001 |
| 313 | Ga0068871_100165984 | 3300006358 | Unclassified | 1890 |
| 314 | Ga0068871_100267574 | 3300006358 | Bacteria | 1492 |
| 315 | Ga0075428_100267437 | 3300006844 | Unclassified | 1840 |
| 316 | Ga0075431_100095635 | 3300006847 | Unclassified | 3066 |
| 317 | Ga0075431_100222745 | 3300006847 | Bacteria | 1924 |
| 318 | Ga0075431_100271673 | 3300006847 | Unclassified | 1718 |
| 319 | Ga0075433_10022514 | 3300006852 | Bacteria | 5289 |
| 320 | Ga0075433_10139851 | 3300006852 | Bacteria | 2152 |
| 321 | Ga0075434_100000016 | 3300006871 | Bacteria | 75294 |
| 322 | Ga0075434_100001835 | 3300006871 | Bacteria | 18336 |
| 323 | Ga0075434_100002692 | 3300006871 | Bacteria | 15693 |
| 324 | Ga0075434_100329839 | 3300006871 | Unclassified | 1546 |
| 325 | Ga0075429_100338961 | 3300006880 | Bacteria | 1316 |
| 326 | Ga0068865_100031058 | 3300006881 | Bacteria | 3558 |
| 327 | Ga0068865_100078938 | 3300006881 | Bacteria | 2356 |
| 328 | Ga0068865_100242782 | 3300006881 | Bacteria | 1418 |
| 329 | Ga0068865_100262008 | 3300006881 | Bacteria | 1369 |
| 330 | Ga0075436_100000459 | 3300006914 | Bacteria | 26338 |
| 331 | Ga0075436_100026863 | 3300006914 | Bacteria | 3963 |
| 332 | Ga0075436_100139527 | 3300006914 | Unclassified | 1703 |
| 333 | Ga0097620_100004449 | 3300006931 | Bacteria | 14303 |
| 334 | Ga0097620_100007294 | 3300006931 | Bacteria | 11215 |
| 335 | Ga0097620_100009277 | 3300006931 | Bacteria | 9934 |
| 336 | Ga0097620_100014485 | 3300006931 | Bacteria | 7916 |
| 337 | Ga0097620_100056588 | 3300006931 | Bacteria | 3948 |
| 338 | Ga0097620_100131654 | 3300006931 | Unclassified | 2573 |
| 339 | Ga0075435_100000506 | 3300007076 | Bacteria | 23788 |
| 340 | Ga0075435_100021652 | 3300007076 | Bacteria | 4948 |
| 341 | Ga0075435_100082032 | 3300007076 | Bacteria | 2650 |
| 342 | Ga0075435_100098694 | 3300007076 | Bacteria | 2418 |
| 343 | Ga0075435_100144522 | 3300007076 | Bacteria | 1997 |
| 344 | Ga0075435_100199308 | 3300007076 | Unclassified | 1696 |
| 345 | Ga0105240_10000738 | 3300009093 | Bacteria | 59852 |
| 346 | Ga0105240_10000778 | 3300009093 | Bacteria | 57686 |
| 347 | Ga0105240_10003112 | 3300009093 | Bacteria | 26112 |
| 348 | Ga0105240_10004261 | 3300009093 | Bacteria | 21881 |
| 349 | Ga0105240_10005632 | 3300009093 | Bacteria | 18594 |
| 350 | Ga0105240_10008154 | 3300009093 | Bacteria | 15021 |
| 351 | Ga0105240_10015119 | 3300009093 | Bacteria | 10505 |
| 352 | Ga0105240_10032933 | 3300009093 | Bacteria | 6702 |
| 353 | Ga0105240_10037194 | 3300009093 | Bacteria | 6256 |
| 354 | Ga0105240_10050887 | 3300009093 | Bacteria | 5218 |
| 355 | Ga0105240_10081819 | 3300009093 | Bacteria | 3966 |
| 356 | Ga0105240_10089891 | 3300009093 | Bacteria | 3755 |
| 357 | Ga0105240_10114882 | 3300009093 | Bacteria | 3251 |
| 358 | Ga0105240_10223764 | 3300009093 | Bacteria | 2191 |
| 359 | Ga0105240_10268406 | 3300009093 | Bacteria | 1966 |
| 360 | Ga0111539_10244495 | 3300009094 | Unclassified | 2089 |
| 361 | Ga0105245_10000286 | 3300009098 | Bacteria | 48236 |
| 362 | Ga0105245_10015306 | 3300009098 | Bacteria | 6684 |
| 363 | Ga0105245_10022064 | 3300009098 | Bacteria | 5588 |
| 364 | Ga0105245_10037097 | 3300009098 | Unclassified | 4332 |
| 365 | Ga0105245_10209382 | 3300009098 | Bacteria | 1876 |
| 366 | Ga0105245_10228269 | 3300009098 | Unclassified | 1799 |
| 367 | Ga0105245_10463925 | 3300009098 | Bacteria | 1277 |
| 368 | Ga0105247_10059563 | 3300009101 | Unclassified | 2364 |
| 369 | Ga0105247_10195917 | 3300009101 | Bacteria | 1355 |
| 370 | Ga0114129_10083219 | 3300009147 | Bacteria | 4446 |
| 371 | Ga0105243_10012146 | 3300009148 | Bacteria | 6510 |
| 372 | Ga0105243_10197117 | 3300009148 | Bacteria | 1763 |
| 373 | Ga0105241_10002536 | 3300009174 | Bacteria | 13704 |
| 374 | Ga0105241_10012765 | 3300009174 | Bacteria | 6165 |
| 375 | Ga0105241_10015936 | 3300009174 | Bacteria | 5507 |
| 376 | Ga0105241_10030045 | 3300009174 | Bacteria | 4059 |
| 377 | Ga0105241_10035879 | 3300009174 | Bacteria | 3730 |
| 378 | Ga0105241_10036485 | 3300009174 | Bacteria | 3699 |
| 379 | Ga0105241_10045138 | 3300009174 | Bacteria | 3342 |
| 380 | Ga0105241_10074500 | 3300009174 | Bacteria | 2643 |
| 381 | Ga0105241_10150604 | 3300009174 | Bacteria | 1903 |
| 382 | Ga0105241_10359509 | 3300009174 | Bacteria | 1267 |
| 383 | Ga0105242_10007645 | 3300009176 | Bacteria | 8319 |
| 384 | Ga0105242_10016682 | 3300009176 | Bacteria | 5713 |
| 385 | Ga0105242_10032177 | 3300009176 | Bacteria | 4193 |
| 386 | Ga0105242_10043252 | 3300009176 | Bacteria | 3644 |
| 387 | Ga0105242_10082051 | 3300009176 | Bacteria | 2697 |
| 388 | Ga0105248_10009328 | 3300009177 | Bacteria | 10807 |
| 389 | Ga0105248_10037677 | 3300009177 | Bacteria | 5410 |
| 390 | Ga0105248_10045680 | 3300009177 | Bacteria | 4911 |
| 391 | Ga0105248_10053050 | 3300009177 | Bacteria | 4549 |
| 392 | Ga0105248_10075262 | 3300009177 | Bacteria | 3795 |
| 393 | Ga0105248_10097274 | 3300009177 | Unclassified | 3316 |
| 394 | Ga0105248_10190191 | 3300009177 | Bacteria | 2313 |
| 395 | Ga0105248_10191166 | 3300009177 | Unclassified | 2307 |
| 396 | Ga0105248_10353905 | 3300009177 | Bacteria | 1653 |
| 397 | Ga0105248_10709299 | 3300009177 | Bacteria | 1135 |
| 398 | Ga0105237_10001829 | 3300009545 | Bacteria | 27403 |
| 399 | Ga0105237_10009578 | 3300009545 | Bacteria | 10371 |
| 400 | Ga0105237_10027698 | 3300009545 | Bacteria | 5779 |
| 401 | Ga0105237_10029272 | 3300009545 | Bacteria | 5601 |
| 402 | Ga0105237_10096614 | 3300009545 | Bacteria | 2945 |
| 403 | Ga0105237_10132215 | 3300009545 | Bacteria | 2490 |
| 404 | Ga0105237_10172633 | 3300009545 | Bacteria | 2162 |
| 405 | Ga0105237_10263113 | 3300009545 | Bacteria | 1727 |
| 406 | Ga0105237_10459219 | 3300009545 | Bacteria | 1280 |
| 407 | Ga0105238_10011478 | 3300009551 | Bacteria | 8924 |
| 408 | Ga0105238_10013565 | 3300009551 | Bacteria | 8226 |
| 409 | Ga0105238_10054528 | 3300009551 | Bacteria | 4014 |
| 410 | Ga0105238_10066329 | 3300009551 | Bacteria | 3611 |
| 411 | Ga0105238_10091442 | 3300009551 | Bacteria | 3030 |
| 412 | Ga0105238_10112402 | 3300009551 | Bacteria | 2703 |
| 413 | Ga0105238_10142206 | 3300009551 | Bacteria | 2376 |
| 414 | Ga0105238_10254390 | 3300009551 | Bacteria | 1735 |
| 415 | Ga0105249_10010222 | 3300009553 | Bacteria | 8242 |
| 416 | Ga0105249_10085478 | 3300009553 | Bacteria | 2940 |
| 417 | Ga0105249_10109827 | 3300009553 | Unclassified | 2605 |
| 418 | Ga0105249_10490945 | 3300009553 | Bacteria | 1272 |
| 419 | Ga0105239_10006589 | 3300010375 | Bacteria | 13448 |
| 420 | Ga0105239_10027677 | 3300010375 | Bacteria | 6237 |
| 421 | Ga0105239_10126118 | 3300010375 | Bacteria | 2845 |
| 422 | Ga0105239_10154065 | 3300010375 | Bacteria | 2566 |
| 423 | Ga0105239_10177728 | 3300010375 | Unclassified | 2381 |
| 424 | Ga0105239_10233415 | 3300010375 | Unclassified | 2064 |
| 425 | Ga0105239_10353885 | 3300010375 | Bacteria | 1658 |
| 426 | Ga0105246_10005450 | 3300011119 | Bacteria | 7749 |
| 427 | Ga0105246_10032128 | 3300011119 | Bacteria | 3479 |
| 428 | Ga0105246_10084031 | 3300011119 | Bacteria | 2276 |
| 429 | Ga0105246_10221458 | 3300011119 | Bacteria | 1483 |
| 430 | Ga0157373_10003057 | 3300013100 | Bacteria | 12628 |
| 431 | Ga0157373_10145551 | 3300013100 | Bacteria | 1667 |
| 432 | Ga0157373_10155016 | 3300013100 | Bacteria | 1612 |
| 433 | Ga0157371_10010847 | 3300013102 | Bacteria | 7071 |
| 434 | Ga0157371_10214395 | 3300013102 | Bacteria | 1382 |
| 435 | Ga0157371_10246624 | 3300013102 | Bacteria | 1285 |
| 436 | Ga0157370_10000270 | 3300013104 | Bacteria | 65780 |
| 437 | Ga0157370_10000943 | 3300013104 | Bacteria | 36885 |
| 438 | Ga0157370_10004563 | 3300013104 | Bacteria | 15854 |
| 439 | Ga0157370_10005579 | 3300013104 | Bacteria | 14100 |
| 440 | Ga0157370_10025649 | 3300013104 | Bacteria | 5833 |
| 441 | Ga0157369_10001413 | 3300013105 | Bacteria | 29512 |
| 442 | Ga0157369_10001679 | 3300013105 | Bacteria | 27005 |
| 443 | Ga0157369_10002903 | 3300013105 | Bacteria | 20483 |
| 444 | Ga0157369_10004017 | 3300013105 | Bacteria | 17438 |
| 445 | Ga0157369_10008771 | 3300013105 | Bacteria | 11585 |
| 446 | Ga0157369_10016798 | 3300013105 | Bacteria | 8226 |
| 447 | Ga0157369_10017461 | 3300013105 | Bacteria | 8063 |
| 448 | Ga0157369_10054092 | 3300013105 | Unclassified | 4335 |
| 449 | Ga0157369_10086887 | 3300013105 | Bacteria | 3339 |
| 450 | Ga0157369_10087736 | 3300013105 | Bacteria | 3322 |
| 451 | Ga0157369_10114128 | 3300013105 | Bacteria | 2869 |
| 452 | Ga0157369_10124202 | 3300013105 | Bacteria | 2738 |
| 453 | Ga0157369_10191417 | 3300013105 | Bacteria | 2149 |
| 454 | Ga0157369_10238750 | 3300013105 | Bacteria | 1898 |
| 455 | Ga0157369_10251548 | 3300013105 | Bacteria | 1844 |
| 456 | Ga0157374_10000735 | 3300013296 | Bacteria | 28588 |
| 457 | Ga0157374_10000866 | 3300013296 | Bacteria | 26455 |
| 458 | Ga0157374_10003307 | 3300013296 | Bacteria | 13543 |
| 459 | Ga0157374_10011216 | 3300013296 | Bacteria | 7750 |
| 460 | Ga0157374_10019999 | 3300013296 | Bacteria | 5935 |
| 461 | Ga0157374_10020405 | 3300013296 | Bacteria | 5879 |
| 462 | Ga0157374_10020845 | 3300013296 | Bacteria | 5822 |
| 463 | Ga0157374_10068427 | 3300013296 | Bacteria | 3341 |
| 464 | Ga0157374_10345365 | 3300013296 | Unclassified | 1478 |
| 465 | Ga0157374_10424963 | 3300013296 | Bacteria | 1328 |
| 466 | Ga0157378_10000023 | 3300013297 | Bacteria | 129977 |
| 467 | Ga0157378_10000055 | 3300013297 | Bacteria | 97875 |
| 468 | Ga0157378_10000397 | 3300013297 | Bacteria | 42878 |
| 469 | Ga0157378_10037407 | 3300013297 | Bacteria | 4298 |
| 470 | Ga0157378_10058340 | 3300013297 | Unclassified | 3442 |
| 471 | Ga0157378_10065146 | 3300013297 | Bacteria | 3261 |
| 472 | Ga0157378_10077553 | 3300013297 | Bacteria | 2996 |
| 473 | Ga0157378_10104789 | 3300013297 | Unclassified | 2585 |
| 474 | Ga0157378_10127942 | 3300013297 | Bacteria | 2348 |
| 475 | Ga0157378_10129910 | 3300013297 | Bacteria | 2331 |
| 476 | Ga0157378_10135373 | 3300013297 | Unclassified | 2284 |
| 477 | Ga0157378_10138838 | 3300013297 | Bacteria | 2255 |
| 478 | Ga0157378_10179915 | 3300013297 | Bacteria | 1989 |
| 479 | Ga0157378_10185301 | 3300013297 | Bacteria | 1960 |
| 480 | Ga0163162_10002315 | 3300013306 | Bacteria | 17866 |
| 481 | Ga0163162_10002954 | 3300013306 | Bacteria | 16227 |
| 482 | Ga0163162_10004379 | 3300013306 | Bacteria | 13597 |
| 483 | Ga0163162_10023877 | 3300013306 | Bacteria | 6034 |
| 484 | Ga0163162_10092923 | 3300013306 | Bacteria | 3101 |
| 485 | Ga0163162_10095153 | 3300013306 | Unclassified | 3065 |
| 486 | Ga0163162_10120579 | 3300013306 | Bacteria | 2727 |
| 487 | Ga0157372_10000390 | 3300013307 | Bacteria | 48665 |
| 488 | Ga0157372_10000561 | 3300013307 | Bacteria | 40941 |
| 489 | Ga0157372_10009344 | 3300013307 | Bacteria | 10434 |
| 490 | Ga0157372_10010189 | 3300013307 | Bacteria | 9981 |
| 491 | Ga0157372_10027492 | 3300013307 | Bacteria | 6196 |
| 492 | Ga0157372_10029050 | 3300013307 | Bacteria | 6033 |
| 493 | Ga0157372_10031391 | 3300013307 | Bacteria | 5817 |
| 494 | Ga0157372_10050111 | 3300013307 | Bacteria | 4645 |
| 495 | Ga0157372_10112670 | 3300013307 | Bacteria | 3117 |
| 496 | Ga0157372_10238441 | 3300013307 | Unclassified | 2110 |
| 497 | Ga0157372_10256343 | 3300013307 | Unclassified | 2031 |
| 498 | Ga0157372_10284044 | 3300013307 | Unclassified | 1924 |
| 499 | Ga0157372_10461177 | 3300013307 | Bacteria | 1481 |
| 500 | Ga0157375_10001430 | 3300013308 | Bacteria | 20541 |
| 501 | Ga0157375_10001599 | 3300013308 | Bacteria | 19466 |
| 502 | Ga0157375_10005189 | 3300013308 | Bacteria | 11303 |
| 503 | Ga0157375_10090683 | 3300013308 | Unclassified | 3116 |
| 504 | Ga0157375_10174103 | 3300013308 | Bacteria | 2301 |
| 505 | Ga0157375_10236758 | 3300013308 | Bacteria | 1985 |
| 506 | Ga0157375_10245078 | 3300013308 | Bacteria | 1952 |
| 507 | Ga0157375_10277525 | 3300013308 | Bacteria | 1839 |
| 508 | Ga0157375_10311474 | 3300013308 | Bacteria | 1738 |
| 509 | Ga0157375_10332976 | 3300013308 | Bacteria | 1683 |
| 510 | Ga0157375_10413456 | 3300013308 | Bacteria | 1515 |
| 511 | Ga0163163_10001032 | 3300014325 | Bacteria | 23598 |
| 512 | Ga0163163_10005022 | 3300014325 | Bacteria | 11402 |
| 513 | Ga0163163_10026864 | 3300014325 | Bacteria | 5507 |
| 514 | Ga0163163_10064553 | 3300014325 | Bacteria | 3633 |
| 515 | Ga0163163_10087812 | 3300014325 | Bacteria | 3120 |
| 516 | Ga0163163_10095610 | 3300014325 | Unclassified | 2990 |
