F491693
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 883 | 638 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0267162|Ga0501034_0267162_261_1640 |
| Length | 433 |
| Sequence | VKNGATSATPTASAASHHRLLSAAMWTPSFAPGYSTQPGKFQARRMGGCRPGNPPALAAAARSIMATHHLLLLPGDGIGPEVMAEVKRVIAFFNNEGGDTFEYEEDLVGGSAYDAHGKAVSDATMKKALAADAVIFGAVGGPKWDGVPYDVRPEAGLLRLRKDLELFANLRPAIVYPALADASSLKRELVEDLNILIVRELTGGVYFGEPKTITDIGNGQKRGVDTQVYDTYEIERIARVAFDLARHRRNKVTSMEKHNVMKSGVLWREVVTATHAREYADVNLEHMLADAGAMQLVRAPKQFDVIVTDNLFGDILSDVAAQLTGSLGMLPSASLGLPDPRSGKRRALYEPVHGSAPDIAGKGIANPIAMLASFAMALRYSFGLGETADRLERAISGVLDKGLRTGDIWTAGHAKIGTTAMGDAILAELSQSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 4 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 18 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 23 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 29 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 30 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 31 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 32 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 33 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 34 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 35 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 36 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 37 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 38 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 39 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 40 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 41 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 42 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 43 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 44 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 45 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 46 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 47 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 48 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 49 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 50 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 51 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 52 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 53 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 54 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 55 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 56 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 57 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 58 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 59 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 60 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 61 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 62 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 63 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 64 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 65 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 66 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 67 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 68 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 69 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 70 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 71 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 72 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 73 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 74 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 75 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 76 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 77 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 78 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 79 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 80 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 81 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 82 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 83 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 84 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 85 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 86 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 87 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 88 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 89 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 90 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 91 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 92 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 93 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 94 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 95 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 96 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 97 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 98 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 99 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 100 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 101 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 102 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 103 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 104 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 105 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 106 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 107 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 108 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 109 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 110 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 111 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 112 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 113 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 114 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 115 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 116 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 117 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 118 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 119 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 120 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 121 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 122 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 123 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 124 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 125 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 126 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 127 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 128 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 129 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 130 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 131 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 132 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 133 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 134 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 135 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 136 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 137 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 138 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 139 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 140 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 141 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 142 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 143 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 144 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 145 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 146 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 147 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 148 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 149 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 150 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 151 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 152 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 153 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 154 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 155 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 156 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 157 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 158 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 159 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 160 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 161 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 162 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 163 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 164 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 165 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 166 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 167 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 168 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 169 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 170 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 171 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 172 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 173 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 174 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 175 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 176 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 177 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 178 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 179 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 180 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 181 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 182 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 183 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 184 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 185 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 186 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 187 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 188 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 189 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 190 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 191 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 192 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 193 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 194 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 195 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 196 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 197 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 198 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 199 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 200 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 201 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 202 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 203 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 204 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 205 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 206 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 207 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 208 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 209 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 210 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 211 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 212 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 213 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 214 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 215 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 216 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 217 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 218 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 219 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 220 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 221 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 222 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 223 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 224 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 225 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 226 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 227 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 228 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 229 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 230 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 231 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 232 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 233 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 234 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 235 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 236 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 237 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 238 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 239 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 240 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 241 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 242 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 243 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 244 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 245 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 246 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 247 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 248 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 249 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 250 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 251 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 252 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 253 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 254 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 255 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 256 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 257 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 258 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 