F491693

General Info

Members Datasets Scaffolds Average Seq Length
1208 883 638 367

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0267162|Ga0501034_0267162_261_1640
Length 433
Sequence VKNGATSATPTASAASHHRLLSAAMWTPSFAPGYSTQPGKFQARRMGGCRPGNPPALAAAARSIMATHHLLLLPGDGIGPEVMAEVKRVIAFFNNEGGDTFEYEEDLVGGSAYDAHGKAVSDATMKKALAADAVIFGAVGGPKWDGVPYDVRPEAGLLRLRKDLELFANLRPAIVYPALADASSLKRELVEDLNILIVRELTGGVYFGEPKTITDIGNGQKRGVDTQVYDTYEIERIARVAFDLARHRRNKVTSMEKHNVMKSGVLWREVVTATHAREYADVNLEHMLADAGAMQLVRAPKQFDVIVTDNLFGDILSDVAAQLTGSLGMLPSASLGLPDPRSGKRRALYEPVHGSAPDIAGKGIANPIAMLASFAMALRYSFGLGETADRLERAISGVLDKGLRTGDIWTAGHAKIGTTAMGDAILAELSQSA

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
33 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
41 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
42 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
43 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
46 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681786 Brucella suis 92/29 Isolate Unclassified
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
58 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
59 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
60 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
61 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
62 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
63 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
64 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
65 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
66 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
67 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
68 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
69 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
70 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
71 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
72 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
73 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
74 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
75 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
76 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
77 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
78 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
79 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
80 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
81 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
82 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
83 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
84 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
85 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
86 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
87 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
88 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
89 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
90 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
91 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
92 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
93 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
94 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
95 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
96 2643221558 Rhizobium sp. Root149 Isolate Unclassified
97 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
98 2643221568 Rhizobium sp. Root564 Isolate Unclassified
99 2643221582 Rhizobium sp. Root651 Isolate Unclassified
100 2643221599 Rhizobium sp. Root708 Isolate Unclassified
101 2643221607 Rhizobium sp. Root73 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
105 2643221640 Caulobacter sp. Root342 Isolate Unclassified
106 2643221642 Caulobacter sp. Root343 Isolate Unclassified
107 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
108 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
109 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
110 2643221688 Rhizobium sp. Root482 Isolate Unclassified
111 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
112 2643221718 Rhizobium sp. Root268 Isolate Unclassified
113 2643221719 Rhizobium sp. Root274 Isolate Unclassified
114 2643221733 Bosea sp. Root381 Isolate Unclassified
115 2643221736 Bosea sp. Root483D1 Isolate Unclassified
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
118 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
119 2718217882 Rhizobium sp. N741 Isolate Nodule
120 2718217927 Rhizobium sp. N324 Isolate Nodule
121 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
122 2718218009 Rhizobium sp. N561 Isolate Nodule
123 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
124 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
125 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
126 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
127 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
128 2718218363 Rhizobium sp. N113 Isolate Nodule
129 2718218365 Rhizobium sp. N731 Isolate Nodule
130 2718218366 Rhizobium sp. N621 Isolate Nodule
131 2718218423 Rhizobium sp. N941 Isolate Nodule
132 2721755514 Rhizobium sp. N6212 Isolate Nodule
133 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
134 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
135 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
136 2721755809 Rhizobium sp. N541 Isolate Nodule
137 2721755810 Rhizobium sp. N871 Isolate Nodule
138 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
139 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
140 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
141 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
142 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
143 2728369365 Rhizobium sp. N1341 Isolate Nodule
144 2728369397 Rhizobium sp. N1314 Isolate Nodule
145 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
146 2738541293 Rhizobium sp. GV031 Isolate Unclassified
147 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
148 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
149 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
150 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
151 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
152 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
153 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
154 2773857925 Microvirga vignae BR3299 Isolate Unclassified
155 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
156 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
157 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
158 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
159 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
160 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
161 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
162 2791355256 Rhizobium sp. M10 Isolate Nodule
163 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
164 2791355260 Rhizobium sp. L9 Isolate Nodule
165 2791355261 Rhizobium sp. J15 Isolate Nodule
166 2791355262 Rhizobium sp. M1 Isolate Nodule
167 2791355263 Rhizobium chutanense C5 Isolate Nodule
168 2791355264 Rhizobium sp. S9 Isolate Nodule
169 2791355265 Rhizobium sp. H4 Isolate Nodule
170 2791355266 Rhizobium sp. L43 Isolate Nodule
171 2791355267 Rhizobium sp. L18 Isolate Nodule
172 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
173 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
174 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
175 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
176 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
177 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
178 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
179 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
180 2802429633 Rhizobium anhuiense J3 Isolate Nodule
181 2802429634 Rhizobium anhuiense S10 Isolate Nodule
182 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
183 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
184 2802429637 Rhizobium anhuiense C15 Isolate Nodule
185 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
186 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
187 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
188 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
189 2818991467 Bosea vestrisii 3192 Isolate Unclassified
190 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
191 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
192 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
193 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
194 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
195 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
196 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
197 2838048938 Rhizobium pisi 27/80 Isolate Nodule
198 2838061910 Rhizobium phaseoli L15 Isolate Nodule
199 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
200 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
201 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
202 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
203 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
204 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
205 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
206 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
207 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
208 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
209 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
210 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
211 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
212 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
213 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
214 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
215 2841760612 Bosea sp. Tri-49 Isolate Nodule
216 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
217 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
218 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
219 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
220 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
221 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
222 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
223 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
224 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
225 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
226 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
227 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
228 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
229 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
230 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
231 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
232 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
233 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
234 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
235 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
236 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
237 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
238 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
239 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
240 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
241 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
242 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
243 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
244 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
245 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
246 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
247 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
248 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
249 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
250 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
251 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
252 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
253 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
254 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
255 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
256 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
257 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
258 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
259 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
260 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
261 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
262 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
263 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
264 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
265 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
266 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
267 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
268 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
269 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
270 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
271 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
272 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
273 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
274 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
275 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
276 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
277 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
278 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
279 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
280 2844104063 Bosea sp. Tri-39 Isolate Nodule
281 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
282 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
283 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
284 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
285 2851182111 Bosea sp. Tri-44 Isolate Nodule
286 2851246043 Bosea sp. Tri-54 Isolate Nodule
287 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
288 2854911287 Brucella lupini LUP21 Isolate Unclassified
289 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
290 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
291 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
292 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
293 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
294 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
295 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
296 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
297 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
298 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
299 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
300 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
301 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
302 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
303 2902330777 Methylobacterium sp. 2A Isolate Unclassified
304 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
305 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
306 2909042592 Labrys sp. LIt4 Isolate Nodule
307 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
308 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
309 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
310 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
311 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
312 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
313 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
314 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
315 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
316 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
317 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
318 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
319 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
320 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
321 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
322 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
323 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
324 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
325 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
326 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
327 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
328 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
329 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
330 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
331 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
332 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
333 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
334 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
335 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
336 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
337 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
338 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
339 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
340 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
341 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
342 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
343 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
344 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
345 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
346 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
347 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
348 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
349 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
350 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
351 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
352 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
353 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
354 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
355 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
356 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
357 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
358 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
359 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
360 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
361 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
362 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
363 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
364 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