| 517 | Ga0163163_10104480 | 3300014325 | Bacteria | 2858 |
| 518 | Ga0163163_10106364 | 3300014325 | Bacteria | 2832 |
| 519 | Ga0163163_10107162 | 3300014325 | Bacteria | 2821 |
| 520 | Ga0163163_10124560 | 3300014325 | Unclassified | 2614 |
| 521 | Ga0163163_10147440 | 3300014325 | Bacteria | 2397 |
| 522 | Ga0163163_10306339 | 3300014325 | Unclassified | 1641 |
| 523 | Ga0163163_10361302 | 3300014325 | Bacteria | 1508 |
| 524 | Ga0157380_10068705 | 3300014326 | Bacteria | 2857 |
| 525 | Ga0157380_10133522 | 3300014326 | Bacteria | 2121 |
| 526 | Ga0157377_10000793 | 3300014745 | Bacteria | 13059 |
| 527 | Ga0157379_10267191 | 3300014968 | Bacteria | 1555 |
| 528 | Ga0157376_10017498 | 3300014969 | Bacteria | 5469 |
| 529 | Ga0157376_10020381 | 3300014969 | Bacteria | 5128 |
| 530 | Ga0157376_10064195 | 3300014969 | Unclassified | 3096 |
| 531 | Ga0157376_10166055 | 3300014969 | Bacteria | 2006 |
| 532 | Ga0157376_10221079 | 3300014969 | Bacteria | 1754 |
| 533 | Ga0182006_1015912 | 3300015261 | Bacteria | 3216 |
| 534 | Ga0182007_10004659 | 3300015262 | Bacteria | 6186 |
| 535 | Ga0182007_10037338 | 3300015262 | Bacteria | 1632 |
| 536 | Ga0163161_10000233 | 3300017792 | Bacteria | 51225 |
| 537 | Ga0163161_10031705 | 3300017792 | Bacteria | 3767 |
| 538 | Ga0163161_10154138 | 3300017792 | Bacteria | 1748 |
| 539 | Ga0206356_11613496 | 3300020070 | Unclassified | 1403 |
| 540 | Ga0206352_10973090 | 3300020078 | Bacteria | 2860 |
| 541 | Ga0213875_10000224 | 3300021388 | Bacteria | 57760 |
| 542 | Ga0213875_10001250 | 3300021388 | Bacteria | 17154 |
| 543 | Ga0213875_10006694 | 3300021388 | Bacteria | 6020 |
| 544 | Ga0213875_10006894 | 3300021388 | Bacteria | 5922 |
| 545 | Ga0224570_100652 | 3300022730 | Bacteria | 2752 |
| 546 | Ga0224569_101640 | 3300022732 | Bacteria | 1863 |
| 547 | Ga0224571_101190 | 3300022734 | Bacteria | 1609 |
| 548 | Ga0224572_1000980 | 3300024225 | Bacteria | 3936 |
| 549 | Ga0228598_1000319 | 3300024227 | Bacteria | 9409 |
| 550 | Ga0228598_1006864 | 3300024227 | Bacteria | 2338 |
| 551 | Ga0207697_10101364 | 3300025315 | Bacteria | 1227 |
| 552 | Ga0207682_10010990 | 3300025893 | Bacteria | 3545 |
| 553 | Ga0207692_10002028 | 3300025898 | Bacteria | 7729 |
| 554 | Ga0207692_10011530 | 3300025898 | Bacteria | 3766 |
| 555 | Ga0207692_10075546 | 3300025898 | Bacteria | 1788 |
| 556 | Ga0207642_10022168 | 3300025899 | Bacteria | 2514 |
| 557 | Ga0207688_10002244 | 3300025901 | Bacteria | 10414 |
| 558 | Ga0207688_10017346 | 3300025901 | Bacteria | 3912 |
| 559 | Ga0207680_10008343 | 3300025903 | Bacteria | 5079 |
| 560 | Ga0207680_10016591 | 3300025903 | Bacteria | 3871 |
| 561 | Ga0207680_10027945 | 3300025903 | Bacteria | 3149 |
| 562 | Ga0207680_10107389 | 3300025903 | Bacteria | 1804 |
| 563 | Ga0207680_10119822 | 3300025903 | Bacteria | 1719 |
| 564 | Ga0207647_10002049 | 3300025904 | Bacteria | 15401 |
| 565 | Ga0207647_10007573 | 3300025904 | Bacteria | 7832 |
| 566 | Ga0207647_10039298 | 3300025904 | Bacteria | 2986 |
| 567 | Ga0207685_10000460 | 3300025905 | Bacteria | 6829 |
| 568 | Ga0207685_10058491 | 3300025905 | Unclassified | 1517 |
| 569 | Ga0207699_10012598 | 3300025906 | Bacteria | 4306 |
| 570 | Ga0207699_10025494 | 3300025906 | Bacteria | 3247 |
| 571 | Ga0207645_10002703 | 3300025907 | Bacteria | 13820 |
| 572 | Ga0207643_10002087 | 3300025908 | Bacteria | 11007 |
| 573 | Ga0207643_10219373 | 3300025908 | Bacteria | 1163 |
| 574 | Ga0207705_10156639 | 3300025909 | Bacteria | 1709 |
| 575 | Ga0207705_10178918 | 3300025909 | Bacteria | 1600 |
| 576 | Ga0207684_10001546 | 3300025910 | Bacteria | 24600 |
| 577 | Ga0207684_10003387 | 3300025910 | Bacteria | 15613 |
| 578 | Ga0207684_10003840 | 3300025910 | Bacteria | 14465 |
| 579 | Ga0207684_10024623 | 3300025910 | Bacteria | 5132 |
| 580 | Ga0207684_10071809 | 3300025910 | Bacteria | 2940 |
| 581 | Ga0207684_10110901 | 3300025910 | Bacteria | 2348 |
| 582 | Ga0207684_10174898 | 3300025910 | Bacteria | 1851 |
| 583 | Ga0207684_10265575 | 3300025910 | Bacteria | 1481 |
| 584 | Ga0207654_10000043 | 3300025911 | Bacteria | 101383 |
| 585 | Ga0207654_10001303 | 3300025911 | Bacteria | 13298 |
| 586 | Ga0207654_10003561 | 3300025911 | Bacteria | 7877 |
| 587 | Ga0207654_10010251 | 3300025911 | Unclassified | 4770 |
| 588 | Ga0207654_10034009 | 3300025911 | Bacteria | 2829 |
| 589 | Ga0207654_10040503 | 3300025911 | Bacteria | 2626 |
| 590 | Ga0207654_10095950 | 3300025911 | Bacteria | 1817 |
| 591 | Ga0207707_10006268 | 3300025912 | Bacteria | 10386 |
| 592 | Ga0207707_10010068 | 3300025912 | Bacteria | 8202 |
| 593 | Ga0207707_10010258 | 3300025912 | Bacteria | 8129 |
| 594 | Ga0207707_10023469 | 3300025912 | Bacteria | 5396 |
| 595 | Ga0207707_10024637 | 3300025912 | Bacteria | 5266 |
| 596 | Ga0207707_10049620 | 3300025912 | Bacteria | 3657 |
| 597 | Ga0207707_10061696 | 3300025912 | Bacteria | 3262 |
| 598 | Ga0207707_10067741 | 3300025912 | Bacteria | 3109 |
| 599 | Ga0207707_10073179 | 3300025912 | Bacteria | 2988 |
| 600 | Ga0207707_10225468 | 3300025912 | Bacteria | 1631 |
| 601 | Ga0207707_10275309 | 3300025912 | Bacteria | 1458 |
| 602 | Ga0207695_10000098 | 3300025913 | Bacteria | 261213 |
| 603 | Ga0207695_10001575 | 3300025913 | Bacteria | 37151 |
| 604 | Ga0207695_10003415 | 3300025913 | Bacteria | 22413 |
| 605 | Ga0207695_10003556 | 3300025913 | Bacteria | 21824 |
| 606 | Ga0207695_10005046 | 3300025913 | Bacteria | 17727 |
| 607 | Ga0207695_10005547 | 3300025913 | Bacteria | 16683 |
| 608 | Ga0207695_10008071 | 3300025913 | Bacteria | 13247 |
| 609 | Ga0207695_10008770 | 3300025913 | Bacteria | 12610 |
| 610 | Ga0207695_10023518 | 3300025913 | Bacteria | 6958 |
| 611 | Ga0207695_10038846 | 3300025913 | Bacteria | 5120 |
| 612 | Ga0207695_10047856 | 3300025913 | Bacteria | 4521 |
| 613 | Ga0207695_10067378 | 3300025913 | Bacteria | 3672 |
| 614 | Ga0207695_10073869 | 3300025913 | Bacteria | 3473 |
| 615 | Ga0207695_10093663 | 3300025913 | Unclassified | 3013 |
| 616 | Ga0207671_10000428 | 3300025914 | Bacteria | 58003 |
| 617 | Ga0207671_10007707 | 3300025914 | Bacteria | 9288 |
| 618 | Ga0207671_10023002 | 3300025914 | Bacteria | 4704 |
| 619 | Ga0207671_10036903 | 3300025914 | Bacteria | 3624 |
| 620 | Ga0207671_10065656 | 3300025914 | Bacteria | 2700 |
| 621 | Ga0207671_10090921 | 3300025914 | Bacteria | 2299 |
| 622 | Ga0207671_10287497 | 3300025914 | Bacteria | 1298 |
| 623 | Ga0207693_10002662 | 3300025915 | Bacteria | 15515 |
| 624 | Ga0207693_10012918 | 3300025915 | Bacteria | 6739 |
| 625 | Ga0207693_10015106 | 3300025915 | Bacteria | 6198 |
| 626 | Ga0207693_10016780 | 3300025915 | Bacteria | 5845 |
| 627 | Ga0207693_10183842 | 3300025915 | Unclassified | 1645 |
| 628 | Ga0207693_10282772 | 3300025915 | Bacteria | 1300 |
| 629 | Ga0207663_10011127 | 3300025916 | Bacteria | 4818 |
| 630 | Ga0207663_10045549 | 3300025916 | Bacteria | 2699 |
| 631 | Ga0207663_10063218 | 3300025916 | Bacteria | 2356 |
| 632 | Ga0207663_10090503 | 3300025916 | Bacteria | 2029 |
| 633 | Ga0207663_10155504 | 3300025916 | Unclassified | 1608 |
| 634 | Ga0207663_10176757 | 3300025916 | Bacteria | 1521 |
| 635 | Ga0207663_10181115 | 3300025916 | Bacteria | 1505 |
| 636 | Ga0207660_10009085 | 3300025917 | Bacteria | 6438 |
| 637 | Ga0207660_10018550 | 3300025917 | Bacteria | 4639 |
| 638 | Ga0207660_10085181 | 3300025917 | Unclassified | 2331 |
| 639 | Ga0207660_10141225 | 3300025917 | Bacteria | 1841 |
| 640 | Ga0207660_10186141 | 3300025917 | Bacteria | 1615 |
| 641 | Ga0207662_10001375 | 3300025918 | Bacteria | 11769 |
| 642 | Ga0207657_10002191 | 3300025919 | Bacteria | 21170 |
| 643 | Ga0207657_10002806 | 3300025919 | Bacteria | 18750 |
| 644 | Ga0207657_10008906 | 3300025919 | Bacteria | 10146 |
| 645 | Ga0207657_10088068 | 3300025919 | Bacteria | 2596 |
| 646 | Ga0207657_10275446 | 3300025919 | Bacteria | 1337 |
| 647 | Ga0207649_10000232 | 3300025920 | Bacteria | 45423 |
| 648 | Ga0207649_10000435 | 3300025920 | Bacteria | 30277 |
| 649 | Ga0207649_10016795 | 3300025920 | Unclassified | 4139 |
| 650 | Ga0207649_10018617 | 3300025920 | Bacteria | 3953 |
| 651 | Ga0207649_10076202 | 3300025920 | Bacteria | 2157 |
| 652 | Ga0207649_10084743 | 3300025920 | Unclassified | 2061 |
| 653 | Ga0207652_10009951 | 3300025921 | Bacteria | 7656 |
| 654 | Ga0207652_10027538 | 3300025921 | Bacteria | 4736 |
| 655 | Ga0207652_10067167 | 3300025921 | Bacteria | 3108 |
| 656 | Ga0207652_10133415 | 3300025921 | Bacteria | 2216 |
| 657 | Ga0207652_10136911 | 3300025921 | Bacteria | 2187 |
| 658 | Ga0207652_10167502 | 3300025921 | Bacteria | 1971 |
| 659 | Ga0207652_10184824 | 3300025921 | Bacteria | 1874 |
| 660 | Ga0207652_10363685 | 3300025921 | Bacteria | 1306 |
| 661 | Ga0207646_10000080 | 3300025922 | Bacteria | 128981 |
| 662 | Ga0207646_10001451 | 3300025922 | Bacteria | 29389 |
| 663 | Ga0207646_10001897 | 3300025922 | Bacteria | 25168 |
| 664 | Ga0207646_10077573 | 3300025922 | Bacteria | 2969 |
| 665 | Ga0207646_10178429 | 3300025922 | Bacteria | 1918 |
| 666 | Ga0207681_10014410 | 3300025923 | Bacteria | 4913 |
| 667 | Ga0207681_10152155 | 3300025923 | Bacteria | 1735 |
| 668 | Ga0207694_10000218 | 3300025924 | Bacteria | 56165 |
| 669 | Ga0207694_10001605 | 3300025924 | Bacteria | 19110 |
| 670 | Ga0207694_10004953 | 3300025924 | Bacteria | 10319 |
| 671 | Ga0207694_10005870 | 3300025924 | Bacteria | 9411 |
| 672 | Ga0207694_10010292 | 3300025924 | Bacteria | 7049 |
| 673 | Ga0207694_10030577 | 3300025924 | Bacteria | 4112 |
| 674 | Ga0207694_10030813 | 3300025924 | Unclassified | 4095 |
| 675 | Ga0207694_10096538 | 3300025924 | Bacteria | 2337 |
| 676 | Ga0207694_10148265 | 3300025924 | Bacteria | 1889 |
| 677 | Ga0207694_10201218 | 3300025924 | Bacteria | 1620 |
| 678 | Ga0207650_10000122 | 3300025925 | Bacteria | 99309 |
| 679 | Ga0207650_10005875 | 3300025925 | Bacteria | 8376 |
| 680 | Ga0207650_10047539 | 3300025925 | Bacteria | 3162 |
| 681 | Ga0207650_10304289 | 3300025925 | Bacteria | 1303 |
| 682 | Ga0207659_10025436 | 3300025926 | Unclassified | 3978 |
| 683 | Ga0207659_10056051 | 3300025926 | Bacteria | 2821 |
| 684 | Ga0207659_10118471 | 3300025926 | Bacteria | 2025 |
| 685 | Ga0207659_10448877 | 3300025926 | Bacteria | 1086 |
| 686 | Ga0207687_10001012 | 3300025927 | Bacteria | 19086 |
| 687 | Ga0207687_10004992 | 3300025927 | Bacteria | 8790 |
| 688 | Ga0207687_10009457 | 3300025927 | Bacteria | 6375 |
| 689 | Ga0207687_10034065 | 3300025927 | Unclassified | 3457 |
| 690 | Ga0207687_10069413 | 3300025927 | Unclassified | 2513 |
| 691 | Ga0207687_10121519 | 3300025927 | Bacteria | 1954 |
| 692 | Ga0207687_10249981 | 3300025927 | Bacteria | 1409 |
| 693 | Ga0207700_10011063 | 3300025928 | Bacteria | 5736 |
| 694 | Ga0207700_10260208 | 3300025928 | Unclassified | 1485 |
| 695 | Ga0207664_10006288 | 3300025929 | Bacteria | 8162 |
| 696 | Ga0207664_10031957 | 3300025929 | Bacteria | 4031 |
| 697 | Ga0207664_10063993 | 3300025929 | Bacteria | 2940 |
| 698 | Ga0207664_10101967 | 3300025929 | Bacteria | 2372 |
| 699 | Ga0207664_10116483 | 3300025929 | Bacteria | 2229 |
| 700 | Ga0207664_10171455 | 3300025929 | Unclassified | 1857 |
| 701 | Ga0207664_10300502 | 3300025929 | Bacteria | 1412 |
| 702 | Ga0207644_10009240 | 3300025931 | Bacteria | 6468 |
| 703 | Ga0207644_10016007 | 3300025931 | Bacteria | 5042 |
| 704 | Ga0207644_10111756 | 3300025931 | Bacteria | 2067 |
| 705 | Ga0207644_10402850 | 3300025931 | Bacteria | 1118 |
| 706 | Ga0207690_10036484 | 3300025932 | Unclassified | 3184 |
| 707 | Ga0207690_10090581 | 3300025932 | Unclassified | 2159 |
| 708 | Ga0207706_10004321 | 3300025933 | Bacteria | 13348 |
| 709 | Ga0207706_10004432 | 3300025933 | Bacteria | 13196 |
| 710 | Ga0207706_10025102 | 3300025933 | Bacteria | 5343 |
| 711 | Ga0207686_10012518 | 3300025934 | Bacteria | 4666 |
| 712 | Ga0207686_10039915 | 3300025934 | Bacteria | 2850 |
| 713 | Ga0207686_10055663 | 3300025934 | Bacteria | 2483 |
| 714 | Ga0207686_10079169 | 3300025934 | Bacteria | 2139 |
| 715 | Ga0207709_10043982 | 3300025935 | Unclassified | 2696 |
| 716 | Ga0207670_10014868 | 3300025936 | Bacteria | 4634 |
| 717 | Ga0207670_10241232 | 3300025936 | Bacteria | 1392 |
| 718 | Ga0207704_10003411 | 3300025938 | Bacteria | 7218 |
| 719 | Ga0207704_10055907 | 3300025938 | Unclassified | 2414 |
| 720 | Ga0207704_10148363 | 3300025938 | Bacteria | 1651 |
| 721 | Ga0207665_10001360 | 3300025939 | Bacteria | 16473 |