259 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 260 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 261 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 262 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 263 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 264 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 265 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 266 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 267 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 268 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 269 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 270 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 271 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 272 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 273 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 274 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 275 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 276 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 277 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 278 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 279 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 280 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 281 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 282 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 283 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 284 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 285 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 286 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 287 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 288 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 289 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 290 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 291 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 292 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 293 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 294 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 295 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 296 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 297 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 298 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 299 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 300 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 301 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 302 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 303 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 304 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 305 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 306 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 307 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 308 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 309 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 310 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 311 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 312 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 313 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 314 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 315 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 316 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 317 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 318 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 319 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 320 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 321 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 322 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 323 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 324 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 325 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 326 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 327 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 328 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 329 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 330 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 331 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 332 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 333 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 334 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 335 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 336 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 337 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 338 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 339 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 340 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 341 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 342 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 343 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 344 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 345 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 346 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 347 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 348 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 349 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 350 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 351 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 352 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 353 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 354 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 355 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 356 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 357 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 358 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 359 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 360 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 361 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 362 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 363 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 364 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 365 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 366 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 367 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 368 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 369 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 370 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 371 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 372 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 373 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 374 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 375 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 376 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 377 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 378 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 379 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 380 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 381 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 382 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 383 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 384 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 385 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 386 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 387 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 388 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 389 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 390 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 391 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 392 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 393 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 394 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 395 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 396 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 397 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 398 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 399 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 400 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 401 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 402 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 403 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 404 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 405 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 406 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 407 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 408 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 409 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 410 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 411 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 412 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 413 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 414 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 415 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 416 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 417 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 418 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 419 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 420 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 421 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 422 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 423 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 424 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 425 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 426 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 427 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 428 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 429 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 430 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 431 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 432 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 433 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 434 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 435 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 436 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 437 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 438 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 439 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 440 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 441 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 442 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 443 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 444 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 445 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 446 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 447 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 448 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 449 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 450 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 451 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 452 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 453 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 454 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 455 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 456 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 457 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 458 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 459 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 460 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 461 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 462 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 463 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 464 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 465 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 466 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 467 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 468 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 469 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 470 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 471 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 472 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 473 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 474 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 475 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 476 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 477 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 478 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 479 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 480 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 481 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 482 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 483 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 484 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 485 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 486 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 487 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 488 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 489 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 490 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 491 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 492 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 493 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 494 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 495 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 496 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 497 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 498 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 499 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 500 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 501 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 