365 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
366 2933599457 Rhizobium phaseoli M3 Isolate Nodule
367 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
368 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
369 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
370 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
371 2936381700 Rhizobium chutanense C16 Isolate Unclassified
372 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
373 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
374 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
375 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
376 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
377 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
378 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
379 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
380 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
381 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
382 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
383 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
384 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
385 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
386 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
387 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
388 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
389 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
390 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
391 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
392 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
393 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
394 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
395 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
396 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
397 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
398 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
399 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
400 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
401 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
402 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
403 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
404 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
405 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
406 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
407 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
408 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
409 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
410 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
411 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
412 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
413 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
414 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
415 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
416 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
417 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
418 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
419 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
420 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
421 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
422 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
423 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
424 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
425 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
426 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
427 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
428 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
429 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
430 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
431 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
432 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
433 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
434 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
435 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
436 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
437 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
438 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
439 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
440 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
441 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
442 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
443 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
444 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
445 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
446 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
447 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
448 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
449 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
450 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
451 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
452 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
453 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
454 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
455 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
456 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
457 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
458 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
459 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
460 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
461 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
462 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
463 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
464 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
465 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
466 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
467 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
468 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
469 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
470 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
471 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
472 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
473 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
474 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
475 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
476 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
477 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
478 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
479 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
480 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
481 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
482 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
483 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
484 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
485 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
486 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
487 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
488 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
489 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
490 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
491 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
492 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
493 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
494 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
495 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
496 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
497 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
498 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
499 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
500 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
501 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
502 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
503 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
504 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
505 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
506 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
507 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
508 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
509 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
510 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
511 2996887358 Rhizobium sp. R711 Isolate Nodule
512 2996893221 Rhizobium sp. R635 Isolate Nodule
513 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
514 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
515 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
516 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
517 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
518 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
519 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
520 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
521 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
522 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
523 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
524 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
525 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
526 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
527 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
528 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
529 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
530 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
531 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
532 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
533 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
534 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
535 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
536 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
537 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
538 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
539 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
540 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
541 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
542 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
543 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
544 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
545 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
546 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
547 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
548 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
549 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
550 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
551 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
552 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
553 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
554 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
555 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
556 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
557 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
558 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
559 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
560 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
561 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
562 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
563 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
564 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
565 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
566 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
567 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
568 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
569 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
570 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
571 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
572 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
573 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
574 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
575 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
576 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
577 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
578 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
579 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
580 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
581 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
582 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
583 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
584 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
585 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
586 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
587 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
588 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
589 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
590 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
591 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
592 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
593 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
594 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
595 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
596 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
597 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
598 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
599 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
600 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
601 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
602 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
603 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
604 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
605 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
606 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
607 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
608 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
609 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
610 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
611 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
612 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
613 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
614 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
615 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
616 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
617 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
618 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
619 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
620 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
621 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
622 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
623 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
624 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
626 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
627 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
628 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
629 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
630 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
631 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
632 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
633 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
638 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
639 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
640 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
641 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
644 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
645 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
646 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
647 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
648 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
649 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
650 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
651 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
652 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
653 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
655 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
656 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
657 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
658 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
659 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
660 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
661 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
662 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
663 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
664 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
665 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
666 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
667 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
668 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
669 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
670 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
671 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
672 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
673 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
674 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
675 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
676 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
677 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
678 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
679 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
680 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
681 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
682 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
683 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
684 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
685 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
686 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
687 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
688 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
689 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