| 722 | Ga0207665_10005963 | 3300025939 | Bacteria | 8106 |
| 723 | Ga0207665_10011906 | 3300025939 | Bacteria | 5713 |
| 724 | Ga0207665_10018349 | 3300025939 | Bacteria | 4598 |
| 725 | Ga0207665_10143115 | 3300025939 | Unclassified | 1707 |
| 726 | Ga0207665_10145594 | 3300025939 | Bacteria | 1693 |
| 727 | Ga0207691_10050923 | 3300025940 | Unclassified | 3789 |
| 728 | Ga0207711_10000700 | 3300025941 | Bacteria | 33079 |
| 729 | Ga0207711_10009811 | 3300025941 | Bacteria | 7964 |
| 730 | Ga0207711_10026299 | 3300025941 | Bacteria | 4882 |
| 731 | Ga0207711_10037770 | 3300025941 | Bacteria | 4104 |
| 732 | Ga0207711_10040657 | 3300025941 | Unclassified | 3956 |
| 733 | Ga0207711_10041421 | 3300025941 | Bacteria | 3922 |
| 734 | Ga0207711_10050164 | 3300025941 | Bacteria | 3572 |
| 735 | Ga0207711_10104813 | 3300025941 | Bacteria | 2506 |
| 736 | Ga0207711_10107334 | 3300025941 | Bacteria | 2479 |
| 737 | Ga0207711_10150266 | 3300025941 | Unclassified | 2101 |
| 738 | Ga0207711_10176666 | 3300025941 | Bacteria | 1940 |
| 739 | Ga0207711_10220469 | 3300025941 | Bacteria | 1735 |
| 740 | Ga0207689_10000382 | 3300025942 | Bacteria | 41581 |
| 741 | Ga0207689_10045086 | 3300025942 | Bacteria | 3647 |
| 742 | Ga0207689_10213602 | 3300025942 | Bacteria | 1594 |
| 743 | Ga0207661_10000018 | 3300025944 | Bacteria | 242506 |
| 744 | Ga0207661_10004310 | 3300025944 | Bacteria | 9958 |
| 745 | Ga0207661_10012254 | 3300025944 | Bacteria | 6227 |
| 746 | Ga0207661_10012659 | 3300025944 | Bacteria | 6141 |
| 747 | Ga0207661_10061636 | 3300025944 | Bacteria | 3031 |
| 748 | Ga0207661_10174833 | 3300025944 | Bacteria | 1871 |
| 749 | Ga0207661_10212767 | 3300025944 | Bacteria | 1705 |
| 750 | Ga0207661_10429156 | 3300025944 | Bacteria | 1201 |
| 751 | Ga0207679_10000070 | 3300025945 | Bacteria | 91501 |
| 752 | Ga0207679_10010001 | 3300025945 | Bacteria | 6094 |
| 753 | Ga0207679_10024856 | 3300025945 | Bacteria | 4112 |
| 754 | Ga0207679_10032704 | 3300025945 | Bacteria | 3655 |
| 755 | Ga0207679_10087481 | 3300025945 | Bacteria | 2399 |
| 756 | Ga0207679_10173609 | 3300025945 | Bacteria | 1777 |
| 757 | Ga0207679_10205627 | 3300025945 | Bacteria | 1647 |
| 758 | Ga0207667_10001054 | 3300025949 | Bacteria | 35065 |
| 759 | Ga0207667_10003885 | 3300025949 | Bacteria | 18377 |
| 760 | Ga0207667_10004127 | 3300025949 | Bacteria | 17850 |
| 761 | Ga0207667_10005322 | 3300025949 | Bacteria | 15684 |
| 762 | Ga0207667_10005455 | 3300025949 | Bacteria | 15504 |
| 763 | Ga0207667_10006676 | 3300025949 | Bacteria | 13952 |
| 764 | Ga0207667_10012067 | 3300025949 | Bacteria | 9992 |
| 765 | Ga0207667_10012911 | 3300025949 | Bacteria | 9595 |
| 766 | Ga0207667_10045590 | 3300025949 | Bacteria | 4642 |
| 767 | Ga0207667_10072308 | 3300025949 | Unclassified | 3585 |
| 768 | Ga0207667_10156877 | 3300025949 | Bacteria | 2341 |
| 769 | Ga0207667_10225203 | 3300025949 | Bacteria | 1921 |
| 770 | Ga0207667_10227298 | 3300025949 | Bacteria | 1911 |
| 771 | Ga0207667_10265634 | 3300025949 | Bacteria | 1755 |
| 772 | Ga0207667_10328075 | 3300025949 | Unclassified | 1563 |
| 773 | Ga0207651_10000872 | 3300025960 | Bacteria | 13212 |
| 774 | Ga0207651_10068770 | 3300025960 | Bacteria | 2498 |
| 775 | Ga0207651_10127219 | 3300025960 | Bacteria | 1944 |
| 776 | Ga0207651_10309105 | 3300025960 | Unclassified | 1317 |
| 777 | Ga0207712_10059526 | 3300025961 | Bacteria | 2704 |
| 778 | Ga0207712_10139418 | 3300025961 | Bacteria | 1859 |
| 779 | Ga0207712_10160496 | 3300025961 | Bacteria | 1747 |
| 780 | Ga0207668_10097549 | 3300025972 | Bacteria | 2175 |
| 781 | Ga0207640_10016762 | 3300025981 | Bacteria | 4269 |
| 782 | Ga0207640_10075792 | 3300025981 | Unclassified | 2281 |
| 783 | Ga0207640_10081426 | 3300025981 | Bacteria | 2214 |
| 784 | Ga0207640_10103147 | 3300025981 | Bacteria | 2005 |
| 785 | Ga0207640_10105530 | 3300025981 | Bacteria | 1985 |
| 786 | Ga0207658_10022253 | 3300025986 | Bacteria | 4412 |
| 787 | Ga0207677_10003749 | 3300026023 | Bacteria | 8065 |
| 788 | Ga0207677_10019789 | 3300026023 | Unclassified | 4074 |
| 789 | Ga0207677_10024324 | 3300026023 | Bacteria | 3761 |
| 790 | Ga0207677_10030731 | 3300026023 | Bacteria | 3432 |
| 791 | Ga0207677_10098718 | 3300026023 | Unclassified | 2143 |
| 792 | Ga0207703_10008345 | 3300026035 | Bacteria | 8188 |
| 793 | Ga0207703_10009189 | 3300026035 | Bacteria | 7776 |
| 794 | Ga0207703_10014402 | 3300026035 | Bacteria | 6166 |
| 795 | Ga0207703_10021734 | 3300026035 | Bacteria | 5024 |
| 796 | Ga0207703_10027454 | 3300026035 | Unclassified | 4483 |
| 797 | Ga0207703_10123585 | 3300026035 | Unclassified | 2225 |
| 798 | Ga0207703_10169245 | 3300026035 | Bacteria | 1920 |
| 799 | Ga0207703_10452332 | 3300026035 | Bacteria | 1200 |
| 800 | Ga0207639_10011487 | 3300026041 | Bacteria | 6153 |
| 801 | Ga0207639_10012377 | 3300026041 | Bacteria | 5940 |
| 802 | Ga0207639_10034160 | 3300026041 | Bacteria | 3757 |
| 803 | Ga0207639_10052420 | 3300026041 | Bacteria | 3109 |
| 804 | Ga0207639_10142412 | 3300026041 | Unclassified | 1999 |
| 805 | Ga0207639_10173793 | 3300026041 | Bacteria | 1827 |
| 806 | Ga0207639_10258071 | 3300026041 | Bacteria | 1523 |
| 807 | Ga0207639_10492927 | 3300026041 | Bacteria | 1118 |
| 808 | Ga0207678_10003533 | 3300026067 | Bacteria | 14064 |
| 809 | Ga0207702_10000660 | 3300026078 | Bacteria | 37577 |
| 810 | Ga0207702_10002946 | 3300026078 | Bacteria | 15895 |
| 811 | Ga0207702_10004480 | 3300026078 | Bacteria | 12400 |
| 812 | Ga0207702_10010432 | 3300026078 | Bacteria | 7772 |
| 813 | Ga0207702_10010767 | 3300026078 | Bacteria | 7635 |
| 814 | Ga0207702_10012076 | 3300026078 | Bacteria | 7184 |
| 815 | Ga0207702_10013371 | 3300026078 | Bacteria | 6827 |
| 816 | Ga0207702_10028314 | 3300026078 | Bacteria | 4656 |
| 817 | Ga0207702_10044070 | 3300026078 | Unclassified | 3749 |
| 818 | Ga0207702_10069124 | 3300026078 | Bacteria | 3036 |
| 819 | Ga0207702_10128337 | 3300026078 | Unclassified | 2279 |
| 820 | Ga0207702_10130104 | 3300026078 | Bacteria | 2264 |
| 821 | Ga0207702_10156755 | 3300026078 | Bacteria | 2076 |
| 822 | Ga0207702_10406374 | 3300026078 | Unclassified | 1314 |
| 823 | Ga0207641_10000020 | 3300026088 | Bacteria | 286415 |
| 824 | Ga0207641_10001395 | 3300026088 | Bacteria | 23810 |
| 825 | Ga0207641_10008398 | 3300026088 | Bacteria | 8531 |
| 826 | Ga0207641_10013337 | 3300026088 | Bacteria | 6740 |
| 827 | Ga0207641_10015798 | 3300026088 | Bacteria | 6184 |
| 828 | Ga0207641_10046732 | 3300026088 | Bacteria | 3650 |
| 829 | Ga0207641_10047976 | 3300026088 | Unclassified | 3604 |
| 830 | Ga0207641_10287108 | 3300026088 | Unclassified | 1550 |
| 831 | Ga0207641_10392093 | 3300026088 | Unclassified | 1332 |
| 832 | Ga0207648_10060856 | 3300026089 | Bacteria | 3293 |
| 833 | Ga0207648_10161030 | 3300026089 | Bacteria | 1982 |
| 834 | Ga0207648_10202165 | 3300026089 | Bacteria | 1762 |
| 835 | Ga0207648_10222962 | 3300026089 | Bacteria | 1676 |
| 836 | Ga0207676_10000101 | 3300026095 | Bacteria | 77252 |
| 837 | Ga0207676_10006392 | 3300026095 | Bacteria | 8324 |
| 838 | Ga0207676_10075849 | 3300026095 | Bacteria | 2714 |
| 839 | Ga0207676_10185360 | 3300026095 | Bacteria | 1826 |
| 840 | Ga0207674_10002444 | 3300026116 | Bacteria | 23463 |
| 841 | Ga0207674_10006072 | 3300026116 | Bacteria | 14279 |
| 842 | Ga0207674_10008451 | 3300026116 | Bacteria | 11890 |
| 843 | Ga0207674_10012608 | 3300026116 | Bacteria | 9447 |
| 844 | Ga0207674_10016816 | 3300026116 | Bacteria | 7994 |
| 845 | Ga0207674_10023066 | 3300026116 | Bacteria | 6675 |
| 846 | Ga0207674_10026189 | 3300026116 | Bacteria | 6203 |
| 847 | Ga0207674_10027266 | 3300026116 | Bacteria | 6047 |
| 848 | Ga0207674_10045660 | 3300026116 | Bacteria | 4504 |
| 849 | Ga0207674_10114366 | 3300026116 | Bacteria | 2671 |
| 850 | Ga0207674_10331652 | 3300026116 | Bacteria | 1471 |
| 851 | Ga0207675_100018648 | 3300026118 | Bacteria | 6477 |
| 852 | Ga0207675_100025755 | 3300026118 | Bacteria | 5474 |
| 853 | Ga0207675_100041040 | 3300026118 | Bacteria | 4322 |
| 854 | Ga0207675_100079523 | 3300026118 | Unclassified | 3072 |
| 855 | Ga0207683_10006839 | 3300026121 | Bacteria | 9767 |
| 856 | Ga0207698_10000762 | 3300026142 | Bacteria | 18730 |
| 857 | Ga0207698_10012473 | 3300026142 | Bacteria | 5563 |
| 858 | Ga0207698_10022675 | 3300026142 | Bacteria | 4369 |
| 859 | Ga0207698_10087614 | 3300026142 | Unclassified | 2536 |
| 860 | Ga0207698_10125094 | 3300026142 | Unclassified | 2185 |
| 861 | Ga0207698_10487371 | 3300026142 | Bacteria | 1197 |
| 862 | Ga0268266_10015357 | 3300028379 | Bacteria | 6571 |
| 863 | Ga0268266_10151128 | 3300028379 | Bacteria | 2093 |
| 864 | Ga0268266_10180550 | 3300028379 | Bacteria | 1921 |
| 865 | Ga0268266_10186943 | 3300028379 | Bacteria | 1889 |
| 866 | Ga0268265_10054954 | 3300028380 | Bacteria | 3024 |
| 867 | Ga0268265_10066384 | 3300028380 | Unclassified | 2789 |
| 868 | Ga0268265_10116131 | 3300028380 | Bacteria | 2195 |
| 869 | Ga0268265_10245809 | 3300028380 | Bacteria | 1581 |
| 870 | Ga0268264_10004196 | 3300028381 | Bacteria | 12307 |
| 871 | Ga0268264_10041709 | 3300028381 | Bacteria | 3797 |
| 872 | Ga0268264_10049947 | 3300028381 | Unclassified | 3481 |
| 873 | Ga0268264_10102172 | 3300028381 | Bacteria | 2494 |
| 874 | Ga0268264_10132777 | 3300028381 | Unclassified | 2210 |
| 875 | Ga0265326_10013329 | 3300028558 | Bacteria | 2407 |
| 876 | Ga0265323_10033392 | 3300028653 | Bacteria | 1905 |
| 877 | Ga0265338_10016017 | 3300028800 | Bacteria | 8192 |
| 878 | Ga0265338_10021507 | 3300028800 | Bacteria | 6723 |
| 879 | Ga0265338_10026484 | 3300028800 | Bacteria | 5845 |
| 880 | Ga0265338_10048161 | 3300028800 | Bacteria | 3881 |
| 881 | Ga0265338_10226273 | 3300028800 | Bacteria | 1394 |
| 882 | Ga0265324_10005661 | 3300029957 | Bacteria | 5341 |
| 883 | Ga0265762_1000551 | 3300030760 | Bacteria | 6551 |
| 884 | Ga0265760_10000020 | 3300031090 | Bacteria | 71420 |
| 885 | Ga0265760_10004749 | 3300031090 | Bacteria | 3893 |
| 886 | Ga0265760_10005052 | 3300031090 | Bacteria | 3776 |
| 887 | Ga0265760_10005330 | 3300031090 | Bacteria | 3689 |
| 888 | Ga0265760_10032052 | 3300031090 | Unclassified | 1551 |
| 889 | Ga0265330_10001456 | 3300031235 | Bacteria | 13794 |
| 890 | Ga0265330_10027320 | 3300031235 | Bacteria | 2579 |
| 891 | Ga0265328_10008799 | 3300031239 | Bacteria | 4143 |
| 892 | Ga0265325_10001034 | 3300031241 | Bacteria | 20055 |
| 893 | Ga0265325_10002055 | 3300031241 | Bacteria | 13801 |
| 894 | Ga0265325_10013014 | 3300031241 | Bacteria | 4745 |
| 895 | Ga0265325_10022498 | 3300031241 | Unclassified | 3452 |
| 896 | Ga0265329_10036646 | 3300031242 | Bacteria | 1581 |
| 897 | Ga0265340_10006128 | 3300031247 | Bacteria | 6630 |
| 898 | Ga0265340_10008558 | 3300031247 | Bacteria | 5519 |
| 899 | Ga0265340_10016745 | 3300031247 | Bacteria | 3792 |
| 900 | Ga0265340_10066705 | 3300031247 | Bacteria | 1712 |
| 901 | Ga0265339_10000100 | 3300031249 | Bacteria | 72186 |
| 902 | Ga0265339_10000877 | 3300031249 | Bacteria | 23128 |
| 903 | Ga0265339_10002548 | 3300031249 | Bacteria | 12987 |
| 904 | Ga0265339_10020822 | 3300031249 | Bacteria | 3826 |
| 905 | Ga0265339_10021865 | 3300031249 | Unclassified | 3713 |
| 906 | Ga0265339_10042430 | 3300031249 | Bacteria | 2519 |
| 907 | Ga0265331_10025225 | 3300031250 | Bacteria | 3003 |
| 908 | Ga0265316_10000820 | 3300031344 | Bacteria | 34379 |
| 909 | Ga0265316_10003118 | 3300031344 | Bacteria | 16902 |
| 910 | Ga0265316_10007789 | 3300031344 | Bacteria | 10030 |
| 911 | Ga0265316_10008025 | 3300031344 | Bacteria | 9854 |
| 912 | Ga0265316_10025371 | 3300031344 | Bacteria | 4948 |
| 913 | Ga0265316_10038896 | 3300031344 | Bacteria | 3826 |
| 914 | Ga0265316_10225993 | 3300031344 | Bacteria | 1380 |
| 915 | Ga0307513_10008524 | 3300031456 | Bacteria | 13098 |
| 916 | Ga0307408_100009490 | 3300031548 | Bacteria | 6418 |
| 917 | Ga0307408_100131557 | 3300031548 | Bacteria | 1953 |
| 918 | Ga0307408_100337640 | 3300031548 | Bacteria | 1274 |
| 919 | Ga0265313_10002559 | 3300031595 | Bacteria | 15536 |
| 920 | Ga0265313_10017364 | 3300031595 | Bacteria | 4093 |
| 921 | Ga0265314_10000139 | 3300031711 | Bacteria | 108861 |
| 922 | Ga0265314_10001920 | 3300031711 | Bacteria | 22204 |
| 923 | Ga0265314_10002227 | 3300031711 | Bacteria | 20176 |
| 924 | Ga0265314_10042495 | 3300031711 | Bacteria | 3241 |
| 925 | Ga0265314_10058385 | 3300031711 | Bacteria | 2644 |
| 926 | Ga0265314_10110914 | 3300031711 | Bacteria | 1743 |