502 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 503 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 504 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 505 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 506 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 507 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 508 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 509 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 510 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 511 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 512 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 513 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 514 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 515 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 516 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 517 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 518 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 519 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 520 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 521 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 522 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 523 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 524 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 525 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 526 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 527 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 528 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 529 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 530 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 531 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 532 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 533 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 534 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 535 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 536 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 537 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 538 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 539 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 540 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 541 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 542 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 543 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 544 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 545 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 546 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 547 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 548 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 549 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 550 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 551 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 552 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 553 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 554 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 555 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 556 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 557 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 558 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 559 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 560 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 561 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 562 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 563 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 564 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 565 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 566 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 567 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 568 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 569 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 570 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 571 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 572 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 573 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 574 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 575 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 576 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 577 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 578 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 579 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 580 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 581 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 582 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 583 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 584 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 587 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 588 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 589 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 590 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 591 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 592 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 593 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 594 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 595 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 596 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 597 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 598 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 599 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 600 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 601 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 602 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 603 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 604 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 605 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 606 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 607 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 608 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 609 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 610 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 611 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 613 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 615 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 616 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 617 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 618 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 619 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 620 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 621 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 622 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 623 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 624 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 625 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 626 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 627 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 628 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 629 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 630 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 631 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 632 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 633 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 645 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 646 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 647 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 648 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 649 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 652 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 653 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 654 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 655 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 657 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 658 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 659 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 660 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 661 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 662 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 663 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 664 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 665 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 666 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 667 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 668 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 669 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 670 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 671 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 672 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 673 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 674 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 675 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 676 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 677 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 678 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 679 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 680 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 681 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 682 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 683 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 684 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 685 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 686 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 687 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 688 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 689 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 690 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 691 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 692 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 693 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 694 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 695 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 696 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 697 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 698 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 699 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 700 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 701 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 702 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 703 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 704 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 705 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 706 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 707 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 708 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 709 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 710 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 711 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 712 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 713 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 714 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 715 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 746 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 747 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 748 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 749 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 750 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 751 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 752 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 753 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 754 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 755 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 756 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 757 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 758 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 759 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 760 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 761 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 762 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 763 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 764 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 765 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 766 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 767 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 768 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 769 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 770 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 771 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 772 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 773 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 774 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 775 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 776 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 777 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 778 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 779 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 780 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 781 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 782 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 783 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 784 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 785 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 786 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 787 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 788 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 789 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 790 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 791 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 792 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 