690 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
691 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
692 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
693 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
694 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
695 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
696 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
697 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
698 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
699 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
700 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
701 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
702 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
703 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
704 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
705 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
706 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
707 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
708 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
709 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
710 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
711 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
712 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
713 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
714 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
715 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
716 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
717 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
718 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
719 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
720 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
721 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
722 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
723 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
724 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
725 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
726 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
727 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
728 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
729 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
730 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
731 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
732 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
733 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
734 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
735 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
736 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
737 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
738 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
739 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
740 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
741 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
742 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
743 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
744 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
745 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
746 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
747 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
748 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
749 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
750 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
751 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
752 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
753 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
754 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
755 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
756 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
757 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
758 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
759 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
760 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
761 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
762 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
763 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
764 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
765 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
766 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
767 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
768 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
769 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
770 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
771 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
772 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
773 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
774 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
775 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
776 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
777 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
778 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
779 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
780 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
781 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
782 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
783 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
784 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
785 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
786 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
787 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
788 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
789 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
790 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
791 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
792 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
793 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
794 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
795 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
796 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
797 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
798 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
799 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
800 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
801 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
802 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
803 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
804 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
805 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
806 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
807 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
808 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
809 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
810 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
811 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
812 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
813 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
814 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
815 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
816 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
817 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
818 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
819 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
820 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
821 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
822 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
823 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
824 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
825 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
826 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
827 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
828 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
829 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
830 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
831 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
832 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
833 641522639 Methylobacterium sp. 4-46 Isolate Nodule
834 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
835 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
836 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
837 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
838 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
839 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
840 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
841 8005258706 Rhizobium sp. R693 Isolate Nodule
842 8005275841 Rhizobium sp. N4311 Isolate Nodule
843 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
844 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
845 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
846 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
847 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
848 8005321885 Rhizobium sp. R72 Isolate Nodule
849 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
850 8005382845 Rhizobium sp. R634 Isolate Nodule
851 8005395548 Rhizobium sp. R339 Isolate Nodule
852 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
853 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
854 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
855 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
856 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
857 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
858 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
859 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
860 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
861 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
862 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
863 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
864 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
865 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
866 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
867 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
868 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
869 8018176218 Rhizobium sp. N122 Isolate Nodule
870 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
871 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
872 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
873 8024501048 Rhizobium sp. H4 Isolate Nodule
874 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
875 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
876 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
877 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
878 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
879 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
880 8056382006 Rhizobium croatiense 13T Isolate Nodule
881 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
882 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
883 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.73
Metatranscriptomes 0.08
Isolates 47.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 14.4
Nodule 36.42
Rhizoplane 3.06
Rhizosphere 30.71
Stem 0
Stem Tuber 0
Unclassified 14.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004991 3300001979 Bacteria 5638
2 JGI25156J39149_1000770 3300002705 Bacteria 16645
3 JGI25162J39368_1000253 3300002737 Bacteria 51894
4 JGI25162J39368_1000485 3300002737 Bacteria 30412
5 JGI25154J39366_1000069 3300002738 Bacteria 96438
6 JGI25158J39367_1000014 3300002739 Bacteria 47475
7 JGI25157J39369_1000108 3300002741 Bacteria 69980
8 JGI25152J39213_1000644 3300002773 Bacteria 18485
9 JGI25152J39213_1001505 3300002773 Bacteria 9924
10 JGI25152J39213_1002615 3300002773 Bacteria 6703
11 JGI25152J39213_1006872 3300002773 Bacteria 3015
12 JGI25152J39213_1007167 3300002773 Bacteria 2921
13 JGI25150J39212_1000018 3300002774 Bacteria 146535
14 JGI25150J39212_1006130 3300002774 Bacteria 2510
15 JGI25159J45721_1000388 3300002987 Bacteria 20428
16 JGI25159J45721_1000604 3300002987 Bacteria 16057
17 JGI25151J46595_10000034 3300003187 Bacteria 192271
18 JGI25151J46595_10000939 3300003187 Bacteria 22542
19 JGI25151J46595_10029230 3300003187 Bacteria 2185
20 JGI25406J46586_10047626 3300003203 Bacteria 1459
21 JGI25165J46597_1000536 3300003214 Bacteria 35271
22 JGI25165J46597_1001214 3300003214 Bacteria 15455
23 JGI25165J46597_1004655 3300003214 Bacteria 2870
24 JGI25153J46596_10001791 3300003215 Bacteria 12747
25 JGI25153J46596_10006280 3300003215 Bacteria 6061
26 JGI25153J46596_10016095 3300003215 Bacteria 3015
27 JGI25153J46596_10016737 3300003215 Bacteria 2921
28 JGI25153J46596_10042669 3300003215 Bacteria 1382
29 JGI25160J50197_1000051 3300003354 Bacteria 132923
30 JGI25160J50197_1021530 3300003354 Bacteria 1913
31 JGI25161J50226_1000011 3300003374 Bacteria 210140
32 JGI25161J50226_1000038 3300003374 Bacteria 131804
33 JGI25161J50226_1001915 3300003374 Bacteria 5768
34 Ga0055526_1000291 3300003771 Bacteria 41931
35 Ga0055526_1014670 3300003771 Bacteria 3202
36 Ga0055526_1024598 3300003771 Bacteria 1963
37 Ga0055524_1000068 3300003775 Bacteria 130413
38 Ga0055524_1007723 3300003775 Bacteria 4540
39 Ga0055536_1000569 3300003781 Bacteria 25206
40 Ga0055536_1002919 3300003781 Bacteria 9391
41 Ga0055528_1000884 3300003790 Bacteria 20244
42 Ga0055530_10003609 3300003791 Bacteria 8683
43 Ga0055540_1001428 3300003792 Bacteria 14240
44 Ga0055540_1001541 3300003792 Bacteria 13519
45 Ga0055531_10005829 3300003794 Bacteria 7123
46 Ga0058692_1007084 3300003856 Bacteria 3007
47 Ga0055543_1000041 3300004625 Bacteria 118501
48 Ga0055543_1000317 3300004625 Bacteria 33524
49 Ga0055543_1000416 3300004625 Bacteria 26883
50 Ga0065165_1000135 3300005262 Bacteria 127785
51 Ga0065165_1000143 3300005262 Bacteria 124381
52 Ga0065165_1010220 3300005262 Bacteria 4090
53 Ga0070670_100000711 3300005331 Bacteria 25830
54 Ga0070680_100136044 3300005336 Bacteria 2058
55 Ga0070682_100109642 3300005337 Bacteria 1837
56 Ga0070711_100045468 3300005439 Bacteria 2987
57 Ga0070700_100028466 3300005441 Bacteria 3324
58 Ga0070663_100014911 3300005455 Bacteria 4999
59 Ga0070662_100235372 3300005457 Bacteria 1467
60 Ga0070681_10274978 3300005458 Bacteria 1595
61 Ga0070698_100321141 3300005471 Bacteria 1479
62 Ga0070679_100026302 3300005530 Bacteria 5715
63 Ga0070697_100000401 3300005536 Bacteria 33563
64 Ga0068853_100000639 3300005539 Bacteria 23990
65 Ga0068853_100025986 3300005539 Bacteria 4914
66 Ga0070695_100003726 3300005545 Bacteria 8892
67 Ga0070693_100009265 3300005547 Bacteria 4891
68 Ga0070665_100001650 3300005548 Bacteria 25702
69 Ga0070665_100039375 3300005548 Bacteria 4753
70 Ga0068855_100040752 3300005563 Bacteria 5509
71 Ga0070664_100082344 3300005564 Bacteria 2775
72 Ga0070702_100014888 3300005615 Bacteria 3958
73 Ga0068863_100009117 3300005841 Bacteria 9690
74 Ga0081455_10001273 3300005937 Bacteria 31479
75 Ga0081540_1000012 3300005983 Bacteria 189939
76 Ga0081539_10000690 3300005985 Bacteria 67656
77 Ga0075365_10000401 3300006038 Bacteria 15895
78 Ga0075365_10002608 3300006038 Bacteria 8919
79 Ga0075365_10015844 3300006038 Bacteria 4568
80 Ga0075365_10221104 3300006038 Bacteria 1328
81 Ga0075368_10032369 3300006042 Bacteria 2030
82 Ga0075364_10000006 3300006051 Bacteria 86571
83 Ga0075364_10050131 3300006051 Bacteria 2725
84 Ga0075364_10051049 3300006051 Bacteria 2700
85 Ga0070716_100027093 3300006173 Bacteria 3075
86 Ga0070712_100177143 3300006175 Bacteria 1659
87 Ga0075362_10073512 3300006177 Bacteria 1565
88 Ga0075367_10001646 3300006178 Bacteria 9725
89 Ga0075367_10044097 3300006178 Bacteria 2613
90 Ga0075369_10000585 3300006186 Bacteria 11566
91 Ga0075369_10014152 3300006186 Bacteria 3183
92 Ga0075366_10004332 3300006195 Bacteria 7613
93 Ga0075370_10003721 3300006353 Bacteria 7302
94 Ga0075428_100003200 3300006844 Bacteria 17905
95 Ga0075428_100063506 3300006844 Bacteria 4043
96 Ga0075428_100109140 3300006844 Bacteria 3016
97 Ga0075430_100048860 3300006846 Bacteria 3571
98 Ga0075431_100000003 3300006847 Bacteria 112884
99 Ga0075431_100010527 3300006847 Bacteria 9298
100 Ga0075429_100012151 3300006880 Bacteria 7464
101 Ga0075436_100000298 3300006914 Bacteria 31645
102 Ga0079104_1001513 3300006946 Bacteria 15427
103 Ga0099826_10000089 3300006948 Bacteria 45251
104 Ga0099826_10034388 3300006948 Bacteria 3621
105 Ga0075435_100010189 3300007076 Bacteria 6867
106 Ga0105240_10000142 3300009093 Bacteria 146932
107 Ga0111539_10000504 3300009094 Bacteria 49771
108 Ga0111539_10003050 3300009094 Bacteria 22190
109 Ga0111539_10271925 3300009094 Bacteria 1972
110 Ga0114129_10000062 3300009147 Bacteria 96507
111 Ga0114129_10015821 3300009147 Bacteria 10726
112 Ga0114129_10548344 3300009147 Bacteria 1504
113 Ga0105243_10019587 3300009148 Bacteria 5129
114 Ga0105241_10008271 3300009174 Bacteria 7658
115 Ga0105248_10110705 3300009177 Bacteria 3097
116 Ga0105248_10190440 3300009177 Bacteria 2311
117 Ga0105237_10002652 3300009545 Bacteria 21994
118 Ga0105237_10305489 3300009545 Bacteria 1594
119 Ga0105237_10310905 3300009545 Bacteria 1579
120 Ga0123341_1021682 3300009765 Bacteria 5386
121 Ga0123342_1009626 3300009766 Bacteria 11472
122 Ga0123342_1028163 3300009766 Bacteria 3062
123 Ga0105239_10001079 3300010375 Bacteria 37830
124 Ga0105246_10006247 3300011119 Bacteria 7273
125 Ga0105246_10067150 3300011119 Bacteria 2512
126 Ga0157373_10007198 3300013100 Bacteria 8299
127 Ga0157371_10004378 3300013102 Bacteria 12348
128 Ga0157370_10000079 3300013104 Bacteria 107305
129 Ga0157370_10000855 3300013104 Bacteria 38623
130 Ga0157370_10095710 3300013104 Bacteria 2786
131 Ga0157370_10163666 3300013104 Bacteria 2069
132 Ga0157372_10493487 3300013307 Bacteria 1428
133 Ga0163163_10009451 3300014325 Bacteria 8706
134 Ga0157379_10213175 3300014968 Bacteria 1749
135 Ga0182007_10019600 3300015262 Bacteria 2430
136 Ga0214544_1005528 3300021320 Bacteria 24379
137 Ga0214542_1005348 3300021321 Bacteria 24469
138 Ga0214542_1012986 3300021321 Bacteria 10323
139 Ga0214543_1000015 3300021327 Bacteria 305679
140 Ga0214543_1005096 3300021327 Bacteria 24495
141 Ga0213873_10026351 3300021358 Bacteria 1411
142 Ga0213874_10010562 3300021377 Bacteria 2314