| 927 | Ga0265342_10002531 | 3300031712 | Bacteria | 15727 |
| 928 | Ga0265342_10003095 | 3300031712 | Bacteria | 13891 |
| 929 | Ga0265342_10012874 | 3300031712 | Bacteria | 5645 |
| 930 | Ga0265342_10016085 | 3300031712 | Bacteria | 4899 |
| 931 | Ga0307405_10097869 | 3300031731 | Bacteria | 1960 |
| 932 | Ga0307413_10005431 | 3300031824 | Bacteria | 5691 |
| 933 | Ga0307413_10133310 | 3300031824 | Bacteria | 1704 |
| 934 | Ga0307413_10301133 | 3300031824 | Bacteria | 1216 |
| 935 | Ga0307410_10001454 | 3300031852 | Bacteria | 10696 |
| 936 | Ga0307410_10016540 | 3300031852 | Bacteria | 4402 |
| 937 | Ga0307410_10020884 | 3300031852 | Bacteria | 4017 |
| 938 | Ga0307410_10161218 | 3300031852 | Bacteria | 1680 |
| 939 | Ga0307406_10035640 | 3300031901 | Bacteria | 3062 |
| 940 | Ga0307406_10081297 | 3300031901 | Bacteria | 2154 |
| 941 | Ga0307406_10091169 | 3300031901 | Bacteria | 2053 |
| 942 | Ga0307407_10038813 | 3300031903 | Unclassified | 2642 |
| 943 | Ga0307407_10084730 | 3300031903 | Bacteria | 1926 |
| 944 | Ga0307412_10021387 | 3300031911 | Bacteria | 3952 |
| 945 | Ga0307409_100002046 | 3300031995 | Bacteria | 10357 |
| 946 | Ga0307409_100014535 | 3300031995 | Bacteria | 5127 |
| 947 | Ga0307409_100052207 | 3300031995 | Bacteria | 3133 |
| 948 | Ga0307416_100002239 | 3300032002 | Bacteria | 11007 |
| 949 | Ga0307416_100016565 | 3300032002 | Bacteria | 5128 |
| 950 | Ga0307416_100089548 | 3300032002 | Bacteria | 2635 |
| 951 | Ga0307416_100291023 | 3300032002 | Bacteria | 1617 |
| 952 | Ga0307416_100435448 | 3300032002 | Unclassified | 1359 |
| 953 | Ga0307411_10001147 | 3300032005 | Bacteria | 10387 |
| 954 | Ga0307411_10005428 | 3300032005 | Bacteria | 6261 |
| 955 | Ga0307411_10033347 | 3300032005 | Bacteria | 3193 |
| 956 | Ga0307415_100006399 | 3300032126 | Bacteria | 6346 |
| 957 | Ga0307415_100006710 | 3300032126 | Bacteria | 6234 |
| 958 | Ga0307415_100021261 | 3300032126 | Bacteria | 3984 |
| 959 | Ga0373932_0013717 | 3300035112 | Unclassified | 2023 |
| 960 | Ga0373936_0032602 | 3300035113 | Bacteria | 2061 |
| 961 | Ga0373939_0056796 | 3300035114 | Bacteria | 1233 |
| 962 | Ga0373939_0060506 | 3300035114 | Bacteria | 1204 |
| 963 | Ga0373945_0012389 | 3300035116 | Bacteria | 2832 |
| 964 | Ga0373953_0051166 | 3300035117 | Bacteria | 1670 |
| 965 | Ga0373953_0074263 | 3300035117 | Bacteria | 1406 |
| 966 | Ga0373954_0029526 | 3300035118 | Bacteria | 2525 |
| 967 | Ga0373956_0017573 | 3300035119 | Unclassified | 3017 |
| 968 | Ga0373956_0125773 | 3300035119 | Bacteria | 1199 |
| 969 | Ga0373957_0046562 | 3300035120 | Bacteria | 1647 |
| 970 | Ga0373943_0039718 | 3300035170 | Bacteria | 2269 |
| 971 | Ga0373946_0075239 | 3300035171 | Bacteria | 1467 |
| 972 | Ga0373955_0052299 | 3300035172 | Bacteria | 2228 |
| 973 | Ga0373924_0090456 | 3300035410 | Bacteria | 1309 |
| 974 | Ga0373931_0006415 | 3300035691 | Bacteria | 5495 |
| 975 | Ga0373931_0109183 | 3300035691 | Bacteria | 1567 |
| 976 | Ga0373935_0012290 | 3300035692 | Bacteria | 5151 |
| 977 | Ga0373935_0073693 | 3300035692 | Bacteria | 2206 |
| 978 | Ga0373935_0077306 | 3300035692 | Bacteria | 2157 |
| 979 | Ga0373927_0006491 | 3300035695 | Bacteria | 7969 |
| 980 | Ga0373927_0017636 | 3300035695 | Bacteria | 4697 |
| 981 | Ga0373927_0065722 | 3300035695 | Bacteria | 2346 |
| 982 | Ga0373927_0074362 | 3300035695 | Bacteria | 2200 |
| 983 | Ga0373927_0091486 | 3300035695 | Bacteria | 1976 |
| 984 | Ga0373927_0130458 | 3300035695 | Bacteria | 1642 |
| 985 | Ga0373927_0185842 | 3300035695 | Bacteria | 1363 |
| 986 | Ga0373933_0010373 | 3300035724 | Bacteria | 5107 |
| 987 | Ga0373933_0032007 | 3300035724 | Bacteria | 3055 |
| 988 | Ga0373933_0047687 | 3300035724 | Unclassified | 2549 |
| 989 | Ga0373933_0140126 | 3300035724 | Bacteria | 1527 |
| 990 | Ga0373947_0000309 | 3300035725 | Bacteria | 27587 |
| 991 | Ga0373947_0006461 | 3300035725 | Bacteria | 6809 |
| 992 | Ga0373947_0010161 | 3300035725 | Bacteria | 5404 |
| 993 | Ga0373947_0100789 | 3300035725 | Bacteria | 1815 |
| 994 | Ga0373947_0155396 | 3300035725 | Bacteria | 1476 |
| 995 | Ga0373937_0009225 | 3300036401 | Bacteria | 8564 |
| 996 | Ga0373937_0027166 | 3300036401 | Bacteria | 5173 |
| 997 | Ga0373937_0031570 | 3300036401 | Bacteria | 4802 |
| 998 | Ga0373937_0033016 | 3300036401 | Bacteria | 4697 |
| 999 | Ga0373937_0115427 | 3300036401 | Bacteria | 2500 |
| 1000 | Ga0373937_0117003 | 3300036401 | Bacteria | 2482 |
| 1001 | Ga0373937_0162940 | 3300036401 | Unclassified | 2091 |
| 1002 | Ga0373937_0192194 | 3300036401 | Bacteria | 1918 |
| 1003 | Ga0373937_0371999 | 3300036401 | Unclassified | 1355 |
| 1004 | Ga0373925_0000062 | 3300037068 | Bacteria | 114902 |
| 1005 | Ga0373925_0003096 | 3300037068 | Bacteria | 13062 |
| 1006 | Ga0373925_0004264 | 3300037068 | Bacteria | 10831 |
| 1007 | Ga0373925_0008239 | 3300037068 | Bacteria | 7587 |
| 1008 | Ga0373925_0070171 | 3300037068 | Bacteria | 2648 |
| 1009 | Ga0373925_0227451 | 3300037068 | Bacteria | 1490 |
| 1010 | Ga0373925_0239784 | 3300037068 | Bacteria | 1452 |
| 1011 | Ga0373925_0417484 | 3300037068 | Bacteria | 1096 |
| 1012 | Ga0395899_0197988 | 3300037312 | Bacteria | 1403 |
| 1013 | Ga0395898_0029045 | 3300037466 | Bacteria | 5541 |
| 1014 | Ga0395905_0249473 | 3300037471 | Bacteria | 1658 |
| 1015 | Ga0436364_0041522 | 3300037853 | Unclassified | 4278 |
| 1016 | Ga0436364_0275010 | 3300037853 | Bacteria | 4564 |
| 1017 | Ga0436364_0278679 | 3300037853 | Bacteria | 3337 |
| 1018 | Ga0436364_0329249 | 3300037853 | Bacteria | 2988 |
| 1019 | Ga0436364_0528118 | 3300037853 | Bacteria | 1241 |
| 1020 | Ga0436364_0589860 | 3300037853 | Bacteria | 38748 |
| 1021 | Ga0436364_0865140 | 3300037853 | Bacteria | 14776 |
| 1022 | Ga0436364_1006074 | 3300037853 | Bacteria | 129171 |
| 1023 | Ga0436364_1103378 | 3300037853 | Bacteria | 14149 |
| 1024 | Ga0436364_1200694 | 3300037853 | Bacteria | 1877 |
| 1025 | Ga0436364_1267343 | 3300037853 | Bacteria | 2492 |
| 1026 | Ga0436364_1304135 | 3300037853 | Bacteria | 9281 |
| 1027 | Ga0436364_1358885 | 3300037853 | Bacteria | 8557 |
| 1028 | Ga0436364_1389561 | 3300037853 | Bacteria | 5011 |
| 1029 | Ga0436364_1463703 | 3300037853 | Bacteria | 18233 |
| 1030 | Ga0395901_0242422 | 3300038443 | Bacteria | 1880 |
| 1031 | Ga0395901_0438732 | 3300038443 | Bacteria | 1337 |
| 1032 | Ga0436365_0106341 | 3300039437 | Bacteria | 2088 |
| 1033 | Ga0436365_0856530 | 3300039437 | Bacteria | 3578 |
| 1034 | Ga0436365_1198256 | 3300039437 | Bacteria | 11815 |
| 1035 | Ga0436365_1769788 | 3300039437 | Bacteria | 2304 |
| 1036 | Ga0436360_0364875 | 3300039438 | Bacteria | 26855 |
| 1037 | Ga0436360_1008170 | 3300039438 | Bacteria | 1200 |
| 1038 | Ga0436361_0167783 | 3300039447 | Bacteria | 6752 |
| 1039 | Ga0436361_0700432 | 3300039447 | Bacteria | 3100 |
| 1040 | Ga0436363_0296278 | 3300039450 | Unclassified | 1790 |
| 1041 | Ga0436363_0816150 | 3300039450 | Bacteria | 4288 |
| 1042 | Ga0436363_0879313 | 3300039450 | Bacteria | 3432 |
| 1043 | Ga0436363_1227875 | 3300039450 | Bacteria | 4857 |
| 1044 | Ga0436362_0578565 | 3300039453 | Bacteria | 3514 |
| 1045 | Ga0439449_0085951 | 3300042007 | Bacteria | 1161 |
| 1046 | Ga0451577_0000241 | 3300042876 | Bacteria | 108191 |
| 1047 | Ga0451577_0018305 | 3300042876 | Bacteria | 6455 |
| 1048 | Ga0453683_0008214 | 3300044673 | Bacteria | 7020 |
| 1049 | Ga0466963_0006314 | 3300044694 | Bacteria | 7008 |
| 1050 | Ga0466963_0008671 | 3300044694 | Bacteria | 6102 |
| 1051 | Ga0466963_0182771 | 3300044694 | Bacteria | 1464 |
| 1052 | Ga0453684_0000366 | 3300044712 | Bacteria | 186117 |
| 1053 | Ga0466971_0100174 | 3300044719 | Bacteria | 1331 |
| 1054 | Ga0451576_0027465 | 3300045051 | Bacteria | 6112 |
| 1055 | Ga0451576_0061563 | 3300045051 | Bacteria | 3914 |
| 1056 | Ga0451576_0078531 | 3300045051 | Bacteria | 3435 |
| 1057 | Ga0451576_0117291 | 3300045051 | Bacteria | 2771 |
| 1058 | Ga0451576_0341710 | 3300045051 | Bacteria | 1567 |
| 1059 | Ga0451576_0515401 | 3300045051 | Unclassified | 1256 |
| 1060 | Ga0451576_0528778 | 3300045051 | Bacteria | 1239 |
| 1061 | Ga0466958_0130035 | 3300045836 | Bacteria | 1581 |
| 1062 | Ga0466967_0005771 | 3300045976 | Bacteria | 8652 |
| 1063 | Ga0466967_0068530 | 3300045976 | Unclassified | 3169 |
| 1064 | Ga0466967_0098854 | 3300045976 | Unclassified | 2665 |
| 1065 | Ga0466967_0111542 | 3300045976 | Unclassified | 2514 |
| 1066 | Ga0466967_0113184 | 3300045976 | Unclassified | 2496 |
| 1067 | Ga0466967_0316669 | 3300045976 | Bacteria | 1504 |
| 1068 | Ga0466967_0636069 | 3300045976 | Bacteria | 1054 |
| 1069 | Ga0495592_0212394 | 3300046454 | Bacteria | 1299 |
| 1070 | Ga0495629_0179942 | 3300046459 | Bacteria | 1466 |
| 1071 | Ga0495651_0111189 | 3300046462 | Bacteria | 2025 |
| 1072 | Ga0495653_0089139 | 3300046463 | Bacteria | 2261 |
| 1073 | Ga0495580_0000038 | 3300046472 | Bacteria | 71800 |
| 1074 | Ga0495580_0000771 | 3300046472 | Bacteria | 27575 |
| 1075 | Ga0495580_0003909 | 3300046472 | Bacteria | 12587 |
| 1076 | Ga0495580_0005258 | 3300046472 | Bacteria | 10753 |
| 1077 | Ga0495580_0005442 | 3300046472 | Bacteria | 10520 |
| 1078 | Ga0495580_0007769 | 3300046472 | Bacteria | 8595 |
| 1079 | Ga0495580_0010881 | 3300046472 | Bacteria | 7061 |
| 1080 | Ga0495580_0017554 | 3300046472 | Bacteria | 5349 |
| 1081 | Ga0495580_0038035 | 3300046472 | Bacteria | 3449 |
| 1082 | Ga0495580_0040648 | 3300046472 | Bacteria | 3321 |
| 1083 | Ga0495580_0065515 | 3300046472 | Bacteria | 2544 |
| 1084 | Ga0495580_0234907 | 3300046472 | Bacteria | 1258 |
| 1085 | Ga0495582_0001575 | 3300046473 | Bacteria | 12866 |
| 1086 | Ga0495582_0040420 | 3300046473 | Bacteria | 2569 |
| 1087 | Ga0495582_0055467 | 3300046473 | Bacteria | 2184 |
| 1088 | Ga0495664_0013230 | 3300046477 | Bacteria | 4680 |
| 1089 | Ga0495664_0044982 | 3300046477 | Bacteria | 2618 |
| 1090 | Ga0495584_0031740 | 3300046491 | Bacteria | 2673 |
| 1091 | Ga0495608_0132009 | 3300046511 | Bacteria | 1598 |
| 1092 | Ga0495628_0004953 | 3300046516 | Bacteria | 11712 |
| 1093 | Ga0495628_0173860 | 3300046516 | Bacteria | 1632 |
| 1094 | Ga0495630_0073547 | 3300046517 | Unclassified | 2574 |
| 1095 | Ga0495630_0085960 | 3300046517 | Bacteria | 2375 |
| 1096 | Ga0495630_0102472 | 3300046517 | Bacteria | 2165 |
| 1097 | Ga0495652_0059175 | 3300046529 | Bacteria | 3243 |
| 1098 | Ga0495652_0159724 | 3300046529 | Bacteria | 1751 |
| 1099 | Ga0495665_0003014 | 3300046531 | Bacteria | 9103 |
| 1100 | Ga0495665_0030482 | 3300046531 | Bacteria | 2887 |
| 1101 | Ga0495665_0062135 | 3300046531 | Bacteria | 1972 |
| 1102 | Ga0495640_0076754 | 3300046533 | Bacteria | 2229 |
| 1103 | Ga0495587_0021453 | 3300046536 | Bacteria | 3984 |
| 1104 | Ga0495587_0025449 | 3300046536 | Bacteria | 3616 |
| 1105 | Ga0495587_0109873 | 3300046536 | Bacteria | 1584 |
| 1106 | Ga0495598_0001452 | 3300046537 | Unclassified | 4699 |
| 1107 | Ga0495645_0016825 | 3300046543 | Bacteria | 5234 |
| 1108 | Ga0495667_0051375 | 3300046559 | Bacteria | 2720 |
| 1109 | Ga0495634_0099834 | 3300046642 | Bacteria | 1876 |
| 1110 | Ga0495635_0039684 | 3300046663 | Bacteria | 3256 |
| 1111 | Ga0495599_0012056 | 3300046678 | Bacteria | 5320 |
| 1112 | Ga0495623_0057093 | 3300046679 | Bacteria | 2456 |
| 1113 | Ga0495623_0140296 | 3300046679 | Bacteria | 1439 |
| 1114 | Ga0495613_0006434 | 3300046689 | Bacteria | 8780 |
| 1115 | Ga0495613_0150029 | 3300046689 | Bacteria | 1663 |
| 1116 | Ga0495613_0189116 | 3300046689 | Bacteria | 1456 |
| 1117 | Ga0495613_0290411 | 3300046689 | Bacteria | 1134 |
| 1118 | Ga0495604_0005315 | 3300047317 | Bacteria | 10215 |
| 1119 | Ga0495604_0073657 | 3300047317 | Bacteria | 2577 |
| 1120 | Ga0495674_0095406 | 3300047319 | Bacteria | 2536 |
| 1121 | Ga0495674_0113793 | 3300047319 | Bacteria | 2291 |
| 1122 | Ga0495680_0011036 | 3300047322 | Bacteria | 8026 |
| 1123 | Ga0495675_0065301 | 3300047444 | Bacteria | 2302 |
| 1124 | Ga0495675_0077323 | 3300047444 | Bacteria | 2097 |
| 1125 | Ga0495684_0007910 | 3300047471 | Bacteria | 8222 |
| 1126 | Ga0495684_0009609 | 3300047471 | Bacteria | 7458 |
| 1127 | Ga0495684_0119962 | 3300047471 | Bacteria | 1981 |
| 1128 | Ga0495684_0124302 | 3300047471 | Bacteria | 1941 |
| 1129 | Ga0495684_0200619 | 3300047471 | Unclassified | 1471 |
| 1130 | Ga0495593_0119900 | 3300047673 | Bacteria | 1339 |
| 1131 | Ga0495602_0056593 | 3300048088 | Bacteria | 3447 |
| 1132 | Ga0495602_0111976 | 3300048088 | Bacteria | 2216 |