793 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 794 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 795 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 796 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 797 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 798 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 799 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 800 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 801 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 802 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 803 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 804 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 805 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 806 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 807 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 808 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 809 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 810 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 814 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 815 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 816 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 817 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 818 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 819 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 820 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 821 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 822 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 823 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 824 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 825 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 826 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 827 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 828 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 829 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 830 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 831 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 832 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 833 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 834 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 835 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 836 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 837 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 838 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 839 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 840 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 841 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 842 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 843 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 844 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 845 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 846 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 847 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 848 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 849 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 850 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 851 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 852 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 853 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 854 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 855 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 856 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 857 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 858 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 859 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 860 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 861 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 862 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 863 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 864 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 865 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 866 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 867 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 868 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 869 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 870 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 871 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 872 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 873 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 874 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 875 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 876 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 877 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 878 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 879 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 880 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 881 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 882 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 883 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.73 |
| Metatranscriptomes | 0.08 |
| Isolates | 47.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 14.4 |
| Nodule | 36.42 |
| Rhizoplane | 3.06 |
| Rhizosphere | 30.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004991 | 3300001979 | Bacteria | 5638 |
| 2 | JGI25156J39149_1000770 | 3300002705 | Bacteria | 16645 |
| 3 | JGI25162J39368_1000253 | 3300002737 | Bacteria | 51894 |
| 4 | JGI25162J39368_1000485 | 3300002737 | Bacteria | 30412 |
| 5 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 6 | JGI25158J39367_1000014 | 3300002739 | Bacteria | 47475 |
| 7 | JGI25157J39369_1000108 | 3300002741 | Bacteria | 69980 |
| 8 | JGI25152J39213_1000644 | 3300002773 | Bacteria | 18485 |
| 9 | JGI25152J39213_1001505 | 3300002773 | Bacteria | 9924 |
| 10 | JGI25152J39213_1002615 | 3300002773 | Bacteria | 6703 |
| 11 | JGI25152J39213_1006872 | 3300002773 | Bacteria | 3015 |
| 12 | JGI25152J39213_1007167 | 3300002773 | Bacteria | 2921 |
| 13 | JGI25150J39212_1000018 | 3300002774 | Bacteria | 146535 |
| 14 | JGI25150J39212_1006130 | 3300002774 | Bacteria | 2510 |
| 15 | JGI25159J45721_1000388 | 3300002987 | Bacteria | 20428 |
| 16 | JGI25159J45721_1000604 | 3300002987 | Bacteria | 16057 |
| 17 | JGI25151J46595_10000034 | 3300003187 | Bacteria | 192271 |
| 18 | JGI25151J46595_10000939 | 3300003187 | Bacteria | 22542 |
| 19 | JGI25151J46595_10029230 | 3300003187 | Bacteria | 2185 |
| 20 | JGI25406J46586_10047626 | 3300003203 | Bacteria | 1459 |
| 21 | JGI25165J46597_1000536 | 3300003214 | Bacteria | 35271 |
| 22 | JGI25165J46597_1001214 | 3300003214 | Bacteria | 15455 |
| 23 | JGI25165J46597_1004655 | 3300003214 | Bacteria | 2870 |
| 24 | JGI25153J46596_10001791 | 3300003215 | Bacteria | 12747 |
| 25 | JGI25153J46596_10006280 | 3300003215 | Bacteria | 6061 |
| 26 | JGI25153J46596_10016095 | 3300003215 | Bacteria | 3015 |
| 27 | JGI25153J46596_10016737 | 3300003215 | Bacteria | 2921 |
| 28 | JGI25153J46596_10042669 | 3300003215 | Bacteria | 1382 |
| 29 | JGI25160J50197_1000051 | 3300003354 | Bacteria | 132923 |
| 30 | JGI25160J50197_1021530 | 3300003354 | Bacteria | 1913 |
| 31 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 32 | JGI25161J50226_1000038 | 3300003374 | Bacteria | 131804 |
| 33 | JGI25161J50226_1001915 | 3300003374 | Bacteria | 5768 |
| 34 | Ga0055526_1000291 | 3300003771 | Bacteria | 41931 |
| 35 | Ga0055526_1014670 | 3300003771 | Bacteria | 3202 |
| 36 | Ga0055526_1024598 | 3300003771 | Bacteria | 1963 |
| 37 | Ga0055524_1000068 | 3300003775 | Bacteria | 130413 |
| 38 | Ga0055524_1007723 | 3300003775 | Bacteria | 4540 |
| 39 | Ga0055536_1000569 | 3300003781 | Bacteria | 25206 |
| 40 | Ga0055536_1002919 | 3300003781 | Bacteria | 9391 |
| 41 | Ga0055528_1000884 | 3300003790 | Bacteria | 20244 |
| 42 | Ga0055530_10003609 | 3300003791 | Bacteria | 8683 |
| 43 | Ga0055540_1001428 | 3300003792 | Bacteria | 14240 |
| 44 | Ga0055540_1001541 | 3300003792 | Bacteria | 13519 |
| 45 | Ga0055531_10005829 | 3300003794 | Bacteria | 7123 |
| 46 | Ga0058692_1007084 | 3300003856 | Bacteria | 3007 |
| 47 | Ga0055543_1000041 | 3300004625 | Bacteria | 118501 |
| 48 | Ga0055543_1000317 | 3300004625 | Bacteria | 33524 |
| 49 | Ga0055543_1000416 | 3300004625 | Bacteria | 26883 |
| 50 | Ga0065165_1000135 | 3300005262 | Bacteria | 127785 |
| 51 | Ga0065165_1000143 | 3300005262 | Bacteria | 124381 |
| 52 | Ga0065165_1010220 | 3300005262 | Bacteria | 4090 |
| 53 | Ga0070670_100000711 | 3300005331 | Bacteria | 25830 |
| 54 | Ga0070680_100136044 | 3300005336 | Bacteria | 2058 |
| 55 | Ga0070682_100109642 | 3300005337 | Bacteria | 1837 |
| 56 | Ga0070711_100045468 | 3300005439 | Bacteria | 2987 |
| 57 | Ga0070700_100028466 | 3300005441 | Bacteria | 3324 |
| 58 | Ga0070663_100014911 | 3300005455 | Bacteria | 4999 |
| 59 | Ga0070662_100235372 | 3300005457 | Bacteria | 1467 |
| 60 | Ga0070681_10274978 | 3300005458 | Bacteria | 1595 |
| 61 | Ga0070698_100321141 | 3300005471 | Bacteria | 1479 |
| 62 | Ga0070679_100026302 | 3300005530 | Bacteria | 5715 |
| 63 | Ga0070697_100000401 | 3300005536 | Bacteria | 33563 |
| 64 | Ga0068853_100000639 | 3300005539 | Bacteria | 23990 |
| 65 | Ga0068853_100025986 | 3300005539 | Bacteria | 4914 |
| 66 | Ga0070695_100003726 | 3300005545 | Bacteria | 8892 |
| 67 | Ga0070693_100009265 | 3300005547 | Bacteria | 4891 |
| 68 | Ga0070665_100001650 | 3300005548 | Bacteria | 25702 |
| 69 | Ga0070665_100039375 | 3300005548 | Bacteria | 4753 |
| 70 | Ga0068855_100040752 | 3300005563 | Bacteria | 5509 |
| 71 | Ga0070664_100082344 | 3300005564 | Bacteria | 2775 |
| 72 | Ga0070702_100014888 | 3300005615 | Bacteria | 3958 |
| 73 | Ga0068863_100009117 | 3300005841 | Bacteria | 9690 |
| 74 | Ga0081455_10001273 | 3300005937 | Bacteria | 31479 |
| 75 | Ga0081540_1000012 | 3300005983 | Bacteria | 189939 |
| 76 | Ga0081539_10000690 | 3300005985 | Bacteria | 67656 |
| 77 | Ga0075365_10000401 | 3300006038 | Bacteria | 15895 |
| 78 | Ga0075365_10002608 | 3300006038 | Bacteria | 8919 |
| 79 | Ga0075365_10015844 | 3300006038 | Bacteria | 4568 |
| 80 | Ga0075365_10221104 | 3300006038 | Bacteria | 1328 |
| 81 | Ga0075368_10032369 | 3300006042 | Bacteria | 2030 |
| 82 | Ga0075364_10000006 | 3300006051 | Bacteria | 86571 |
| 83 | Ga0075364_10050131 | 3300006051 | Bacteria | 2725 |
| 84 | Ga0075364_10051049 | 3300006051 | Bacteria | 2700 |
| 85 | Ga0070716_100027093 | 3300006173 | Bacteria | 3075 |
| 86 | Ga0070712_100177143 | 3300006175 | Bacteria | 1659 |
| 87 | Ga0075362_10073512 | 3300006177 | Bacteria | 1565 |
| 88 | Ga0075367_10001646 | 3300006178 | Bacteria | 9725 |
| 89 | Ga0075367_10044097 | 3300006178 | Bacteria | 2613 |
| 90 | Ga0075369_10000585 | 3300006186 | Bacteria | 11566 |
| 91 | Ga0075369_10014152 | 3300006186 | Bacteria | 3183 |
| 92 | Ga0075366_10004332 | 3300006195 | Bacteria | 7613 |
| 93 | Ga0075370_10003721 | 3300006353 | Bacteria | 7302 |
| 94 | Ga0075428_100003200 | 3300006844 | Bacteria | 17905 |
| 95 | Ga0075428_100063506 | 3300006844 | Bacteria | 4043 |
| 96 | Ga0075428_100109140 | 3300006844 | Bacteria | 3016 |
| 97 | Ga0075430_100048860 | 3300006846 | Bacteria | 3571 |
| 98 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 99 | Ga0075431_100010527 | 3300006847 | Bacteria | 9298 |
| 100 | Ga0075429_100012151 | 3300006880 | Bacteria | 7464 |
| 101 | Ga0075436_100000298 | 3300006914 | Bacteria | 31645 |
| 102 | Ga0079104_1001513 | 3300006946 | Bacteria | 15427 |
| 103 | Ga0099826_10000089 | 3300006948 | Bacteria | 45251 |
| 104 | Ga0099826_10034388 | 3300006948 | Bacteria | 3621 |
| 105 | Ga0075435_100010189 | 3300007076 | Bacteria | 6867 |
| 106 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 107 | Ga0111539_10000504 | 3300009094 | Bacteria | 49771 |
| 108 | Ga0111539_10003050 | 3300009094 | Bacteria | 22190 |
| 109 | Ga0111539_10271925 | 3300009094 | Bacteria | 1972 |
| 110 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 111 | Ga0114129_10015821 | 3300009147 | Bacteria | 10726 |
| 112 | Ga0114129_10548344 | 3300009147 | Bacteria | 1504 |
| 113 | Ga0105243_10019587 | 3300009148 | Bacteria | 5129 |
| 114 | Ga0105241_10008271 | 3300009174 | Bacteria | 7658 |
| 115 | Ga0105248_10110705 | 3300009177 | Bacteria | 3097 |
| 116 | Ga0105248_10190440 | 3300009177 | Bacteria | 2311 |
| 117 | Ga0105237_10002652 | 3300009545 | Bacteria | 21994 |
| 118 | Ga0105237_10305489 | 3300009545 | Bacteria | 1594 |
| 119 | Ga0105237_10310905 | 3300009545 | Bacteria | 1579 |
| 120 | Ga0123341_1021682 | 3300009765 | Bacteria | 5386 |
| 121 | Ga0123342_1009626 | 3300009766 | Bacteria | 11472 |
| 122 | Ga0123342_1028163 | 3300009766 | Bacteria | 3062 |
| 123 | Ga0105239_10001079 | 3300010375 | Bacteria | 37830 |
| 124 | Ga0105246_10006247 | 3300011119 | Bacteria | 7273 |
| 125 | Ga0105246_10067150 | 3300011119 | Bacteria | 2512 |
| 126 | Ga0157373_10007198 | 3300013100 | Bacteria | 8299 |
| 127 | Ga0157371_10004378 | 3300013102 | Bacteria | 12348 |
| 128 | Ga0157370_10000079 | 3300013104 | Bacteria | 107305 |
| 129 | Ga0157370_10000855 | 3300013104 | Bacteria | 38623 |
| 130 | Ga0157370_10095710 | 3300013104 | Bacteria | 2786 |
| 131 | Ga0157370_10163666 | 3300013104 | Bacteria | 2069 |
| 132 | Ga0157372_10493487 | 3300013307 | Bacteria | 1428 |
| 133 | Ga0163163_10009451 | 3300014325 | Bacteria | 8706 |
| 134 | Ga0157379_10213175 | 3300014968 | Bacteria | 1749 |
| 135 | Ga0182007_10019600 | 3300015262 | Bacteria | 2430 |
| 136 | Ga0214544_1005528 | 3300021320 | Bacteria | 24379 |
| 137 | Ga0214542_1005348 | 3300021321 | Bacteria | 24469 |
| 138 | Ga0214542_1012986 | 3300021321 | Bacteria | 10323 |
| 139 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 140 | Ga0214543_1005096 | 3300021327 | Bacteria | 24495 |
| 141 | Ga0213873_10026351 | 3300021358 | Bacteria | 1411 |
| 142 | Ga0213874_10010562 | 3300021377 | Bacteria | 2314 |
| 143 | Ga0213876_10005281 | 3300021384 | Bacteria | 7113 |
| 144 | Ga0213875_10009375 | 3300021388 | Bacteria | 4963 |
| 145 | Ga0213875_10042001 | 3300021388 | Bacteria | 2150 |