143 Ga0213876_10005281 3300021384 Bacteria 7113
144 Ga0213875_10009375 3300021388 Bacteria 4963
145 Ga0213875_10042001 3300021388 Bacteria 2150
146 Ga0228711_1000004 3300022739 Bacteria 250146
147 Ga0228710_1000002 3300022740 Bacteria 287279
148 Ga0209435_100031 3300025206 Bacteria 164115
149 Ga0209436_100013 3300025208 Bacteria 131492
150 Ga0209672_103539 3300025228 Bacteria 3195
151 Ga0209437_100179 3300025233 Bacteria 134210
152 Ga0209437_100181 3300025233 Bacteria 132953
153 Ga0207425_1000035 3300025245 Bacteria 225942
154 Ga0207425_1004487 3300025245 Bacteria 4170
155 Ga0207425_1009575 3300025245 Bacteria 2402
156 Ga0209646_1000102 3300025246 Bacteria 164115
157 Ga0209646_1004214 3300025246 Bacteria 2651
158 Ga0209026_1000096 3300025250 Bacteria 164115
159 Ga0209677_100455 3300025253 Bacteria 23764
160 Ga0209759_1000090 3300025256 Bacteria 164115
161 Ga0209759_1017442 3300025256 Bacteria 1770
162 Ga0209129_1000029 3300025258 Bacteria 401149
163 Ga0209129_1000050 3300025258 Bacteria 267408
164 Ga0209129_1000377 3300025258 Bacteria 36213
165 Ga0209129_1001450 3300025258 Bacteria 13231
166 Ga0209129_1001464 3300025258 Bacteria 13166
167 Ga0209129_1003105 3300025258 Bacteria 7470
168 Ga0209129_1003160 3300025258 Bacteria 7380
169 Ga0209233_1000185 3300025261 Bacteria 133788
170 Ga0209233_1000212 3300025261 Bacteria 110364
171 Ga0209233_1000445 3300025261 Bacteria 28225
172 Ga0209673_1000033 3300025273 Bacteria 335369
173 Ga0209673_1000050 3300025273 Bacteria 285287
174 Ga0209673_1000476 3300025273 Bacteria 66898
175 Ga0209673_1001553 3300025273 Bacteria 20717
176 Ga0209673_1003936 3300025273 Bacteria 8308
177 Ga0209673_1005022 3300025273 Bacteria 6834
178 Ga0209673_1005150 3300025273 Bacteria 6688
179 Ga0209673_1021903 3300025273 Bacteria 2221
180 Ga0209673_1029073 3300025273 Bacteria 1766
181 Ga0209130_1000009 3300025284 Bacteria 498952
182 Ga0209130_1000058 3300025284 Bacteria 210250
183 Ga0209130_1000342 3300025284 Bacteria 53602
184 Ga0209675_1000819 3300025291 Bacteria 20482
185 Ga0209676_1000169 3300025292 Bacteria 155600
186 Ga0209676_1015294 3300025292 Bacteria 2830
187 Ga0209676_1025353 3300025292 Bacteria 1903
188 Ga0209025_1000132 3300025294 Bacteria 197432
189 Ga0209025_1000453 3300025294 Bacteria 80110
190 Ga0209025_1001274 3300025294 Bacteria 34655
191 Ga0209025_1001429 3300025294 Bacteria 31509
192 Ga0209025_1002399 3300025294 Bacteria 19986
193 Ga0209025_1003718 3300025294 Bacteria 14024
194 Ga0209025_1004205 3300025294 Bacteria 12700
195 Ga0209025_1029766 3300025294 Bacteria 2632
196 Ga0209564_1000041 3300025295 Bacteria 405199
197 Ga0209564_1000065 3300025295 Bacteria 315205
198 Ga0209564_1000227 3300025295 Bacteria 125497
199 Ga0209564_1000284 3300025295 Bacteria 102684
200 Ga0209564_1000894 3300025295 Bacteria 39163
201 Ga0209564_1004855 3300025295 Bacteria 7993
202 Ga0209758_1000255 3300025297 Bacteria 106892
203 Ga0209758_1000406 3300025297 Bacteria 73962
204 Ga0209758_1000563 3300025297 Bacteria 58374
205 Ga0209758_1000780 3300025297 Bacteria 45747
206 Ga0209758_1001039 3300025297 Bacteria 36357
207 Ga0209758_1001297 3300025297 Bacteria 30633
208 Ga0209758_1004746 3300025297 Bacteria 11042
209 Ga0209758_1024172 3300025297 Bacteria 2717
210 Ga0209050_1000281 3300025298 Bacteria 108751
211 Ga0209050_1006418 3300025298 Bacteria 6969
212 Ga0209050_1010967 3300025298 Bacteria 4376
213 Ga0209256_1000014 3300025299 Bacteria 687409
214 Ga0209256_1000266 3300025299 Bacteria 92357
215 Ga0209256_1001149 3300025299 Bacteria 30019
216 Ga0209256_1002933 3300025299 Bacteria 12813
217 Ga0209256_1003784 3300025299 Bacteria 10192
218 Ga0207426_1000041 3300025302 Bacteria 433536
219 Ga0207426_1000131 3300025302 Bacteria 210250
220 Ga0207426_1000214 3300025302 Bacteria 137296
221 Ga0207426_1000798 3300025302 Bacteria 34125
222 Ga0207426_1023075 3300025302 Bacteria 2127
223 Ga0209051_1000118 3300025303 Bacteria 149426
224 Ga0209051_1001684 3300025303 Bacteria 17792
225 Ga0209051_1004711 3300025303 Bacteria 8288
226 Ga0209051_1004805 3300025303 Bacteria 8148
227 Ga0209051_1006782 3300025303 Bacteria 6383
228 Ga0209257_1001639 3300025304 Bacteria 25617
229 Ga0209257_1005651 3300025304 Bacteria 8641
230 Ga0209257_1006038 3300025304 Bacteria 8083
231 Ga0207699_10071266 3300025906 Bacteria 2125
232 Ga0207707_10165371 3300025912 Bacteria 1933
233 Ga0207695_10000234 3300025913 Bacteria 146987
234 Ga0207671_10000043 3300025914 Bacteria 206915
235 Ga0207671_10148460 3300025914 Bacteria 1810
236 Ga0207693_10004461 3300025915 Bacteria 11827
237 Ga0207693_10027984 3300025915 Bacteria 4456
238 Ga0207663_10054708 3300025916 Bacteria 2500
239 Ga0207650_10001757 3300025925 Bacteria 15368
240 Ga0207700_10089252 3300025928 Bacteria 2429
241 Ga0207664_10027534 3300025929 Bacteria 4310
242 Ga0207706_10236763 3300025933 Bacteria 1596
243 Ga0207665_10027798 3300025939 Bacteria 3736
244 Ga0207711_10169391 3300025941 Bacteria 1981
245 Ga0207679_10209680 3300025945 Bacteria 1633
246 Ga0207667_10183250 3300025949 Bacteria 2150
247 Ga0207668_10200000 3300025972 Bacteria 1590
248 Ga0207640_10171870 3300025981 Bacteria 1616
249 Ga0207639_10004015 3300026041 Bacteria 9931
250 Ga0207639_10036187 3300026041 Bacteria 3657
251 Ga0207678_10000231 3300026067 Bacteria 49870
252 Ga0207678_10285375 3300026067 Bacteria 1417
253 Ga0207708_10046003 3300026075 Bacteria 3324
254 Ga0207641_10040375 3300026088 Bacteria 3907
255 Ga0207698_10215155 3300026142 Bacteria 1732
256 Ga0209281_1000030 3300027111 Bacteria 425931
257 Ga0209281_1000144 3300027111 Bacteria 172471
258 Ga0209371_1000037 3300027312 Bacteria 367074
259 Ga0209371_1002602 3300027312 Bacteria 9903
260 Ga0209371_1005786 3300027312 Bacteria 4789
261 Ga0209282_1000004 3300027666 Bacteria 425931
262 Ga0209282_1000960 3300027666 Bacteria 15074
263 Ga0209282_1037870 3300027666 Bacteria 2895
264 Ga0209813_10000521 3300027866 Bacteria 9090
265 Ga0207428_10084061 3300027907 Bacteria 2481
266 Ga0268266_10003484 3300028379 Bacteria 15672
267 Ga0268266_10033539 3300028379 Bacteria 4364
268 Ga0265318_10028340 3300028577 Bacteria 2191
269 Ga0307515_10001049 3300028794 Bacteria 63286
270 Ga0307515_10002808 3300028794 Bacteria 37051
271 Ga0307515_10193442 3300028794 Bacteria 1936
272 Ga0268256_1000039 3300030500 Bacteria 354969
273 Ga0268256_1005001 3300030500 Bacteria 5327
274 Ga0268256_1020498 3300030500 Bacteria 1781
275 Ga0265328_10000806 3300031239 Bacteria 14482
276 Ga0265329_10053172 3300031242 Bacteria 1288
277 Ga0265340_10001914 3300031247 Bacteria 11883
278 Ga0265340_10004381 3300031247 Bacteria 7905
279 Ga0265339_10005618 3300031249 Bacteria 8323
280 Ga0265331_10046737 3300031250 Bacteria 2086
281 Ga0265331_10066213 3300031250 Bacteria 1697
282 Ga0265316_10004581 3300031344 Bacteria 13719
283 Ga0307408_100086903 3300031548 Bacteria 2351
284 Ga0265313_10002093 3300031595 Bacteria 17809
285 Ga0265313_10006036 3300031595 Bacteria 8739
286 Ga0265314_10059431 3300031711 Bacteria 2615
287 Ga0265314_10091592 3300031711 Bacteria 1978
288 Ga0265342_10009718 3300031712 Bacteria 6740
289 Ga0265342_10023964 3300031712 Bacteria 3856
290 Ga0265342_10031119 3300031712 Bacteria 3302
291 Ga0265342_10054397 3300031712 Bacteria 2378
292 Ga0316577_10187234 3300031733 Bacteria 1170
293 Ga0307410_10379912 3300031852 Bacteria 1136
294 Ga0307406_10001514 3300031901 Bacteria 12821
295 Ga0307406_10004006 3300031901 Bacteria 8011
296 Ga0307412_10131130 3300031911 Bacteria 1821
297 Ga0315914_1000001 3300031967 Bacteria 416633
298 Ga0307409_100021452 3300031995 Bacteria 4429
299 Ga0307409_100367464 3300031995 Bacteria 1363
300 Ga0307415_100037032 3300032126 Bacteria 3203
301 Ga0315913_1000004 3300033430 Bacteria 192741
302 Ga0315915_1000002 3300033464 Bacteria 425854
303 Ga0373958_0002411 3300034819 Bacteria 2617
304 Ga0373959_0006566 3300034820 Bacteria 1935
305 Ga0373938_0002090 3300034957 Bacteria 3212
306 Ga0373940_0003021 3300035088 Bacteria 3370
307 Ga0373952_0013131 3300035092 Bacteria 1638
308 Ga0373943_0013738 3300035170 Bacteria 3660
309 Ga0373943_0070322 3300035170 Bacteria 1771
310 Ga0373946_0008626 3300035171 Bacteria 3741
311 Ga0373942_0008587 3300035207 Bacteria 2384
312 Ga0373961_0001703 3300035241 Bacteria 6126
313 Ga0373962_0018219 3300035242 Bacteria 1826
314 Ga0373931_0035801 3300035691 Bacteria 2583
315 Ga0373935_0087224 3300035692 Bacteria 2037
316 Ga0373927_0046776 3300035695 Bacteria 2798
317 Ga0373947_0027685 3300035725 Bacteria 3318
318 Ga0373937_0019984 3300036401 Bacteria 5998
319 Ga0395899_0000288 3300037312 Bacteria 64881
320 Ga0395899_0064282 3300037312 Bacteria 2698
321 Ga0395900_0000246 3300037418 Bacteria 85104
322 Ga0395900_0017621 3300037418 Bacteria 7288
323 Ga0395900_0293807 3300037418 Bacteria 1613
324 Ga0395898_0000447 3300037466 Bacteria 85103
325 Ga0395898_0242408 3300037466 Bacteria 1719
326 Ga0395905_0000228 3300037471 Bacteria 85103
327 Ga0436364_0095273 3300037853 Bacteria 2767
328 Ga0436364_0469239 3300037853 Bacteria 3082
329 Ga0436364_0472918 3300037853 Bacteria 4002
330 Ga0436364_1178347 3300037853 Bacteria 1295
331 Ga0395901_0000167 3300038443 Bacteria 85844
332 Ga0395901_0011053 3300038443 Bacteria 9146
333 Ga0400486_00583 3300038742 Bacteria 1904
334 Ga0436365_0307172 3300039437 Bacteria 3473
335 Ga0436365_1156422 3300039437 Bacteria 2117
336 Ga0436360_0420029 3300039438 Bacteria 1854
337 Ga0436362_1144778 3300039453 Bacteria 3440
338 Ga0439436_0002227 3300041404 Bacteria 5806
339 Ga0439466_0056508 3300041411 Bacteria 1273
340 Ga0451835_0131822 3300041492 Bacteria 2222
341 Ga0451843_0374774 3300041509 Bacteria 2448
342 Ga0439449_0001844 3300042007 Bacteria 8338
343 Ga0439449_0045378 3300042007 Bacteria 1629
344 Ga0466965_0001568 3300044683 Bacteria 9311
345 Ga0466968_0017536 3300044735 Bacteria 2863
346 Ga0466970_0009635 3300044765 Bacteria 4887
347 Ga0495603_0052773 3300046455 Bacteria 2413
348 Ga0495629_0046729 3300046459 Bacteria 3036
349 Ga0495629_0051882 3300046459 Bacteria 2870
350 Ga0495638_0000110 3300046460 Bacteria 131410
351 Ga0495638_0022742 3300046460 Bacteria 4111
352 Ga0495653_0093160 3300046463 Bacteria 2198
353 Ga0495662_0026233 3300046476 Bacteria 2814
354 Ga0495664_0000434 3300046477 Bacteria 20493
355 Ga0495610_0001935 3300046512 Bacteria 17840
356 Ga0495610_0048670 3300046512 Bacteria 2080
357 Ga0495630_0036316 3300046517 Bacteria 3684
358 Ga0495643_0015274 3300046522 Bacteria 4543
359 Ga0495648_0097720 3300046524 Bacteria 1628
360 Ga0495652_0028653 3300046529 Bacteria 4898
361 Ga0495665_0106603 3300046531 Bacteria 1470
362 Ga0495640_0003016 3300046533 Bacteria 13550
363 Ga0495586_0004850 3300046535 Bacteria 7194
364 Ga0495645_0000746 3300046543 Bacteria 22248
365 Ga0495622_0024841 3300046557 Bacteria 2798
366 Ga0495668_0000040 3300046616 Bacteria 230681
367 Ga0495668_0050542 3300046616 Bacteria 2304
368 Ga0495634_0064876 3300046642 Bacteria 2420
369 Ga0495625_0028083 3300046660 Bacteria 4223
370 Ga0495625_0064017 3300046660 Bacteria 2595
371 Ga0495635_0018303 3300046663 Bacteria 4888
372 Ga0495647_0070964 3300046681 Bacteria 1394
373 Ga0495613_0066634 3300046689 Bacteria 2629
374 Ga0495624_0023367 3300046690 Bacteria 4077
375 Ga0495649_0070966 3300046694 Bacteria 1867
376 Ga0495660_0062980 3300046810 Bacteria 1987
377 Ga0495581_0072176 3300047315 Bacteria 1997
378 Ga0495604_0206357 3300047317 Bacteria 1360
379 Ga0495674_0003969 3300047319 Bacteria 14347
380 Ga0495684_0018874 3300047471 Bacteria 5310
381 Ga0495684_0224847 3300047471 Bacteria 1375
382 Ga0495686_0001104 3300047472 Bacteria 32036
383 Ga0495686_0014411 3300047472 Bacteria 5442
384 Ga0495686_0074514 3300047472 Bacteria 2083
385 Ga0496100_0151761 3300048903 Bacteria 1653
386 Ga0496101_0127827 3300048904 Bacteria 1927
387 Ga0496102_0008097 3300048905 Bacteria 8991
388 Ga0496102_0345135 3300048905 Bacteria 1402
389 Ga0496104_0072583 3300048907 Bacteria 3273
390 Ga0496104_0088118 3300048907 Bacteria 2965
391 Ga0496104_0276417 3300048907 Bacteria 1592
392 Ga0496105_0005515 3300048908 Bacteria 9603
393 Ga0496105_0042963 3300048908 Bacteria 3727
394 Ga0496105_0151371 3300048908 Bacteria 1907
395 Ga0496106_0002165 3300048909 Bacteria 14680
396 Ga0496108_0015803 3300048911 Bacteria 6153
397 Ga0496109_0000839 3300048912 Bacteria 25665
398 Ga0496109_0023566 3300048912 Bacteria 5465
399 Ga0496110_0050718 3300048913 Bacteria 3644
400 Ga0496110_0285855 3300048913 Bacteria 1502
401 Ga0496110_0394571 3300048913 Bacteria 1261
402 Ga0496111_0002183 3300048914 Bacteria 11720
403 Ga0496111_0033578 3300048914 Bacteria 3660
404 Ga0496112_0022574 3300048915 Bacteria 5997
405 Ga0496112_0093831 3300048915 Bacteria 2971
406 Ga0496113_0011161 3300048916 Bacteria 5977
407 Ga0496113_0106304 3300048916 Bacteria 2180
408 Ga0496114_0085342 3300048917 Bacteria 2674
409 Ga0496114_0087202 3300048917 Bacteria 2646
410 Ga0496114_0119466 3300048917 Bacteria 2266
411 Ga0496115_0008711 3300048918 Bacteria 7518
412 Ga0496115_0222072 3300048918 Bacteria 1559
413 Ga0496115_0304758 3300048918 Bacteria 1305
414 Ga0496116_0000057 3300048919 Bacteria 281652
415 Ga0496116_0002318 3300048919 Bacteria 20175
416 Ga0496116_0019030 3300048919 Bacteria 5273
417 Ga0496116_0020748 3300048919 Bacteria 4978
418 Ga0496116_0041103 3300048919 Bacteria 3175
419 Ga0496116_0044265 3300048919 Bacteria 3025
420 Ga0496116_0053222 3300048919 Bacteria 2675
421 Ga0496116_0143395 3300048919 Bacteria 1339
422 Ga0496117_0000031 3300048920 Bacteria 381048
423 Ga0496117_0003198 3300048920 Bacteria 19389
424 Ga0496117_0020568 3300048920 Bacteria 5375
425 Ga0496117_0034978 3300048920 Bacteria 3778
426 Ga0496117_0181360 3300048920 Bacteria 1210
427 Ga0496118_0000208 3300048921 Bacteria 102645
428 Ga0496118_0003362 3300048921 Bacteria 20223
429 Ga0496118_0029801 3300048921 Bacteria 4568
430 Ga0496119_0000806 3300048922 Bacteria 41963
431 Ga0496119_0004232 3300048922 Bacteria 14390
432 Ga0496119_0004341 3300048922 Bacteria 14150
433 Ga0496119_0029169 3300048922 Bacteria 3748
434 Ga0496120_0001041 3300048923 Bacteria 37083
435 Ga0496120_0007227 3300048923 Bacteria 8314
436 Ga0496121_0000034 3300048924 Bacteria 377095
437 Ga0496121_0002668 3300048924 Bacteria 26718
438 Ga0496121_0080886 3300048924 Bacteria 2573
439 Ga0496121_0125341 3300048924 Bacteria 1932
440 Ga0496122_0000023 3300048925 Bacteria 381035
441 Ga0496122_0000082 3300048925 Bacteria 209159
442 Ga0496122_0006697 3300048925 Bacteria 13111
443 Ga0496122_0007207 3300048925 Bacteria 12447
444 Ga0496122_0022034 3300048925 Bacteria 5677
445 Ga0496122_0026691 3300048925 Bacteria 4969
446 Ga0496122_0081780 3300048925 Bacteria 2246
447 Ga0496122_0114119 3300048925 Bacteria 1763
448 Ga0496123_0000027 3300048926 Bacteria 306773
449 Ga0496123_0000067 3300048926 Bacteria 209159
450 Ga0496123_0001298 3300048926 Bacteria 35561
451 Ga0496123_0016752 3300048926 Bacteria 5930
452 Ga0496123_0026186 3300048926 Bacteria 4377
453 Ga0496123_0026533 3300048926 Bacteria 4335
454 Ga0496123_0028835 3300048926 Bacteria 4100
455 Ga0496123_0071615 3300048926 Bacteria 2161
456 Ga0496124_0000174 3300048927 Bacteria 129228
457 Ga0496124_0007057 3300048927 Bacteria 12034
458 Ga0496124_0015700 3300048927 Bacteria 7241
459 Ga0496124_0016245 3300048927 Bacteria 7090
460 Ga0496124_0041570 3300048927 Bacteria 3965
461 Ga0496124_0046198 3300048927 Bacteria 3730
462 Ga0496124_0083378 3300048927 Bacteria 2622
463 Ga0496124_0127019 3300048927 Bacteria 2030
464 Ga0496125_0000030 3300048928 Bacteria 375023
465 Ga0496125_0000516 3300048928 Bacteria 67232
466 Ga0496125_0003344 3300048928 Bacteria 19544
467 Ga0496125_0005733 3300048928 Bacteria 13666
468 Ga0496125_0008873 3300048928 Bacteria 10443
469 Ga0496125_0083844 3300048928 Bacteria 2422
470 Ga0496125_0102795 3300048928 Bacteria 2099
471 Ga0496126_0000115 3300048929 Bacteria 188546
472 Ga0496126_0005502 3300048929 Bacteria 14437
473 Ga0496126_0022484 3300048929 Bacteria 6134
474 Ga0496126_0043592 3300048929 Bacteria 4137
475 Ga0496126_0058720 3300048929 Bacteria 3466
476 Ga0496126_0170453 3300048929 Bacteria 1854
477 Ga0496126_0171418 3300048929 Bacteria 1848
478 Ga0496126_0205532 3300048929 Bacteria 1660
479 Ga0501031_0000064 3300049568 Bacteria 56925
480 Ga0501031_0002368 3300049568 Bacteria 11954
481 Ga0501031_0201824 3300049568 Bacteria 1297
482 Ga0501032_0000001 3300049569 Bacteria 422097
483 Ga0501032_0000006 3300049569 Bacteria 261727
484 Ga0501032_0016646 3300049569 Bacteria 5169
485 Ga0501032_0234935 3300049569 Bacteria 1191
486 Ga0501033_0000053 3300049570 Bacteria 109042
487 Ga0501033_0000077 3300049570 Bacteria 92696
488 Ga0501033_0000120 3300049570 Bacteria 75504
489 Ga0501033_0103071 3300049570 Bacteria 2081
490 Ga0501034_0000023 3300049571 Bacteria 263892
491 Ga0501034_0000030 3300049571 Bacteria 248180
492 Ga0501034_0000166 3300049571 Bacteria 122782
493 Ga0501034_0000702 3300049571 Bacteria 50840
494 Ga0501034_0035613 3300049571 Bacteria 5045
495 Ga0501034_0250005 3300049571 Bacteria 1717
496 Ga0501034_0267162 3300049571 Bacteria 1652
497 Ga0501036_0000003 3300049572 Bacteria 261545
498 Ga0501036_0000482 3300049572 Bacteria 28438
499 Ga0501036_0020693 3300049572 Bacteria 5527
500 Ga0501036_0116520 3300049572 Bacteria 2257
501 Ga0501037_0000003 3300049573 Bacteria 261548
502 Ga0501037_0000065 3300049573 Bacteria 96747
503 Ga0501037_0003608 3300049573 Bacteria 11219
504 Ga0501037_0078465 3300049573 Bacteria 2396
505 Ga0501037_0083175 3300049573 Bacteria 2319
506 Ga0501037_0103264 3300049573 Bacteria 2056
507 Ga0501038_0000004 3300049574 Bacteria 261289
508 Ga0501038_0000043 3300049574 Bacteria 113010
509 Ga0501038_0050273 3300049574 Bacteria 3602
510 Ga0501038_0125249 3300049574 Bacteria 2115
511 Ga0501039_0000008 3300049575 Bacteria 274778
512 Ga0501039_0000022 3300049575 Bacteria 160858
513 Ga0501039_0000758 3300049575 Bacteria 23236
514 Ga0501039_0044624 3300049575 Bacteria 3425
515 Ga0501040_0024664 3300049576 Bacteria 4037
516 Ga0501040_0028701 3300049576 Bacteria 3752
517 Ga0501041_0006354 3300049577 Bacteria 6914
518 Ga0501043_0000310 3300049579 Bacteria 44324
519 Ga0501043_0000365 3300049579 Bacteria 40969
520 Ga0501043_0040770 3300049579 Bacteria 3649
521 Ga0501043_0085007 3300049579 Bacteria 2486
522 Ga0501046_0000033 3300049580 Bacteria 174675
523 Ga0501046_0084533 3300049580 Bacteria 2447
524 Ga0501046_0095375 3300049580 Bacteria 2285
525 Ga0501047_0001189 3300049581 Bacteria 25783
526 Ga0501047_0008720 3300049581 Bacteria 9570