| 1133 | Ga0496101_0114838 | 3300048904 | Unclassified | 2030 |
| 1134 | Ga0496101_0229073 | 3300048904 | Bacteria | 1444 |
| 1135 | Ga0496102_0004607 | 3300048905 | Bacteria | 11666 |
| 1136 | Ga0496102_0015409 | 3300048905 | Bacteria | 6658 |
| 1137 | Ga0496102_0046845 | 3300048905 | Bacteria | 3928 |
| 1138 | Ga0496103_0128254 | 3300048906 | Bacteria | 1619 |
| 1139 | Ga0496104_0083236 | 3300048907 | Bacteria | 3052 |
| 1140 | Ga0496104_0106105 | 3300048907 | Bacteria | 2692 |
| 1141 | Ga0496104_0270201 | 3300048907 | Bacteria | 1613 |
| 1142 | Ga0496105_0102309 | 3300048908 | Bacteria | 2366 |
| 1143 | Ga0496105_0343597 | 3300048908 | Bacteria | 1193 |
| 1144 | Ga0496106_0122233 | 3300048909 | Bacteria | 2036 |
| 1145 | Ga0496108_0000559 | 3300048911 | Bacteria | 29177 |
| 1146 | Ga0496109_0000018 | 3300048912 | Bacteria | 191977 |
| 1147 | Ga0496109_0582184 | 3300048912 | Bacteria | 1055 |
| 1148 | Ga0496110_0000049 | 3300048913 | Bacteria | 59257 |
| 1149 | Ga0496110_0178359 | 3300048913 | Unclassified | 1929 |
| 1150 | Ga0496110_0420151 | 3300048913 | Unclassified | 1219 |
| 1151 | Ga0496111_0014257 | 3300048914 | Bacteria | 5425 |
| 1152 | Ga0496111_0190078 | 3300048914 | Bacteria | 1526 |
| 1153 | Ga0496112_0000058 | 3300048915 | Bacteria | 76327 |
| 1154 | Ga0496112_0003222 | 3300048915 | Bacteria | 13438 |
| 1155 | Ga0496112_0014639 | 3300048915 | Bacteria | 7289 |
| 1156 | Ga0496112_0016978 | 3300048915 | Bacteria | 6832 |
| 1157 | Ga0496112_0065182 | 3300048915 | Bacteria | 3595 |
| 1158 | Ga0496112_0099272 | 3300048915 | Bacteria | 2881 |
| 1159 | Ga0496112_0143490 | 3300048915 | Bacteria | 2356 |
| 1160 | Ga0496112_0249967 | 3300048915 | Bacteria | 1724 |
| 1161 | Ga0496112_0413010 | 3300048915 | Unclassified | 1289 |
| 1162 | Ga0496113_0000640 | 3300048916 | Bacteria | 17614 |
| 1163 | Ga0496114_0058188 | 3300048917 | Unclassified | 3227 |
| 1164 | Ga0496115_0005832 | 3300048918 | Bacteria | 8973 |
| 1165 | Ga0496115_0083856 | 3300048918 | Bacteria | 2598 |
| 1166 | Ga0496115_0182321 | 3300048918 | Unclassified | 1735 |
| 1167 | Ga0501297_009917 | 3300049520 | Bacteria | 1071 |
| 1168 | Ga0501031_0001940 | 3300049568 | Bacteria | 13040 |
| 1169 | Ga0501032_0004389 | 3300049569 | Bacteria | 10645 |
| 1170 | Ga0501033_0004620 | 3300049570 | Bacteria | 11025 |
| 1171 | Ga0501034_0007144 | 3300049571 | Bacteria | 11916 |
| 1172 | Ga0501036_0000288 | 3300049572 | Bacteria | 34814 |
| 1173 | Ga0501037_0006041 | 3300049573 | Bacteria | 8837 |
| 1174 | Ga0501038_0033799 | 3300049574 | Bacteria | 4500 |
| 1175 | Ga0501043_0002066 | 3300049579 | Bacteria | 17119 |
| 1176 | Ga0501046_0001257 | 3300049580 | Bacteria | 24532 |
| 1177 | Ga0501047_0052740 | 3300049581 | Bacteria | 3931 |
| 1178 | Ga0501067_0018724 | 3300049583 | Bacteria | 3832 |
| 1179 | Ga0501068_0009400 | 3300049584 | Bacteria | 5468 |
| 1180 | Ga0501069_0002547 | 3300049585 | Bacteria | 9311 |
| 1181 | Ga0501070_0033467 | 3300049586 | Bacteria | 4301 |
| 1182 | Ga0501070_0120264 | 3300049586 | Bacteria | 2170 |
| 1183 | Ga0501072_0000827 | 3300049588 | Bacteria | 22786 |
| 1184 | Ga0501073_0005585 | 3300049589 | Bacteria | 9406 |
| 1185 | Ga0501074_0210115 | 3300049590 | Bacteria | 1386 |
| 1186 | Ga0501076_0012466 | 3300049592 | Bacteria | 6358 |
| 1187 | Ga0501077_0017418 | 3300049593 | Bacteria | 4534 |
| 1188 | Ga0501225_0034743 | 3300049705 | Bacteria | 1388 |
| 1189 | Ga0501245_010258 | 3300049708 | Bacteria | 1352 |
| 1190 | Ga0501079_0003815 | 3300049741 | Bacteria | 11133 |
| 1191 | Ga0501079_0371613 | 3300049741 | Bacteria | 1121 |
| 1192 | Ga0501080_0000940 | 3300049742 | Bacteria | 23816 |
| 1193 | Ga0501080_0172866 | 3300049742 | Bacteria | 1992 |
| 1194 | Ga0501083_0021177 | 3300049744 | Bacteria | 4518 |
| 1195 | Ga0501035_0035229 | 3300049822 | Bacteria | 4543 |
| 1196 | Ga0501035_0112503 | 3300049822 | Bacteria | 2385 |
| 1197 | Ga0501044_0001320 | 3300049823 | Bacteria | 29193 |
| 1198 | Ga0501044_0006259 | 3300049823 | Bacteria | 13160 |
| 1199 | Ga0501044_0012356 | 3300049823 | Bacteria | 9242 |
| 1200 | Ga0501044_0014266 | 3300049823 | Bacteria | 8579 |
| 1201 | Ga0501045_0223052 | 3300049824 | Bacteria | 1403 |
| 1202 | nmdc:mga0qj67_142372_c1 | 3300050509 | Bacteria | 1944 |
| 1203 | nmdc:mga0qj67_39168_c1 | 3300050509 | Bacteria | 3721 |
| 1204 | nmdc:mga06r32_120557_c1 | 3300050510 | Bacteria | 2587 |
| 1205 | nmdc:mga06r32_15120_c1 | 3300050510 | Bacteria | 7008 |
| 1206 | nmdc:mga06r32_27487_c1 | 3300050510 | Bacteria | 5315 |
| 1207 | nmdc:mga06r32_342925_c1 | 3300050510 | Bacteria | 1478 |
| 1208 | nmdc:mga08y16_182635_c1 | 3300050511 | Unclassified | 2177 |
| 1209 | nmdc:mga0n895_110236_c1 | 3300050512 | Bacteria | 2768 |
| 1210 | nmdc:mga0n895_111648_c1 | 3300050512 | Bacteria | 2750 |
| 1211 | nmdc:mga0n895_15381_c1 | 3300050512 | Bacteria | 6973 |
| 1212 | nmdc:mga0n895_16452_c1 | 3300050512 | Bacteria | 6788 |
| 1213 | nmdc:mga0rr50_158012_c1 | 3300050513 | Bacteria | 1838 |
| 1214 | nmdc:mga0rr50_65195_c1 | 3300050513 | Bacteria | 2758 |
| 1215 | nmdc:mga0rr50_9705_c1 | 3300050513 | Bacteria | 6070 |
| 1216 | nmdc:mga08x19_121665_c1 | 3300050514 | Unclassified | 1750 |
| 1217 | nmdc:mga08x19_1620_c1 | 3300050514 | Bacteria | 13960 |
| 1218 | nmdc:mga08x19_291882_c1 | 3300050514 | Bacteria | 1131 |
| 1219 | nmdc:mga08x19_318456_c1 | 3300050514 | Bacteria | 1082 |
| 1220 | nmdc:mga08x19_6581_c1 | 3300050514 | Bacteria | 6886 |
| 1221 | Ga0495595_0125789 | 3300053084 | Bacteria | 1251 |
| 1222 | Ga0495619_0046651 | 3300053085 | Bacteria | 2850 |
| 1223 | Ga0500568_0001756 | 3300053139 | Bacteria | 13383 |
| 1224 | Ga0501084_0005911 | 3300054114 | Bacteria | 10077 |
| 1225 | Ga0587073_0008746 | 3300059492 | Bacteria | 1648 |
| 1226 | Ga0587073_0025404 | 3300059492 | Bacteria | 1178 |
| 1227 | Ga0587077_018485 | 3300059493 | Bacteria | 1201 |
| 1228 | Ga0501082_0000669 | 3300060353 | Bacteria | 30133 |
| 1229 | Ga0501082_0049257 | 3300060353 | Bacteria | 3632 |
| 1230 | Ga0501082_0071448 | 3300060353 | Bacteria | 2989 |
| 1231 | Ga0207665_10155696 | |||
| 1232 | JGI24752J21851_1002068 | |||
| 1233 | JGI24751J29686_10003788 | |||
| 1234 | JGI25406J46586_10034602 | |||
| 1235 | Ga0065715_10024703 | |||
| 1236 | Ga0065715_10109151 | |||
| 1237 | Ga0070676_10004945 | |||
| 1238 | Ga0070683_100014106 | |||
| 1239 | Ga0070683_100018324 | |||
| 1240 | Ga0070683_100093089 | |||
| 1241 | Ga0070690_100080585 | |||
| 1242 | Ga0070690_100084349 | |||
| 1243 | Ga0070690_100125602 | |||
| 1244 | Ga0070670_100027685 | |||
| 1245 | Ga0070677_10002404 | |||
| 1246 | Ga0070677_10112352 | |||
| 1247 | Ga0068869_100002204 | |||
| 1248 | Ga0068869_100060896 | |||
| 1249 | Ga0070666_10039335 | |||
| 1250 | Ga0070666_10060631 | |||
| 1251 | Ga0070680_100009419 | |||
| 1252 | Ga0070680_100311319 | |||
| 1253 | Ga0070682_100085761 | |||
| 1254 | Ga0068868_100002500 | |||
| 1255 | Ga0068868_100020989 | |||
| 1256 | Ga0068868_100031685 | |||
| 1257 | Ga0068868_100037736 | |||
| 1258 | Ga0068868_100067399 | |||
| 1259 | Ga0068868_100134220 | |||
| 1260 | Ga0068868_100244423 | |||
| 1261 | Ga0070660_100001412 | |||
| 1262 | Ga0070660_100007536 | |||
| 1263 | Ga0070660_100027967 | |||
| 1264 | Ga0070660_100072828 | |||
| 1265 | Ga0070689_100058793 | |||
| 1266 | Ga0070689_100332832 | |||
| 1267 | Ga0070687_100082758 | |||
| 1268 | Ga0070661_100052129 | |||
| 1269 | Ga0070661_100078580 | |||
| 1270 | Ga0070661_100086054 | |||
| 1271 | Ga0070661_100111483 | |||
| 1272 | Ga0070661_100125765 | |||
| 1273 | Ga0070661_100198415 | |||
| 1274 | Ga0070692_10016814 | |||
| 1275 | Ga0070668_100020879 | |||
| 1276 | Ga0070668_100120630 | |||
| 1277 | Ga0070668_100194552 | |||
| 1278 | Ga0070669_100011802 | |||
| 1279 | Ga0070669_100024500 | |||
| 1280 | Ga0070675_100001298 | |||
| 1281 | Ga0070671_100019223 | |||
| 1282 | Ga0070671_100375081 | |||
| 1283 | Ga0070674_100010264 | |||
| 1284 | Ga0070673_100007525 | |||
| 1285 | Ga0070673_100102555 | |||
| 1286 | Ga0070688_100004440 | |||
| 1287 | Ga0070688_100020808 | |||
| 1288 | Ga0070659_100008991 | |||
| 1289 | Ga0070659_100033480 | |||
| 1290 | Ga0070659_100077887 | |||
| 1291 | Ga0070659_100142906 | |||
| 1292 | Ga0070659_100165530 | |||
| 1293 | Ga0070659_100226139 | |||
| 1294 | Ga0070667_100008426 | |||
| 1295 | Ga0070709_10007704 | |||
| 1296 | Ga0070709_10323902 | |||
| 1297 | Ga0070714_100027657 | |||
| 1298 | Ga0070714_100164710 | |||
| 1299 | Ga0070714_100179455 | |||
| 1300 | Ga0070713_100001466 | |||
| 1301 | Ga0070713_100009249 | |||
| 1302 | Ga0070713_100014676 | |||
| 1303 | Ga0070713_100021771 | |||
| 1304 | Ga0070713_100183302 | |||
| 1305 | Ga0070713_100346675 | |||
| 1306 | Ga0070710_10000918 | |||
| 1307 | Ga0070710_10012743 | |||
| 1308 | Ga0070711_100006476 | |||
| 1309 | Ga0070711_100011115 | |||
| 1310 | Ga0070711_100015697 | |||
| 1311 | Ga0070711_100090348 | |||
| 1312 | Ga0070711_100161070 | |||
| 1313 | Ga0070705_100194435 | |||
| 1314 | Ga0070705_100195893 | |||
| 1315 | Ga0070708_100000611 | |||
| 1316 | Ga0070708_100002494 | |||
| 1317 | Ga0070708_100004519 | |||
| 1318 | Ga0070708_100012329 | |||
| 1319 | Ga0070708_100037562 | |||
| 1320 | Ga0070708_100045758 | |||
| 1321 | Ga0070708_100049462 | |||
| 1322 | Ga0070708_100053252 | |||
| 1323 | Ga0070708_100142421 | |||
| 1324 | Ga0070663_100023777 | |||
| 1325 | Ga0070663_100024610 | |||
| 1326 | Ga0070678_100021849 | |||
| 1327 | Ga0070678_100294366 | |||
| 1328 | Ga0070662_100019596 | |||
| 1329 | Ga0070662_100028095 | |||
| 1330 | Ga0070662_100056588 | |||
| 1331 | Ga0070681_10000134 | |||
| 1332 | Ga0070681_10006449 | |||
| 1333 | Ga0070681_10009100 | |||
| 1334 | Ga0070681_10017743 | |||
| 1335 | Ga0070681_10043723 | |||
| 1336 | Ga0070681_10158863 | |||
| 1337 | Ga0070681_10192779 | |||
| 1338 | Ga0070681_10288148 | |||
| 1339 | Ga0068867_100028639 | |||
| 1340 | Ga0068867_100048259 | |||
| 1341 | Ga0068867_100074897 | |||
| 1342 | Ga0068867_100517812 | |||
| 1343 | Ga0070706_100001823 | |||
| 1344 | Ga0070706_100002374 | |||
| 1345 | Ga0070706_100003656 | |||
| 1346 | Ga0070706_100007208 | |||
| 1347 | Ga0070706_100114735 | |||
| 1348 | Ga0070706_100120393 | |||
| 1349 | Ga0070706_100307065 | |||
| 1350 | Ga0070707_100000161 | |||
| 1351 | Ga0070707_100000278 | |||
| 1352 | Ga0070707_100005702 | |||
| 1353 | Ga0070707_100013421 | |||
| 1354 | Ga0070707_100068823 | |||
| 1355 | Ga0070707_100132821 | |||
| 1356 | Ga0070707_100198721 | |||
| 1357 | Ga0070707_100228174 | |||
| 1358 | Ga0070698_100000203 | |||
| 1359 | Ga0070698_100004684 | |||
| 1360 | Ga0070698_100028386 | |||
| 1361 | Ga0070698_100118542 | |||
| 1362 | Ga0070699_100000177 | |||
| 1363 | Ga0070699_100001034 | |||
| 1364 | Ga0070699_100025461 | |||
| 1365 | Ga0070699_100066879 | |||
| 1366 | Ga0070699_100209745 | |||
| 1367 | Ga0070679_100009205 | |||
| 1368 | Ga0070679_100034387 | |||
| 1369 | Ga0070679_100054379 | |||
| 1370 | Ga0070679_100147860 | |||
| 1371 | Ga0070679_100249212 | |||
| 1372 | Ga0070679_100306261 | |||
| 1373 | Ga0070679_100554707 | |||
| 1374 | Ga0070684_100000115 | |||
| 1375 | Ga0070684_100003345 | |||
| 1376 | Ga0070684_100007884 | |||
| 1377 | Ga0070684_100015096 | |||
| 1378 | Ga0070684_100030457 | |||
| 1379 | Ga0070684_100037127 | |||
| 1380 | Ga0070684_100178706 | |||
| 1381 | Ga0070684_100271920 | |||
| 1382 | Ga0070684_100361451 | |||
| 1383 | Ga0070697_100000375 | |||
| 1384 | Ga0070697_100001730 | |||
| 1385 | Ga0070697_100004705 | |||
| 1386 | Ga0070697_100010820 | |||
| 1387 | Ga0070697_100025499 | |||
| 1388 | Ga0070697_100141217 | |||
| 1389 | Ga0070697_100180247 | |||
| 1390 | Ga0070697_100237324 | |||
| 1391 | Ga0068853_100015287 | |||
| 1392 | Ga0068853_100039653 | |||
| 1393 | Ga0068853_100058982 | |||
| 1394 | Ga0068853_100065296 | |||
| 1395 | Ga0068853_100080658 | |||
| 1396 | Ga0068853_100092585 | |||
| 1397 | Ga0068853_100206965 | |||
| 1398 | Ga0068853_100232463 | |||
| 1399 | Ga0068853_100274093 | |||
| 1400 | Ga0070672_100023140 | |||
| 1401 | Ga0070672_100131779 | |||
| 1402 | Ga0070686_100052240 | |||
| 1403 | Ga0070696_100000202 | |||
| 1404 | Ga0070696_100018135 | |||
| 1405 | Ga0070696_100242265 | |||
| 1406 | Ga0070693_100043953 | |||
| 1407 | Ga0070665_100003957 | |||
| 1408 | Ga0070665_100115173 | |||
| 1409 | Ga0070665_100425699 | |||
| 1410 | Ga0070704_100027151 | |||
| 1411 | Ga0068855_100001610 | |||
| 1412 | Ga0068855_100001802 | |||
| 1413 | Ga0068855_100001938 | |||