| 146 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 147 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 148 | Ga0209435_100031 | 3300025206 | Bacteria | 164115 |
| 149 | Ga0209436_100013 | 3300025208 | Bacteria | 131492 |
| 150 | Ga0209672_103539 | 3300025228 | Bacteria | 3195 |
| 151 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 152 | Ga0209437_100181 | 3300025233 | Bacteria | 132953 |
| 153 | Ga0207425_1000035 | 3300025245 | Bacteria | 225942 |
| 154 | Ga0207425_1004487 | 3300025245 | Bacteria | 4170 |
| 155 | Ga0207425_1009575 | 3300025245 | Bacteria | 2402 |
| 156 | Ga0209646_1000102 | 3300025246 | Bacteria | 164115 |
| 157 | Ga0209646_1004214 | 3300025246 | Bacteria | 2651 |
| 158 | Ga0209026_1000096 | 3300025250 | Bacteria | 164115 |
| 159 | Ga0209677_100455 | 3300025253 | Bacteria | 23764 |
| 160 | Ga0209759_1000090 | 3300025256 | Bacteria | 164115 |
| 161 | Ga0209759_1017442 | 3300025256 | Bacteria | 1770 |
| 162 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 163 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 164 | Ga0209129_1000377 | 3300025258 | Bacteria | 36213 |
| 165 | Ga0209129_1001450 | 3300025258 | Bacteria | 13231 |
| 166 | Ga0209129_1001464 | 3300025258 | Bacteria | 13166 |
| 167 | Ga0209129_1003105 | 3300025258 | Bacteria | 7470 |
| 168 | Ga0209129_1003160 | 3300025258 | Bacteria | 7380 |
| 169 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 170 | Ga0209233_1000212 | 3300025261 | Bacteria | 110364 |
| 171 | Ga0209233_1000445 | 3300025261 | Bacteria | 28225 |
| 172 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 173 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 174 | Ga0209673_1000476 | 3300025273 | Bacteria | 66898 |
| 175 | Ga0209673_1001553 | 3300025273 | Bacteria | 20717 |
| 176 | Ga0209673_1003936 | 3300025273 | Bacteria | 8308 |
| 177 | Ga0209673_1005022 | 3300025273 | Bacteria | 6834 |
| 178 | Ga0209673_1005150 | 3300025273 | Bacteria | 6688 |
| 179 | Ga0209673_1021903 | 3300025273 | Bacteria | 2221 |
| 180 | Ga0209673_1029073 | 3300025273 | Bacteria | 1766 |
| 181 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 182 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 183 | Ga0209130_1000342 | 3300025284 | Bacteria | 53602 |
| 184 | Ga0209675_1000819 | 3300025291 | Bacteria | 20482 |
| 185 | Ga0209676_1000169 | 3300025292 | Bacteria | 155600 |
| 186 | Ga0209676_1015294 | 3300025292 | Bacteria | 2830 |
| 187 | Ga0209676_1025353 | 3300025292 | Bacteria | 1903 |
| 188 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 189 | Ga0209025_1000453 | 3300025294 | Bacteria | 80110 |
| 190 | Ga0209025_1001274 | 3300025294 | Bacteria | 34655 |
| 191 | Ga0209025_1001429 | 3300025294 | Bacteria | 31509 |
| 192 | Ga0209025_1002399 | 3300025294 | Bacteria | 19986 |
| 193 | Ga0209025_1003718 | 3300025294 | Bacteria | 14024 |
| 194 | Ga0209025_1004205 | 3300025294 | Bacteria | 12700 |
| 195 | Ga0209025_1029766 | 3300025294 | Bacteria | 2632 |
| 196 | Ga0209564_1000041 | 3300025295 | Bacteria | 405199 |
| 197 | Ga0209564_1000065 | 3300025295 | Bacteria | 315205 |
| 198 | Ga0209564_1000227 | 3300025295 | Bacteria | 125497 |
| 199 | Ga0209564_1000284 | 3300025295 | Bacteria | 102684 |
| 200 | Ga0209564_1000894 | 3300025295 | Bacteria | 39163 |
| 201 | Ga0209564_1004855 | 3300025295 | Bacteria | 7993 |
| 202 | Ga0209758_1000255 | 3300025297 | Bacteria | 106892 |
| 203 | Ga0209758_1000406 | 3300025297 | Bacteria | 73962 |
| 204 | Ga0209758_1000563 | 3300025297 | Bacteria | 58374 |
| 205 | Ga0209758_1000780 | 3300025297 | Bacteria | 45747 |
| 206 | Ga0209758_1001039 | 3300025297 | Bacteria | 36357 |
| 207 | Ga0209758_1001297 | 3300025297 | Bacteria | 30633 |
| 208 | Ga0209758_1004746 | 3300025297 | Bacteria | 11042 |
| 209 | Ga0209758_1024172 | 3300025297 | Bacteria | 2717 |
| 210 | Ga0209050_1000281 | 3300025298 | Bacteria | 108751 |
| 211 | Ga0209050_1006418 | 3300025298 | Bacteria | 6969 |
| 212 | Ga0209050_1010967 | 3300025298 | Bacteria | 4376 |
| 213 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 214 | Ga0209256_1000266 | 3300025299 | Bacteria | 92357 |
| 215 | Ga0209256_1001149 | 3300025299 | Bacteria | 30019 |
| 216 | Ga0209256_1002933 | 3300025299 | Bacteria | 12813 |
| 217 | Ga0209256_1003784 | 3300025299 | Bacteria | 10192 |
| 218 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 219 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 220 | Ga0207426_1000214 | 3300025302 | Bacteria | 137296 |
| 221 | Ga0207426_1000798 | 3300025302 | Bacteria | 34125 |
| 222 | Ga0207426_1023075 | 3300025302 | Bacteria | 2127 |
| 223 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 224 | Ga0209051_1001684 | 3300025303 | Bacteria | 17792 |
| 225 | Ga0209051_1004711 | 3300025303 | Bacteria | 8288 |
| 226 | Ga0209051_1004805 | 3300025303 | Bacteria | 8148 |
| 227 | Ga0209051_1006782 | 3300025303 | Bacteria | 6383 |
| 228 | Ga0209257_1001639 | 3300025304 | Bacteria | 25617 |
| 229 | Ga0209257_1005651 | 3300025304 | Bacteria | 8641 |
| 230 | Ga0209257_1006038 | 3300025304 | Bacteria | 8083 |
| 231 | Ga0207699_10071266 | 3300025906 | Bacteria | 2125 |
| 232 | Ga0207707_10165371 | 3300025912 | Bacteria | 1933 |
| 233 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 234 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 235 | Ga0207671_10148460 | 3300025914 | Bacteria | 1810 |
| 236 | Ga0207693_10004461 | 3300025915 | Bacteria | 11827 |
| 237 | Ga0207693_10027984 | 3300025915 | Bacteria | 4456 |
| 238 | Ga0207663_10054708 | 3300025916 | Bacteria | 2500 |
| 239 | Ga0207650_10001757 | 3300025925 | Bacteria | 15368 |
| 240 | Ga0207700_10089252 | 3300025928 | Bacteria | 2429 |
| 241 | Ga0207664_10027534 | 3300025929 | Bacteria | 4310 |
| 242 | Ga0207706_10236763 | 3300025933 | Bacteria | 1596 |
| 243 | Ga0207665_10027798 | 3300025939 | Bacteria | 3736 |
| 244 | Ga0207711_10169391 | 3300025941 | Bacteria | 1981 |
| 245 | Ga0207679_10209680 | 3300025945 | Bacteria | 1633 |
| 246 | Ga0207667_10183250 | 3300025949 | Bacteria | 2150 |
| 247 | Ga0207668_10200000 | 3300025972 | Bacteria | 1590 |
| 248 | Ga0207640_10171870 | 3300025981 | Bacteria | 1616 |
| 249 | Ga0207639_10004015 | 3300026041 | Bacteria | 9931 |
| 250 | Ga0207639_10036187 | 3300026041 | Bacteria | 3657 |
| 251 | Ga0207678_10000231 | 3300026067 | Bacteria | 49870 |
| 252 | Ga0207678_10285375 | 3300026067 | Bacteria | 1417 |
| 253 | Ga0207708_10046003 | 3300026075 | Bacteria | 3324 |
| 254 | Ga0207641_10040375 | 3300026088 | Bacteria | 3907 |
| 255 | Ga0207698_10215155 | 3300026142 | Bacteria | 1732 |
| 256 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 257 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 258 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 259 | Ga0209371_1002602 | 3300027312 | Bacteria | 9903 |
| 260 | Ga0209371_1005786 | 3300027312 | Bacteria | 4789 |
| 261 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 262 | Ga0209282_1000960 | 3300027666 | Bacteria | 15074 |
| 263 | Ga0209282_1037870 | 3300027666 | Bacteria | 2895 |
| 264 | Ga0209813_10000521 | 3300027866 | Bacteria | 9090 |
| 265 | Ga0207428_10084061 | 3300027907 | Bacteria | 2481 |
| 266 | Ga0268266_10003484 | 3300028379 | Bacteria | 15672 |
| 267 | Ga0268266_10033539 | 3300028379 | Bacteria | 4364 |
| 268 | Ga0265318_10028340 | 3300028577 | Bacteria | 2191 |
| 269 | Ga0307515_10001049 | 3300028794 | Bacteria | 63286 |
| 270 | Ga0307515_10002808 | 3300028794 | Bacteria | 37051 |
| 271 | Ga0307515_10193442 | 3300028794 | Bacteria | 1936 |
| 272 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 273 | Ga0268256_1005001 | 3300030500 | Bacteria | 5327 |
| 274 | Ga0268256_1020498 | 3300030500 | Bacteria | 1781 |
| 275 | Ga0265328_10000806 | 3300031239 | Bacteria | 14482 |
| 276 | Ga0265329_10053172 | 3300031242 | Bacteria | 1288 |
| 277 | Ga0265340_10001914 | 3300031247 | Bacteria | 11883 |
| 278 | Ga0265340_10004381 | 3300031247 | Bacteria | 7905 |
| 279 | Ga0265339_10005618 | 3300031249 | Bacteria | 8323 |
| 280 | Ga0265331_10046737 | 3300031250 | Bacteria | 2086 |
| 281 | Ga0265331_10066213 | 3300031250 | Bacteria | 1697 |
| 282 | Ga0265316_10004581 | 3300031344 | Bacteria | 13719 |
| 283 | Ga0307408_100086903 | 3300031548 | Bacteria | 2351 |
| 284 | Ga0265313_10002093 | 3300031595 | Bacteria | 17809 |
| 285 | Ga0265313_10006036 | 3300031595 | Bacteria | 8739 |
| 286 | Ga0265314_10059431 | 3300031711 | Bacteria | 2615 |
| 287 | Ga0265314_10091592 | 3300031711 | Bacteria | 1978 |
| 288 | Ga0265342_10009718 | 3300031712 | Bacteria | 6740 |
| 289 | Ga0265342_10023964 | 3300031712 | Bacteria | 3856 |
| 290 | Ga0265342_10031119 | 3300031712 | Bacteria | 3302 |
| 291 | Ga0265342_10054397 | 3300031712 | Bacteria | 2378 |
| 292 | Ga0316577_10187234 | 3300031733 | Bacteria | 1170 |
| 293 | Ga0307410_10379912 | 3300031852 | Bacteria | 1136 |
| 294 | Ga0307406_10001514 | 3300031901 | Bacteria | 12821 |
| 295 | Ga0307406_10004006 | 3300031901 | Bacteria | 8011 |
| 296 | Ga0307412_10131130 | 3300031911 | Bacteria | 1821 |
| 297 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 298 | Ga0307409_100021452 | 3300031995 | Bacteria | 4429 |
| 299 | Ga0307409_100367464 | 3300031995 | Bacteria | 1363 |
| 300 | Ga0307415_100037032 | 3300032126 | Bacteria | 3203 |
| 301 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 302 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 303 | Ga0373958_0002411 | 3300034819 | Bacteria | 2617 |
| 304 | Ga0373959_0006566 | 3300034820 | Bacteria | 1935 |
| 305 | Ga0373938_0002090 | 3300034957 | Bacteria | 3212 |
| 306 | Ga0373940_0003021 | 3300035088 | Bacteria | 3370 |
| 307 | Ga0373952_0013131 | 3300035092 | Bacteria | 1638 |
| 308 | Ga0373943_0013738 | 3300035170 | Bacteria | 3660 |
| 309 | Ga0373943_0070322 | 3300035170 | Bacteria | 1771 |
| 310 | Ga0373946_0008626 | 3300035171 | Bacteria | 3741 |
| 311 | Ga0373942_0008587 | 3300035207 | Bacteria | 2384 |
| 312 | Ga0373961_0001703 | 3300035241 | Bacteria | 6126 |
| 313 | Ga0373962_0018219 | 3300035242 | Bacteria | 1826 |
| 314 | Ga0373931_0035801 | 3300035691 | Bacteria | 2583 |
| 315 | Ga0373935_0087224 | 3300035692 | Bacteria | 2037 |
| 316 | Ga0373927_0046776 | 3300035695 | Bacteria | 2798 |
| 317 | Ga0373947_0027685 | 3300035725 | Bacteria | 3318 |
| 318 | Ga0373937_0019984 | 3300036401 | Bacteria | 5998 |
| 319 | Ga0395899_0000288 | 3300037312 | Bacteria | 64881 |
| 320 | Ga0395899_0064282 | 3300037312 | Bacteria | 2698 |
| 321 | Ga0395900_0000246 | 3300037418 | Bacteria | 85104 |
| 322 | Ga0395900_0017621 | 3300037418 | Bacteria | 7288 |
| 323 | Ga0395900_0293807 | 3300037418 | Bacteria | 1613 |
| 324 | Ga0395898_0000447 | 3300037466 | Bacteria | 85103 |
| 325 | Ga0395898_0242408 | 3300037466 | Bacteria | 1719 |
| 326 | Ga0395905_0000228 | 3300037471 | Bacteria | 85103 |
| 327 | Ga0436364_0095273 | 3300037853 | Bacteria | 2767 |
| 328 | Ga0436364_0469239 | 3300037853 | Bacteria | 3082 |
| 329 | Ga0436364_0472918 | 3300037853 | Bacteria | 4002 |
| 330 | Ga0436364_1178347 | 3300037853 | Bacteria | 1295 |
| 331 | Ga0395901_0000167 | 3300038443 | Bacteria | 85844 |
| 332 | Ga0395901_0011053 | 3300038443 | Bacteria | 9146 |
| 333 | Ga0400486_00583 | 3300038742 | Bacteria | 1904 |
| 334 | Ga0436365_0307172 | 3300039437 | Bacteria | 3473 |
| 335 | Ga0436365_1156422 | 3300039437 | Bacteria | 2117 |
| 336 | Ga0436360_0420029 | 3300039438 | Bacteria | 1854 |
| 337 | Ga0436362_1144778 | 3300039453 | Bacteria | 3440 |
| 338 | Ga0439436_0002227 | 3300041404 | Bacteria | 5806 |
| 339 | Ga0439466_0056508 | 3300041411 | Bacteria | 1273 |
| 340 | Ga0451835_0131822 | 3300041492 | Bacteria | 2222 |
| 341 | Ga0451843_0374774 | 3300041509 | Bacteria | 2448 |
| 342 | Ga0439449_0001844 | 3300042007 | Bacteria | 8338 |
| 343 | Ga0439449_0045378 | 3300042007 | Bacteria | 1629 |
| 344 | Ga0466965_0001568 | 3300044683 | Bacteria | 9311 |
| 345 | Ga0466968_0017536 | 3300044735 | Bacteria | 2863 |
| 346 | Ga0466970_0009635 | 3300044765 | Bacteria | 4887 |
| 347 | Ga0495603_0052773 | 3300046455 | Bacteria | 2413 |
| 348 | Ga0495629_0046729 | 3300046459 | Bacteria | 3036 |
| 349 | Ga0495629_0051882 | 3300046459 | Bacteria | 2870 |
| 350 | Ga0495638_0000110 | 3300046460 | Bacteria | 131410 |
| 351 | Ga0495638_0022742 | 3300046460 | Bacteria | 4111 |
| 352 | Ga0495653_0093160 | 3300046463 | Bacteria | 2198 |
| 353 | Ga0495662_0026233 | 3300046476 | Bacteria | 2814 |
| 354 | Ga0495664_0000434 | 3300046477 | Bacteria | 20493 |
| 355 | Ga0495610_0001935 | 3300046512 | Bacteria | 17840 |
| 356 | Ga0495610_0048670 | 3300046512 | Bacteria | 2080 |
| 357 | Ga0495630_0036316 | 3300046517 | Bacteria | 3684 |
| 358 | Ga0495643_0015274 | 3300046522 | Bacteria | 4543 |
| 359 | Ga0495648_0097720 | 3300046524 | Bacteria | 1628 |
| 360 | Ga0495652_0028653 | 3300046529 | Bacteria | 4898 |
| 361 | Ga0495665_0106603 | 3300046531 | Bacteria | 1470 |
| 362 | Ga0495640_0003016 | 3300046533 | Bacteria | 13550 |
| 363 | Ga0495586_0004850 | 3300046535 | Bacteria | 7194 |
| 364 | Ga0495645_0000746 | 3300046543 | Bacteria | 22248 |
| 365 | Ga0495622_0024841 | 3300046557 | Bacteria | 2798 |
| 366 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 367 | Ga0495668_0050542 | 3300046616 | Bacteria | 2304 |
| 368 | Ga0495634_0064876 | 3300046642 | Bacteria | 2420 |
| 369 | Ga0495625_0028083 | 3300046660 | Bacteria | 4223 |
| 370 | Ga0495625_0064017 | 3300046660 | Bacteria | 2595 |
| 371 | Ga0495635_0018303 | 3300046663 | Bacteria | 4888 |
| 372 | Ga0495647_0070964 | 3300046681 | Bacteria | 1394 |
| 373 | Ga0495613_0066634 | 3300046689 | Bacteria | 2629 |
| 374 | Ga0495624_0023367 | 3300046690 | Bacteria | 4077 |
| 375 | Ga0495649_0070966 | 3300046694 | Bacteria | 1867 |
| 376 | Ga0495660_0062980 | 3300046810 | Bacteria | 1987 |
| 377 | Ga0495581_0072176 | 3300047315 | Bacteria | 1997 |
| 378 | Ga0495604_0206357 | 3300047317 | Bacteria | 1360 |
| 379 | Ga0495674_0003969 | 3300047319 | Bacteria | 14347 |
| 380 | Ga0495684_0018874 | 3300047471 | Bacteria | 5310 |
| 381 | Ga0495684_0224847 | 3300047471 | Bacteria | 1375 |
| 382 | Ga0495686_0001104 | 3300047472 | Bacteria | 32036 |