527 Ga0501047_0030041 3300049581 Bacteria 5239
528 Ga0501047_0081069 3300049581 Bacteria 3119
529 Ga0501047_0086740 3300049581 Bacteria 3007
530 Ga0501047_0088783 3300049581 Bacteria 2968
531 Ga0501047_0099841 3300049581 Bacteria 2782
532 Ga0501047_0180703 3300049581 Bacteria 1976
533 Ga0501047_0235623 3300049581 Bacteria 1682
534 Ga0501048_0000324 3300049582 Bacteria 32839
535 Ga0501048_0323017 3300049582 Bacteria 1100
536 Ga0501067_0004739 3300049583 Bacteria 7532
537 Ga0501067_0012913 3300049583 Bacteria 4623
538 Ga0501067_0033149 3300049583 Bacteria 2866
539 Ga0501070_0001033 3300049586 Bacteria 25035
540 Ga0501070_0022645 3300049586 Bacteria 5261
541 Ga0501070_0046271 3300049586 Bacteria 3618
542 Ga0501070_0142952 3300049586 Bacteria 1975
543 Ga0501072_0015322 3300049588 Bacteria 5880
544 Ga0501073_0005082 3300049589 Bacteria 9865
545 Ga0501073_0030271 3300049589 Bacteria 3865
546 Ga0501073_0123636 3300049589 Bacteria 1793
547 Ga0501074_0008675 3300049590 Bacteria 7364
548 Ga0501075_0000668 3300049591 Bacteria 21132
549 Ga0501076_0005133 3300049592 Bacteria 9371
550 Ga0501076_0022154 3300049592 Bacteria 4882
551 Ga0501077_0001833 3300049593 Bacteria 12853
552 Ga0501080_0001688 3300049742 Bacteria 18817
553 Ga0501080_0006905 3300049742 Bacteria 10240
554 Ga0501080_0027940 3300049742 Bacteria 5246
555 Ga0501080_0049498 3300049742 Bacteria 3911
556 Ga0501080_0196405 3300049742 Bacteria 1853
557 Ga0501081_0001741 3300049743 Bacteria 13504
558 Ga0501081_0268081 3300049743 Bacteria 1248
559 Ga0501083_0011274 3300049744 Bacteria 6271
560 Ga0501083_0018879 3300049744 Bacteria 4800
561 Ga0501083_0045436 3300049744 Bacteria 2971
562 Ga0501083_0058689 3300049744 Bacteria 2574
563 Ga0501035_0000031 3300049822 Bacteria 175591
564 Ga0501035_0000084 3300049822 Bacteria 116222
565 Ga0501035_0000234 3300049822 Bacteria 66162
566 Ga0501035_0000479 3300049822 Bacteria 44840
567 Ga0501035_0000897 3300049822 Bacteria 31484
568 Ga0501035_0174975 3300049822 Bacteria 1852
569 Ga0501035_0179733 3300049822 Bacteria 1823
570 Ga0501044_0000008 3300049823 Bacteria 274778
571 Ga0501044_0000073 3300049823 Bacteria 122507
572 Ga0501044_0003116 3300049823 Bacteria 18793
573 Ga0501044_0061367 3300049823 Bacteria 3846
574 Ga0501044_0228289 3300049823 Bacteria 1810
575 Ga0501044_0301290 3300049823 Bacteria 1531
576 Ga0501044_0303876 3300049823 Bacteria 1524
577 Ga0501045_0032669 3300049824 Bacteria 3772
578 Ga0501045_0053846 3300049824 Bacteria 2941
579 nmdc:mga03683_24084_c1 3300050489 Bacteria 2378
580 nmdc:mga03n38_71584_c1 3300050490 Bacteria 1606
581 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
582 nmdc:mga00v17_83046_c1 3300050491 Bacteria 2003
583 nmdc:mga00v17_89_c1 3300050491 Bacteria 55686
584 nmdc:mga0k408_49766_c1 3300050493 Bacteria 2426
585 nmdc:mga07m45_98969_c1 3300050496 Bacteria 1674
586 nmdc:mga05p37_20638_c1 3300050507 Bacteria 7970
587 nmdc:mga05p37_311_c1 3300050507 Bacteria 51481
588 nmdc:mga09592_10686_c1 3300050508 Bacteria 7472
589 nmdc:mga06r32_152475_c1 3300050510 Bacteria 2290
590 nmdc:mga06r32_24194_c1 3300050510 Bacteria 5633
591 nmdc:mga06r32_653_c1 3300050510 Bacteria 30286
592 nmdc:mga08y16_132152_c1 3300050511 Bacteria 2595
593 nmdc:mga08y16_165_c1 3300050511 Bacteria 57478
594 nmdc:mga08y16_193049_c1 3300050511 Bacteria 2112
595 nmdc:mga0rr50_7458_c1 3300050513 Bacteria 6749
596 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
597 nmdc:mga0sz30_1823_c2 3300050516 Bacteria 5964
598 nmdc:mga0sz30_36660_c1 3300050516 Bacteria 2051
599 nmdc:mga0sz30_81_c1 3300050516 Bacteria 36474
600 Ga0495612_0000152 3300053078 Bacteria 29021
601 Ga0495595_0014098 3300053084 Bacteria 3386
602 Ga0495595_0044858 3300053084 Bacteria 2032
603 Ga0495619_0003543 3300053085 Bacteria 10077
604 Ga0495619_0017043 3300053085 Bacteria 4605
605 Ga0500643_017532 3300053087 Bacteria 2397
606 Ga0500641_0003244 3300053096 Bacteria 5752
607 Ga0500556_0000092 3300053104 Bacteria 83297
608 Ga0500556_0000160 3300053104 Bacteria 55309
609 Ga0500556_0018924 3300053104 Bacteria 2181
610 Ga0500562_000997 3300053108 Bacteria 6911
611 Ga0500569_002816 3300053109 Bacteria 3473
612 Ga0500618_000573 3300053125 Bacteria 22735
613 Ga0500658_0000093 3300053134 Bacteria 41128
614 Ga0500561_0000421 3300053137 Bacteria 6974
615 Ga0500568_0000421 3300053139 Bacteria 31992
616 Ga0500573_0000379 3300053140 Bacteria 18825
617 Ga0500573_0007703 3300053140 Bacteria 5891
618 Ga0500616_0000583 3300053153 Bacteria 44437
619 Ga0500616_0001279 3300053153 Bacteria 25126
620 Ga0500616_0003758 3300053153 Bacteria 11304
621 Ga0500616_0020342 3300053153 Bacteria 3728
622 Ga0500616_0036018 3300053153 Bacteria 2688
623 Ga0500616_0049992 3300053153 Bacteria 2209
624 Ga0500622_0003893 3300053156 Bacteria 9667
625 Ga0500622_0016225 3300053156 Bacteria 3981
626 Ga0500622_0078113 3300053156 Bacteria 1661
627 Ga0500634_0015039 3300053161 Bacteria 4098
628 Ga0500637_0008150 3300053178 Bacteria 5274
629 Ga0500645_000746 3300053730 Bacteria 20007
630 Ga0501084_0000488 3300054114 Bacteria 30370
631 Ga0501084_0027159 3300054114 Bacteria 4783
632 Ga0501084_0031365 3300054114 Bacteria 4444
633 Ga0501084_0055846 3300054114 Bacteria 3304
634 Ga0587090_000500 3300059510 Bacteria 3316
635 Ga0501082_0037839 3300060353 Bacteria 4161
636 Ga0501082_0070911 3300060353 Bacteria 3000
637 Ga0501082_0295480 3300060353 Bacteria 1410
638 Ga0466962_0064336 3300061719 Bacteria 1751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041411 Ga0439466_0056508 Ga0439466_0056508_11_913 299
2 3300048908 Ga0496105_0151371 Ga0496105_0151371_393_1568 342
3 iso_pu_bacteria 2585428106 2587917171 346
4 iso_pu_bacteria 2643221640 2644223626 346
5 iso_pu_bacteria 2643221642 2644236286 346
6 iso_pu_bacteria 2884960567 2884963557 346
7 iso_pu_bacteria 2928531327 2928531877 346
8 3300048929 Ga0496126_0205532 Ga0496126_0205532_594_1649 349
9 3300053087 Ga0500643_017532 Ga0500643_017532_12_1061 349
10 3300003781 Ga0055536_1000569 Ga0055536_10005699 350
11 3300003791 Ga0055530_10003609 Ga0055530_100036099 350
12 3300006195 Ga0075366_10004332 Ga0075366_100043328 350
13 3300006844 Ga0075428_100003200 Ga0075428_1000032008 350
14 3300006846 Ga0075430_100048860 Ga0075430_1000488602 350
15 3300006847 Ga0075431_100000003 Ga0075431_100000003102 350
16 3300006880 Ga0075429_100012151 Ga0075429_1000121515 350
17 3300009094 Ga0111539_10000504 Ga0111539_1000050427 350
18 3300009147 Ga0114129_10000062 Ga0114129_1000006287 350
19 3300025292 Ga0209676_1000169 Ga0209676_100016964 350
20 3300025298 Ga0209050_1000281 Ga0209050_100028140 350
21 3300025303 Ga0209051_1006782 Ga0209051_10067824 350
22 3300025304 Ga0209257_1005651 Ga0209257_10056512 350
23 3300027907 Ga0207428_10084061 Ga0207428_100840612 350
24 3300046616 Ga0495668_0000040 Ga0495668_0000040_110718_111770 350
25 3300046660 Ga0495625_0028083 Ga0495625_0028083_1091_2143 350
26 3300048926 Ga0496123_0071615 Ga0496123_0071615_1089_2141 350
27 3300048928 Ga0496125_0102795 Ga0496125_0102795_293_1345 350
28 3300048929 Ga0496126_0005502 Ga0496126_0005502_8739_9791 350
29 3300050493 nmdc:mga0k408_49766_c1 nmdc:mga0k408_49766_c1_814_1866 350
30 3300050496 nmdc:mga07m45_98969_c1 nmdc:mga07m45_98969_c1_434_1486 350
31 3300050507 nmdc:mga05p37_311_c1 nmdc:mga05p37_311_c1_32831_33943 350
32 3300050508 nmdc:mga09592_10686_c1 nmdc:mga09592_10686_c1_1572_2684 350
33 3300050510 nmdc:mga06r32_653_c1 nmdc:mga06r32_653_c1_3652_4764 350
34 3300050511 nmdc:mga08y16_165_c1 nmdc:mga08y16_165_c1_34358_35470 350
35 3300053156 Ga0500622_0078113 Ga0500622_0078113_404_1456 350
36 3300037853 Ga0436364_1178347 Ga0436364_1178347_89_1144 351
37 3300049582 Ga0501048_0323017 Ga0501048_0323017_27_1082 351
38 3300049742 Ga0501080_0196405 Ga0501080_0196405_229_1284 351
39 3300049569 Ga0501032_0234935 Ga0501032_0234935_53_1111 352
40 3300049579 Ga0501043_0085007 Ga0501043_0085007_1395_2453 352
41 3300049823 Ga0501044_0301290 Ga0501044_0301290_440_1498 352
42 3300053104 Ga0500556_0018924 Ga0500556_0018924_635_1693 352
43 3300053108 Ga0500562_000997 Ga0500562_000997_1242_2300 352
44 3300053153 Ga0500616_0049992 Ga0500616_0049992_325_1383 352
45 3300053730 Ga0500645_000746 Ga0500645_000746_12550_13608 352
46 3300025915 Ga0207693_10027984 Ga0207693_100279844 355
47 3300048924 Ga0496121_0125341 Ga0496121_0125341_149_1219 356
48 3300048928 Ga0496125_0000516 Ga0496125_0000516_59467_60579 357
49 3300048929 Ga0496126_0022484 Ga0496126_0022484_4376_5488 357
50 3300049743 Ga0501081_0268081 Ga0501081_0268081_101_1207 357
51 3300053096 Ga0500641_0003244 Ga0500641_0003244_705_1778 357
52 3300053156 Ga0500622_0003893 Ga0500622_0003893_4229_5305 357
53 3300054114 Ga0501084_0027159 Ga0501084_0027159_3652_4758 357
54 3300005336 Ga0070680_100136044 Ga0070680_1001360441 359
55 3300005457 Ga0070662_100235372 Ga0070662_1002353722 359
56 3300005458 Ga0070681_10274978 Ga0070681_102749782 359
57 3300005539 Ga0068853_100000639 Ga0068853_10000063924 359
58 3300005563 Ga0068855_100040752 Ga0068855_1000407522 359
59 3300009174 Ga0105241_10008271 Ga0105241_100082713 359
60 3300013104 Ga0157370_10095710 Ga0157370_100957103 359
61 3300025912 Ga0207707_10165371 Ga0207707_101653712 359
62 3300025933 Ga0207706_10236763 Ga0207706_102367632 359
63 3300025949 Ga0207667_10183250 Ga0207667_101832502 359
64 3300025981 Ga0207640_10171870 Ga0207640_101718702 359
65 3300026041 Ga0207639_10004015 Ga0207639_1000401512 359
66 3300026142 Ga0207698_10215155 Ga0207698_102151552 359
67 iso_pu_bacteria 8054563764 8054566017 360
68 3300049580 Ga0501046_0084533 Ga0501046_0084533_1147_2232 361
69 iso_pu_bacteria 2545555834 2545678699 361
70 iso_pu_bacteria 2738541281 2738747254 361
71 iso_pu_bacteria 2738543032 2739356483 361
72 iso_pu_bacteria 3003665799 3003668890 361
73 iso_pu_bacteria 641522639 641646734 361
74 iso_pu_bacteria 643348564 643604943 361
75 3300037853 Ga0436364_0472918 Ga0436364_0472918_515_1636 362
76 3300038742 Ga0400486_00583 Ga0400486_00583_389_1477 362
77 iso_pu_bacteria 2595698237 2596373779 362
78 iso_pu_bacteria 2773857925 2774871888 362
79 iso_pu_bacteria 2889306138 2889311085 362
80 iso_pu_bacteria 2902330777 2902336142 362
81 iso_pu_bacteria 2902405164 2902407183 362
82 iso_pu_bacteria 2909042592 2909046889 362
83 iso_pu_bacteria 2928125067 2928127361 362
84 3300025928 Ga0207700_10089252 Ga0207700_100892522 363
85 iso_pu_bacteria 2643221550 2643771749 363
86 iso_pu_bacteria 2643221551 2643777293 363
87 iso_pu_bacteria 2643221555 2643795741 363
88 iso_pu_bacteria 2643221564 2643838010 363
89 iso_pu_bacteria 2643221733 2644731640 363
90 iso_pu_bacteria 2643221736 2644742020 363
91 iso_pu_bacteria 2671180139 2671694938 363
92 iso_pu_bacteria 2818991467 2819719377 363
93 iso_pu_bacteria 2837651117 2837651359 363
94 iso_pu_bacteria 2841760612 2841763428 363
95 iso_pu_bacteria 2841911363 2841912147 363
96 iso_pu_bacteria 2841917233 2841918014 363
97 iso_pu_bacteria 2844104063 2844109668 363
98 iso_pu_bacteria 2851182111 2851182666 363
99 iso_pu_bacteria 2851246043 2851251775 363
100 iso_pu_bacteria 2996310559 2996311696 363
101 iso_pu_bacteria 2996336353 2996339354 363
102 iso_pu_bacteria 8001845381 8001845846 363
103 iso_pu_bacteria 8057529695 8057534639 363
104 iso_pu_bacteria 2643221568 2643854906 364
105 iso_pu_bacteria 2828305725 2828307931 364
106 iso_pu_bacteria 2919166419 2919170537 364
107 iso_pu_bacteria 2919450847 2919452167 364
108 iso_pu_bacteria 2978969890 2978972660 364
109 iso_pu_bacteria 2984587000 2984590912 364
110 iso_pu_bacteria 2989771324 2989771696 364
111 3300025906 Ga0207699_10071266 Ga0207699_100712663 365
112 3300048904 Ga0496101_0127827 Ga0496101_0127827_613_1713 365
113 3300048907 Ga0496104_0088118 Ga0496104_0088118_1014_2114 365
114 3300048907 Ga0496104_0276417 Ga0496104_0276417_45_1145 365
115 3300048912 Ga0496109_0023566 Ga0496109_0023566_1352_2452 365
116 3300048915 Ga0496112_0093831 Ga0496112_0093831_1482_2582 365
117 3300048918 Ga0496115_0222072 Ga0496115_0222072_149_1249 365
118 iso_pu_bacteria 2510917026 2511172718 365
119 iso_pu_bacteria 2585427633 2585998052 365
120 iso_pu_bacteria 2585427634 2586002632 365
121 iso_pu_bacteria 2599185236 2599722616 365
122 iso_pu_bacteria 2600254933 2600377415 365
123 iso_pu_bacteria 2643221558 2643814848 365
124 iso_pu_bacteria 2854916844 2854922289 365
125 iso_pu_bacteria 2891088606 2891090992 365
126 iso_pu_bacteria 2919171160 2919176908 365
127 iso_pu_bacteria 8018150411 8018154988 365
128 3300006051 Ga0075364_10050131 Ga0075364_100501312 366
129 3300028577 Ga0265318_10028340 Ga0265318_100283402 366
130 3300031242 Ga0265329_10053172 Ga0265329_100531721 366
131 3300031595 Ga0265313_10006036 Ga0265313_100060364 366
132 3300031711 Ga0265314_10091592 Ga0265314_100915922 366
133 3300031712 Ga0265342_10023964 Ga0265342_100239642 366
134 3300031712 Ga0265342_10031119 Ga0265342_100311192 366
135 3300031712 Ga0265342_10054397 Ga0265342_100543972 366
136 3300049581 Ga0501047_0086740 Ga0501047_0086740_12_1112 366
137 3300049583 Ga0501067_0033149 Ga0501067_0033149_1301_2401 366
138 3300049586 Ga0501070_0046271 Ga0501070_0046271_1925_3025 366
139 3300049589 Ga0501073_0030271 Ga0501073_0030271_2425_3525 366
140 3300049744 Ga0501083_0018879 Ga0501083_0018879_1593_2693 366
141 3300050491 nmdc:mga00v17_83046_c1 nmdc:mga00v17_83046_c1_318_1427 366
142 3300050516 nmdc:mga0sz30_1823_c2 nmdc:mga0sz30_1823_c2_267_1367 366
143 3300060353 Ga0501082_0295480 Ga0501082_0295480_254_1354 366
144 iso_pu_bacteria 2509276019 2509378013 366
145 iso_pu_bacteria 2509276021 2509389264 366
146 iso_pu_bacteria 2509276033 2509446344 366
147 iso_pu_bacteria 2510065019 2510135396 366
148 iso_pu_bacteria 2510065057 2510305799 366
149 iso_pu_bacteria 2510461069 2510843408 366
150 iso_pu_bacteria 2510461076 2510896849 366
151 iso_pu_bacteria 2510917022 2511135869 366
152 iso_pu_bacteria 2510917028 2511184125 366
153 iso_pu_bacteria 2510917030 2511199382 366
154 iso_pu_bacteria 2511231052 2511498563 366
155 iso_pu_bacteria 2512875026 2512973474 366
156 iso_pu_bacteria 2513237084 2513572909 366
157 iso_pu_bacteria 2513237085 2513580442 366
158 iso_pu_bacteria 2513237086 2513583723 366
159 iso_pu_bacteria 2513237087 2513591188 366
160 iso_pu_bacteria 2513237088 2513596922 366
161 iso_pu_bacteria 2513237089 2513602009 366
162 iso_pu_bacteria 2513237091 2513615797 366
163 iso_pu_bacteria 2513237093 2513634945 366
164 iso_pu_bacteria 2513237103 2513711495 366
165 iso_pu_bacteria 2513237138 2513865223 366
166 iso_pu_bacteria 2513237140 2513886759 366
167 iso_pu_bacteria 2513237143 2513906823 366
168 iso_pu_bacteria 2513237144 2513912867 366
169 iso_pu_bacteria 2513237146 2513928661 366
170 iso_pu_bacteria 2513237156 2513983463 366
171 iso_pu_bacteria 2513237159 2513998301 366
172 iso_pu_bacteria 2513237160 2514003393 366
173 iso_pu_bacteria 2513237162 2514019559 366
174 iso_pu_bacteria 2515075009 2515114566 366
175 iso_pu_bacteria 2515154107 2515612455 366
176 iso_pu_bacteria 2515154113 2515635017 366
177 iso_pu_bacteria 2515154114 2515644420 366
178 iso_pu_bacteria 2515154116 2515657500 366
179 iso_pu_bacteria 2515154134 2515741747 366
180 iso_pu_bacteria 2516653046 2516894841 366
181 iso_pu_bacteria 2516653077 2517038207 366
182 iso_pu_bacteria 2516653085 2517078485 366
183 iso_pu_bacteria 2517093000 2517097224 366
184 iso_pu_bacteria 2517287029 2517408386 366
185 iso_pu_bacteria 2517487022 2517571523 366
186 iso_pu_bacteria 2519899620 2520379780 366
187 iso_pu_bacteria 2524023207 2524450340 366
188 iso_pu_bacteria 2524023209 2524461159 366
189 iso_pu_bacteria 2529292951 2530647209 366
190 iso_pu_bacteria 2534681786 2535486835 366
191 iso_pu_bacteria 2537561587 2537873588 366
192 iso_pu_bacteria 2551306084 2551676695 366
193 iso_pu_bacteria 2551306084 2551680319 366
194 iso_pu_bacteria 2551306085 2551685150 366
195 iso_pu_bacteria 2551306086 2551696580 366
196 iso_pu_bacteria 2551306087 2551702906 366
197 iso_pu_bacteria 2551306089 2551711349 366
198 iso_pu_bacteria 2551306090 2551716179 366
199 iso_pu_bacteria 2551306093 2551741182 366
200 iso_pu_bacteria 2558860100 2558867485 366
201 iso_pu_bacteria 2582581294 2585201634 366
202 iso_pu_bacteria 2582581298 2585224081 366
203 iso_pu_bacteria 2582581299 2585228641 366
204 iso_pu_bacteria 2582581304 2585257253 366
205 iso_pu_bacteria 2582581307 2585272042 366
206 iso_pu_bacteria 2582581308 2585279654 366
207 iso_pu_bacteria 2582581315 2585327492 366
208 iso_pu_bacteria 2582581867 2585399854 366
209 iso_pu_bacteria 2585427526 2585529217 366
210 iso_pu_bacteria 2585427527 2585535734 366
211 iso_pu_bacteria 2585427528 2585543033 366
212 iso_pu_bacteria 2585427529 2585549781 366
213 iso_pu_bacteria 2585427530 2585551111 366
214 iso_pu_bacteria 2585427531 2585563413 366
215 iso_pu_bacteria 2585427590 2585820942 366
216 iso_pu_bacteria 2585427593 2585839198 366
217 iso_pu_bacteria 2585427594 2585844990 366
218 iso_pu_bacteria 2585427608 2585897165 366
219 iso_pu_bacteria 2585427609 2585909080 366
220 iso_pu_bacteria 2585428125 2587984494 366
221 iso_pu_bacteria 2599185170 2599419986 366
222 iso_pu_bacteria 2599185210 2599603166 366
223 iso_pu_bacteria 2600255279 2601610929 366
224 iso_pu_bacteria 2600255308 2601747703 366
225 iso_pu_bacteria 2615840624 2616297466 366
226 iso_pu_bacteria 2615840626 2616306442 366
227 iso_pu_bacteria 2615840698 2616551070 366
228 iso_pu_bacteria 2617270742 2617382303 366
229 iso_pu_bacteria 2643221582 2643921565 366
230 iso_pu_bacteria 2643221599 2644002563 366
231 iso_pu_bacteria 2643221607 2644052414 366
232 iso_pu_bacteria 2643221634 2644194728 366
233 iso_pu_bacteria 2643221636 2644201203 366
234 iso_pu_bacteria 2643221637 2644209581 366
235 iso_pu_bacteria 2643221643 2644240408 366
236 iso_pu_bacteria 2643221653 2644299750 366
237 iso_pu_bacteria 2643221686 2644484692 366
238 iso_pu_bacteria 2643221688 2644492578 366
239 iso_pu_bacteria 2643221689 2644499487 366
240 iso_pu_bacteria 2643221718 2644653109 366
241 iso_pu_bacteria 2643221719 2644657977 366
242 iso_pu_bacteria 2667528174 2671116051 366
243 iso_pu_bacteria 2690316117 2692319865 366
244 iso_pu_bacteria 2718217882 2719183102 366
245 iso_pu_bacteria 2718217927 2719387822 366
246 iso_pu_bacteria 2718217997 2719667443 366
247 iso_pu_bacteria 2718218009 2719733819 366
248 iso_pu_bacteria 2718218199 2720493863 366
249 iso_pu_bacteria 2718218232 2720615324 366
250 iso_pu_bacteria 2718218233 2720622112 366
251 iso_pu_bacteria 2718218235 2720633466 366
252 iso_pu_bacteria 2718218269 2720777164 366