| 1414 | Ga0068855_100005500 | |||
| 1415 | Ga0068855_100006862 | |||
| 1416 | Ga0068855_100009417 | |||
| 1417 | Ga0068855_100012497 | |||
| 1418 | Ga0068855_100013448 | |||
| 1419 | Ga0068855_100017232 | |||
| 1420 | Ga0068855_100023744 | |||
| 1421 | Ga0068855_100025908 | |||
| 1422 | Ga0068855_100058499 | |||
| 1423 | Ga0068855_100069512 | |||
| 1424 | Ga0068855_100231622 | |||
| 1425 | Ga0068855_100531844 | |||
| 1426 | Ga0070664_100000499 | |||
| 1427 | Ga0070664_100006593 | |||
| 1428 | Ga0070664_100051359 | |||
| 1429 | Ga0070664_100071370 | |||
| 1430 | Ga0068857_100000884 | |||
| 1431 | Ga0068857_100002702 | |||
| 1432 | Ga0068857_100004174 | |||
| 1433 | Ga0068857_100007990 | |||
| 1434 | Ga0068857_100018004 | |||
| 1435 | Ga0068857_100027347 | |||
| 1436 | Ga0068857_100036054 | |||
| 1437 | Ga0068857_100058361 | |||
| 1438 | Ga0068857_100099880 | |||
| 1439 | Ga0068857_100163120 | |||
| 1440 | Ga0068854_100008746 | |||
| 1441 | Ga0068854_100060620 | |||
| 1442 | Ga0068854_100066029 | |||
| 1443 | Ga0068854_100100176 | |||
| 1444 | Ga0068856_100001233 | |||
| 1445 | Ga0068856_100002050 | |||
| 1446 | Ga0068856_100003730 | |||
| 1447 | Ga0068856_100003905 | |||
| 1448 | Ga0068856_100010421 | |||
| 1449 | Ga0068856_100013027 | |||
| 1450 | Ga0068856_100018796 | |||
| 1451 | Ga0068856_100021486 | |||
| 1452 | Ga0068856_100030837 | |||
| 1453 | Ga0068856_100042666 | |||
| 1454 | Ga0068856_100053309 | |||
| 1455 | Ga0068856_100055393 | |||
| 1456 | Ga0068856_100196198 | |||
| 1457 | Ga0068856_100202616 | |||
| 1458 | Ga0068856_100245160 | |||
| 1459 | Ga0068856_100301638 | |||
| 1460 | Ga0068852_100000816 | |||
| 1461 | Ga0068852_100011156 | |||
| 1462 | Ga0068852_100014842 | |||
| 1463 | Ga0068852_100022648 | |||
| 1464 | Ga0068852_100069354 | |||
| 1465 | Ga0068852_100079235 | |||
| 1466 | Ga0068852_100123125 | |||
| 1467 | Ga0068859_100004449 | |||
| 1468 | Ga0068859_100007294 | |||
| 1469 | Ga0068859_100009277 | |||
| 1470 | Ga0068859_100014487 | |||
| 1471 | Ga0068859_100056588 | |||
| 1472 | Ga0068859_100131664 | |||
| 1473 | Ga0068864_100000671 | |||
| 1474 | Ga0068864_100054754 | |||
| 1475 | Ga0068864_100127589 | |||
| 1476 | Ga0068864_100167173 | |||
| 1477 | Ga0068864_100248679 | |||
| 1478 | Ga0068866_10076147 | |||
| 1479 | Ga0068866_10078232 | |||
| 1480 | Ga0068866_10154667 | |||
| 1481 | Ga0068861_100043251 | |||
| 1482 | Ga0068861_100058352 | |||
| 1483 | Ga0068861_100059942 | |||
| 1484 | Ga0068861_100297038 | |||
| 1485 | Ga0068861_100358082 | |||
| 1486 | Ga0068851_10122850 | |||
| 1487 | Ga0068863_100001213 | |||
| 1488 | Ga0068863_100008903 | |||
| 1489 | Ga0068863_100022134 | |||
| 1490 | Ga0068863_100058107 | |||
| 1491 | Ga0068863_100153220 | |||
| 1492 | Ga0068858_100001221 | |||
| 1493 | Ga0068858_100010124 | |||
| 1494 | Ga0068858_100010190 | |||
| 1495 | Ga0068858_100025559 | |||
| 1496 | Ga0068858_100036648 | |||
| 1497 | Ga0068860_100004364 | |||
| 1498 | Ga0068860_100005498 | |||
| 1499 | Ga0068860_100021845 | |||
| 1500 | Ga0068860_100165878 | |||
| 1501 | Ga0068862_100017239 | |||
| 1502 | Ga0068862_100071958 | |||
| 1503 | Ga0081455_10004058 | |||
| 1504 | Ga0081539_10004502 | |||
| 1505 | Ga0081539_10071357 | |||
| 1506 | Ga0070717_10007177 | |||
| 1507 | Ga0070717_10008742 | |||
| 1508 | Ga0070717_10009346 | |||
| 1509 | Ga0070717_10014111 | |||
| 1510 | Ga0070717_10028405 | |||
| 1511 | Ga0070717_10045872 | |||
| 1512 | Ga0070717_10069424 | |||
| 1513 | Ga0070717_10083645 | |||
| 1514 | Ga0070717_10214515 | |||
| 1515 | Ga0070717_10417332 | |||
| 1516 | Ga0070716_100000492 | |||
| 1517 | Ga0070716_100013677 | |||
| 1518 | Ga0070716_100014511 | |||
| 1519 | Ga0070716_100088062 | |||
| 1520 | Ga0070712_100001995 | |||
| 1521 | Ga0070712_100004983 | |||
| 1522 | Ga0070712_100017275 | |||
| 1523 | Ga0070712_100023272 | |||
| 1524 | Ga0070712_100049714 | |||
| 1525 | Ga0097621_100000429 | |||
| 1526 | Ga0097621_100004346 | |||
| 1527 | Ga0097621_100008381 | |||
| 1528 | Ga0097621_100015622 | |||
| 1529 | Ga0097621_100027845 | |||
| 1530 | Ga0097621_100071374 | |||
| 1531 | Ga0097621_100085534 | |||
| 1532 | Ga0097621_100114210 | |||
| 1533 | Ga0097621_100156816 | |||
| 1534 | Ga0068871_100000253 | |||
| 1535 | Ga0068871_100002905 | |||
| 1536 | Ga0068871_100009225 | |||
| 1537 | Ga0068871_100022924 | |||
| 1538 | Ga0068871_100031711 | |||
| 1539 | Ga0068871_100036856 | |||
| 1540 | Ga0068871_100052344 | |||
| 1541 | Ga0068871_100088363 | |||
| 1542 | Ga0068871_100147997 | |||
| 1543 | Ga0068871_100165984 | |||
| 1544 | Ga0068871_100267574 | |||
| 1545 | Ga0075428_100267437 | |||
| 1546 | Ga0075431_100095635 | |||
| 1547 | Ga0075431_100222745 | |||
| 1548 | Ga0075431_100271673 | |||
| 1549 | Ga0075433_10022514 | |||
| 1550 | Ga0075433_10139851 | |||
| 1551 | Ga0075434_100000016 | |||
| 1552 | Ga0075434_100001835 | |||
| 1553 | Ga0075434_100002692 | |||
| 1554 | Ga0075434_100329839 | |||
| 1555 | Ga0075429_100338961 | |||
| 1556 | Ga0068865_100031058 | |||
| 1557 | Ga0068865_100078938 | |||
| 1558 | Ga0068865_100242782 | |||
| 1559 | Ga0068865_100262008 | |||
| 1560 | Ga0075436_100000459 | |||
| 1561 | Ga0075436_100026863 | |||
| 1562 | Ga0075436_100139527 | |||
| 1563 | Ga0097620_100004449 | |||
| 1564 | Ga0097620_100007294 | |||
| 1565 | Ga0097620_100009277 | |||
| 1566 | Ga0097620_100014485 | |||
| 1567 | Ga0097620_100056588 | |||
| 1568 | Ga0097620_100131654 | |||
| 1569 | Ga0075435_100000506 | |||
| 1570 | Ga0075435_100021652 | |||
| 1571 | Ga0075435_100082032 | |||
| 1572 | Ga0075435_100098694 | |||
| 1573 | Ga0075435_100144522 | |||
| 1574 | Ga0075435_100199308 | |||
| 1575 | Ga0105240_10000738 | |||
| 1576 | Ga0105240_10000778 | |||
| 1577 | Ga0105240_10003112 | |||
| 1578 | Ga0105240_10004261 | |||
| 1579 | Ga0105240_10005632 | |||
| 1580 | Ga0105240_10008154 | |||
| 1581 | Ga0105240_10015119 | |||
| 1582 | Ga0105240_10032933 | |||
| 1583 | Ga0105240_10037194 | |||
| 1584 | Ga0105240_10050887 | |||
| 1585 | Ga0105240_10081819 | |||
| 1586 | Ga0105240_10089891 | |||
| 1587 | Ga0105240_10114882 | |||
| 1588 | Ga0105240_10223764 | |||
| 1589 | Ga0105240_10268406 | |||
| 1590 | Ga0111539_10244495 | |||
| 1591 | Ga0105245_10000286 | |||
| 1592 | Ga0105245_10015306 | |||
| 1593 | Ga0105245_10022064 | |||
| 1594 | Ga0105245_10037097 | |||
| 1595 | Ga0105245_10209382 | |||
| 1596 | Ga0105245_10228269 | |||
| 1597 | Ga0105245_10463925 | |||
| 1598 | Ga0105247_10059563 | |||
| 1599 | Ga0105247_10195917 | |||
| 1600 | Ga0114129_10083219 | |||
| 1601 | Ga0105243_10012146 | |||
| 1602 | Ga0105243_10197117 | |||
| 1603 | Ga0105241_10002536 | |||
| 1604 | Ga0105241_10012765 | |||
| 1605 | Ga0105241_10015936 | |||
| 1606 | Ga0105241_10030045 | |||
| 1607 | Ga0105241_10035879 | |||
| 1608 | Ga0105241_10036485 | |||
| 1609 | Ga0105241_10045138 | |||
| 1610 | Ga0105241_10074500 | |||
| 1611 | Ga0105241_10150604 | |||
| 1612 | Ga0105241_10359509 | |||
| 1613 | Ga0105242_10007645 | |||
| 1614 | Ga0105242_10016682 | |||
| 1615 | Ga0105242_10032177 | |||
| 1616 | Ga0105242_10043252 | |||
| 1617 | Ga0105242_10082051 | |||
| 1618 | Ga0105248_10009328 | |||
| 1619 | Ga0105248_10037677 | |||
| 1620 | Ga0105248_10045680 | |||
| 1621 | Ga0105248_10053050 | |||
| 1622 | Ga0105248_10075262 | |||
| 1623 | Ga0105248_10097274 | |||
| 1624 | Ga0105248_10190191 | |||
| 1625 | Ga0105248_10191166 | |||
| 1626 | Ga0105248_10353905 | |||
| 1627 | Ga0105248_10709299 | |||
| 1628 | Ga0105237_10001829 | |||
| 1629 | Ga0105237_10009578 | |||
| 1630 | Ga0105237_10027698 | |||
| 1631 | Ga0105237_10029272 | |||
| 1632 | Ga0105237_10096614 | |||
| 1633 | Ga0105237_10132215 | |||
| 1634 | Ga0105237_10172633 | |||
| 1635 | Ga0105237_10263113 | |||
| 1636 | Ga0105237_10459219 | |||
| 1637 | Ga0105238_10011478 | |||
| 1638 | Ga0105238_10013565 | |||
| 1639 | Ga0105238_10054528 | |||
| 1640 | Ga0105238_10066329 | |||
| 1641 | Ga0105238_10091442 | |||
| 1642 | Ga0105238_10112402 | |||
| 1643 | Ga0105238_10142206 | |||
| 1644 | Ga0105238_10254390 | |||
| 1645 | Ga0105249_10010222 | |||
| 1646 | Ga0105249_10085478 | |||
| 1647 | Ga0105249_10109827 | |||
| 1648 | Ga0105249_10490945 | |||
| 1649 | Ga0105239_10006589 | |||
| 1650 | Ga0105239_10027677 | |||
| 1651 | Ga0105239_10126118 | |||
| 1652 | Ga0105239_10154065 | |||
| 1653 | Ga0105239_10177728 | |||
| 1654 | Ga0105239_10233415 | |||
| 1655 | Ga0105239_10353885 | |||
| 1656 | Ga0105246_10005450 | |||
| 1657 | Ga0105246_10032128 | |||
| 1658 | Ga0105246_10084031 | |||
| 1659 | Ga0105246_10221458 | |||
| 1660 | Ga0157373_10003057 | |||
| 1661 | Ga0157373_10145551 | |||
| 1662 | Ga0157373_10155016 | |||
| 1663 | Ga0157371_10010847 | |||
| 1664 | Ga0157371_10214395 | |||
| 1665 | Ga0157371_10246624 | |||
| 1666 | Ga0157370_10000270 | |||
| 1667 | Ga0157370_10000943 | |||
| 1668 | Ga0157370_10004563 | |||
| 1669 | Ga0157370_10005579 | |||
| 1670 | Ga0157370_10025649 | |||
| 1671 | Ga0157369_10001413 | |||
| 1672 | Ga0157369_10001679 | |||
| 1673 | Ga0157369_10002903 | |||
| 1674 | Ga0157369_10004017 | |||
| 1675 | Ga0157369_10008771 | |||
| 1676 | Ga0157369_10016798 | |||
| 1677 | Ga0157369_10017461 | |||
| 1678 | Ga0157369_10054092 | |||
| 1679 | Ga0157369_10086887 | |||
| 1680 | Ga0157369_10087736 | |||
| 1681 | Ga0157369_10114128 | |||
| 1682 | Ga0157369_10124202 | |||
| 1683 | Ga0157369_10191417 | |||
| 1684 | Ga0157369_10238750 | |||
| 1685 | Ga0157369_10251548 | |||
| 1686 | Ga0157374_10000735 | |||
| 1687 | Ga0157374_10000866 | |||
| 1688 | Ga0157374_10003307 | |||
| 1689 | Ga0157374_10011216 | |||
| 1690 | Ga0157374_10019999 | |||
| 1691 | Ga0157374_10020405 | |||
| 1692 | Ga0157374_10020845 | |||
| 1693 | Ga0157374_10068427 | |||
| 1694 | Ga0157374_10345365 | |||
| 1695 | Ga0157374_10424963 | |||
| 1696 | Ga0157378_10000023 | |||
| 1697 | Ga0157378_10000055 | |||
| 1698 | Ga0157378_10000397 | |||
| 1699 | Ga0157378_10037407 | |||
| 1700 | Ga0157378_10058340 | |||
| 1701 | Ga0157378_10065146 | |||
| 1702 | Ga0157378_10077553 | |||
| 1703 | Ga0157378_10104789 | |||
| 1704 | Ga0157378_10127942 | |||
| 1705 | Ga0157378_10129910 | |||
| 1706 | Ga0157378_10135373 | |||
| 1707 | Ga0157378_10138838 | |||
| 1708 | Ga0157378_10179915 | |||
| 1709 | Ga0157378_10185301 | |||
| 1710 | Ga0163162_10002315 | |||
| 1711 | Ga0163162_10002954 | |||
| 1712 | Ga0163162_10004379 | |||
| 1713 | Ga0163162_10023877 | |||
| 1714 | Ga0163162_10092923 | |||
| 1715 | Ga0163162_10095153 | |||
| 1716 | Ga0163162_10120579 | |||
| 1717 | Ga0157372_10000390 | |||
| 1718 | Ga0157372_10000561 | |||
| 1719 | Ga0157372_10009344 | |||
| 1720 | Ga0157372_10010189 | |||
| 1721 | Ga0157372_10027492 | |||
| 1722 | Ga0157372_10029050 | |||
| 1723 | Ga0157372_10031391 | |||
| 1724 | Ga0157372_10050111 | |||
| 1725 | Ga0157372_10112670 | |||
| 1726 | Ga0157372_10238441 | |||
| 1727 | Ga0157372_10256343 | |||
| 1728 | Ga0157372_10284044 | |||
| 1729 | Ga0157372_10461177 | |||
| 1730 | Ga0157375_10001430 | |||
| 1731 | Ga0157375_10001599 | |||
| 1732 | Ga0157375_10005189 | |||
| 1733 | Ga0157375_10090683 | |||
| 1734 | Ga0157375_10174103 | |||
| 1735 | Ga0157375_10236758 | |||
| 1736 | Ga0157375_10245078 | |||
| 1737 | Ga0157375_10277525 | |||
| 1738 | Ga0157375_10311474 | |||
| 1739 | Ga0157375_10332976 | |||
| 1740 | Ga0157375_10413456 | |||
| 1741 | Ga0163163_10001032 | |||
| 1742 | Ga0163163_10005022 | |||
| 1743 | Ga0163163_10026864 | |||
| 1744 | Ga0163163_10064553 | |||
| 1745 | Ga0163163_10087812 | |||
| 1746 | Ga0163163_10095610 | |||
| 1747 | Ga0163163_10104480 | |||
| 1748 | Ga0163163_10106364 | |||
| 1749 | Ga0163163_10107162 | |||
| 1750 | Ga0163163_10124560 | |||
| 1751 | Ga0163163_10147440 | |||
| 1752 | Ga0163163_10306339 | |||
| 1753 | Ga0163163_10361302 | |||
| 1754 | Ga0157380_10068705 | |||
| 1755 | Ga0157380_10133522 | |||
| 1756 | Ga0157377_10000793 | |||
| 1757 | Ga0157379_10267191 | |||
| 1758 | Ga0157376_10017498 | |||
| 1759 | Ga0157376_10020381 | |||
| 1760 | Ga0157376_10064195 | |||
| 1761 | Ga0157376_10166055 | |||
| 1762 | Ga0157376_10221079 | |||
| 1763 | Ga0182006_1015912 | |||
| 1764 | Ga0182007_10004659 | |||
| 1765 | Ga0182007_10037338 | |||
| 1766 | Ga0163161_10000233 | |||
| 1767 | Ga0163161_10031705 | |||
| 1768 | Ga0163161_10154138 | |||
| 1769 | Ga0206356_11613496 | |||
| 1770 | Ga0206352_10973090 | |||
| 1771 | Ga0213875_10000224 | |||
| 1772 | Ga0213875_10001250 | |||
| 1773 | Ga0213875_10006694 | |||
| 1774 | Ga0213875_10006894 | |||