| 383 | Ga0495686_0014411 | 3300047472 | Bacteria | 5442 |
| 384 | Ga0495686_0074514 | 3300047472 | Bacteria | 2083 |
| 385 | Ga0496100_0151761 | 3300048903 | Bacteria | 1653 |
| 386 | Ga0496101_0127827 | 3300048904 | Bacteria | 1927 |
| 387 | Ga0496102_0008097 | 3300048905 | Bacteria | 8991 |
| 388 | Ga0496102_0345135 | 3300048905 | Bacteria | 1402 |
| 389 | Ga0496104_0072583 | 3300048907 | Bacteria | 3273 |
| 390 | Ga0496104_0088118 | 3300048907 | Bacteria | 2965 |
| 391 | Ga0496104_0276417 | 3300048907 | Bacteria | 1592 |
| 392 | Ga0496105_0005515 | 3300048908 | Bacteria | 9603 |
| 393 | Ga0496105_0042963 | 3300048908 | Bacteria | 3727 |
| 394 | Ga0496105_0151371 | 3300048908 | Bacteria | 1907 |
| 395 | Ga0496106_0002165 | 3300048909 | Bacteria | 14680 |
| 396 | Ga0496108_0015803 | 3300048911 | Bacteria | 6153 |
| 397 | Ga0496109_0000839 | 3300048912 | Bacteria | 25665 |
| 398 | Ga0496109_0023566 | 3300048912 | Bacteria | 5465 |
| 399 | Ga0496110_0050718 | 3300048913 | Bacteria | 3644 |
| 400 | Ga0496110_0285855 | 3300048913 | Bacteria | 1502 |
| 401 | Ga0496110_0394571 | 3300048913 | Bacteria | 1261 |
| 402 | Ga0496111_0002183 | 3300048914 | Bacteria | 11720 |
| 403 | Ga0496111_0033578 | 3300048914 | Bacteria | 3660 |
| 404 | Ga0496112_0022574 | 3300048915 | Bacteria | 5997 |
| 405 | Ga0496112_0093831 | 3300048915 | Bacteria | 2971 |
| 406 | Ga0496113_0011161 | 3300048916 | Bacteria | 5977 |
| 407 | Ga0496113_0106304 | 3300048916 | Bacteria | 2180 |
| 408 | Ga0496114_0085342 | 3300048917 | Bacteria | 2674 |
| 409 | Ga0496114_0087202 | 3300048917 | Bacteria | 2646 |
| 410 | Ga0496114_0119466 | 3300048917 | Bacteria | 2266 |
| 411 | Ga0496115_0008711 | 3300048918 | Bacteria | 7518 |
| 412 | Ga0496115_0222072 | 3300048918 | Bacteria | 1559 |
| 413 | Ga0496115_0304758 | 3300048918 | Bacteria | 1305 |
| 414 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 415 | Ga0496116_0002318 | 3300048919 | Bacteria | 20175 |
| 416 | Ga0496116_0019030 | 3300048919 | Bacteria | 5273 |
| 417 | Ga0496116_0020748 | 3300048919 | Bacteria | 4978 |
| 418 | Ga0496116_0041103 | 3300048919 | Bacteria | 3175 |
| 419 | Ga0496116_0044265 | 3300048919 | Bacteria | 3025 |
| 420 | Ga0496116_0053222 | 3300048919 | Bacteria | 2675 |
| 421 | Ga0496116_0143395 | 3300048919 | Bacteria | 1339 |
| 422 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 423 | Ga0496117_0003198 | 3300048920 | Bacteria | 19389 |
| 424 | Ga0496117_0020568 | 3300048920 | Bacteria | 5375 |
| 425 | Ga0496117_0034978 | 3300048920 | Bacteria | 3778 |
| 426 | Ga0496117_0181360 | 3300048920 | Bacteria | 1210 |
| 427 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 428 | Ga0496118_0003362 | 3300048921 | Bacteria | 20223 |
| 429 | Ga0496118_0029801 | 3300048921 | Bacteria | 4568 |
| 430 | Ga0496119_0000806 | 3300048922 | Bacteria | 41963 |
| 431 | Ga0496119_0004232 | 3300048922 | Bacteria | 14390 |
| 432 | Ga0496119_0004341 | 3300048922 | Bacteria | 14150 |
| 433 | Ga0496119_0029169 | 3300048922 | Bacteria | 3748 |
| 434 | Ga0496120_0001041 | 3300048923 | Bacteria | 37083 |
| 435 | Ga0496120_0007227 | 3300048923 | Bacteria | 8314 |
| 436 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 437 | Ga0496121_0002668 | 3300048924 | Bacteria | 26718 |
| 438 | Ga0496121_0080886 | 3300048924 | Bacteria | 2573 |
| 439 | Ga0496121_0125341 | 3300048924 | Bacteria | 1932 |
| 440 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 441 | Ga0496122_0000082 | 3300048925 | Bacteria | 209159 |
| 442 | Ga0496122_0006697 | 3300048925 | Bacteria | 13111 |
| 443 | Ga0496122_0007207 | 3300048925 | Bacteria | 12447 |
| 444 | Ga0496122_0022034 | 3300048925 | Bacteria | 5677 |
| 445 | Ga0496122_0026691 | 3300048925 | Bacteria | 4969 |
| 446 | Ga0496122_0081780 | 3300048925 | Bacteria | 2246 |
| 447 | Ga0496122_0114119 | 3300048925 | Bacteria | 1763 |
| 448 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 449 | Ga0496123_0000067 | 3300048926 | Bacteria | 209159 |
| 450 | Ga0496123_0001298 | 3300048926 | Bacteria | 35561 |
| 451 | Ga0496123_0016752 | 3300048926 | Bacteria | 5930 |
| 452 | Ga0496123_0026186 | 3300048926 | Bacteria | 4377 |
| 453 | Ga0496123_0026533 | 3300048926 | Bacteria | 4335 |
| 454 | Ga0496123_0028835 | 3300048926 | Bacteria | 4100 |
| 455 | Ga0496123_0071615 | 3300048926 | Bacteria | 2161 |
| 456 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 457 | Ga0496124_0007057 | 3300048927 | Bacteria | 12034 |
| 458 | Ga0496124_0015700 | 3300048927 | Bacteria | 7241 |
| 459 | Ga0496124_0016245 | 3300048927 | Bacteria | 7090 |
| 460 | Ga0496124_0041570 | 3300048927 | Bacteria | 3965 |
| 461 | Ga0496124_0046198 | 3300048927 | Bacteria | 3730 |
| 462 | Ga0496124_0083378 | 3300048927 | Bacteria | 2622 |
| 463 | Ga0496124_0127019 | 3300048927 | Bacteria | 2030 |
| 464 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 465 | Ga0496125_0000516 | 3300048928 | Bacteria | 67232 |
| 466 | Ga0496125_0003344 | 3300048928 | Bacteria | 19544 |
| 467 | Ga0496125_0005733 | 3300048928 | Bacteria | 13666 |
| 468 | Ga0496125_0008873 | 3300048928 | Bacteria | 10443 |
| 469 | Ga0496125_0083844 | 3300048928 | Bacteria | 2422 |
| 470 | Ga0496125_0102795 | 3300048928 | Bacteria | 2099 |
| 471 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 472 | Ga0496126_0005502 | 3300048929 | Bacteria | 14437 |
| 473 | Ga0496126_0022484 | 3300048929 | Bacteria | 6134 |
| 474 | Ga0496126_0043592 | 3300048929 | Bacteria | 4137 |
| 475 | Ga0496126_0058720 | 3300048929 | Bacteria | 3466 |
| 476 | Ga0496126_0170453 | 3300048929 | Bacteria | 1854 |
| 477 | Ga0496126_0171418 | 3300048929 | Bacteria | 1848 |
| 478 | Ga0496126_0205532 | 3300048929 | Bacteria | 1660 |
| 479 | Ga0501031_0000064 | 3300049568 | Bacteria | 56925 |
| 480 | Ga0501031_0002368 | 3300049568 | Bacteria | 11954 |
| 481 | Ga0501031_0201824 | 3300049568 | Bacteria | 1297 |
| 482 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 483 | Ga0501032_0000006 | 3300049569 | Bacteria | 261727 |
| 484 | Ga0501032_0016646 | 3300049569 | Bacteria | 5169 |
| 485 | Ga0501032_0234935 | 3300049569 | Bacteria | 1191 |
| 486 | Ga0501033_0000053 | 3300049570 | Bacteria | 109042 |
| 487 | Ga0501033_0000077 | 3300049570 | Bacteria | 92696 |
| 488 | Ga0501033_0000120 | 3300049570 | Bacteria | 75504 |
| 489 | Ga0501033_0103071 | 3300049570 | Bacteria | 2081 |
| 490 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 491 | Ga0501034_0000030 | 3300049571 | Bacteria | 248180 |
| 492 | Ga0501034_0000166 | 3300049571 | Bacteria | 122782 |
| 493 | Ga0501034_0000702 | 3300049571 | Bacteria | 50840 |
| 494 | Ga0501034_0035613 | 3300049571 | Bacteria | 5045 |
| 495 | Ga0501034_0250005 | 3300049571 | Bacteria | 1717 |
| 496 | Ga0501034_0267162 | 3300049571 | Bacteria | 1652 |
| 497 | Ga0501036_0000003 | 3300049572 | Bacteria | 261545 |
| 498 | Ga0501036_0000482 | 3300049572 | Bacteria | 28438 |
| 499 | Ga0501036_0020693 | 3300049572 | Bacteria | 5527 |
| 500 | Ga0501036_0116520 | 3300049572 | Bacteria | 2257 |
| 501 | Ga0501037_0000003 | 3300049573 | Bacteria | 261548 |
| 502 | Ga0501037_0000065 | 3300049573 | Bacteria | 96747 |
| 503 | Ga0501037_0003608 | 3300049573 | Bacteria | 11219 |
| 504 | Ga0501037_0078465 | 3300049573 | Bacteria | 2396 |
| 505 | Ga0501037_0083175 | 3300049573 | Bacteria | 2319 |
| 506 | Ga0501037_0103264 | 3300049573 | Bacteria | 2056 |
| 507 | Ga0501038_0000004 | 3300049574 | Bacteria | 261289 |
| 508 | Ga0501038_0000043 | 3300049574 | Bacteria | 113010 |
| 509 | Ga0501038_0050273 | 3300049574 | Bacteria | 3602 |
| 510 | Ga0501038_0125249 | 3300049574 | Bacteria | 2115 |
| 511 | Ga0501039_0000008 | 3300049575 | Bacteria | 274778 |
| 512 | Ga0501039_0000022 | 3300049575 | Bacteria | 160858 |
| 513 | Ga0501039_0000758 | 3300049575 | Bacteria | 23236 |
| 514 | Ga0501039_0044624 | 3300049575 | Bacteria | 3425 |
| 515 | Ga0501040_0024664 | 3300049576 | Bacteria | 4037 |
| 516 | Ga0501040_0028701 | 3300049576 | Bacteria | 3752 |
| 517 | Ga0501041_0006354 | 3300049577 | Bacteria | 6914 |
| 518 | Ga0501043_0000310 | 3300049579 | Bacteria | 44324 |
| 519 | Ga0501043_0000365 | 3300049579 | Bacteria | 40969 |
| 520 | Ga0501043_0040770 | 3300049579 | Bacteria | 3649 |
| 521 | Ga0501043_0085007 | 3300049579 | Bacteria | 2486 |
| 522 | Ga0501046_0000033 | 3300049580 | Bacteria | 174675 |
| 523 | Ga0501046_0084533 | 3300049580 | Bacteria | 2447 |
| 524 | Ga0501046_0095375 | 3300049580 | Bacteria | 2285 |
| 525 | Ga0501047_0001189 | 3300049581 | Bacteria | 25783 |
| 526 | Ga0501047_0008720 | 3300049581 | Bacteria | 9570 |
| 527 | Ga0501047_0030041 | 3300049581 | Bacteria | 5239 |
| 528 | Ga0501047_0081069 | 3300049581 | Bacteria | 3119 |
| 529 | Ga0501047_0086740 | 3300049581 | Bacteria | 3007 |
| 530 | Ga0501047_0088783 | 3300049581 | Bacteria | 2968 |
| 531 | Ga0501047_0099841 | 3300049581 | Bacteria | 2782 |
| 532 | Ga0501047_0180703 | 3300049581 | Bacteria | 1976 |
| 533 | Ga0501047_0235623 | 3300049581 | Bacteria | 1682 |
| 534 | Ga0501048_0000324 | 3300049582 | Bacteria | 32839 |
| 535 | Ga0501048_0323017 | 3300049582 | Bacteria | 1100 |
| 536 | Ga0501067_0004739 | 3300049583 | Bacteria | 7532 |
| 537 | Ga0501067_0012913 | 3300049583 | Bacteria | 4623 |
| 538 | Ga0501067_0033149 | 3300049583 | Bacteria | 2866 |
| 539 | Ga0501070_0001033 | 3300049586 | Bacteria | 25035 |
| 540 | Ga0501070_0022645 | 3300049586 | Bacteria | 5261 |
| 541 | Ga0501070_0046271 | 3300049586 | Bacteria | 3618 |
| 542 | Ga0501070_0142952 | 3300049586 | Bacteria | 1975 |
| 543 | Ga0501072_0015322 | 3300049588 | Bacteria | 5880 |
| 544 | Ga0501073_0005082 | 3300049589 | Bacteria | 9865 |
| 545 | Ga0501073_0030271 | 3300049589 | Bacteria | 3865 |
| 546 | Ga0501073_0123636 | 3300049589 | Bacteria | 1793 |
| 547 | Ga0501074_0008675 | 3300049590 | Bacteria | 7364 |
| 548 | Ga0501075_0000668 | 3300049591 | Bacteria | 21132 |
| 549 | Ga0501076_0005133 | 3300049592 | Bacteria | 9371 |
| 550 | Ga0501076_0022154 | 3300049592 | Bacteria | 4882 |
| 551 | Ga0501077_0001833 | 3300049593 | Bacteria | 12853 |
| 552 | Ga0501080_0001688 | 3300049742 | Bacteria | 18817 |
| 553 | Ga0501080_0006905 | 3300049742 | Bacteria | 10240 |
| 554 | Ga0501080_0027940 | 3300049742 | Bacteria | 5246 |
| 555 | Ga0501080_0049498 | 3300049742 | Bacteria | 3911 |
| 556 | Ga0501080_0196405 | 3300049742 | Bacteria | 1853 |
| 557 | Ga0501081_0001741 | 3300049743 | Bacteria | 13504 |
| 558 | Ga0501081_0268081 | 3300049743 | Bacteria | 1248 |
| 559 | Ga0501083_0011274 | 3300049744 | Bacteria | 6271 |
| 560 | Ga0501083_0018879 | 3300049744 | Bacteria | 4800 |
| 561 | Ga0501083_0045436 | 3300049744 | Bacteria | 2971 |
| 562 | Ga0501083_0058689 | 3300049744 | Bacteria | 2574 |
| 563 | Ga0501035_0000031 | 3300049822 | Bacteria | 175591 |
| 564 | Ga0501035_0000084 | 3300049822 | Bacteria | 116222 |
| 565 | Ga0501035_0000234 | 3300049822 | Bacteria | 66162 |
| 566 | Ga0501035_0000479 | 3300049822 | Bacteria | 44840 |
| 567 | Ga0501035_0000897 | 3300049822 | Bacteria | 31484 |
| 568 | Ga0501035_0174975 | 3300049822 | Bacteria | 1852 |
| 569 | Ga0501035_0179733 | 3300049822 | Bacteria | 1823 |
| 570 | Ga0501044_0000008 | 3300049823 | Bacteria | 274778 |
| 571 | Ga0501044_0000073 | 3300049823 | Bacteria | 122507 |
| 572 | Ga0501044_0003116 | 3300049823 | Bacteria | 18793 |
| 573 | Ga0501044_0061367 | 3300049823 | Bacteria | 3846 |
| 574 | Ga0501044_0228289 | 3300049823 | Bacteria | 1810 |
| 575 | Ga0501044_0301290 | 3300049823 | Bacteria | 1531 |
| 576 | Ga0501044_0303876 | 3300049823 | Bacteria | 1524 |
| 577 | Ga0501045_0032669 | 3300049824 | Bacteria | 3772 |
| 578 | Ga0501045_0053846 | 3300049824 | Bacteria | 2941 |
| 579 | nmdc:mga03683_24084_c1 | 3300050489 | Bacteria | 2378 |
| 580 | nmdc:mga03n38_71584_c1 | 3300050490 | Bacteria | 1606 |
| 581 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 582 | nmdc:mga00v17_83046_c1 | 3300050491 | Bacteria | 2003 |
| 583 | nmdc:mga00v17_89_c1 | 3300050491 | Bacteria | 55686 |
| 584 | nmdc:mga0k408_49766_c1 | 3300050493 | Bacteria | 2426 |
| 585 | nmdc:mga07m45_98969_c1 | 3300050496 | Bacteria | 1674 |
| 586 | nmdc:mga05p37_20638_c1 | 3300050507 | Bacteria | 7970 |
| 587 | nmdc:mga05p37_311_c1 | 3300050507 | Bacteria | 51481 |
| 588 | nmdc:mga09592_10686_c1 | 3300050508 | Bacteria | 7472 |
| 589 | nmdc:mga06r32_152475_c1 | 3300050510 | Bacteria | 2290 |
| 590 | nmdc:mga06r32_24194_c1 | 3300050510 | Bacteria | 5633 |
| 591 | nmdc:mga06r32_653_c1 | 3300050510 | Bacteria | 30286 |
| 592 | nmdc:mga08y16_132152_c1 | 3300050511 | Bacteria | 2595 |
| 593 | nmdc:mga08y16_165_c1 | 3300050511 | Bacteria | 57478 |
| 594 | nmdc:mga08y16_193049_c1 | 3300050511 | Bacteria | 2112 |
| 595 | nmdc:mga0rr50_7458_c1 | 3300050513 | Bacteria | 6749 |
| 596 | nmdc:mga08x19_18_c1 | 3300050514 | Bacteria | 321445 |
| 597 | nmdc:mga0sz30_1823_c2 | 3300050516 | Bacteria | 5964 |
| 598 | nmdc:mga0sz30_36660_c1 | 3300050516 | Bacteria | 2051 |
| 599 | nmdc:mga0sz30_81_c1 | 3300050516 | Bacteria | 36474 |
| 600 | Ga0495612_0000152 | 3300053078 | Bacteria | 29021 |
| 601 | Ga0495595_0014098 | 3300053084 | Bacteria | 3386 |
| 602 | Ga0495595_0044858 | 3300053084 | Bacteria | 2032 |
| 603 | Ga0495619_0003543 | 3300053085 | Bacteria | 10077 |
| 604 | Ga0495619_0017043 | 3300053085 | Bacteria | 4605 |
| 605 | Ga0500643_017532 | 3300053087 | Bacteria | 2397 |
| 606 | Ga0500641_0003244 | 3300053096 | Bacteria | 5752 |
| 607 | Ga0500556_0000092 | 3300053104 | Bacteria | 83297 |
| 608 | Ga0500556_0000160 | 3300053104 | Bacteria | 55309 |
| 609 | Ga0500556_0018924 | 3300053104 | Bacteria | 2181 |
| 610 | Ga0500562_000997 | 3300053108 | Bacteria | 6911 |
| 611 | Ga0500569_002816 | 3300053109 | Bacteria | 3473 |
| 612 | Ga0500618_000573 | 3300053125 | Bacteria | 22735 |
| 613 | Ga0500658_0000093 | 3300053134 | Bacteria | 41128 |
| 614 | Ga0500561_0000421 | 3300053137 | Bacteria | 6974 |
| 615 | Ga0500568_0000421 | 3300053139 | Bacteria | 31992 |
| 616 | Ga0500573_0000379 | 3300053140 | Bacteria | 18825 |
| 617 | Ga0500573_0007703 | 3300053140 | Bacteria | 5891 |
| 618 | Ga0500616_0000583 | 3300053153 | Bacteria | 44437 |