253 iso_pu_bacteria 2718218363 2721149214 366
254 iso_pu_bacteria 2718218365 2721160618 366
255 iso_pu_bacteria 2718218366 2721166027 366
256 iso_pu_bacteria 2718218423 2721401455 366
257 iso_pu_bacteria 2721755514 2722842197 366
258 iso_pu_bacteria 2721755556 2723028762 366
259 iso_pu_bacteria 2721755684 2723562375 366
260 iso_pu_bacteria 2721755685 2723569071 366
261 iso_pu_bacteria 2721755809 2724040269 366
262 iso_pu_bacteria 2721755810 2724046575 366
263 iso_pu_bacteria 2721755819 2724091771 366
264 iso_pu_bacteria 2721755822 2724106336 366
265 iso_pu_bacteria 2721755823 2724112143 366
266 iso_pu_bacteria 2724679232 2725945753 366
267 iso_pu_bacteria 2728369352 2730109698 366
268 iso_pu_bacteria 2728369365 2730166337 366
269 iso_pu_bacteria 2728369397 2730300250 366
270 iso_pu_bacteria 2738541293 2738801096 366
271 iso_pu_bacteria 2738541317 2738946994 366
272 iso_pu_bacteria 2738541333 2739037729 366
273 iso_pu_bacteria 2758568016 2758640075 366
274 iso_pu_bacteria 2765235802 2765465750 366
275 iso_pu_bacteria 2765235942 2766064112 366
276 iso_pu_bacteria 2767802442 2770199136 366
277 iso_pu_bacteria 2775507049 2776915552 366
278 iso_pu_bacteria 2775507266 2778179195 366
279 iso_pu_bacteria 2791355082 2792582318 366
280 iso_pu_bacteria 2791355091 2792621830 366
281 iso_pu_bacteria 2791355092 2792628912 366
282 iso_pu_bacteria 2791355094 2792640052 366
283 iso_pu_bacteria 2791355253 2793281811 366
284 iso_pu_bacteria 2791355256 2793295491 366
285 iso_pu_bacteria 2791355259 2793317596 366
286 iso_pu_bacteria 2791355260 2793320861 366
287 iso_pu_bacteria 2791355261 2793327430 366
288 iso_pu_bacteria 2791355262 2793332375 366
289 iso_pu_bacteria 2791355263 2793338969 366
290 iso_pu_bacteria 2791355264 2793346739 366
291 iso_pu_bacteria 2791355265 2793356089 366
292 iso_pu_bacteria 2791355266 2793359234 366
293 iso_pu_bacteria 2791355267 2793366043 366
294 iso_pu_bacteria 2802428858 2802717111 366
295 iso_pu_bacteria 2802428859 2802724901 366
296 iso_pu_bacteria 2802428860 2802729651 366
297 iso_pu_bacteria 2802428861 2802736997 366
298 iso_pu_bacteria 2802428862 2802743402 366
299 iso_pu_bacteria 2802428863 2802749472 366
300 iso_pu_bacteria 2802429605 2805926350 366
301 iso_pu_bacteria 2802429606 2805934077 366
302 iso_pu_bacteria 2802429633 2806047727 366
303 iso_pu_bacteria 2802429634 2806055303 366
304 iso_pu_bacteria 2802429635 2806062184 366
305 iso_pu_bacteria 2802429636 2806070057 366
306 iso_pu_bacteria 2802429637 2806076643 366
307 iso_pu_bacteria 2818991272 2819244539 366
308 iso_pu_bacteria 2818991439 2819561051 366
309 iso_pu_bacteria 2818991448 2819611950 366
310 iso_pu_bacteria 2818991453 2819638510 366
311 iso_pu_bacteria 2838016132 2838018184 366
312 iso_pu_bacteria 2838022645 2838023863 366
313 iso_pu_bacteria 2838029111 2838034097 366
314 iso_pu_bacteria 2838035591 2838040192 366
315 iso_pu_bacteria 2838042994 2838046725 366
316 iso_pu_bacteria 2838048938 2838050956 366
317 iso_pu_bacteria 2838061910 2838062723 366
318 iso_pu_bacteria 2838068647 2838072268 366
319 iso_pu_bacteria 2838074704 2838078085 366
320 iso_pu_bacteria 2838661181 2838667011 366
321 iso_pu_bacteria 2838668709 2838672304 366
322 iso_pu_bacteria 2838675328 2838678579 366
323 iso_pu_bacteria 2838680041 2838683736 366
324 iso_pu_bacteria 2838686498 2838693318 366
325 iso_pu_bacteria 2838694306 2838698264 366
326 iso_pu_bacteria 2838701080 2838704827 366
327 iso_pu_bacteria 2838707686 2838711379 366
328 iso_pu_bacteria 2838714209 2838718333 366
329 iso_pu_bacteria 2838719591 2838722875 366
330 iso_pu_bacteria 2838724970 2838728399 366
331 iso_pu_bacteria 2838729681 2838735312 366
332 iso_pu_bacteria 2838742623 2838748139 366
333 iso_pu_bacteria 2839993093 2839993393 366
334 iso_pu_bacteria 2841846520 2841850431 366
335 iso_pu_bacteria 2841851746 2841857384 366
336 iso_pu_bacteria 2841859092 2841863316 366
337 iso_pu_bacteria 2841864319 2841867612 366
338 iso_pu_bacteria 2842077413 2842081180 366
339 iso_pu_bacteria 2842110456 2842116568 366
340 iso_pu_bacteria 2842118031 2842122043 366
341 iso_pu_bacteria 2842124991 2842129059 366
342 iso_pu_bacteria 2842130223 2842133472 366
343 iso_pu_bacteria 2842146304 2842148937 366
344 iso_pu_bacteria 2842152218 2842155617 366
345 iso_pu_bacteria 2842156927 2842162441 366
346 iso_pu_bacteria 2842163707 2842166858 366
347 iso_pu_bacteria 2842170452 2842174425 366
348 iso_pu_bacteria 2842175837 2842179086 366
349 iso_pu_bacteria 2842180545 2842186081 366
350 iso_pu_bacteria 2842187318 2842190757 366
351 iso_pu_bacteria 2842192696 2842194743 366
352 iso_pu_bacteria 2842198810 2842201217 366
353 iso_pu_bacteria 2842205361 2842207558 366
354 iso_pu_bacteria 2842211629 2842214919 366
355 iso_pu_bacteria 2842217011 2842221930 366
356 iso_pu_bacteria 2842224351 2842227640 366
357 iso_pu_bacteria 2842229732 2842235540 366
358 iso_pu_bacteria 2842237096 2842241057 366
359 iso_pu_bacteria 2842243621 2842249177 366
360 iso_pu_bacteria 2842250916 2842254508 366
361 iso_pu_bacteria 2842257432 2842263132 366
362 iso_pu_bacteria 2842264693 2842269303 366
363 iso_pu_bacteria 2842271015 2842277786 366
364 iso_pu_bacteria 2842278818 2842280731 366
365 iso_pu_bacteria 2842285085 2842288658 366
366 iso_pu_bacteria 2842291075 2842294837 366
367 iso_pu_bacteria 2842298080 2842302603 366
368 iso_pu_bacteria 2842304105 2842305671 366
369 iso_pu_bacteria 2842311132 2842311560 366
370 iso_pu_bacteria 2842317721 2842321248 366
371 iso_pu_bacteria 2842341865 2842346841 366
372 iso_pu_bacteria 2842357229 2842358895 366
373 iso_pu_bacteria 2842363717 2842366126 366
374 iso_pu_bacteria 2842370503 2842375145 366
375 iso_pu_bacteria 2842377471 2842381236 366
376 iso_pu_bacteria 2842384541 2842388306 366
377 iso_pu_bacteria 2842395702 2842395795 366
378 iso_pu_bacteria 2842402390 2842405996 366
379 iso_pu_bacteria 2842409023 2842412580 366
380 iso_pu_bacteria 2842415677 2842419541 366
381 iso_pu_bacteria 2842422224 2842425900 366
382 iso_pu_bacteria 2842428310 2842433413 366
383 iso_pu_bacteria 2842434925 2842439532 366
384 iso_pu_bacteria 2842441272 2842446160 366
385 iso_pu_bacteria 2842447887 2842448602 366
386 iso_pu_bacteria 2842462802 2842467662 366
387 iso_pu_bacteria 2842469257 2842474374 366
388 iso_pu_bacteria 2842475841 2842480935 366
389 iso_pu_bacteria 2842482326 2842485258 366
390 iso_pu_bacteria 2842489311 2842491315 366
391 iso_pu_bacteria 2842495871 2842498639 366
392 iso_pu_bacteria 2842502639 2842507454 366
393 iso_pu_bacteria 2842509118 2842514716 366
394 iso_pu_bacteria 2842515876 2842519947 366
395 iso_pu_bacteria 2842521101 2842524675 366
396 iso_pu_bacteria 2844454524 2844456833 366
397 iso_pu_bacteria 2847417321 2847420912 366
398 iso_pu_bacteria 2848992105 2848995745 366
399 iso_pu_bacteria 2850079185 2850082729 366
400 iso_pu_bacteria 2852387548 2852392078 366
401 iso_pu_bacteria 2854911287 2854913314 366
402 iso_pu_bacteria 2855825444 2855827475 366
403 iso_pu_bacteria 2855839649 2855842849 366
404 iso_pu_bacteria 2855872281 2855873609 366
405 iso_pu_bacteria 2857516855 2857519733 366
406 iso_pu_bacteria 2858800743 2858802187 366
407 iso_pu_bacteria 2889790730 2889795758 366
408 iso_pu_bacteria 2889914905 2889916405 366
409 iso_pu_bacteria 2896384573 2896390111 366
410 iso_pu_bacteria 2899792073 2899795413 366
411 iso_pu_bacteria 2899803654 2899804992 366
412 iso_pu_bacteria 2904578770 2904579958 366
413 iso_pu_bacteria 2913295892 2913300246 366
414 iso_pu_bacteria 2913308742 2913312181 366
415 iso_pu_bacteria 2915980308 2915981737 366
416 iso_pu_bacteria 2915986958 2915993376 366
417 iso_pu_bacteria 2915993759 2915999841 366
418 iso_pu_bacteria 2916000859 2916006142 366
419 iso_pu_bacteria 2916007675 2916009077 366
420 iso_pu_bacteria 2916014648 2916019841 366
421 iso_pu_bacteria 2916021584 2916023906 366
422 iso_pu_bacteria 2916028427 2916030988 366
423 iso_pu_bacteria 2916035215 2916040472 366
424 iso_pu_bacteria 2916041962 2916043407 366
425 iso_pu_bacteria 2916048683 2916050668 366
426 iso_pu_bacteria 2916055098 2916056835 366
427 iso_pu_bacteria 2916061851 2916066508 366
428 iso_pu_bacteria 2916068649 2916074337 366
429 iso_pu_bacteria 2916076590 2916077161 366
430 iso_pu_bacteria 2919100787 2919107916 366
431 iso_pu_bacteria 2919114240 2919118410 366
432 iso_pu_bacteria 2919119836 2919120370 366
433 iso_pu_bacteria 2919408235 2919411432 366
434 iso_pu_bacteria 2920760137 2920760242 366
435 iso_pu_bacteria 2921201388 2921204792 366
436 iso_pu_bacteria 2921208531 2921210369 366
437 iso_pu_bacteria 2921237296 2921240381 366
438 iso_pu_bacteria 2921244191 2921245655 366
439 iso_pu_bacteria 2921250672 2921252826 366
440 iso_pu_bacteria 2921257292 2921262604 366
441 iso_pu_bacteria 2921263974 2921266264 366
442 iso_pu_bacteria 2921282425 2921288908 366
443 iso_pu_bacteria 2921289301 2921293955 366
444 iso_pu_bacteria 2921296804 2921302974 366
445 iso_pu_bacteria 2923556063 2923560635 366
446 iso_pu_bacteria 2924144063 2924144784 366
447 iso_pu_bacteria 2924150972 2924157636 366
448 iso_pu_bacteria 2924158325 2924158806 366
449 iso_pu_bacteria 2924165586 2924168550 366
450 iso_pu_bacteria 2924172951 2924174282 366
451 iso_pu_bacteria 2924179722 2924185976 366
452 iso_pu_bacteria 2924186466 2924190239 366
453 iso_pu_bacteria 2924193448 2924193510 366
454 iso_pu_bacteria 2924200457 2924201422 366
455 iso_pu_bacteria 2924207177 2924207766 366
456 iso_pu_bacteria 2924214083 2924220746 366
457 iso_pu_bacteria 2924221636 2924227108 366
458 iso_pu_bacteria 2924228884 2924234060 366
459 iso_pu_bacteria 2926754445 2926754939 366
460 iso_pu_bacteria 2929138655 2929141959 366
461 iso_pu_bacteria 2933006813 2933010536 366
462 iso_pu_bacteria 2933011516 2933015792 366
463 iso_pu_bacteria 2933016740 2933018586 366
464 iso_pu_bacteria 2933570622 2933572178 366
465 iso_pu_bacteria 2933586486 2933592826 366
466 iso_pu_bacteria 2933594066 2933597470 366
467 iso_pu_bacteria 2933599457 2933602880 366
468 iso_pu_bacteria 2935894831 2935898083 366
469 iso_pu_bacteria 2935901341 2935903475 366
470 iso_pu_bacteria 2936367885 2936370051 366
471 iso_pu_bacteria 2936375103 2936379227 366
472 iso_pu_bacteria 2936381700 2936381797 366
473 iso_pu_bacteria 2936996657 2936997413 366
474 iso_pu_bacteria 2937002841 2937004124 366
475 iso_pu_bacteria 2937009748 2937010338 366
476 iso_pu_bacteria 2937016420 2937017746 366
477 iso_pu_bacteria 2937023124 2937023201 366
478 iso_pu_bacteria 2937029754 2937031749 366
479 iso_pu_bacteria 2937036028 2937037816 366
480 iso_pu_bacteria 2937042894 2937043999 366
481 iso_pu_bacteria 2937049772 2937053432 366
482 iso_pu_bacteria 2937056579 2937063020 366
483 iso_pu_bacteria 2937063883 2937070425 366
484 iso_pu_bacteria 2937071275 2937072604 366
485 iso_pu_bacteria 2937078374 2937082155 366
486 iso_pu_bacteria 2937084907 2937089927 366
487 iso_pu_bacteria 2937091812 2937092456 366
488 iso_pu_bacteria 2937098957 2937103081 366
489 iso_pu_bacteria 2937106411 2937113219 366
490 iso_pu_bacteria 2937113482 2937114220 366
491 iso_pu_bacteria 2937119839 2937120218 366
492 iso_pu_bacteria 2937126314 2937128566 366
493 iso_pu_bacteria 2957375807 2957376816 366
494 iso_pu_bacteria 2957382221 2957384946 366
495 iso_pu_bacteria 2957388812 2957395220 366
496 iso_pu_bacteria 2957395598 2957398047 366
497 iso_pu_bacteria 2957402308 2957405572 366
498 iso_pu_bacteria 2957408893 2957411736 366
499 iso_pu_bacteria 2957415311 2957417493 366
500 iso_pu_bacteria 2957422303 2957422341 366
501 iso_pu_bacteria 2957430029 2957430055 366
502 iso_pu_bacteria 2957437181 2957441646 366
503 iso_pu_bacteria 2957443900 2957450380 366
504 iso_pu_bacteria 2957450854 2957455957 366
505 iso_pu_bacteria 2957457609 2957460975 366
506 iso_pu_bacteria 2957464669 2957466531 366
507 iso_pu_bacteria 2957471148 2957471387 366
508 iso_pu_bacteria 2957478035 2957479443 366
509 iso_pu_bacteria 2957484790 2957491149 366
510 iso_pu_bacteria 2957491536 2957494458 366
511 iso_pu_bacteria 2957498199 2957505196 366
512 iso_pu_bacteria 2957505466 2957508243 366
513 iso_pu_bacteria 2960591022 2960592776 366
514 iso_pu_bacteria 2960597568 2960597922 366
515 iso_pu_bacteria 2960603979 2960606608 366
516 iso_pu_bacteria 2960610863 2960613700 366
517 iso_pu_bacteria 2960617483 2960623922 366
518 iso_pu_bacteria 2960624210 2960629875 366
519 iso_pu_bacteria 2960631154 2960634173 366
520 iso_pu_bacteria 2960637947 2960643706 366
521 iso_pu_bacteria 2960645483 2960646614 366
522 iso_pu_bacteria 2960652885 2960655644 366
523 iso_pu_bacteria 2960660292 2960666918 366
524 iso_pu_bacteria 2960667422 2960673265 366
525 iso_pu_bacteria 2960674078 2960674906 366
526 iso_pu_bacteria 2960680706 2960681701 366
527 iso_pu_bacteria 2960687367 2960689358 366
528 iso_pu_bacteria 2960693952 2960699035 366
529 iso_pu_bacteria 2964607997 2964615067 366
530 iso_pu_bacteria 2964615318 2964616990 366
531 iso_pu_bacteria 2964621998 2964625855 366
532 iso_pu_bacteria 2964628898 2964629510 366
533 iso_pu_bacteria 2964636051 2964641523 366
534 iso_pu_bacteria 2964643177 2964643633 366
535 iso_pu_bacteria 2964649959 2964655236 366
536 iso_pu_bacteria 2964656573 2964659955 366
537 iso_pu_bacteria 2964663802 2964669376 366
538 iso_pu_bacteria 2964670856 2964676969 366
539 iso_pu_bacteria 2964678106 2964679196 366
540 iso_pu_bacteria 2964685014 2964687429 366
541 iso_pu_bacteria 2964691889 2964695118 366
542 iso_pu_bacteria 2964698721 2964699135 366
543 iso_pu_bacteria 2964705432 2964706001 366
544 iso_pu_bacteria 2964712639 2964712684 366
545 iso_pu_bacteria 2964719344 2964719555 366
546 iso_pu_bacteria 2967664464 2967671092 366
547 iso_pu_bacteria 2967671571 2967675582 366
548 iso_pu_bacteria 2967678726 2967681224 366
549 iso_pu_bacteria 2967686174 2967692451 366
550 iso_pu_bacteria 2967693043 2967699375 366
551 iso_pu_bacteria 2967699805 2967703193 366
552 iso_pu_bacteria 2967706974 2967713218 366
553 iso_pu_bacteria 2967714385 2967721172 366
554 iso_pu_bacteria 2967721400 2967724987 366
555 iso_pu_bacteria 2967728569 2967731808 366
556 iso_pu_bacteria 2967735183 2967738439 366
557 iso_pu_bacteria 2967742019 2967743594 366
558 iso_pu_bacteria 2967748971 2967753464 366
559 iso_pu_bacteria 2967755722 2967757514 366
560 iso_pu_bacteria 2967762386 2967765821 366
561 iso_pu_bacteria 2967769361 2967770370 366
562 iso_pu_bacteria 2967775926 2967782340 366
563 iso_pu_bacteria 2970019648 2970021964 366
564 iso_pu_bacteria 2970026789 2970028702 366
565 iso_pu_bacteria 2970033650 2970036674 366
566 iso_pu_bacteria 2970040964 2970046575 366
567 iso_pu_bacteria 2970047711 2970049648 366
568 iso_pu_bacteria 2970054988 2970058860 366
569 iso_pu_bacteria 2970061556 2970065361 366
570 iso_pu_bacteria 2970068827 2970070335 366
571 iso_pu_bacteria 2970076120 2970076743 366
572 iso_pu_bacteria 2970082768 2970083998 366
573 iso_pu_bacteria 2970088815 2970092767 366
574 iso_pu_bacteria 2970095765 2970101237 366
575 iso_pu_bacteria 2970102677 2970106941 366
576 iso_pu_bacteria 2970109326 2970111087 366
577 iso_pu_bacteria 2970116247 2970118350 366
578 iso_pu_bacteria 2970122695 2970124531 366
579 iso_pu_bacteria 2970129317 2970133546 366
580 iso_pu_bacteria 2970136068 2970142222 366
581 iso_pu_bacteria 2970143518 2970147311 366
582 iso_pu_bacteria 2970149975 2970151726 366
583 iso_pu_bacteria 2970156795 2970158684 366
584 iso_pu_bacteria 2970164137 2970170779 366
585 iso_pu_bacteria 2970170962 2970175045 366
586 iso_pu_bacteria 2970177841 2970182141 366
587 iso_pu_bacteria 2970184632 2970185541 366
588 iso_pu_bacteria 2970191845 2970197938 366
589 iso_pu_bacteria 2977516862 2977523757 366
590 iso_pu_bacteria 2977523885 2977525126 366
591 iso_pu_bacteria 2977530762 2977531176 366
592 iso_pu_bacteria 2977537788 2977544495 366
593 iso_pu_bacteria 2977544691 2977547173 366
594 iso_pu_bacteria 2977551784 2977558036 366
595 iso_pu_bacteria 2977558990 2977564748 366
596 iso_pu_bacteria 2977565890 2977571287 366
597 iso_pu_bacteria 2977572785 2977573810 366
598 iso_pu_bacteria 2977579622 2977585153 366
599 iso_pu_bacteria 2979089926 2979092626 366
600 iso_pu_bacteria 2979095461 2979099983 366
601 iso_pu_bacteria 2979100975 2979104598 366
602 iso_pu_bacteria 2984509177 2984513605 366
603 iso_pu_bacteria 2984518228 2984522815 366
604 iso_pu_bacteria 2984537506 2984542121 366
605 iso_pu_bacteria 2984601300 2984601551 366
606 iso_pu_bacteria 2989776772 2989780207 366
607 iso_pu_bacteria 2996887358 2996890352 366
608 iso_pu_bacteria 2996893221 2996897056 366
609 iso_pu_bacteria 3005409236 3005415937 366
610 iso_pu_bacteria 3005416602 3005416911 366
611 iso_pu_bacteria 3005445848 3005449820 366
612 iso_pu_bacteria 3005452660 3005456047 366
613 iso_pu_bacteria 639633055 639650584 366
614 iso_pu_bacteria 648276728 648737284 366
615 iso_pu_bacteria 8003570095 8003573682 366
616 iso_pu_bacteria 8003992118 8003995430 366
617 iso_pu_bacteria 8003999396 8004003190 366
618 iso_pu_bacteria 8005246636 8005249345 366
619 iso_pu_bacteria 8005258706 8005262535 366
620 iso_pu_bacteria 8005275841 8005282580 366
621 iso_pu_bacteria 8005282627 8005286605 366
622 iso_pu_bacteria 8005289223 8005295225 366
623 iso_pu_bacteria 8005301065 8005306101 366
624 iso_pu_bacteria 8005307578 8005309671 366
625 iso_pu_bacteria 8005314921 8005315885 366
626 iso_pu_bacteria 8005321885 8005324879 366
627 iso_pu_bacteria 8005376324 8005381419 366
628 iso_pu_bacteria 8005382845 8005387632 366
629 iso_pu_bacteria 8005395548 8005400663 366
630 iso_pu_bacteria 8005430974 8005431933 366
631 iso_pu_bacteria 8005460587 8005465259 366
632 iso_pu_bacteria 8005484373 8005486972 366
633 iso_pu_bacteria 8005497431 8005497835 366
634 iso_pu_bacteria 8005556819 8005561323 366
635 iso_pu_bacteria 8005563573 8005565946 366
636 iso_pu_bacteria 8005570704 8005571994 366
637 iso_pu_bacteria 8005619151 8005623570 366
638 iso_pu_bacteria 8005626139 8005630869 366
639 iso_pu_bacteria 8005645114 8005645169 366
640 iso_pu_bacteria 8005668836 8005669241 366
641 iso_pu_bacteria 8005682033 8005687385 366
642 iso_pu_bacteria 8005688590 8005694201 366
643 iso_pu_bacteria 8005695170 8005695852 366
644 iso_pu_bacteria 8018127388 8018128693 366
645 iso_pu_bacteria 8018163183 8018164939 366
646 iso_pu_bacteria 8018176218 8018177620 366
647 iso_pu_bacteria 8023680758 8023686702 366
648 iso_pu_bacteria 8024479707 8024484521 366
649 iso_pu_bacteria 8024486573 8024490989 366
650 iso_pu_bacteria 8024501048 8024502148 366
651 iso_pu_bacteria 8046767195 8046768395 366