| 1775 | Ga0224570_100652 | |||
| 1776 | Ga0224569_101640 | |||
| 1777 | Ga0224571_101190 | |||
| 1778 | Ga0224572_1000980 | |||
| 1779 | Ga0228598_1000319 | |||
| 1780 | Ga0228598_1006864 | |||
| 1781 | Ga0207697_10101364 | |||
| 1782 | Ga0207682_10010990 | |||
| 1783 | Ga0207692_10002028 | |||
| 1784 | Ga0207692_10011530 | |||
| 1785 | Ga0207692_10075546 | |||
| 1786 | Ga0207642_10022168 | |||
| 1787 | Ga0207688_10002244 | |||
| 1788 | Ga0207688_10017346 | |||
| 1789 | Ga0207680_10008343 | |||
| 1790 | Ga0207680_10016591 | |||
| 1791 | Ga0207680_10027945 | |||
| 1792 | Ga0207680_10107389 | |||
| 1793 | Ga0207680_10119822 | |||
| 1794 | Ga0207647_10002049 | |||
| 1795 | Ga0207647_10007573 | |||
| 1796 | Ga0207647_10039298 | |||
| 1797 | Ga0207685_10000460 | |||
| 1798 | Ga0207685_10058491 | |||
| 1799 | Ga0207699_10012598 | |||
| 1800 | Ga0207699_10025494 | |||
| 1801 | Ga0207645_10002703 | |||
| 1802 | Ga0207643_10002087 | |||
| 1803 | Ga0207643_10219373 | |||
| 1804 | Ga0207705_10156639 | |||
| 1805 | Ga0207705_10178918 | |||
| 1806 | Ga0207684_10001546 | |||
| 1807 | Ga0207684_10003387 | |||
| 1808 | Ga0207684_10003840 | |||
| 1809 | Ga0207684_10024623 | |||
| 1810 | Ga0207684_10071809 | |||
| 1811 | Ga0207684_10110901 | |||
| 1812 | Ga0207684_10174898 | |||
| 1813 | Ga0207684_10265575 | |||
| 1814 | Ga0207654_10000043 | |||
| 1815 | Ga0207654_10001303 | |||
| 1816 | Ga0207654_10003561 | |||
| 1817 | Ga0207654_10010251 | |||
| 1818 | Ga0207654_10034009 | |||
| 1819 | Ga0207654_10040503 | |||
| 1820 | Ga0207654_10095950 | |||
| 1821 | Ga0207707_10006268 | |||
| 1822 | Ga0207707_10010068 | |||
| 1823 | Ga0207707_10010258 | |||
| 1824 | Ga0207707_10023469 | |||
| 1825 | Ga0207707_10024637 | |||
| 1826 | Ga0207707_10049620 | |||
| 1827 | Ga0207707_10061696 | |||
| 1828 | Ga0207707_10067741 | |||
| 1829 | Ga0207707_10073179 | |||
| 1830 | Ga0207707_10225468 | |||
| 1831 | Ga0207707_10275309 | |||
| 1832 | Ga0207695_10000098 | |||
| 1833 | Ga0207695_10001575 | |||
| 1834 | Ga0207695_10003415 | |||
| 1835 | Ga0207695_10003556 | |||
| 1836 | Ga0207695_10005046 | |||
| 1837 | Ga0207695_10005547 | |||
| 1838 | Ga0207695_10008071 | |||
| 1839 | Ga0207695_10008770 | |||
| 1840 | Ga0207695_10023518 | |||
| 1841 | Ga0207695_10038846 | |||
| 1842 | Ga0207695_10047856 | |||
| 1843 | Ga0207695_10067378 | |||
| 1844 | Ga0207695_10073869 | |||
| 1845 | Ga0207695_10093663 | |||
| 1846 | Ga0207671_10000428 | |||
| 1847 | Ga0207671_10007707 | |||
| 1848 | Ga0207671_10023002 | |||
| 1849 | Ga0207671_10036903 | |||
| 1850 | Ga0207671_10065656 | |||
| 1851 | Ga0207671_10090921 | |||
| 1852 | Ga0207671_10287497 | |||
| 1853 | Ga0207693_10002662 | |||
| 1854 | Ga0207693_10012918 | |||
| 1855 | Ga0207693_10015106 | |||
| 1856 | Ga0207693_10016780 | |||
| 1857 | Ga0207693_10183842 | |||
| 1858 | Ga0207693_10282772 | |||
| 1859 | Ga0207663_10011127 | |||
| 1860 | Ga0207663_10045549 | |||
| 1861 | Ga0207663_10063218 | |||
| 1862 | Ga0207663_10090503 | |||
| 1863 | Ga0207663_10155504 | |||
| 1864 | Ga0207663_10176757 | |||
| 1865 | Ga0207663_10181115 | |||
| 1866 | Ga0207660_10009085 | |||
| 1867 | Ga0207660_10018550 | |||
| 1868 | Ga0207660_10085181 | |||
| 1869 | Ga0207660_10141225 | |||
| 1870 | Ga0207660_10186141 | |||
| 1871 | Ga0207662_10001375 | |||
| 1872 | Ga0207657_10002191 | |||
| 1873 | Ga0207657_10002806 | |||
| 1874 | Ga0207657_10008906 | |||
| 1875 | Ga0207657_10088068 | |||
| 1876 | Ga0207657_10275446 | |||
| 1877 | Ga0207649_10000232 | |||
| 1878 | Ga0207649_10000435 | |||
| 1879 | Ga0207649_10016795 | |||
| 1880 | Ga0207649_10018617 | |||
| 1881 | Ga0207649_10076202 | |||
| 1882 | Ga0207649_10084743 | |||
| 1883 | Ga0207652_10009951 | |||
| 1884 | Ga0207652_10027538 | |||
| 1885 | Ga0207652_10067167 | |||
| 1886 | Ga0207652_10133415 | |||
| 1887 | Ga0207652_10136911 | |||
| 1888 | Ga0207652_10167502 | |||
| 1889 | Ga0207652_10184824 | |||
| 1890 | Ga0207652_10363685 | |||
| 1891 | Ga0207646_10000080 | |||
| 1892 | Ga0207646_10001451 | |||
| 1893 | Ga0207646_10001897 | |||
| 1894 | Ga0207646_10077573 | |||
| 1895 | Ga0207646_10178429 | |||
| 1896 | Ga0207681_10014410 | |||
| 1897 | Ga0207681_10152155 | |||
| 1898 | Ga0207694_10000218 | |||
| 1899 | Ga0207694_10001605 | |||
| 1900 | Ga0207694_10004953 | |||
| 1901 | Ga0207694_10005870 | |||
| 1902 | Ga0207694_10010292 | |||
| 1903 | Ga0207694_10030577 | |||
| 1904 | Ga0207694_10030813 | |||
| 1905 | Ga0207694_10096538 | |||
| 1906 | Ga0207694_10148265 | |||
| 1907 | Ga0207694_10201218 | |||
| 1908 | Ga0207650_10000122 | |||
| 1909 | Ga0207650_10005875 | |||
| 1910 | Ga0207650_10047539 | |||
| 1911 | Ga0207650_10304289 | |||
| 1912 | Ga0207659_10025436 | |||
| 1913 | Ga0207659_10056051 | |||
| 1914 | Ga0207659_10118471 | |||
| 1915 | Ga0207659_10448877 | |||
| 1916 | Ga0207687_10001012 | |||
| 1917 | Ga0207687_10004992 | |||
| 1918 | Ga0207687_10009457 | |||
| 1919 | Ga0207687_10034065 | |||
| 1920 | Ga0207687_10069413 | |||
| 1921 | Ga0207687_10121519 | |||
| 1922 | Ga0207687_10249981 | |||
| 1923 | Ga0207700_10011063 | |||
| 1924 | Ga0207700_10260208 | |||
| 1925 | Ga0207664_10006288 | |||
| 1926 | Ga0207664_10031957 | |||
| 1927 | Ga0207664_10063993 | |||
| 1928 | Ga0207664_10101967 | |||
| 1929 | Ga0207664_10116483 | |||
| 1930 | Ga0207664_10171455 | |||
| 1931 | Ga0207664_10300502 | |||
| 1932 | Ga0207644_10009240 | |||
| 1933 | Ga0207644_10016007 | |||
| 1934 | Ga0207644_10111756 | |||
| 1935 | Ga0207644_10402850 | |||
| 1936 | Ga0207690_10036484 | |||
| 1937 | Ga0207690_10090581 | |||
| 1938 | Ga0207706_10004321 | |||
| 1939 | Ga0207706_10004432 | |||
| 1940 | Ga0207706_10025102 | |||
| 1941 | Ga0207686_10012518 | |||
| 1942 | Ga0207686_10039915 | |||
| 1943 | Ga0207686_10055663 | |||
| 1944 | Ga0207686_10079169 | |||
| 1945 | Ga0207709_10043982 | |||
| 1946 | Ga0207670_10014868 | |||
| 1947 | Ga0207670_10241232 | |||
| 1948 | Ga0207704_10003411 | |||
| 1949 | Ga0207704_10055907 | |||
| 1950 | Ga0207704_10148363 | |||
| 1951 | Ga0207665_10001360 | |||
| 1952 | Ga0207665_10005963 | |||
| 1953 | Ga0207665_10011906 | |||
| 1954 | Ga0207665_10018349 | |||
| 1955 | Ga0207665_10143115 | |||
| 1956 | Ga0207665_10145594 | |||
| 1957 | Ga0207691_10050923 | |||
| 1958 | Ga0207711_10000700 | |||
| 1959 | Ga0207711_10009811 | |||
| 1960 | Ga0207711_10026299 | |||
| 1961 | Ga0207711_10037770 | |||
| 1962 | Ga0207711_10040657 | |||
| 1963 | Ga0207711_10041421 | |||
| 1964 | Ga0207711_10050164 | |||
| 1965 | Ga0207711_10104813 | |||
| 1966 | Ga0207711_10107334 | |||
| 1967 | Ga0207711_10150266 | |||
| 1968 | Ga0207711_10176666 | |||
| 1969 | Ga0207711_10220469 | |||
| 1970 | Ga0207689_10000382 | |||
| 1971 | Ga0207689_10045086 | |||
| 1972 | Ga0207689_10213602 | |||
| 1973 | Ga0207661_10000018 | |||
| 1974 | Ga0207661_10004310 | |||
| 1975 | Ga0207661_10012254 | |||
| 1976 | Ga0207661_10012659 | |||
| 1977 | Ga0207661_10061636 | |||
| 1978 | Ga0207661_10174833 | |||
| 1979 | Ga0207661_10212767 | |||
| 1980 | Ga0207661_10429156 | |||
| 1981 | Ga0207679_10000070 | |||
| 1982 | Ga0207679_10010001 | |||
| 1983 | Ga0207679_10024856 | |||
| 1984 | Ga0207679_10032704 | |||
| 1985 | Ga0207679_10087481 | |||
| 1986 | Ga0207679_10173609 | |||
| 1987 | Ga0207679_10205627 | |||
| 1988 | Ga0207667_10001054 | |||
| 1989 | Ga0207667_10003885 | |||
| 1990 | Ga0207667_10004127 | |||
| 1991 | Ga0207667_10005322 | |||
| 1992 | Ga0207667_10005455 | |||
| 1993 | Ga0207667_10006676 | |||
| 1994 | Ga0207667_10012067 | |||
| 1995 | Ga0207667_10012911 | |||
| 1996 | Ga0207667_10045590 | |||
| 1997 | Ga0207667_10072308 | |||
| 1998 | Ga0207667_10156877 | |||
| 1999 | Ga0207667_10225203 | |||
| 2000 | Ga0207667_10227298 | |||
| 2001 | Ga0207667_10265634 | |||
| 2002 | Ga0207667_10328075 | |||
| 2003 | Ga0207651_10000872 | |||
| 2004 | Ga0207651_10068770 | |||
| 2005 | Ga0207651_10127219 | |||
| 2006 | Ga0207651_10309105 | |||
| 2007 | Ga0207712_10059526 | |||
| 2008 | Ga0207712_10139418 | |||
| 2009 | Ga0207712_10160496 | |||
| 2010 | Ga0207668_10097549 | |||
| 2011 | Ga0207640_10016762 | |||
| 2012 | Ga0207640_10075792 | |||
| 2013 | Ga0207640_10081426 | |||
| 2014 | Ga0207640_10103147 | |||
| 2015 | Ga0207640_10105530 | |||
| 2016 | Ga0207658_10022253 | |||
| 2017 | Ga0207677_10003749 | |||
| 2018 | Ga0207677_10019789 | |||
| 2019 | Ga0207677_10024324 | |||
| 2020 | Ga0207677_10030731 | |||
| 2021 | Ga0207677_10098718 | |||
| 2022 | Ga0207703_10008345 | |||
| 2023 | Ga0207703_10009189 | |||
| 2024 | Ga0207703_10014402 | |||
| 2025 | Ga0207703_10021734 | |||
| 2026 | Ga0207703_10027454 | |||
| 2027 | Ga0207703_10123585 | |||
| 2028 | Ga0207703_10169245 | |||
| 2029 | Ga0207703_10452332 | |||
| 2030 | Ga0207639_10011487 | |||
| 2031 | Ga0207639_10012377 | |||
| 2032 | Ga0207639_10034160 | |||
| 2033 | Ga0207639_10052420 | |||
| 2034 | Ga0207639_10142412 | |||
| 2035 | Ga0207639_10173793 | |||
| 2036 | Ga0207639_10258071 | |||
| 2037 | Ga0207639_10492927 | |||
| 2038 | Ga0207678_10003533 | |||
| 2039 | Ga0207702_10000660 | |||
| 2040 | Ga0207702_10002946 | |||
| 2041 | Ga0207702_10004480 | |||
| 2042 | Ga0207702_10010432 | |||
| 2043 | Ga0207702_10010767 | |||
| 2044 | Ga0207702_10012076 | |||
| 2045 | Ga0207702_10013371 | |||
| 2046 | Ga0207702_10028314 | |||
| 2047 | Ga0207702_10044070 | |||
| 2048 | Ga0207702_10069124 | |||
| 2049 | Ga0207702_10128337 | |||
| 2050 | Ga0207702_10130104 | |||
| 2051 | Ga0207702_10156755 | |||
| 2052 | Ga0207702_10406374 | |||
| 2053 | Ga0207641_10000020 | |||
| 2054 | Ga0207641_10001395 | |||
| 2055 | Ga0207641_10008398 | |||
| 2056 | Ga0207641_10013337 | |||
| 2057 | Ga0207641_10015798 | |||
| 2058 | Ga0207641_10046732 | |||
| 2059 | Ga0207641_10047976 | |||
| 2060 | Ga0207641_10287108 | |||
| 2061 | Ga0207641_10392093 | |||
| 2062 | Ga0207648_10060856 | |||
| 2063 | Ga0207648_10161030 | |||
| 2064 | Ga0207648_10202165 | |||
| 2065 | Ga0207648_10222962 | |||
| 2066 | Ga0207676_10000101 | |||
| 2067 | Ga0207676_10006392 | |||
| 2068 | Ga0207676_10075849 | |||
| 2069 | Ga0207676_10185360 | |||
| 2070 | Ga0207674_10002444 | |||
| 2071 | Ga0207674_10006072 | |||
| 2072 | Ga0207674_10008451 | |||
| 2073 | Ga0207674_10012608 | |||
| 2074 | Ga0207674_10016816 | |||
| 2075 | Ga0207674_10023066 | |||
| 2076 | Ga0207674_10026189 | |||
| 2077 | Ga0207674_10027266 | |||
| 2078 | Ga0207674_10045660 | |||
| 2079 | Ga0207674_10114366 | |||
| 2080 | Ga0207674_10331652 | |||
| 2081 | Ga0207675_100018648 | |||
| 2082 | Ga0207675_100025755 | |||
| 2083 | Ga0207675_100041040 | |||
| 2084 | Ga0207675_100079523 | |||
| 2085 | Ga0207683_10006839 | |||
| 2086 | Ga0207698_10000762 | |||
| 2087 | Ga0207698_10012473 | |||
| 2088 | Ga0207698_10022675 | |||
| 2089 | Ga0207698_10087614 | |||
| 2090 | Ga0207698_10125094 | |||
| 2091 | Ga0207698_10487371 | |||
| 2092 | Ga0268266_10015357 | |||
| 2093 | Ga0268266_10151128 | |||
| 2094 | Ga0268266_10180550 | |||
| 2095 | Ga0268266_10186943 | |||
| 2096 | Ga0268265_10054954 | |||
| 2097 | Ga0268265_10066384 | |||
| 2098 | Ga0268265_10116131 | |||
| 2099 | Ga0268265_10245809 | |||
| 2100 | Ga0268264_10004196 | |||
| 2101 | Ga0268264_10041709 | |||
| 2102 | Ga0268264_10049947 | |||
| 2103 | Ga0268264_10102172 | |||
| 2104 | Ga0268264_10132777 | |||
| 2105 | Ga0265326_10013329 | |||
| 2106 | Ga0265323_10033392 | |||
| 2107 | Ga0265338_10016017 | |||
| 2108 | Ga0265338_10021507 | |||
| 2109 | Ga0265338_10026484 | |||
| 2110 | Ga0265338_10048161 | |||
| 2111 | Ga0265338_10226273 | |||
| 2112 | Ga0265324_10005661 | |||
| 2113 | Ga0265762_1000551 | |||
| 2114 | Ga0265760_10000020 | |||
| 2115 | Ga0265760_10004749 | |||
| 2116 | Ga0265760_10005052 | |||
| 2117 | Ga0265760_10005330 | |||
| 2118 | Ga0265760_10032052 | |||
| 2119 | Ga0265330_10001456 | |||
| 2120 | Ga0265330_10027320 | |||
| 2121 | Ga0265328_10008799 | |||
| 2122 | Ga0265325_10001034 | |||
| 2123 | Ga0265325_10002055 | |||
| 2124 | Ga0265325_10013014 | |||
| 2125 | Ga0265325_10022498 | |||
| 2126 | Ga0265329_10036646 | |||
| 2127 | Ga0265340_10006128 | |||
| 2128 | Ga0265340_10008558 | |||
| 2129 | Ga0265340_10016745 | |||
| 2130 | Ga0265340_10066705 | |||
| 2131 | Ga0265339_10000100 | |||
| 2132 | Ga0265339_10000877 | |||
| 2133 | Ga0265339_10002548 | |||
| 2134 | Ga0265339_10020822 | |||
| 2135 | Ga0265339_10021865 | |||
| 2136 | Ga0265339_10042430 | |||
| 2137 | Ga0265331_10025225 | |||
| 2138 | Ga0265316_10000820 | |||
| 2139 | Ga0265316_10003118 | |||
| 2140 | Ga0265316_10007789 | |||