| 619 | Ga0500616_0001279 | 3300053153 | Bacteria | 25126 |
| 620 | Ga0500616_0003758 | 3300053153 | Bacteria | 11304 |
| 621 | Ga0500616_0020342 | 3300053153 | Bacteria | 3728 |
| 622 | Ga0500616_0036018 | 3300053153 | Bacteria | 2688 |
| 623 | Ga0500616_0049992 | 3300053153 | Bacteria | 2209 |
| 624 | Ga0500622_0003893 | 3300053156 | Bacteria | 9667 |
| 625 | Ga0500622_0016225 | 3300053156 | Bacteria | 3981 |
| 626 | Ga0500622_0078113 | 3300053156 | Bacteria | 1661 |
| 627 | Ga0500634_0015039 | 3300053161 | Bacteria | 4098 |
| 628 | Ga0500637_0008150 | 3300053178 | Bacteria | 5274 |
| 629 | Ga0500645_000746 | 3300053730 | Bacteria | 20007 |
| 630 | Ga0501084_0000488 | 3300054114 | Bacteria | 30370 |
| 631 | Ga0501084_0027159 | 3300054114 | Bacteria | 4783 |
| 632 | Ga0501084_0031365 | 3300054114 | Bacteria | 4444 |
| 633 | Ga0501084_0055846 | 3300054114 | Bacteria | 3304 |
| 634 | Ga0587090_000500 | 3300059510 | Bacteria | 3316 |
| 635 | Ga0501082_0037839 | 3300060353 | Bacteria | 4161 |
| 636 | Ga0501082_0070911 | 3300060353 | Bacteria | 3000 |
| 637 | Ga0501082_0295480 | 3300060353 | Bacteria | 1410 |
| 638 | Ga0466962_0064336 | 3300061719 | Bacteria | 1751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041411 | Ga0439466_0056508 | Ga0439466_0056508_11_913 | 299 |
| 2 | 3300048908 | Ga0496105_0151371 | Ga0496105_0151371_393_1568 | 342 |
| 3 | iso_pu_bacteria | 2585428106 | 2587917171 | 346 |
| 4 | iso_pu_bacteria | 2643221640 | 2644223626 | 346 |
| 5 | iso_pu_bacteria | 2643221642 | 2644236286 | 346 |
| 6 | iso_pu_bacteria | 2884960567 | 2884963557 | 346 |
| 7 | iso_pu_bacteria | 2928531327 | 2928531877 | 346 |
| 8 | 3300048929 | Ga0496126_0205532 | Ga0496126_0205532_594_1649 | 349 |
| 9 | 3300053087 | Ga0500643_017532 | Ga0500643_017532_12_1061 | 349 |
| 10 | 3300003781 | Ga0055536_1000569 | Ga0055536_10005699 | 350 |
| 11 | 3300003791 | Ga0055530_10003609 | Ga0055530_100036099 | 350 |
| 12 | 3300006195 | Ga0075366_10004332 | Ga0075366_100043328 | 350 |
| 13 | 3300006844 | Ga0075428_100003200 | Ga0075428_1000032008 | 350 |
| 14 | 3300006846 | Ga0075430_100048860 | Ga0075430_1000488602 | 350 |
| 15 | 3300006847 | Ga0075431_100000003 | Ga0075431_100000003102 | 350 |
| 16 | 3300006880 | Ga0075429_100012151 | Ga0075429_1000121515 | 350 |
| 17 | 3300009094 | Ga0111539_10000504 | Ga0111539_1000050427 | 350 |
| 18 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006287 | 350 |
| 19 | 3300025292 | Ga0209676_1000169 | Ga0209676_100016964 | 350 |
| 20 | 3300025298 | Ga0209050_1000281 | Ga0209050_100028140 | 350 |
| 21 | 3300025303 | Ga0209051_1006782 | Ga0209051_10067824 | 350 |
| 22 | 3300025304 | Ga0209257_1005651 | Ga0209257_10056512 | 350 |
| 23 | 3300027907 | Ga0207428_10084061 | Ga0207428_100840612 | 350 |
| 24 | 3300046616 | Ga0495668_0000040 | Ga0495668_0000040_110718_111770 | 350 |
| 25 | 3300046660 | Ga0495625_0028083 | Ga0495625_0028083_1091_2143 | 350 |
| 26 | 3300048926 | Ga0496123_0071615 | Ga0496123_0071615_1089_2141 | 350 |
| 27 | 3300048928 | Ga0496125_0102795 | Ga0496125_0102795_293_1345 | 350 |
| 28 | 3300048929 | Ga0496126_0005502 | Ga0496126_0005502_8739_9791 | 350 |
| 29 | 3300050493 | nmdc:mga0k408_49766_c1 | nmdc:mga0k408_49766_c1_814_1866 | 350 |
| 30 | 3300050496 | nmdc:mga07m45_98969_c1 | nmdc:mga07m45_98969_c1_434_1486 | 350 |
| 31 | 3300050507 | nmdc:mga05p37_311_c1 | nmdc:mga05p37_311_c1_32831_33943 | 350 |
| 32 | 3300050508 | nmdc:mga09592_10686_c1 | nmdc:mga09592_10686_c1_1572_2684 | 350 |
| 33 | 3300050510 | nmdc:mga06r32_653_c1 | nmdc:mga06r32_653_c1_3652_4764 | 350 |
| 34 | 3300050511 | nmdc:mga08y16_165_c1 | nmdc:mga08y16_165_c1_34358_35470 | 350 |
| 35 | 3300053156 | Ga0500622_0078113 | Ga0500622_0078113_404_1456 | 350 |
| 36 | 3300037853 | Ga0436364_1178347 | Ga0436364_1178347_89_1144 | 351 |
| 37 | 3300049582 | Ga0501048_0323017 | Ga0501048_0323017_27_1082 | 351 |
| 38 | 3300049742 | Ga0501080_0196405 | Ga0501080_0196405_229_1284 | 351 |
| 39 | 3300049569 | Ga0501032_0234935 | Ga0501032_0234935_53_1111 | 352 |
| 40 | 3300049579 | Ga0501043_0085007 | Ga0501043_0085007_1395_2453 | 352 |
| 41 | 3300049823 | Ga0501044_0301290 | Ga0501044_0301290_440_1498 | 352 |
| 42 | 3300053104 | Ga0500556_0018924 | Ga0500556_0018924_635_1693 | 352 |
| 43 | 3300053108 | Ga0500562_000997 | Ga0500562_000997_1242_2300 | 352 |
| 44 | 3300053153 | Ga0500616_0049992 | Ga0500616_0049992_325_1383 | 352 |
| 45 | 3300053730 | Ga0500645_000746 | Ga0500645_000746_12550_13608 | 352 |
| 46 | 3300025915 | Ga0207693_10027984 | Ga0207693_100279844 | 355 |
| 47 | 3300048924 | Ga0496121_0125341 | Ga0496121_0125341_149_1219 | 356 |
| 48 | 3300048928 | Ga0496125_0000516 | Ga0496125_0000516_59467_60579 | 357 |
| 49 | 3300048929 | Ga0496126_0022484 | Ga0496126_0022484_4376_5488 | 357 |
| 50 | 3300049743 | Ga0501081_0268081 | Ga0501081_0268081_101_1207 | 357 |
| 51 | 3300053096 | Ga0500641_0003244 | Ga0500641_0003244_705_1778 | 357 |
| 52 | 3300053156 | Ga0500622_0003893 | Ga0500622_0003893_4229_5305 | 357 |
| 53 | 3300054114 | Ga0501084_0027159 | Ga0501084_0027159_3652_4758 | 357 |
| 54 | 3300005336 | Ga0070680_100136044 | Ga0070680_1001360441 | 359 |
| 55 | 3300005457 | Ga0070662_100235372 | Ga0070662_1002353722 | 359 |
| 56 | 3300005458 | Ga0070681_10274978 | Ga0070681_102749782 | 359 |
| 57 | 3300005539 | Ga0068853_100000639 | Ga0068853_10000063924 | 359 |
| 58 | 3300005563 | Ga0068855_100040752 | Ga0068855_1000407522 | 359 |
| 59 | 3300009174 | Ga0105241_10008271 | Ga0105241_100082713 | 359 |
| 60 | 3300013104 | Ga0157370_10095710 | Ga0157370_100957103 | 359 |
| 61 | 3300025912 | Ga0207707_10165371 | Ga0207707_101653712 | 359 |
| 62 | 3300025933 | Ga0207706_10236763 | Ga0207706_102367632 | 359 |
| 63 | 3300025949 | Ga0207667_10183250 | Ga0207667_101832502 | 359 |
| 64 | 3300025981 | Ga0207640_10171870 | Ga0207640_101718702 | 359 |
| 65 | 3300026041 | Ga0207639_10004015 | Ga0207639_1000401512 | 359 |
| 66 | 3300026142 | Ga0207698_10215155 | Ga0207698_102151552 | 359 |
| 67 | iso_pu_bacteria | 8054563764 | 8054566017 | 360 |
| 68 | 3300049580 | Ga0501046_0084533 | Ga0501046_0084533_1147_2232 | 361 |
| 69 | iso_pu_bacteria | 2545555834 | 2545678699 | 361 |
| 70 | iso_pu_bacteria | 2738541281 | 2738747254 | 361 |
| 71 | iso_pu_bacteria | 2738543032 | 2739356483 | 361 |
| 72 | iso_pu_bacteria | 3003665799 | 3003668890 | 361 |
| 73 | iso_pu_bacteria | 641522639 | 641646734 | 361 |
| 74 | iso_pu_bacteria | 643348564 | 643604943 | 361 |
| 75 | 3300037853 | Ga0436364_0472918 | Ga0436364_0472918_515_1636 | 362 |
| 76 | 3300038742 | Ga0400486_00583 | Ga0400486_00583_389_1477 | 362 |
| 77 | iso_pu_bacteria | 2595698237 | 2596373779 | 362 |
| 78 | iso_pu_bacteria | 2773857925 | 2774871888 | 362 |
| 79 | iso_pu_bacteria | 2889306138 | 2889311085 | 362 |
| 80 | iso_pu_bacteria | 2902330777 | 2902336142 | 362 |
| 81 | iso_pu_bacteria | 2902405164 | 2902407183 | 362 |
| 82 | iso_pu_bacteria | 2909042592 | 2909046889 | 362 |
| 83 | iso_pu_bacteria | 2928125067 | 2928127361 | 362 |
| 84 | 3300025928 | Ga0207700_10089252 | Ga0207700_100892522 | 363 |
| 85 | iso_pu_bacteria | 2643221550 | 2643771749 | 363 |
| 86 | iso_pu_bacteria | 2643221551 | 2643777293 | 363 |
| 87 | iso_pu_bacteria | 2643221555 | 2643795741 | 363 |
| 88 | iso_pu_bacteria | 2643221564 | 2643838010 | 363 |
| 89 | iso_pu_bacteria | 2643221733 | 2644731640 | 363 |
| 90 | iso_pu_bacteria | 2643221736 | 2644742020 | 363 |
| 91 | iso_pu_bacteria | 2671180139 | 2671694938 | 363 |
| 92 | iso_pu_bacteria | 2818991467 | 2819719377 | 363 |
| 93 | iso_pu_bacteria | 2837651117 | 2837651359 | 363 |
| 94 | iso_pu_bacteria | 2841760612 | 2841763428 | 363 |
| 95 | iso_pu_bacteria | 2841911363 | 2841912147 | 363 |
| 96 | iso_pu_bacteria | 2841917233 | 2841918014 | 363 |
| 97 | iso_pu_bacteria | 2844104063 | 2844109668 | 363 |
| 98 | iso_pu_bacteria | 2851182111 | 2851182666 | 363 |
| 99 | iso_pu_bacteria | 2851246043 | 2851251775 | 363 |
| 100 | iso_pu_bacteria | 2996310559 | 2996311696 | 363 |
| 101 | iso_pu_bacteria | 2996336353 | 2996339354 | 363 |
| 102 | iso_pu_bacteria | 8001845381 | 8001845846 | 363 |
| 103 | iso_pu_bacteria | 8057529695 | 8057534639 | 363 |
| 104 | iso_pu_bacteria | 2643221568 | 2643854906 | 364 |
| 105 | iso_pu_bacteria | 2828305725 | 2828307931 | 364 |
| 106 | iso_pu_bacteria | 2919166419 | 2919170537 | 364 |
| 107 | iso_pu_bacteria | 2919450847 | 2919452167 | 364 |
| 108 | iso_pu_bacteria | 2978969890 | 2978972660 | 364 |
| 109 | iso_pu_bacteria | 2984587000 | 2984590912 | 364 |
| 110 | iso_pu_bacteria | 2989771324 | 2989771696 | 364 |
| 111 | 3300025906 | Ga0207699_10071266 | Ga0207699_100712663 | 365 |
| 112 | 3300048904 | Ga0496101_0127827 | Ga0496101_0127827_613_1713 | 365 |
| 113 | 3300048907 | Ga0496104_0088118 | Ga0496104_0088118_1014_2114 | 365 |
| 114 | 3300048907 | Ga0496104_0276417 | Ga0496104_0276417_45_1145 | 365 |
| 115 | 3300048912 | Ga0496109_0023566 | Ga0496109_0023566_1352_2452 | 365 |
| 116 | 3300048915 | Ga0496112_0093831 | Ga0496112_0093831_1482_2582 | 365 |
| 117 | 3300048918 | Ga0496115_0222072 | Ga0496115_0222072_149_1249 | 365 |
| 118 | iso_pu_bacteria | 2510917026 | 2511172718 | 365 |
| 119 | iso_pu_bacteria | 2585427633 | 2585998052 | 365 |
| 120 | iso_pu_bacteria | 2585427634 | 2586002632 | 365 |
| 121 | iso_pu_bacteria | 2599185236 | 2599722616 | 365 |
| 122 | iso_pu_bacteria | 2600254933 | 2600377415 | 365 |
| 123 | iso_pu_bacteria | 2643221558 | 2643814848 | 365 |
| 124 | iso_pu_bacteria | 2854916844 | 2854922289 | 365 |
| 125 | iso_pu_bacteria | 2891088606 | 2891090992 | 365 |
| 126 | iso_pu_bacteria | 2919171160 | 2919176908 | 365 |
| 127 | iso_pu_bacteria | 8018150411 | 8018154988 | 365 |
| 128 | 3300006051 | Ga0075364_10050131 | Ga0075364_100501312 | 366 |
| 129 | 3300028577 | Ga0265318_10028340 | Ga0265318_100283402 | 366 |
| 130 | 3300031242 | Ga0265329_10053172 | Ga0265329_100531721 | 366 |
| 131 | 3300031595 | Ga0265313_10006036 | Ga0265313_100060364 | 366 |
| 132 | 3300031711 | Ga0265314_10091592 | Ga0265314_100915922 | 366 |
| 133 | 3300031712 | Ga0265342_10023964 | Ga0265342_100239642 | 366 |
| 134 | 3300031712 | Ga0265342_10031119 | Ga0265342_100311192 | 366 |
| 135 | 3300031712 | Ga0265342_10054397 | Ga0265342_100543972 | 366 |
| 136 | 3300049581 | Ga0501047_0086740 | Ga0501047_0086740_12_1112 | 366 |
| 137 | 3300049583 | Ga0501067_0033149 | Ga0501067_0033149_1301_2401 | 366 |
| 138 | 3300049586 | Ga0501070_0046271 | Ga0501070_0046271_1925_3025 | 366 |
| 139 | 3300049589 | Ga0501073_0030271 | Ga0501073_0030271_2425_3525 | 366 |
| 140 | 3300049744 | Ga0501083_0018879 | Ga0501083_0018879_1593_2693 | 366 |
| 141 | 3300050491 | nmdc:mga00v17_83046_c1 | nmdc:mga00v17_83046_c1_318_1427 | 366 |
| 142 | 3300050516 | nmdc:mga0sz30_1823_c2 | nmdc:mga0sz30_1823_c2_267_1367 | 366 |
| 143 | 3300060353 | Ga0501082_0295480 | Ga0501082_0295480_254_1354 | 366 |
| 144 | iso_pu_bacteria | 2509276019 | 2509378013 | 366 |
| 145 | iso_pu_bacteria | 2509276021 | 2509389264 | 366 |
| 146 | iso_pu_bacteria | 2509276033 | 2509446344 | 366 |
| 147 | iso_pu_bacteria | 2510065019 | 2510135396 | 366 |
| 148 | iso_pu_bacteria | 2510065057 | 2510305799 | 366 |
| 149 | iso_pu_bacteria | 2510461069 | 2510843408 | 366 |
| 150 | iso_pu_bacteria | 2510461076 | 2510896849 | 366 |
| 151 | iso_pu_bacteria | 2510917022 | 2511135869 | 366 |
| 152 | iso_pu_bacteria | 2510917028 | 2511184125 | 366 |
| 153 | iso_pu_bacteria | 2510917030 | 2511199382 | 366 |
| 154 | iso_pu_bacteria | 2511231052 | 2511498563 | 366 |
| 155 | iso_pu_bacteria | 2512875026 | 2512973474 | 366 |
| 156 | iso_pu_bacteria | 2513237084 | 2513572909 | 366 |
| 157 | iso_pu_bacteria | 2513237085 | 2513580442 | 366 |
| 158 | iso_pu_bacteria | 2513237086 | 2513583723 | 366 |
| 159 | iso_pu_bacteria | 2513237087 | 2513591188 | 366 |
| 160 | iso_pu_bacteria | 2513237088 | 2513596922 | 366 |
| 161 | iso_pu_bacteria | 2513237089 | 2513602009 | 366 |
| 162 | iso_pu_bacteria | 2513237091 | 2513615797 | 366 |
| 163 | iso_pu_bacteria | 2513237093 | 2513634945 | 366 |
| 164 | iso_pu_bacteria | 2513237103 | 2513711495 | 366 |
| 165 | iso_pu_bacteria | 2513237138 | 2513865223 | 366 |
| 166 | iso_pu_bacteria | 2513237140 | 2513886759 | 366 |
| 167 | iso_pu_bacteria | 2513237143 | 2513906823 | 366 |
| 168 | iso_pu_bacteria | 2513237144 | 2513912867 | 366 |
| 169 | iso_pu_bacteria | 2513237146 | 2513928661 | 366 |
| 170 | iso_pu_bacteria | 2513237156 | 2513983463 | 366 |
| 171 | iso_pu_bacteria | 2513237159 | 2513998301 | 366 |
| 172 | iso_pu_bacteria | 2513237160 | 2514003393 | 366 |
| 173 | iso_pu_bacteria | 2513237162 | 2514019559 | 366 |
| 174 | iso_pu_bacteria | 2515075009 | 2515114566 | 366 |
| 175 | iso_pu_bacteria | 2515154107 | 2515612455 | 366 |
| 176 | iso_pu_bacteria | 2515154113 | 2515635017 | 366 |
| 177 | iso_pu_bacteria | 2515154114 | 2515644420 | 366 |
| 178 | iso_pu_bacteria | 2515154116 | 2515657500 | 366 |
| 179 | iso_pu_bacteria | 2515154134 | 2515741747 | 366 |
| 180 | iso_pu_bacteria | 2516653046 | 2516894841 | 366 |
| 181 | iso_pu_bacteria | 2516653077 | 2517038207 | 366 |
| 182 | iso_pu_bacteria | 2516653085 | 2517078485 | 366 |
| 183 | iso_pu_bacteria | 2517093000 | 2517097224 | 366 |
| 184 | iso_pu_bacteria | 2517287029 | 2517408386 | 366 |
| 185 | iso_pu_bacteria | 2517487022 | 2517571523 | 366 |
| 186 | iso_pu_bacteria | 2519899620 | 2520379780 | 366 |
| 187 | iso_pu_bacteria | 2524023207 | 2524450340 | 366 |
| 188 | iso_pu_bacteria | 2524023209 | 2524461159 | 366 |
| 189 | iso_pu_bacteria | 2529292951 | 2530647209 | 366 |
| 190 | iso_pu_bacteria | 2534681786 | 2535486835 | 366 |
| 191 | iso_pu_bacteria | 2537561587 | 2537873588 | 366 |
| 192 | iso_pu_bacteria | 2551306084 | 2551676695 | 366 |
| 193 | iso_pu_bacteria | 2551306084 | 2551680319 | 366 |
| 194 | iso_pu_bacteria | 2551306085 | 2551685150 | 366 |
| 195 | iso_pu_bacteria | 2551306086 | 2551696580 | 366 |
| 196 | iso_pu_bacteria | 2551306087 | 2551702906 | 366 |
| 197 | iso_pu_bacteria | 2551306089 | 2551711349 | 366 |
| 198 | iso_pu_bacteria | 2551306090 | 2551716179 | 366 |
| 199 | iso_pu_bacteria | 2551306093 | 2551741182 | 366 |