652 iso_pu_bacteria 8049293176 8049296375 366
653 iso_pu_bacteria 8054558443 8054563307 366
654 iso_pu_bacteria 8055431914 8055432943 366
655 iso_pu_bacteria 8056375014 8056380555 366
656 iso_pu_bacteria 8056382006 8056383386 366
657 iso_pu_bacteria 8057575449 8057581936 366
658 iso_pu_bacteria 8057874678 8057879439 366
659 3300003771 Ga0055526_1000291 Ga0055526_100029133 367
660 3300003775 Ga0055524_1000068 Ga0055524_1000068131 367
661 3300005262 Ga0065165_1000143 Ga0065165_100014361 367
662 3300005471 Ga0070698_100321141 Ga0070698_1003211412 367
663 3300005937 Ga0081455_10001273 Ga0081455_1000127326 367
664 3300009545 Ga0105237_10310905 Ga0105237_103109052 367
665 3300025273 Ga0209673_1021903 Ga0209673_10219031 367
666 3300025284 Ga0209130_1000342 Ga0209130_100034246 367
667 3300025291 Ga0209675_1000819 Ga0209675_100081913 367
668 3300025294 Ga0209025_1004205 Ga0209025_100420510 367
669 3300025295 Ga0209564_1000041 Ga0209564_1000041272 367
670 3300025295 Ga0209564_1000065 Ga0209564_1000065231 367
671 3300025299 Ga0209256_1000014 Ga0209256_1000014132 367
672 3300025299 Ga0209256_1000266 Ga0209256_100026699 367
673 3300025302 Ga0207426_1023075 Ga0207426_10230752 367
674 3300028794 Ga0307515_10193442 Ga0307515_101934422 367
675 3300031250 Ga0265331_10066213 Ga0265331_100662132 367
676 3300036401 Ga0373937_0019984 Ga0373937_0019984_113_1234 367
677 3300037312 Ga0395899_0000288 Ga0395899_0000288_13610_14713 367
678 3300037418 Ga0395900_0000246 Ga0395900_0000246_13609_14712 367
679 3300037418 Ga0395900_0293807 Ga0395900_0293807_193_1296 367
680 3300037466 Ga0395898_0000447 Ga0395898_0000447_13608_14711 367
681 3300037471 Ga0395905_0000228 Ga0395905_0000228_70393_71496 367
682 3300038443 Ga0395901_0000167 Ga0395901_0000167_71133_72236 367
683 3300048913 Ga0496110_0285855 Ga0496110_0285855_79_1188 367
684 3300048917 Ga0496114_0119466 Ga0496114_0119466_892_2001 367
685 3300048920 Ga0496117_0020568 Ga0496117_0020568_2053_3162 367
686 3300048926 Ga0496123_0016752 Ga0496123_0016752_1806_2915 367
687 3300049570 Ga0501033_0103071 Ga0501033_0103071_610_1713 367
688 3300049572 Ga0501036_0116520 Ga0501036_0116520_1052_2155 367
689 3300049573 Ga0501037_0078465 Ga0501037_0078465_1212_2321 367
690 3300049575 Ga0501039_0044624 Ga0501039_0044624_242_1345 367
691 3300049576 Ga0501040_0024664 Ga0501040_0024664_1569_2672 367
692 3300049577 Ga0501041_0006354 Ga0501041_0006354_3951_5054 367
693 3300049581 Ga0501047_0099841 Ga0501047_0099841_1122_2225 367
694 3300049588 Ga0501072_0015322 Ga0501072_0015322_2253_3356 367
695 3300049591 Ga0501075_0000668 Ga0501075_0000668_11396_12499 367
696 3300049592 Ga0501076_0005133 Ga0501076_0005133_730_1833 367
697 3300049593 Ga0501077_0001833 Ga0501077_0001833_669_1772 367
698 3300049742 Ga0501080_0027940 Ga0501080_0027940_2449_3552 367
699 3300049743 Ga0501081_0001741 Ga0501081_0001741_9325_10428 367
700 3300049824 Ga0501045_0053846 Ga0501045_0053846_915_2018 367
701 3300053084 Ga0495595_0014098 Ga0495595_0014098_2014_3135 367
702 3300053084 Ga0495595_0044858 Ga0495595_0044858_65_1171 367
703 3300053085 Ga0495619_0017043 Ga0495619_0017043_751_1857 367
704 3300053156 Ga0500622_0016225 Ga0500622_0016225_173_1282 367
705 3300054114 Ga0501084_0000488 Ga0501084_0000488_25217_26320 367
706 3300005548 Ga0070665_100001650 Ga0070665_10000165028 368
707 3300005841 Ga0068863_100009117 Ga0068863_1000091174 368
708 3300006038 Ga0075365_10221104 Ga0075365_102211041 368
709 3300013102 Ga0157371_10004378 Ga0157371_100043785 368
710 3300013307 Ga0157372_10493487 Ga0157372_104934871 368
711 3300021358 Ga0213873_10026351 Ga0213873_100263511 368
712 3300021384 Ga0213876_10005281 Ga0213876_100052814 368
713 3300021388 Ga0213875_10009375 Ga0213875_100093752 368
714 3300026088 Ga0207641_10040375 Ga0207641_100403753 368
715 3300028379 Ga0268266_10003484 Ga0268266_1000348417 368
716 3300031733 Ga0316577_10187234 Ga0316577_101872341 368
717 3300031901 Ga0307406_10004006 Ga0307406_100040063 368
718 3300035088 Ga0373940_0003021 Ga0373940_0003021_477_1583 368
719 3300037853 Ga0436364_0469239 Ga0436364_0469239_1781_2890 368
720 3300039437 Ga0436365_0307172 Ga0436365_0307172_266_1375 368
721 3300039453 Ga0436362_1144778 Ga0436362_1144778_362_1471 368
722 3300046455 Ga0495603_0052773 Ga0495603_0052773_917_2023 368
723 3300046616 Ga0495668_0050542 Ga0495668_0050542_517_1623 368
724 3300047472 Ga0495686_0074514 Ga0495686_0074514_872_1978 368
725 3300048919 Ga0496116_0000057 Ga0496116_0000057_165329_166435 368
726 3300048920 Ga0496117_0181360 Ga0496117_0181360_80_1186 368
727 3300048929 Ga0496126_0000115 Ga0496126_0000115_165240_166346 368
728 3300048929 Ga0496126_0171418 Ga0496126_0171418_717_1823 368
729 3300049568 Ga0501031_0000064 Ga0501031_0000064_19533_20639 368
730 3300049568 Ga0501031_0002368 Ga0501031_0002368_9703_10809 368
731 3300049569 Ga0501032_0000001 Ga0501032_0000001_56051_57157 368
732 3300049569 Ga0501032_0000006 Ga0501032_0000006_6482_7588 368
733 3300049570 Ga0501033_0000053 Ga0501033_0000053_19533_20639 368
734 3300049570 Ga0501033_0000077 Ga0501033_0000077_22857_23963 368
735 3300049571 Ga0501034_0000023 Ga0501034_0000023_89933_91039 368
736 3300049571 Ga0501034_0000030 Ga0501034_0000030_227542_228648 368
737 3300049571 Ga0501034_0250005 Ga0501034_0250005_550_1656 368
738 3300049572 Ga0501036_0000003 Ga0501036_0000003_254140_255246 368
739 3300049572 Ga0501036_0000482 Ga0501036_0000482_3720_4826 368
740 3300049573 Ga0501037_0000003 Ga0501037_0000003_254140_255246 368
741 3300049573 Ga0501037_0000065 Ga0501037_0000065_94219_95325 368
742 3300049574 Ga0501038_0000004 Ga0501038_0000004_254140_255246 368
743 3300049574 Ga0501038_0000043 Ga0501038_0000043_51804_52910 368
744 3300049574 Ga0501038_0050273 Ga0501038_0050273_173_1279 368
745 3300049575 Ga0501039_0000008 Ga0501039_0000008_254140_255246 368
746 3300049575 Ga0501039_0000022 Ga0501039_0000022_121404_122510 368
747 3300049579 Ga0501043_0000310 Ga0501043_0000310_35758_36864 368
748 3300049579 Ga0501043_0000365 Ga0501043_0000365_5315_6421 368
749 3300049581 Ga0501047_0008720 Ga0501047_0008720_2858_3964 368
750 3300049581 Ga0501047_0180703 Ga0501047_0180703_390_1496 368
751 3300049581 Ga0501047_0235623 Ga0501047_0235623_366_1472 368
752 3300049583 Ga0501067_0004739 Ga0501067_0004739_2856_3962 368
753 3300049583 Ga0501067_0012913 Ga0501067_0012913_2226_3332 368
754 3300049586 Ga0501070_0142952 Ga0501070_0142952_686_1792 368
755 3300049744 Ga0501083_0045436 Ga0501083_0045436_1252_2358 368
756 3300049822 Ga0501035_0000031 Ga0501035_0000031_154953_156059 368
757 3300049822 Ga0501035_0000234 Ga0501035_0000234_63063_64169 368
758 3300049822 Ga0501035_0174975 Ga0501035_0174975_619_1725 368
759 3300049822 Ga0501035_0179733 Ga0501035_0179733_396_1502 368
760 3300049823 Ga0501044_0000008 Ga0501044_0000008_254140_255246 368
761 3300049823 Ga0501044_0003116 Ga0501044_0003116_133_1239 368
762 3300053178 Ga0500637_0008150 Ga0500637_0008150_2310_3416 368
763 3300054114 Ga0501084_0031365 Ga0501084_0031365_1672_2778 368
764 3300054114 Ga0501084_0055846 Ga0501084_0055846_1430_2536 368
765 3300061719 Ga0466962_0064336 Ga0466962_0064336_466_1572 368
766 3300003203 JGI25406J46586_10047626 JGI25406J46586_100476261 369
767 3300003781 Ga0055536_1002919 Ga0055536_10029195 369
768 3300003794 Ga0055531_10005829 Ga0055531_100058296 369
769 3300005548 Ga0070665_100039375 Ga0070665_1000393753 369
770 3300005985 Ga0081539_10000690 Ga0081539_1000069020 369
771 3300006038 Ga0075365_10015844 Ga0075365_100158441 369
772 3300006051 Ga0075364_10000006 Ga0075364_1000000651 369
773 3300013104 Ga0157370_10163666 Ga0157370_101636663 369
774 3300025292 Ga0209676_1015294 Ga0209676_10152942 369
775 3300025297 Ga0209758_1000406 Ga0209758_100040619 369
776 3300025298 Ga0209050_1006418 Ga0209050_10064182 369
777 3300025303 Ga0209051_1001684 Ga0209051_10016847 369
778 3300025304 Ga0209257_1001639 Ga0209257_100163922 369
779 3300028379 Ga0268266_10033539 Ga0268266_100335393 369
780 3300031247 Ga0265340_10001914 Ga0265340_1000191411 369
781 3300031247 Ga0265340_10004381 Ga0265340_100043813 369
782 3300031249 Ga0265339_10005618 Ga0265339_100056185 369
783 3300031344 Ga0265316_10004581 Ga0265316_100045816 369
784 3300031595 Ga0265313_10002093 Ga0265313_1000209314 369
785 3300031712 Ga0265342_10009718 Ga0265342_100097187 369
786 3300046512 Ga0495610_0048670 Ga0495610_0048670_218_1330 369
787 3300046517 Ga0495630_0036316 Ga0495630_0036316_1140_2249 369
788 3300047471 Ga0495684_0224847 Ga0495684_0224847_164_1291 369
789 3300048905 Ga0496102_0345135 Ga0496102_0345135_192_1301 369
790 3300048914 Ga0496111_0033578 Ga0496111_0033578_752_1861 369
791 3300048922 Ga0496119_0000806 Ga0496119_0000806_39120_40235 369
792 3300048925 Ga0496122_0000082 Ga0496122_0000082_109021_110130 369
793 3300048925 Ga0496122_0006697 Ga0496122_0006697_1627_2742 369
794 3300048925 Ga0496122_0022034 Ga0496122_0022034_4540_5649 369
795 3300048926 Ga0496123_0000067 Ga0496123_0000067_99030_100139 369
796 3300048926 Ga0496123_0001298 Ga0496123_0001298_21716_22831 369
797 3300049571 Ga0501034_0267162 Ga0501034_0267162_261_1640 369
798 3300049573 Ga0501037_0083175 Ga0501037_0083175_1035_2144 369
799 3300049573 Ga0501037_0103264 Ga0501037_0103264_190_1299 369
800 3300049581 Ga0501047_0081069 Ga0501047_0081069_465_1772 369
801 3300049589 Ga0501073_0123636 Ga0501073_0123636_368_1477 369
802 3300049742 Ga0501080_0049498 Ga0501080_0049498_2617_3726 369
803 3300049744 Ga0501083_0011274 Ga0501083_0011274_3443_4552 369
804 3300050491 nmdc:mga00v17_89_c1 nmdc:mga00v17_89_c1_31909_33018 369
805 3300053104 Ga0500556_0000160 Ga0500556_0000160_23109_24224 369
806 3300053125 Ga0500618_000573 Ga0500618_000573_3779_4888 369
807 3300053153 Ga0500616_0000583 Ga0500616_0000583_39482_40591 369
808 3300060353 Ga0501082_0037839 Ga0501082_0037839_985_2094 369
809 3300001979 JGI24740J21852_10004991 JGI24740J21852_100049914 370
810 3300002705 JGI25156J39149_1000770 JGI25156J39149_10007705 370
811 3300002737 JGI25162J39368_1000253 JGI25162J39368_100025330 370
812 3300002737 JGI25162J39368_1000485 JGI25162J39368_10004854 370
813 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006971 370
814 3300002739 JGI25158J39367_1000014 JGI25158J39367_100001443 370
815 3300002741 JGI25157J39369_1000108 JGI25157J39369_100010811 370
816 3300002773 JGI25152J39213_1000644 JGI25152J39213_100064413 370
817 3300002773 JGI25152J39213_1001505 JGI25152J39213_10015054 370
818 3300002773 JGI25152J39213_1002615 JGI25152J39213_10026152 370
819 3300002773 JGI25152J39213_1006872 JGI25152J39213_10068722 370
820 3300002773 JGI25152J39213_1007167 JGI25152J39213_10071672 370
821 3300002774 JGI25150J39212_1000018 JGI25150J39212_1000018134 370
822 3300002774 JGI25150J39212_1006130 JGI25150J39212_10061302 370
823 3300002987 JGI25159J45721_1000388 JGI25159J45721_10003882 370
824 3300002987 JGI25159J45721_1000604 JGI25159J45721_100060411 370
825 3300003187 JGI25151J46595_10000034 JGI25151J46595_1000003446 370
826 3300003187 JGI25151J46595_10000939 JGI25151J46595_100009399 370
827 3300003187 JGI25151J46595_10029230 JGI25151J46595_100292302 370
828 3300003214 JGI25165J46597_1000536 JGI25165J46597_10005369 370
829 3300003214 JGI25165J46597_1001214 JGI25165J46597_100121411 370
830 3300003214 JGI25165J46597_1004655 JGI25165J46597_10046551 370
831 3300003215 JGI25153J46596_10001791 JGI25153J46596_100017917 370
832 3300003215 JGI25153J46596_10006280 JGI25153J46596_100062803 370
833 3300003215 JGI25153J46596_10016095 JGI25153J46596_100160952 370
834 3300003215 JGI25153J46596_10016737 JGI25153J46596_100167372 370
835 3300003215 JGI25153J46596_10042669 JGI25153J46596_100426691 370
836 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005190 370
837 3300003354 JGI25160J50197_1021530 JGI25160J50197_10215302 370
838 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011104 370
839 3300003374 JGI25161J50226_1000038 JGI25161J50226_100003827 370
840 3300003374 JGI25161J50226_1001915 JGI25161J50226_10019154 370
841 3300003771 Ga0055526_1014670 Ga0055526_10146703 370
842 3300003771 Ga0055526_1024598 Ga0055526_10245981 370
843 3300003775 Ga0055524_1007723 Ga0055524_10077233 370
844 3300003790 Ga0055528_1000884 Ga0055528_10008845 370
845 3300003792 Ga0055540_1001428 Ga0055540_100142813 370
846 3300003792 Ga0055540_1001541 Ga0055540_10015418 370
847 3300003856 Ga0058692_1007084 Ga0058692_10070842 370
848 3300004625 Ga0055543_1000041 Ga0055543_100004115 370
849 3300004625 Ga0055543_1000317 Ga0055543_10003177 370
850 3300004625 Ga0055543_1000416 Ga0055543_100041617 370
851 3300005262 Ga0065165_1000135 Ga0065165_1000135104 370
852 3300005262 Ga0065165_1010220 Ga0065165_10102203 370
853 3300005331 Ga0070670_100000711 Ga0070670_1000007114 370
854 3300005337 Ga0070682_100109642 Ga0070682_1001096421 370
855 3300005439 Ga0070711_100045468 Ga0070711_1000454682 370
856 3300005441 Ga0070700_100028466 Ga0070700_1000284664 370
857 3300005455 Ga0070663_100014911 Ga0070663_1000149114 370
858 3300005530 Ga0070679_100026302 Ga0070679_1000263022 370
859 3300005536 Ga0070697_100000401 Ga0070697_10000040112 370
860 3300005539 Ga0068853_100025986 Ga0068853_1000259865 370
861 3300005545 Ga0070695_100003726 Ga0070695_1000037266 370
862 3300005547 Ga0070693_100009265 Ga0070693_1000092653 370
863 3300005564 Ga0070664_100082344 Ga0070664_1000823442 370
864 3300005615 Ga0070702_100014888 Ga0070702_1000148884 370
865 3300005983 Ga0081540_1000012 Ga0081540_1000012152 370
866 3300006038 Ga0075365_10000401 Ga0075365_1000040113 370
867 3300006038 Ga0075365_10002608 Ga0075365_100026086 370
868 3300006042 Ga0075368_10032369 Ga0075368_100323692 370
869 3300006051 Ga0075364_10051049 Ga0075364_100510491 370
870 3300006173 Ga0070716_100027093 Ga0070716_1000270932 370
871 3300006175 Ga0070712_100177143 Ga0070712_1001771432 370
872 3300006177 Ga0075362_10073512 Ga0075362_100735121 370
873 3300006178 Ga0075367_10001646 Ga0075367_100016464 370
874 3300006178 Ga0075367_10044097 Ga0075367_100440972 370
875 3300006186 Ga0075369_10000585 Ga0075369_100005852 370
876 3300006186 Ga0075369_10014152 Ga0075369_100141522 370
877 3300006353 Ga0075370_10003721 Ga0075370_100037219 370
878 3300006844 Ga0075428_100063506 Ga0075428_1000635064 370
879 3300006844 Ga0075428_100109140 Ga0075428_1001091402 370
880 3300006847 Ga0075431_100010527 Ga0075431_1000105275 370
881 3300006914 Ga0075436_100000298 Ga0075436_1000002986 370
882 3300006946 Ga0079104_1001513 Ga0079104_10015135 370
883 3300006948 Ga0099826_10000089 Ga0099826_1000008934 370
884 3300006948 Ga0099826_10034388 Ga0099826_100343882 370
885 3300007076 Ga0075435_100010189 Ga0075435_1000101894 370
886 3300009093 Ga0105240_10000142 Ga0105240_1000014246 370
887 3300009094 Ga0111539_10003050 Ga0111539_1000305017 370
888 3300009094 Ga0111539_10271925 Ga0111539_102719252 370
889 3300009147 Ga0114129_10015821 Ga0114129_100158214 370
890 3300009147 Ga0114129_10548344 Ga0114129_105483441 370
891 3300009148 Ga0105243_10019587 Ga0105243_100195872 370
892 3300009177 Ga0105248_10110705 Ga0105248_101107052 370
893 3300009177 Ga0105248_10190440 Ga0105248_101904402 370
894 3300009545 Ga0105237_10002652 Ga0105237_1000265211 370
895 3300009545 Ga0105237_10305489 Ga0105237_103054892 370
896 3300009765 Ga0123341_1021682 Ga0123341_10216822 370
897 3300009766 Ga0123342_1009626 Ga0123342_10096263 370
898 3300009766 Ga0123342_1028163 Ga0123342_10281632 370
899 3300010375 Ga0105239_10001079 Ga0105239_1000107921 370
900 3300011119 Ga0105246_10006247 Ga0105246_100062472 370
901 3300011119 Ga0105246_10067150 Ga0105246_100671502 370
902 3300013100 Ga0157373_10007198 Ga0157373_100071982 370
903 3300013104 Ga0157370_10000079 Ga0157370_100000793 370
904 3300013104 Ga0157370_10000855 Ga0157370_1000085528 370
905 3300014325 Ga0163163_10009451 Ga0163163_100094515 370
906 3300014968 Ga0157379_10213175 Ga0157379_102131752 370
907 3300015262 Ga0182007_10019600 Ga0182007_100196002 370
908 3300021320 Ga0214544_1005528 Ga0214544_10055282 370
909 3300021321 Ga0214542_1005348 Ga0214542_100534815 370
910 3300021321 Ga0214542_1012986 Ga0214542_10129867 370
911 3300021327 Ga0214543_1000015 Ga0214543_1000015167 370
912 3300021327 Ga0214543_1005096 Ga0214543_100509615 370
913 3300021377 Ga0213874_10010562 Ga0213874_100105622 370
914 3300021388 Ga0213875_10042001 Ga0213875_100420012 370
915 3300022739 Ga0228711_1000004 Ga0228711_1000004209 370
916 3300022740 Ga0228710_1000002 Ga0228710_1000002157 370
917 3300025206 Ga0209435_100031 Ga0209435_10003154 370
918 3300025208 Ga0209436_100013 Ga0209436_10001326 370
919 3300025228 Ga0209672_103539 Ga0209672_1035392 370
920 3300025233 Ga0209437_100179 Ga0209437_10017995 370
921 3300025233 Ga0209437_100181 Ga0209437_10018193 370
922 3300025245 Ga0207425_1000035 Ga0207425_100003569 370
923 3300025245 Ga0207425_1004487 Ga0207425_10044873 370
924 3300025245 Ga0207425_1009575 Ga0207425_10095751 370
925 3300025246 Ga0209646_1000102 Ga0209646_100010254 370
926 3300025246 Ga0209646_1004214 Ga0209646_10042141 370
927 3300025250 Ga0209026_1000096 Ga0209026_100009654 370
928 3300025253 Ga0209677_100455 Ga0209677_10045511 370
929 3300025256 Ga0209759_1000090 Ga0209759_100009054 370
930 3300025256 Ga0209759_1017442 Ga0209759_10174422 370
931 3300025258 Ga0209129_1000029 Ga0209129_100002969 370
932 3300025258 Ga0209129_1000050 Ga0209129_100005096 370
933 3300025258 Ga0209129_1000377 Ga0209129_10003779 370
934 3300025258 Ga0209129_1001450 Ga0209129_100145012 370
935 3300025258 Ga0209129_1001464 Ga0209129_10014647 370
936 3300025258 Ga0209129_1003105 Ga0209129_10031055 370
937 3300025258 Ga0209129_1003160 Ga0209129_10031601 370
938 3300025261 Ga0209233_1000185 Ga0209233_100018594 370
939 3300025261 Ga0209233_1000212 Ga0209233_100021231 370
940 3300025261 Ga0209233_1000445 Ga0209233_100044527 370
941 3300025273 Ga0209673_1000033 Ga0209673_100003396 370
942 3300025273 Ga0209673_1000050 Ga0209673_1000050166 370
943 3300025273 Ga0209673_1000476 Ga0209673_100047623 370
944 3300025273 Ga0209673_1001553 Ga0209673_100155314 370
945 3300025273 Ga0209673_1003936 Ga0209673_10039367 370
946 3300025273 Ga0209673_1005022 Ga0209673_10050226 370
947 3300025273 Ga0209673_1005150 Ga0209673_10051508 370
948 3300025273 Ga0209673_1029073 Ga0209673_10290731 370
949 3300025284 Ga0209130_1000009 Ga0209130_100000997 370
950 3300025284 Ga0209130_1000058 Ga0209130_100005891 370
951 3300025292 Ga0209676_1025353 Ga0209676_10253532 370