| 2141 | Ga0265316_10008025 | |||
| 2142 | Ga0265316_10025371 | |||
| 2143 | Ga0265316_10038896 | |||
| 2144 | Ga0265316_10225993 | |||
| 2145 | Ga0307513_10008524 | |||
| 2146 | Ga0307408_100009490 | |||
| 2147 | Ga0307408_100131557 | |||
| 2148 | Ga0307408_100337640 | |||
| 2149 | Ga0265313_10002559 | |||
| 2150 | Ga0265313_10017364 | |||
| 2151 | Ga0265314_10000139 | |||
| 2152 | Ga0265314_10001920 | |||
| 2153 | Ga0265314_10002227 | |||
| 2154 | Ga0265314_10042495 | |||
| 2155 | Ga0265314_10058385 | |||
| 2156 | Ga0265314_10110914 | |||
| 2157 | Ga0265342_10002531 | |||
| 2158 | Ga0265342_10003095 | |||
| 2159 | Ga0265342_10012874 | |||
| 2160 | Ga0265342_10016085 | |||
| 2161 | Ga0307405_10097869 | |||
| 2162 | Ga0307413_10005431 | |||
| 2163 | Ga0307413_10133310 | |||
| 2164 | Ga0307413_10301133 | |||
| 2165 | Ga0307410_10001454 | |||
| 2166 | Ga0307410_10016540 | |||
| 2167 | Ga0307410_10020884 | |||
| 2168 | Ga0307410_10161218 | |||
| 2169 | Ga0307406_10035640 | |||
| 2170 | Ga0307406_10081297 | |||
| 2171 | Ga0307406_10091169 | |||
| 2172 | Ga0307407_10038813 | |||
| 2173 | Ga0307407_10084730 | |||
| 2174 | Ga0307412_10021387 | |||
| 2175 | Ga0307409_100002046 | |||
| 2176 | Ga0307409_100014535 | |||
| 2177 | Ga0307409_100052207 | |||
| 2178 | Ga0307416_100002239 | |||
| 2179 | Ga0307416_100016565 | |||
| 2180 | Ga0307416_100089548 | |||
| 2181 | Ga0307416_100291023 | |||
| 2182 | Ga0307416_100435448 | |||
| 2183 | Ga0307411_10001147 | |||
| 2184 | Ga0307411_10005428 | |||
| 2185 | Ga0307411_10033347 | |||
| 2186 | Ga0307415_100006399 | |||
| 2187 | Ga0307415_100006710 | |||
| 2188 | Ga0307415_100021261 | |||
| 2189 | Ga0373932_0013717 | |||
| 2190 | Ga0373936_0032602 | |||
| 2191 | Ga0373939_0056796 | |||
| 2192 | Ga0373939_0060506 | |||
| 2193 | Ga0373945_0012389 | |||
| 2194 | Ga0373953_0051166 | |||
| 2195 | Ga0373953_0074263 | |||
| 2196 | Ga0373954_0029526 | |||
| 2197 | Ga0373956_0017573 | |||
| 2198 | Ga0373956_0125773 | |||
| 2199 | Ga0373957_0046562 | |||
| 2200 | Ga0373943_0039718 | |||
| 2201 | Ga0373946_0075239 | |||
| 2202 | Ga0373955_0052299 | |||
| 2203 | Ga0373924_0090456 | |||
| 2204 | Ga0373931_0006415 | |||
| 2205 | Ga0373931_0109183 | |||
| 2206 | Ga0373935_0012290 | |||
| 2207 | Ga0373935_0073693 | |||
| 2208 | Ga0373935_0077306 | |||
| 2209 | Ga0373927_0006491 | |||
| 2210 | Ga0373927_0017636 | |||
| 2211 | Ga0373927_0065722 | |||
| 2212 | Ga0373927_0074362 | |||
| 2213 | Ga0373927_0091486 | |||
| 2214 | Ga0373927_0130458 | |||
| 2215 | Ga0373927_0185842 | |||
| 2216 | Ga0373933_0010373 | |||
| 2217 | Ga0373933_0032007 | |||
| 2218 | Ga0373933_0047687 | |||
| 2219 | Ga0373933_0140126 | |||
| 2220 | Ga0373947_0000309 | |||
| 2221 | Ga0373947_0006461 | |||
| 2222 | Ga0373947_0010161 | |||
| 2223 | Ga0373947_0100789 | |||
| 2224 | Ga0373947_0155396 | |||
| 2225 | Ga0373937_0009225 | |||
| 2226 | Ga0373937_0027166 | |||
| 2227 | Ga0373937_0031570 | |||
| 2228 | Ga0373937_0033016 | |||
| 2229 | Ga0373937_0115427 | |||
| 2230 | Ga0373937_0117003 | |||
| 2231 | Ga0373937_0162940 | |||
| 2232 | Ga0373937_0192194 | |||
| 2233 | Ga0373937_0371999 | |||
| 2234 | Ga0373925_0000062 | |||
| 2235 | Ga0373925_0003096 | |||
| 2236 | Ga0373925_0004264 | |||
| 2237 | Ga0373925_0008239 | |||
| 2238 | Ga0373925_0070171 | |||
| 2239 | Ga0373925_0227451 | |||
| 2240 | Ga0373925_0239784 | |||
| 2241 | Ga0373925_0417484 | |||
| 2242 | Ga0395899_0197988 | |||
| 2243 | Ga0395898_0029045 | |||
| 2244 | Ga0395905_0249473 | |||
| 2245 | Ga0436364_0041522 | |||
| 2246 | Ga0436364_0275010 | |||
| 2247 | Ga0436364_0278679 | |||
| 2248 | Ga0436364_0329249 | |||
| 2249 | Ga0436364_0528118 | |||
| 2250 | Ga0436364_0589860 | |||
| 2251 | Ga0436364_0865140 | |||
| 2252 | Ga0436364_1006074 | |||
| 2253 | Ga0436364_1103378 | |||
| 2254 | Ga0436364_1200694 | |||
| 2255 | Ga0436364_1267343 | |||
| 2256 | Ga0436364_1304135 | |||
| 2257 | Ga0436364_1358885 | |||
| 2258 | Ga0436364_1389561 | |||
| 2259 | Ga0436364_1463703 | |||
| 2260 | Ga0395901_0242422 | |||
| 2261 | Ga0395901_0438732 | |||
| 2262 | Ga0436365_0106341 | |||
| 2263 | Ga0436365_0856530 | |||
| 2264 | Ga0436365_1198256 | |||
| 2265 | Ga0436365_1769788 | |||
| 2266 | Ga0436360_0364875 | |||
| 2267 | Ga0436360_1008170 | |||
| 2268 | Ga0436361_0167783 | |||
| 2269 | Ga0436361_0700432 | |||
| 2270 | Ga0436363_0296278 | |||
| 2271 | Ga0436363_0816150 | |||
| 2272 | Ga0436363_0879313 | |||
| 2273 | Ga0436363_1227875 | |||
| 2274 | Ga0436362_0578565 | |||
| 2275 | Ga0439449_0085951 | |||
| 2276 | Ga0451577_0000241 | |||
| 2277 | Ga0451577_0018305 | |||
| 2278 | Ga0453683_0008214 | |||
| 2279 | Ga0466963_0006314 | |||
| 2280 | Ga0466963_0008671 | |||
| 2281 | Ga0466963_0182771 | |||
| 2282 | Ga0453684_0000366 | |||
| 2283 | Ga0466971_0100174 | |||
| 2284 | Ga0451576_0027465 | |||
| 2285 | Ga0451576_0061563 | |||
| 2286 | Ga0451576_0078531 | |||
| 2287 | Ga0451576_0117291 | |||
| 2288 | Ga0451576_0341710 | |||
| 2289 | Ga0451576_0515401 | |||
| 2290 | Ga0451576_0528778 | |||
| 2291 | Ga0466958_0130035 | |||
| 2292 | Ga0466967_0005771 | |||
| 2293 | Ga0466967_0068530 | |||
| 2294 | Ga0466967_0098854 | |||
| 2295 | Ga0466967_0111542 | |||
| 2296 | Ga0466967_0113184 | |||
| 2297 | Ga0466967_0316669 | |||
| 2298 | Ga0466967_0636069 | |||
| 2299 | Ga0495592_0212394 | |||
| 2300 | Ga0495629_0179942 | |||
| 2301 | Ga0495651_0111189 | |||
| 2302 | Ga0495653_0089139 | |||
| 2303 | Ga0495580_0000038 | |||
| 2304 | Ga0495580_0000771 | |||
| 2305 | Ga0495580_0003909 | |||
| 2306 | Ga0495580_0005258 | |||
| 2307 | Ga0495580_0005442 | |||
| 2308 | Ga0495580_0007769 | |||
| 2309 | Ga0495580_0010881 | |||
| 2310 | Ga0495580_0017554 | |||
| 2311 | Ga0495580_0038035 | |||
| 2312 | Ga0495580_0040648 | |||
| 2313 | Ga0495580_0065515 | |||
| 2314 | Ga0495580_0234907 | |||
| 2315 | Ga0495582_0001575 | |||
| 2316 | Ga0495582_0040420 | |||
| 2317 | Ga0495582_0055467 | |||
| 2318 | Ga0495664_0013230 | |||
| 2319 | Ga0495664_0044982 | |||
| 2320 | Ga0495584_0031740 | |||
| 2321 | Ga0495608_0132009 | |||
| 2322 | Ga0495628_0004953 | |||
| 2323 | Ga0495628_0173860 | |||
| 2324 | Ga0495630_0073547 | |||
| 2325 | Ga0495630_0085960 | |||
| 2326 | Ga0495630_0102472 | |||
| 2327 | Ga0495652_0059175 | |||
| 2328 | Ga0495652_0159724 | |||
| 2329 | Ga0495665_0003014 | |||
| 2330 | Ga0495665_0030482 | |||
| 2331 | Ga0495665_0062135 | |||
| 2332 | Ga0495640_0076754 | |||
| 2333 | Ga0495587_0021453 | |||
| 2334 | Ga0495587_0025449 | |||
| 2335 | Ga0495587_0109873 | |||
| 2336 | Ga0495598_0001452 | |||
| 2337 | Ga0495645_0016825 | |||
| 2338 | Ga0495667_0051375 | |||
| 2339 | Ga0495634_0099834 | |||
| 2340 | Ga0495635_0039684 | |||
| 2341 | Ga0495599_0012056 | |||
| 2342 | Ga0495623_0057093 | |||
| 2343 | Ga0495623_0140296 | |||
| 2344 | Ga0495613_0006434 | |||
| 2345 | Ga0495613_0150029 | |||
| 2346 | Ga0495613_0189116 | |||
| 2347 | Ga0495613_0290411 | |||
| 2348 | Ga0495604_0005315 | |||
| 2349 | Ga0495604_0073657 | |||
| 2350 | Ga0495674_0095406 | |||
| 2351 | Ga0495674_0113793 | |||
| 2352 | Ga0495680_0011036 | |||
| 2353 | Ga0495675_0065301 | |||
| 2354 | Ga0495675_0077323 | |||
| 2355 | Ga0495684_0007910 | |||
| 2356 | Ga0495684_0009609 | |||
| 2357 | Ga0495684_0119962 | |||
| 2358 | Ga0495684_0124302 | |||
| 2359 | Ga0495684_0200619 | |||
| 2360 | Ga0495593_0119900 | |||
| 2361 | Ga0495602_0056593 | |||
| 2362 | Ga0495602_0111976 | |||
| 2363 | Ga0496101_0114838 | |||
| 2364 | Ga0496101_0229073 | |||
| 2365 | Ga0496102_0004607 | |||
| 2366 | Ga0496102_0015409 | |||
| 2367 | Ga0496102_0046845 | |||
| 2368 | Ga0496103_0128254 | |||
| 2369 | Ga0496104_0083236 | |||
| 2370 | Ga0496104_0106105 | |||
| 2371 | Ga0496104_0270201 | |||
| 2372 | Ga0496105_0102309 | |||
| 2373 | Ga0496105_0343597 | |||
| 2374 | Ga0496106_0122233 | |||
| 2375 | Ga0496108_0000559 | |||
| 2376 | Ga0496109_0000018 | |||
| 2377 | Ga0496109_0582184 | |||
| 2378 | Ga0496110_0000049 | |||
| 2379 | Ga0496110_0178359 | |||
| 2380 | Ga0496110_0420151 | |||
| 2381 | Ga0496111_0014257 | |||
| 2382 | Ga0496111_0190078 | |||
| 2383 | Ga0496112_0000058 | |||
| 2384 | Ga0496112_0003222 | |||
| 2385 | Ga0496112_0014639 | |||
| 2386 | Ga0496112_0016978 | |||
| 2387 | Ga0496112_0065182 | |||
| 2388 | Ga0496112_0099272 | |||
| 2389 | Ga0496112_0143490 | |||
| 2390 | Ga0496112_0249967 | |||
| 2391 | Ga0496112_0413010 | |||
| 2392 | Ga0496113_0000640 | |||
| 2393 | Ga0496114_0058188 | |||
| 2394 | Ga0496115_0005832 | |||
| 2395 | Ga0496115_0083856 | |||
| 2396 | Ga0496115_0182321 | |||
| 2397 | Ga0501297_009917 | |||
| 2398 | Ga0501031_0001940 | |||
| 2399 | Ga0501032_0004389 | |||
| 2400 | Ga0501033_0004620 | |||
| 2401 | Ga0501034_0007144 | |||
| 2402 | Ga0501036_0000288 | |||
| 2403 | Ga0501037_0006041 | |||
| 2404 | Ga0501038_0033799 | |||
| 2405 | Ga0501043_0002066 | |||
| 2406 | Ga0501046_0001257 | |||
| 2407 | Ga0501047_0052740 | |||
| 2408 | Ga0501067_0018724 | |||
| 2409 | Ga0501068_0009400 | |||
| 2410 | Ga0501069_0002547 | |||
| 2411 | Ga0501070_0033467 | |||
| 2412 | Ga0501070_0120264 | |||
| 2413 | Ga0501072_0000827 | |||
| 2414 | Ga0501073_0005585 | |||
| 2415 | Ga0501074_0210115 | |||
| 2416 | Ga0501076_0012466 | |||
| 2417 | Ga0501077_0017418 | |||
| 2418 | Ga0501225_0034743 | |||
| 2419 | Ga0501245_010258 | |||
| 2420 | Ga0501079_0003815 | |||
| 2421 | Ga0501079_0371613 | |||
| 2422 | Ga0501080_0000940 | |||
| 2423 | Ga0501080_0172866 | |||
| 2424 | Ga0501083_0021177 | |||
| 2425 | Ga0501035_0035229 | |||
| 2426 | Ga0501035_0112503 | |||
| 2427 | Ga0501044_0001320 | |||
| 2428 | Ga0501044_0006259 | |||
| 2429 | Ga0501044_0012356 | |||
| 2430 | Ga0501044_0014266 | |||
| 2431 | Ga0501045_0223052 | |||
| 2432 | nmdc:mga0qj67_142372_c1 | |||
| 2433 | nmdc:mga0qj67_39168_c1 | |||
| 2434 | nmdc:mga06r32_120557_c1 | |||
| 2435 | nmdc:mga06r32_15120_c1 | |||
| 2436 | nmdc:mga06r32_27487_c1 | |||
| 2437 | nmdc:mga06r32_342925_c1 | |||
| 2438 | nmdc:mga08y16_182635_c1 | |||
| 2439 | nmdc:mga0n895_110236_c1 | |||
| 2440 | nmdc:mga0n895_111648_c1 | |||
| 2441 | nmdc:mga0n895_15381_c1 | |||
| 2442 | nmdc:mga0n895_16452_c1 | |||
| 2443 | nmdc:mga0rr50_158012_c1 | |||
| 2444 | nmdc:mga0rr50_65195_c1 | |||
| 2445 | nmdc:mga0rr50_9705_c1 | |||
| 2446 | nmdc:mga08x19_121665_c1 | |||
| 2447 | nmdc:mga08x19_1620_c1 | |||
| 2448 | nmdc:mga08x19_291882_c1 | |||
| 2449 | nmdc:mga08x19_318456_c1 | |||
| 2450 | nmdc:mga08x19_6581_c1 | |||
| 2451 | Ga0495595_0125789 | |||
| 2452 | Ga0495619_0046651 | |||
| 2453 | Ga0500568_0001756 | |||
| 2454 | Ga0501084_0005911 | |||
| 2455 | Ga0587073_0008746 | |||
| 2456 | Ga0587073_0025404 | |||
| 2457 | Ga0587077_018485 | |||
| 2458 | Ga0501082_0000669 | |||
| 2459 | Ga0501082_0049257 | |||
| 2460 | Ga0501082_0071448 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fsi-assembly1.cif.gz_A | the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam | 0.7936 | 39 | 228 |
| 3cb8-assembly1.cif.gz_A | 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate | 0.7731 | 41 | 226 |
| 5v1s-assembly1.cif.gz_A | crystal structure of streptococcus suis suib bound to s-adenosylmethionine | 0.7687 | 33 | 289 |
| 5v1q-assembly1.cif.gz_A | crystal structure of streptococcus suis suib | 0.759 | 33 | 291 |
| 6b4c-assembly9.cif.gz_I | structure of viperin from trichoderma virens | 0.7332 | 34 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57888_1_320_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7898 | 34 | 204 | 3.20.20.70 |
| af_O33183_77_264_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7894 | 36 | 208 | 3.20.20.70 |
| af_Q59026_29_239_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7872 | 39 | 229 | 3.20.20.70 |
| af_P0A9N4_2_246_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7811 | 39 | 227 | 3.20.20.70 |
| af_O69696_93_337_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7791 | 46 | 229 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5XMT7-F1-model_v4 | Radical SAM protein | 0.9877 | 10 | 314 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A2V8FWE1-F1-model_v4 | Radical SAM protein | 0.9871 | 36 | 326 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A3N5XMT7-F1-model_v4 | Radical SAM protein | 0.9782 | 10 | 314 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A519YML2-F1-model_v4 | Radical SAM protein | 0.9775 | 19 | 148 |
GO:0003824
GO:0046872 GO:0051536 |
| AF-A0A7Y4TMD4-F1-model_v4 | Radical SAM protein | 0.9689 | 17 | 275 |
GO:0003824
GO:0046872 GO:0051536 |