952 3300025294 Ga0209025_1000132 Ga0209025_1000132137 370
953 3300025294 Ga0209025_1000453 Ga0209025_100045335 370
954 3300025294 Ga0209025_1001274 Ga0209025_100127430 370
955 3300025294 Ga0209025_1001429 Ga0209025_100142910 370
956 3300025294 Ga0209025_1002399 Ga0209025_10023997 370
957 3300025294 Ga0209025_1003718 Ga0209025_10037183 370
958 3300025294 Ga0209025_1029766 Ga0209025_10297662 370
959 3300025295 Ga0209564_1000227 Ga0209564_100022732 370
960 3300025295 Ga0209564_1000284 Ga0209564_100028437 370
961 3300025295 Ga0209564_1000894 Ga0209564_100089423 370
962 3300025295 Ga0209564_1004855 Ga0209564_10048552 370
963 3300025297 Ga0209758_1000255 Ga0209758_100025534 370
964 3300025297 Ga0209758_1000563 Ga0209758_100056323 370
965 3300025297 Ga0209758_1000780 Ga0209758_100078012 370
966 3300025297 Ga0209758_1001039 Ga0209758_10010399 370
967 3300025297 Ga0209758_1001297 Ga0209758_100129732 370
968 3300025297 Ga0209758_1004746 Ga0209758_10047468 370
969 3300025297 Ga0209758_1024172 Ga0209758_10241722 370
970 3300025298 Ga0209050_1010967 Ga0209050_10109673 370
971 3300025299 Ga0209256_1001149 Ga0209256_100114925 370
972 3300025299 Ga0209256_1002933 Ga0209256_10029332 370
973 3300025299 Ga0209256_1003784 Ga0209256_100378410 370
974 3300025302 Ga0207426_1000041 Ga0207426_100004135 370
975 3300025302 Ga0207426_1000131 Ga0207426_100013191 370
976 3300025302 Ga0207426_1000214 Ga0207426_100021498 370
977 3300025302 Ga0207426_1000798 Ga0207426_100079825 370
978 3300025303 Ga0209051_1000118 Ga0209051_100011848 370
979 3300025303 Ga0209051_1004711 Ga0209051_10047111 370
980 3300025303 Ga0209051_1004805 Ga0209051_10048056 370
981 3300025304 Ga0209257_1006038 Ga0209257_10060387 370
982 3300025913 Ga0207695_10000234 Ga0207695_1000023447 370
983 3300025914 Ga0207671_10000043 Ga0207671_1000004321 370
984 3300025914 Ga0207671_10148460 Ga0207671_101484602 370
985 3300025915 Ga0207693_10004461 Ga0207693_1000446110 370
986 3300025916 Ga0207663_10054708 Ga0207663_100547082 370
987 3300025925 Ga0207650_10001757 Ga0207650_100017575 370
988 3300025929 Ga0207664_10027534 Ga0207664_100275343 370
989 3300025939 Ga0207665_10027798 Ga0207665_100277984 370
990 3300025941 Ga0207711_10169391 Ga0207711_101693912 370
991 3300025945 Ga0207679_10209680 Ga0207679_102096802 370
992 3300025972 Ga0207668_10200000 Ga0207668_102000002 370
993 3300026041 Ga0207639_10036187 Ga0207639_100361873 370
994 3300026067 Ga0207678_10000231 Ga0207678_1000023124 370
995 3300026067 Ga0207678_10285375 Ga0207678_102853752 370
996 3300026075 Ga0207708_10046003 Ga0207708_100460034 370
997 3300027111 Ga0209281_1000030 Ga0209281_1000030102 370
998 3300027111 Ga0209281_1000144 Ga0209281_100014462 370
999 3300027312 Ga0209371_1000037 Ga0209371_1000037232 370
1000 3300027312 Ga0209371_1002602 Ga0209371_10026022 370
1001 3300027312 Ga0209371_1005786 Ga0209371_10057863 370
1002 3300027666 Ga0209282_1000004 Ga0209282_1000004102 370
1003 3300027666 Ga0209282_1000960 Ga0209282_100096010 370
1004 3300027666 Ga0209282_1037870 Ga0209282_10378702 370
1005 3300027866 Ga0209813_10000521 Ga0209813_1000052111 370
1006 3300028794 Ga0307515_10001049 Ga0307515_1000104947 370
1007 3300028794 Ga0307515_10002808 Ga0307515_1000280827 370
1008 3300030500 Ga0268256_1000039 Ga0268256_100003976 370
1009 3300030500 Ga0268256_1005001 Ga0268256_10050013 370
1010 3300030500 Ga0268256_1020498 Ga0268256_10204981 370
1011 3300031239 Ga0265328_10000806 Ga0265328_100008065 370
1012 3300031250 Ga0265331_10046737 Ga0265331_100467372 370
1013 3300031548 Ga0307408_100086903 Ga0307408_1000869032 370
1014 3300031711 Ga0265314_10059431 Ga0265314_100594312 370
1015 3300031852 Ga0307410_10379912 Ga0307410_103799121 370
1016 3300031901 Ga0307406_10001514 Ga0307406_100015146 370
1017 3300031911 Ga0307412_10131130 Ga0307412_101311302 370
1018 3300031967 Ga0315914_1000001 Ga0315914_1000001281 370
1019 3300031995 Ga0307409_100021452 Ga0307409_1000214523 370
1020 3300031995 Ga0307409_100367464 Ga0307409_1003674641 370
1021 3300032126 Ga0307415_100037032 Ga0307415_1000370324 370
1022 3300033430 Ga0315913_1000004 Ga0315913_100000420 370
1023 3300033464 Ga0315915_1000002 Ga0315915_1000002103 370
1024 3300034819 Ga0373958_0002411 Ga0373958_0002411_1357_2469 370
1025 3300034820 Ga0373959_0006566 Ga0373959_0006566_603_1715 370
1026 3300034957 Ga0373938_0002090 Ga0373938_0002090_1840_2952 370
1027 3300035092 Ga0373952_0013131 Ga0373952_0013131_439_1551 370
1028 3300035170 Ga0373943_0013738 Ga0373943_0013738_961_2073 370
1029 3300035170 Ga0373943_0070322 Ga0373943_0070322_125_1237 370
1030 3300035171 Ga0373946_0008626 Ga0373946_0008626_1384_2496 370
1031 3300035207 Ga0373942_0008587 Ga0373942_0008587_334_1446 370
1032 3300035241 Ga0373961_0001703 Ga0373961_0001703_3083_4195 370
1033 3300035242 Ga0373962_0018219 Ga0373962_0018219_283_1395 370
1034 3300035691 Ga0373931_0035801 Ga0373931_0035801_172_1284 370
1035 3300035692 Ga0373935_0087224 Ga0373935_0087224_233_1345 370
1036 3300035695 Ga0373927_0046776 Ga0373927_0046776_1122_2234 370
1037 3300035725 Ga0373947_0027685 Ga0373947_0027685_1800_2912 370
1038 3300037312 Ga0395899_0064282 Ga0395899_0064282_1484_2596 370
1039 3300037418 Ga0395900_0017621 Ga0395900_0017621_980_2095 370
1040 3300037466 Ga0395898_0242408 Ga0395898_0242408_579_1694 370
1041 3300037853 Ga0436364_0095273 Ga0436364_0095273_988_2109 370
1042 3300038443 Ga0395901_0011053 Ga0395901_0011053_7383_8495 370
1043 3300039437 Ga0436365_1156422 Ga0436365_1156422_965_2077 370
1044 3300039438 Ga0436360_0420029 Ga0436360_0420029_97_1209 370
1045 3300041404 Ga0439436_0002227 Ga0439436_0002227_4107_5219 370
1046 3300041492 Ga0451835_0131822 Ga0451835_0131822_973_2085 370
1047 3300041509 Ga0451843_0374774 Ga0451843_0374774_373_1485 370
1048 3300042007 Ga0439449_0001844 Ga0439449_0001844_6967_8079 370
1049 3300042007 Ga0439449_0045378 Ga0439449_0045378_374_1486 370
1050 3300044683 Ga0466965_0001568 Ga0466965_0001568_1589_2701 370
1051 3300044735 Ga0466968_0017536 Ga0466968_0017536_1546_2658 370
1052 3300044765 Ga0466970_0009635 Ga0466970_0009635_3423_4535 370
1053 3300046459 Ga0495629_0046729 Ga0495629_0046729_41_1153 370
1054 3300046459 Ga0495629_0051882 Ga0495629_0051882_522_1634 370
1055 3300046460 Ga0495638_0000110 Ga0495638_0000110_28337_29449 370
1056 3300046460 Ga0495638_0022742 Ga0495638_0022742_1836_2948 370
1057 3300046463 Ga0495653_0093160 Ga0495653_0093160_912_2024 370
1058 3300046476 Ga0495662_0026233 Ga0495662_0026233_251_1363 370
1059 3300046477 Ga0495664_0000434 Ga0495664_0000434_4455_5567 370
1060 3300046512 Ga0495610_0001935 Ga0495610_0001935_13234_14346 370
1061 3300046522 Ga0495643_0015274 Ga0495643_0015274_2448_3560 370
1062 3300046524 Ga0495648_0097720 Ga0495648_0097720_425_1537 370
1063 3300046529 Ga0495652_0028653 Ga0495652_0028653_2069_3181 370
1064 3300046531 Ga0495665_0106603 Ga0495665_0106603_22_1134 370
1065 3300046533 Ga0495640_0003016 Ga0495640_0003016_10607_11719 370
1066 3300046535 Ga0495586_0004850 Ga0495586_0004850_5925_7037 370
1067 3300046543 Ga0495645_0000746 Ga0495645_0000746_13130_14242 370
1068 3300046557 Ga0495622_0024841 Ga0495622_0024841_181_1293 370
1069 3300046642 Ga0495634_0064876 Ga0495634_0064876_465_1577 370
1070 3300046660 Ga0495625_0064017 Ga0495625_0064017_302_1414 370
1071 3300046663 Ga0495635_0018303 Ga0495635_0018303_2532_3644 370
1072 3300046681 Ga0495647_0070964 Ga0495647_0070964_74_1186 370
1073 3300046689 Ga0495613_0066634 Ga0495613_0066634_1023_2135 370
1074 3300046690 Ga0495624_0023367 Ga0495624_0023367_221_1333 370
1075 3300046694 Ga0495649_0070966 Ga0495649_0070966_418_1530 370
1076 3300046810 Ga0495660_0062980 Ga0495660_0062980_317_1429 370
1077 3300047315 Ga0495581_0072176 Ga0495581_0072176_105_1217 370
1078 3300047317 Ga0495604_0206357 Ga0495604_0206357_105_1217 370
1079 3300047319 Ga0495674_0003969 Ga0495674_0003969_10704_11816 370
1080 3300047471 Ga0495684_0018874 Ga0495684_0018874_3260_4372 370
1081 3300047472 Ga0495686_0001104 Ga0495686_0001104_5066_6178 370
1082 3300047472 Ga0495686_0014411 Ga0495686_0014411_3739_4851 370
1083 3300048903 Ga0496100_0151761 Ga0496100_0151761_224_1342 370
1084 3300048905 Ga0496102_0008097 Ga0496102_0008097_4331_5443 370
1085 3300048907 Ga0496104_0072583 Ga0496104_0072583_223_1335 370
1086 3300048908 Ga0496105_0005515 Ga0496105_0005515_4343_5461 370
1087 3300048908 Ga0496105_0042963 Ga0496105_0042963_669_1781 370
1088 3300048909 Ga0496106_0002165 Ga0496106_0002165_11205_12317 370
1089 3300048911 Ga0496108_0015803 Ga0496108_0015803_4958_6076 370
1090 3300048912 Ga0496109_0000839 Ga0496109_0000839_7885_9003 370
1091 3300048913 Ga0496110_0050718 Ga0496110_0050718_2073_3185 370
1092 3300048913 Ga0496110_0394571 Ga0496110_0394571_85_1197 370
1093 3300048914 Ga0496111_0002183 Ga0496111_0002183_4327_5439 370
1094 3300048915 Ga0496112_0022574 Ga0496112_0022574_581_1699 370
1095 3300048916 Ga0496113_0011161 Ga0496113_0011161_581_1699 370
1096 3300048916 Ga0496113_0106304 Ga0496113_0106304_491_1609 370
1097 3300048917 Ga0496114_0085342 Ga0496114_0085342_1280_2395 370
1098 3300048917 Ga0496114_0087202 Ga0496114_0087202_391_1503 370
1099 3300048918 Ga0496115_0008711 Ga0496115_0008711_2002_3120 370
1100 3300048918 Ga0496115_0304758 Ga0496115_0304758_87_1205 370
1101 3300048919 Ga0496116_0002318 Ga0496116_0002318_892_2004 370
1102 3300048919 Ga0496116_0019030 Ga0496116_0019030_2106_3218 370
1103 3300048919 Ga0496116_0020748 Ga0496116_0020748_3447_4559 370
1104 3300048919 Ga0496116_0041103 Ga0496116_0041103_971_2083 370
1105 3300048919 Ga0496116_0044265 Ga0496116_0044265_1866_2978 370
1106 3300048919 Ga0496116_0053222 Ga0496116_0053222_1486_2598 370
1107 3300048919 Ga0496116_0143395 Ga0496116_0143395_54_1166 370
1108 3300048920 Ga0496117_0000031 Ga0496117_0000031_275175_276287 370
1109 3300048920 Ga0496117_0003198 Ga0496117_0003198_15055_16167 370
1110 3300048920 Ga0496117_0034978 Ga0496117_0034978_2268_3380 370
1111 3300048921 Ga0496118_0000208 Ga0496118_0000208_19576_20688 370
1112 3300048921 Ga0496118_0003362 Ga0496118_0003362_14675_15787 370
1113 3300048921 Ga0496118_0029801 Ga0496118_0029801_1282_2394 370
1114 3300048922 Ga0496119_0004232 Ga0496119_0004232_5023_6135 370
1115 3300048922 Ga0496119_0004341 Ga0496119_0004341_9286_10398 370
1116 3300048922 Ga0496119_0029169 Ga0496119_0029169_1903_3015 370
1117 3300048923 Ga0496120_0001041 Ga0496120_0001041_26361_27473 370
1118 3300048923 Ga0496120_0007227 Ga0496120_0007227_3351_4463 370
1119 3300048924 Ga0496121_0000034 Ga0496121_0000034_115022_116134 370
1120 3300048924 Ga0496121_0002668 Ga0496121_0002668_13855_14967 370
1121 3300048924 Ga0496121_0080886 Ga0496121_0080886_1447_2559 370
1122 3300048925 Ga0496122_0000023 Ga0496122_0000023_275163_276275 370
1123 3300048925 Ga0496122_0007207 Ga0496122_0007207_4455_5567 370
1124 3300048925 Ga0496122_0026691 Ga0496122_0026691_1157_2269 370
1125 3300048925 Ga0496122_0081780 Ga0496122_0081780_1097_2209 370
1126 3300048925 Ga0496122_0114119 Ga0496122_0114119_447_1559 370
1127 3300048926 Ga0496123_0000027 Ga0496123_0000027_104761_105873 370
1128 3300048926 Ga0496123_0026186 Ga0496123_0026186_1277_2389 370
1129 3300048926 Ga0496123_0026533 Ga0496123_0026533_1229_2341 370
1130 3300048926 Ga0496123_0028835 Ga0496123_0028835_2805_3917 370
1131 3300048927 Ga0496124_0000174 Ga0496124_0000174_124200_125312 370
1132 3300048927 Ga0496124_0007057 Ga0496124_0007057_2014_3126 370
1133 3300048927 Ga0496124_0015700 Ga0496124_0015700_1316_2428 370
1134 3300048927 Ga0496124_0016245 Ga0496124_0016245_1305_2417 370
1135 3300048927 Ga0496124_0041570 Ga0496124_0041570_1246_2358 370
1136 3300048927 Ga0496124_0046198 Ga0496124_0046198_2557_3669 370
1137 3300048927 Ga0496124_0083378 Ga0496124_0083378_1495_2607 370
1138 3300048927 Ga0496124_0127019 Ga0496124_0127019_563_1675 370
1139 3300048928 Ga0496125_0000030 Ga0496125_0000030_258362_259474 370
1140 3300048928 Ga0496125_0003344 Ga0496125_0003344_3411_4523 370
1141 3300048928 Ga0496125_0005733 Ga0496125_0005733_10682_11794 370
1142 3300048928 Ga0496125_0008873 Ga0496125_0008873_5993_7174 370
1143 3300048928 Ga0496125_0083844 Ga0496125_0083844_1045_2157 370
1144 3300048929 Ga0496126_0043592 Ga0496126_0043592_509_1621 370
1145 3300048929 Ga0496126_0058720 Ga0496126_0058720_93_1205 370
1146 3300048929 Ga0496126_0170453 Ga0496126_0170453_717_1829 370
1147 3300049568 Ga0501031_0201824 Ga0501031_0201824_136_1248 370
1148 3300049569 Ga0501032_0016646 Ga0501032_0016646_1754_2869 370
1149 3300049570 Ga0501033_0000120 Ga0501033_0000120_64679_65791 370
1150 3300049571 Ga0501034_0000166 Ga0501034_0000166_105722_106837 370
1151 3300049571 Ga0501034_0000702 Ga0501034_0000702_42920_44032 370
1152 3300049571 Ga0501034_0035613 Ga0501034_0035613_3824_4948 370
1153 3300049572 Ga0501036_0020693 Ga0501036_0020693_2993_4108 370
1154 3300049573 Ga0501037_0003608 Ga0501037_0003608_7810_8925 370
1155 3300049574 Ga0501038_0125249 Ga0501038_0125249_420_1535 370
1156 3300049575 Ga0501039_0000758 Ga0501039_0000758_17521_18636 370
1157 3300049576 Ga0501040_0028701 Ga0501040_0028701_1601_2716 370
1158 3300049579 Ga0501043_0040770 Ga0501043_0040770_2360_3475 370
1159 3300049580 Ga0501046_0000033 Ga0501046_0000033_59785_60903 370
1160 3300049580 Ga0501046_0095375 Ga0501046_0095375_455_1579 370
1161 3300049581 Ga0501047_0001189 Ga0501047_0001189_860_1975 370
1162 3300049581 Ga0501047_0030041 Ga0501047_0030041_2183_3307 370
1163 3300049581 Ga0501047_0088783 Ga0501047_0088783_1163_2275 370
1164 3300049582 Ga0501048_0000324 Ga0501048_0000324_12931_14046 370
1165 3300049586 Ga0501070_0001033 Ga0501070_0001033_2985_4097 370
1166 3300049586 Ga0501070_0022645 Ga0501070_0022645_1160_2275 370
1167 3300049589 Ga0501073_0005082 Ga0501073_0005082_63_1175 370
1168 3300049590 Ga0501074_0008675 Ga0501074_0008675_4501_5613 370
1169 3300049592 Ga0501076_0022154 Ga0501076_0022154_3146_4258 370
1170 3300049742 Ga0501080_0001688 Ga0501080_0001688_2005_3120 370
1171 3300049742 Ga0501080_0006905 Ga0501080_0006905_5214_6326 370
1172 3300049744 Ga0501083_0058689 Ga0501083_0058689_972_2084 370
1173 3300049822 Ga0501035_0000084 Ga0501035_0000084_99405_100520 370
1174 3300049822 Ga0501035_0000479 Ga0501035_0000479_7991_9103 370
1175 3300049822 Ga0501035_0000897 Ga0501035_0000897_29205_30317 370
1176 3300049823 Ga0501044_0000073 Ga0501044_0000073_15671_16786 370
1177 3300049823 Ga0501044_0061367 Ga0501044_0061367_21_1133 370
1178 3300049823 Ga0501044_0228289 Ga0501044_0228289_266_1390 370
1179 3300049823 Ga0501044_0303876 Ga0501044_0303876_137_1249 370
1180 3300049824 Ga0501045_0032669 Ga0501045_0032669_1575_2690 370
1181 3300050489 nmdc:mga03683_24084_c1 nmdc:mga03683_24084_c1_395_1507 370
1182 3300050490 nmdc:mga03n38_71584_c1 nmdc:mga03n38_71584_c1_138_1250 370
1183 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_23228_24340 370
1184 3300050507 nmdc:mga05p37_20638_c1 nmdc:mga05p37_20638_c1_2990_4102 370
1185 3300050510 nmdc:mga06r32_152475_c1 nmdc:mga06r32_152475_c1_1165_2277 370
1186 3300050510 nmdc:mga06r32_24194_c1 nmdc:mga06r32_24194_c1_124_1236 370
1187 3300050511 nmdc:mga08y16_132152_c1 nmdc:mga08y16_132152_c1_662_1774 370
1188 3300050511 nmdc:mga08y16_193049_c1 nmdc:mga08y16_193049_c1_356_1468 370
1189 3300050513 nmdc:mga0rr50_7458_c1 nmdc:mga0rr50_7458_c1_4009_5136 370
1190 3300050514 nmdc:mga08x19_18_c1 nmdc:mga08x19_18_c1_61000_62127 370
1191 3300050516 nmdc:mga0sz30_36660_c1 nmdc:mga0sz30_36660_c1_328_1440 370
1192 3300050516 nmdc:mga0sz30_81_c1 nmdc:mga0sz30_81_c1_23156_24268 370
1193 3300053078 Ga0495612_0000152 Ga0495612_0000152_7454_8566 370
1194 3300053085 Ga0495619_0003543 Ga0495619_0003543_747_1859 370
1195 3300053104 Ga0500556_0000092 Ga0500556_0000092_34986_36098 370
1196 3300053109 Ga0500569_002816 Ga0500569_002816_2218_3330 370
1197 3300053134 Ga0500658_0000093 Ga0500658_0000093_5276_6388 370
1198 3300053137 Ga0500561_0000421 Ga0500561_0000421_5433_6545 370
1199 3300053139 Ga0500568_0000421 Ga0500568_0000421_26503_27615 370
1200 3300053140 Ga0500573_0000379 Ga0500573_0000379_12827_13942 370
1201 3300053140 Ga0500573_0007703 Ga0500573_0007703_3913_5028 370
1202 3300053153 Ga0500616_0001279 Ga0500616_0001279_18453_19565 370
1203 3300053153 Ga0500616_0003758 Ga0500616_0003758_7118_8233 370
1204 3300053153 Ga0500616_0020342 Ga0500616_0020342_2063_3175 370
1205 3300053153 Ga0500616_0036018 Ga0500616_0036018_636_1748 370
1206 3300053161 Ga0500634_0015039 Ga0500634_0015039_1467_2579 370
1207 3300059510 Ga0587090_000500 Ga0587090_000500_1270_2382 370
1208 3300060353 Ga0501082_0070911 Ga0501082_0070911_1339_2454 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00180

Iso_dh

Isocitrate/isopropylmalate dehydrogenase

69

425

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a05-assembly1.cif.gz_B crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate 0.9667 3 366
5j33-assembly3.cif.gz_F isopropylmalate dehydrogenase in complex with nad+ 0.9656 2 366
5j33-assembly3.cif.gz_F isopropylmalate dehydrogenase in complex with nad+ 0.9604 2 366
1a05-assembly1.cif.gz_B crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate 0.9588 3 366
4wuo-assembly1.cif.gz_B structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh 0.9566 5 365
ID Description Score Start End Superfamily
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9537 4 370 3.40.718.10
3u1hA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9407 4 370 3.40.718.10
5hn5A00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9323 3 368 3.40.718.10
1w0dB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9258 3 364 3.40.718.10
1x0lB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9214 3 367 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A528BRB6-F1-model_v4 3-isopropylmalate dehydrogenase 0.9986 269 366 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A5R2MUI9-F1-model_v4 3-isopropylmalate dehydrogenase 0.9976 158 259 GO:0003862
GO:0005829
GO:0009098
GO:0046872
AF-A0A4R1S1M7-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) 0.9938 1 370 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-I9NE03-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) 0.9936 1 370 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287
AF-P24404-F1-model_v4 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) 0.9934 1 370 GO:0000287
GO:0003862
GO:0005829
GO:0009098
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.64 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map