| 200 | iso_pu_bacteria | 2558860100 | 2558867485 | 366 |
| 201 | iso_pu_bacteria | 2582581294 | 2585201634 | 366 |
| 202 | iso_pu_bacteria | 2582581298 | 2585224081 | 366 |
| 203 | iso_pu_bacteria | 2582581299 | 2585228641 | 366 |
| 204 | iso_pu_bacteria | 2582581304 | 2585257253 | 366 |
| 205 | iso_pu_bacteria | 2582581307 | 2585272042 | 366 |
| 206 | iso_pu_bacteria | 2582581308 | 2585279654 | 366 |
| 207 | iso_pu_bacteria | 2582581315 | 2585327492 | 366 |
| 208 | iso_pu_bacteria | 2582581867 | 2585399854 | 366 |
| 209 | iso_pu_bacteria | 2585427526 | 2585529217 | 366 |
| 210 | iso_pu_bacteria | 2585427527 | 2585535734 | 366 |
| 211 | iso_pu_bacteria | 2585427528 | 2585543033 | 366 |
| 212 | iso_pu_bacteria | 2585427529 | 2585549781 | 366 |
| 213 | iso_pu_bacteria | 2585427530 | 2585551111 | 366 |
| 214 | iso_pu_bacteria | 2585427531 | 2585563413 | 366 |
| 215 | iso_pu_bacteria | 2585427590 | 2585820942 | 366 |
| 216 | iso_pu_bacteria | 2585427593 | 2585839198 | 366 |
| 217 | iso_pu_bacteria | 2585427594 | 2585844990 | 366 |
| 218 | iso_pu_bacteria | 2585427608 | 2585897165 | 366 |
| 219 | iso_pu_bacteria | 2585427609 | 2585909080 | 366 |
| 220 | iso_pu_bacteria | 2585428125 | 2587984494 | 366 |
| 221 | iso_pu_bacteria | 2599185170 | 2599419986 | 366 |
| 222 | iso_pu_bacteria | 2599185210 | 2599603166 | 366 |
| 223 | iso_pu_bacteria | 2600255279 | 2601610929 | 366 |
| 224 | iso_pu_bacteria | 2600255308 | 2601747703 | 366 |
| 225 | iso_pu_bacteria | 2615840624 | 2616297466 | 366 |
| 226 | iso_pu_bacteria | 2615840626 | 2616306442 | 366 |
| 227 | iso_pu_bacteria | 2615840698 | 2616551070 | 366 |
| 228 | iso_pu_bacteria | 2617270742 | 2617382303 | 366 |
| 229 | iso_pu_bacteria | 2643221582 | 2643921565 | 366 |
| 230 | iso_pu_bacteria | 2643221599 | 2644002563 | 366 |
| 231 | iso_pu_bacteria | 2643221607 | 2644052414 | 366 |
| 232 | iso_pu_bacteria | 2643221634 | 2644194728 | 366 |
| 233 | iso_pu_bacteria | 2643221636 | 2644201203 | 366 |
| 234 | iso_pu_bacteria | 2643221637 | 2644209581 | 366 |
| 235 | iso_pu_bacteria | 2643221643 | 2644240408 | 366 |
| 236 | iso_pu_bacteria | 2643221653 | 2644299750 | 366 |
| 237 | iso_pu_bacteria | 2643221686 | 2644484692 | 366 |
| 238 | iso_pu_bacteria | 2643221688 | 2644492578 | 366 |
| 239 | iso_pu_bacteria | 2643221689 | 2644499487 | 366 |
| 240 | iso_pu_bacteria | 2643221718 | 2644653109 | 366 |
| 241 | iso_pu_bacteria | 2643221719 | 2644657977 | 366 |
| 242 | iso_pu_bacteria | 2667528174 | 2671116051 | 366 |
| 243 | iso_pu_bacteria | 2690316117 | 2692319865 | 366 |
| 244 | iso_pu_bacteria | 2718217882 | 2719183102 | 366 |
| 245 | iso_pu_bacteria | 2718217927 | 2719387822 | 366 |
| 246 | iso_pu_bacteria | 2718217997 | 2719667443 | 366 |
| 247 | iso_pu_bacteria | 2718218009 | 2719733819 | 366 |
| 248 | iso_pu_bacteria | 2718218199 | 2720493863 | 366 |
| 249 | iso_pu_bacteria | 2718218232 | 2720615324 | 366 |
| 250 | iso_pu_bacteria | 2718218233 | 2720622112 | 366 |
| 251 | iso_pu_bacteria | 2718218235 | 2720633466 | 366 |
| 252 | iso_pu_bacteria | 2718218269 | 2720777164 | 366 |
| 253 | iso_pu_bacteria | 2718218363 | 2721149214 | 366 |
| 254 | iso_pu_bacteria | 2718218365 | 2721160618 | 366 |
| 255 | iso_pu_bacteria | 2718218366 | 2721166027 | 366 |
| 256 | iso_pu_bacteria | 2718218423 | 2721401455 | 366 |
| 257 | iso_pu_bacteria | 2721755514 | 2722842197 | 366 |
| 258 | iso_pu_bacteria | 2721755556 | 2723028762 | 366 |
| 259 | iso_pu_bacteria | 2721755684 | 2723562375 | 366 |
| 260 | iso_pu_bacteria | 2721755685 | 2723569071 | 366 |
| 261 | iso_pu_bacteria | 2721755809 | 2724040269 | 366 |
| 262 | iso_pu_bacteria | 2721755810 | 2724046575 | 366 |
| 263 | iso_pu_bacteria | 2721755819 | 2724091771 | 366 |
| 264 | iso_pu_bacteria | 2721755822 | 2724106336 | 366 |
| 265 | iso_pu_bacteria | 2721755823 | 2724112143 | 366 |
| 266 | iso_pu_bacteria | 2724679232 | 2725945753 | 366 |
| 267 | iso_pu_bacteria | 2728369352 | 2730109698 | 366 |
| 268 | iso_pu_bacteria | 2728369365 | 2730166337 | 366 |
| 269 | iso_pu_bacteria | 2728369397 | 2730300250 | 366 |
| 270 | iso_pu_bacteria | 2738541293 | 2738801096 | 366 |
| 271 | iso_pu_bacteria | 2738541317 | 2738946994 | 366 |
| 272 | iso_pu_bacteria | 2738541333 | 2739037729 | 366 |
| 273 | iso_pu_bacteria | 2758568016 | 2758640075 | 366 |
| 274 | iso_pu_bacteria | 2765235802 | 2765465750 | 366 |
| 275 | iso_pu_bacteria | 2765235942 | 2766064112 | 366 |
| 276 | iso_pu_bacteria | 2767802442 | 2770199136 | 366 |
| 277 | iso_pu_bacteria | 2775507049 | 2776915552 | 366 |
| 278 | iso_pu_bacteria | 2775507266 | 2778179195 | 366 |
| 279 | iso_pu_bacteria | 2791355082 | 2792582318 | 366 |
| 280 | iso_pu_bacteria | 2791355091 | 2792621830 | 366 |
| 281 | iso_pu_bacteria | 2791355092 | 2792628912 | 366 |
| 282 | iso_pu_bacteria | 2791355094 | 2792640052 | 366 |
| 283 | iso_pu_bacteria | 2791355253 | 2793281811 | 366 |
| 284 | iso_pu_bacteria | 2791355256 | 2793295491 | 366 |
| 285 | iso_pu_bacteria | 2791355259 | 2793317596 | 366 |
| 286 | iso_pu_bacteria | 2791355260 | 2793320861 | 366 |
| 287 | iso_pu_bacteria | 2791355261 | 2793327430 | 366 |
| 288 | iso_pu_bacteria | 2791355262 | 2793332375 | 366 |
| 289 | iso_pu_bacteria | 2791355263 | 2793338969 | 366 |
| 290 | iso_pu_bacteria | 2791355264 | 2793346739 | 366 |
| 291 | iso_pu_bacteria | 2791355265 | 2793356089 | 366 |
| 292 | iso_pu_bacteria | 2791355266 | 2793359234 | 366 |
| 293 | iso_pu_bacteria | 2791355267 | 2793366043 | 366 |
| 294 | iso_pu_bacteria | 2802428858 | 2802717111 | 366 |
| 295 | iso_pu_bacteria | 2802428859 | 2802724901 | 366 |
| 296 | iso_pu_bacteria | 2802428860 | 2802729651 | 366 |
| 297 | iso_pu_bacteria | 2802428861 | 2802736997 | 366 |
| 298 | iso_pu_bacteria | 2802428862 | 2802743402 | 366 |
| 299 | iso_pu_bacteria | 2802428863 | 2802749472 | 366 |
| 300 | iso_pu_bacteria | 2802429605 | 2805926350 | 366 |
| 301 | iso_pu_bacteria | 2802429606 | 2805934077 | 366 |
| 302 | iso_pu_bacteria | 2802429633 | 2806047727 | 366 |
| 303 | iso_pu_bacteria | 2802429634 | 2806055303 | 366 |
| 304 | iso_pu_bacteria | 2802429635 | 2806062184 | 366 |
| 305 | iso_pu_bacteria | 2802429636 | 2806070057 | 366 |
| 306 | iso_pu_bacteria | 2802429637 | 2806076643 | 366 |
| 307 | iso_pu_bacteria | 2818991272 | 2819244539 | 366 |
| 308 | iso_pu_bacteria | 2818991439 | 2819561051 | 366 |
| 309 | iso_pu_bacteria | 2818991448 | 2819611950 | 366 |
| 310 | iso_pu_bacteria | 2818991453 | 2819638510 | 366 |
| 311 | iso_pu_bacteria | 2838016132 | 2838018184 | 366 |
| 312 | iso_pu_bacteria | 2838022645 | 2838023863 | 366 |
| 313 | iso_pu_bacteria | 2838029111 | 2838034097 | 366 |
| 314 | iso_pu_bacteria | 2838035591 | 2838040192 | 366 |
| 315 | iso_pu_bacteria | 2838042994 | 2838046725 | 366 |
| 316 | iso_pu_bacteria | 2838048938 | 2838050956 | 366 |
| 317 | iso_pu_bacteria | 2838061910 | 2838062723 | 366 |
| 318 | iso_pu_bacteria | 2838068647 | 2838072268 | 366 |
| 319 | iso_pu_bacteria | 2838074704 | 2838078085 | 366 |
| 320 | iso_pu_bacteria | 2838661181 | 2838667011 | 366 |
| 321 | iso_pu_bacteria | 2838668709 | 2838672304 | 366 |
| 322 | iso_pu_bacteria | 2838675328 | 2838678579 | 366 |
| 323 | iso_pu_bacteria | 2838680041 | 2838683736 | 366 |
| 324 | iso_pu_bacteria | 2838686498 | 2838693318 | 366 |
| 325 | iso_pu_bacteria | 2838694306 | 2838698264 | 366 |
| 326 | iso_pu_bacteria | 2838701080 | 2838704827 | 366 |
| 327 | iso_pu_bacteria | 2838707686 | 2838711379 | 366 |
| 328 | iso_pu_bacteria | 2838714209 | 2838718333 | 366 |
| 329 | iso_pu_bacteria | 2838719591 | 2838722875 | 366 |
| 330 | iso_pu_bacteria | 2838724970 | 2838728399 | 366 |
| 331 | iso_pu_bacteria | 2838729681 | 2838735312 | 366 |
| 332 | iso_pu_bacteria | 2838742623 | 2838748139 | 366 |
| 333 | iso_pu_bacteria | 2839993093 | 2839993393 | 366 |
| 334 | iso_pu_bacteria | 2841846520 | 2841850431 | 366 |
| 335 | iso_pu_bacteria | 2841851746 | 2841857384 | 366 |
| 336 | iso_pu_bacteria | 2841859092 | 2841863316 | 366 |
| 337 | iso_pu_bacteria | 2841864319 | 2841867612 | 366 |
| 338 | iso_pu_bacteria | 2842077413 | 2842081180 | 366 |
| 339 | iso_pu_bacteria | 2842110456 | 2842116568 | 366 |
| 340 | iso_pu_bacteria | 2842118031 | 2842122043 | 366 |
| 341 | iso_pu_bacteria | 2842124991 | 2842129059 | 366 |
| 342 | iso_pu_bacteria | 2842130223 | 2842133472 | 366 |
| 343 | iso_pu_bacteria | 2842146304 | 2842148937 | 366 |
| 344 | iso_pu_bacteria | 2842152218 | 2842155617 | 366 |
| 345 | iso_pu_bacteria | 2842156927 | 2842162441 | 366 |
| 346 | iso_pu_bacteria | 2842163707 | 2842166858 | 366 |
| 347 | iso_pu_bacteria | 2842170452 | 2842174425 | 366 |
| 348 | iso_pu_bacteria | 2842175837 | 2842179086 | 366 |
| 349 | iso_pu_bacteria | 2842180545 | 2842186081 | 366 |
| 350 | iso_pu_bacteria | 2842187318 | 2842190757 | 366 |
| 351 | iso_pu_bacteria | 2842192696 | 2842194743 | 366 |
| 352 | iso_pu_bacteria | 2842198810 | 2842201217 | 366 |
| 353 | iso_pu_bacteria | 2842205361 | 2842207558 | 366 |
| 354 | iso_pu_bacteria | 2842211629 | 2842214919 | 366 |
| 355 | iso_pu_bacteria | 2842217011 | 2842221930 | 366 |
| 356 | iso_pu_bacteria | 2842224351 | 2842227640 | 366 |
| 357 | iso_pu_bacteria | 2842229732 | 2842235540 | 366 |
| 358 | iso_pu_bacteria | 2842237096 | 2842241057 | 366 |
| 359 | iso_pu_bacteria | 2842243621 | 2842249177 | 366 |
| 360 | iso_pu_bacteria | 2842250916 | 2842254508 | 366 |
| 361 | iso_pu_bacteria | 2842257432 | 2842263132 | 366 |
| 362 | iso_pu_bacteria | 2842264693 | 2842269303 | 366 |
| 363 | iso_pu_bacteria | 2842271015 | 2842277786 | 366 |
| 364 | iso_pu_bacteria | 2842278818 | 2842280731 | 366 |
| 365 | iso_pu_bacteria | 2842285085 | 2842288658 | 366 |
| 366 | iso_pu_bacteria | 2842291075 | 2842294837 | 366 |
| 367 | iso_pu_bacteria | 2842298080 | 2842302603 | 366 |
| 368 | iso_pu_bacteria | 2842304105 | 2842305671 | 366 |
| 369 | iso_pu_bacteria | 2842311132 | 2842311560 | 366 |
| 370 | iso_pu_bacteria | 2842317721 | 2842321248 | 366 |
| 371 | iso_pu_bacteria | 2842341865 | 2842346841 | 366 |
| 372 | iso_pu_bacteria | 2842357229 | 2842358895 | 366 |
| 373 | iso_pu_bacteria | 2842363717 | 2842366126 | 366 |
| 374 | iso_pu_bacteria | 2842370503 | 2842375145 | 366 |
| 375 | iso_pu_bacteria | 2842377471 | 2842381236 | 366 |
| 376 | iso_pu_bacteria | 2842384541 | 2842388306 | 366 |
| 377 | iso_pu_bacteria | 2842395702 | 2842395795 | 366 |
| 378 | iso_pu_bacteria | 2842402390 | 2842405996 | 366 |
| 379 | iso_pu_bacteria | 2842409023 | 2842412580 | 366 |
| 380 | iso_pu_bacteria | 2842415677 | 2842419541 | 366 |
| 381 | iso_pu_bacteria | 2842422224 | 2842425900 | 366 |
| 382 | iso_pu_bacteria | 2842428310 | 2842433413 | 366 |
| 383 | iso_pu_bacteria | 2842434925 | 2842439532 | 366 |
| 384 | iso_pu_bacteria | 2842441272 | 2842446160 | 366 |
| 385 | iso_pu_bacteria | 2842447887 | 2842448602 | 366 |
| 386 | iso_pu_bacteria | 2842462802 | 2842467662 | 366 |
| 387 | iso_pu_bacteria | 2842469257 | 2842474374 | 366 |
| 388 | iso_pu_bacteria | 2842475841 | 2842480935 | 366 |
| 389 | iso_pu_bacteria | 2842482326 | 2842485258 | 366 |
| 390 | iso_pu_bacteria | 2842489311 | 2842491315 | 366 |
| 391 | iso_pu_bacteria | 2842495871 | 2842498639 | 366 |
| 392 | iso_pu_bacteria | 2842502639 | 2842507454 | 366 |
| 393 | iso_pu_bacteria | 2842509118 | 2842514716 | 366 |
| 394 | iso_pu_bacteria | 2842515876 | 2842519947 | 366 |
| 395 | iso_pu_bacteria | 2842521101 | 2842524675 | 366 |
| 396 | iso_pu_bacteria | 2844454524 | 2844456833 | 366 |
| 397 | iso_pu_bacteria | 2847417321 | 2847420912 | 366 |
| 398 | iso_pu_bacteria | 2848992105 | 2848995745 | 366 |
| 399 | iso_pu_bacteria | 2850079185 | 2850082729 | 366 |
| 400 | iso_pu_bacteria | 2852387548 | 2852392078 | 366 |
| 401 | iso_pu_bacteria | 2854911287 | 2854913314 | 366 |
| 402 | iso_pu_bacteria | 2855825444 | 2855827475 | 366 |
| 403 | iso_pu_bacteria | 2855839649 | 2855842849 | 366 |
| 404 | iso_pu_bacteria | 2855872281 | 2855873609 | 366 |
| 405 | iso_pu_bacteria | 2857516855 | 2857519733 | 366 |
| 406 | iso_pu_bacteria | 2858800743 | 2858802187 | 366 |
| 407 | iso_pu_bacteria | 2889790730 | 2889795758 | 366 |
| 408 | iso_pu_bacteria | 2889914905 | 2889916405 | 366 |
| 409 | iso_pu_bacteria | 2896384573 | 2896390111 | 366 |
| 410 | iso_pu_bacteria | 2899792073 | 2899795413 | 366 |
| 411 | iso_pu_bacteria | 2899803654 | 2899804992 | 366 |
| 412 | iso_pu_bacteria | 2904578770 | 2904579958 | 366 |
| 413 | iso_pu_bacteria | 2913295892 | 2913300246 | 366 |
| 414 | iso_pu_bacteria | 2913308742 | 2913312181 | 366 |
| 415 | iso_pu_bacteria | 2915980308 | 2915981737 | 366 |
| 416 | iso_pu_bacteria | 2915986958 | 2915993376 | 366 |
| 417 | iso_pu_bacteria | 2915993759 | 2915999841 | 366 |
| 418 | iso_pu_bacteria | 2916000859 | 2916006142 | 366 |
| 419 | iso_pu_bacteria | 2916007675 | 2916009077 | 366 |
| 420 | iso_pu_bacteria | 2916014648 | 2916019841 | 366 |
| 421 | iso_pu_bacteria | 2916021584 | 2916023906 | 366 |
| 422 | iso_pu_bacteria | 2916028427 | 2916030988 | 366 |
| 423 | iso_pu_bacteria | 2916035215 | 2916040472 | 366 |
| 424 | iso_pu_bacteria | 2916041962 | 2916043407 | 366 |
| 425 | iso_pu_bacteria | 2916048683 | 2916050668 | 366 |
| 426 | iso_pu_bacteria | 2916055098 | 2916056835 | 366 |
| 427 | iso_pu_bacteria | 2916061851 | 2916066508 | 366 |
| 428 | iso_pu_bacteria | 2916068649 | 2916074337 | 366 |
| 429 | iso_pu_bacteria | 2916076590 | 2916077161 | 366 |
| 430 | iso_pu_bacteria | 2919100787 | 2919107916 | 366 |
| 431 | iso_pu_bacteria | 2919114240 | 2919118410 | 366 |
| 432 | iso_pu_bacteria | 2919119836 | 2919120370 | 366 |
| 433 | iso_pu_bacteria | 2919408235 | 2919411432 | 366 |
| 434 | iso_pu_bacteria | 2920760137 | 2920760242 | 366 |
| 435 | iso_pu_bacteria | 2921201388 | 2921204792 | 366 |
| 436 | iso_pu_bacteria | 2921208531 | 2921210369 | 366 |
| 437 | iso_pu_bacteria | 2921237296 | 2921240381 | 366 |
| 438 | iso_pu_bacteria | 2921244191 | 2921245655 | 366 |
| 439 | iso_pu_bacteria | 2921250672 | 2921252826 | 366 |
| 440 | iso_pu_bacteria | 2921257292 | 2921262604 | 366 |
| 441 | iso_pu_bacteria | 2921263974 | 2921266264 | 366 |
| 442 | iso_pu_bacteria | 2921282425 | 2921288908 | 366 |
| 443 | iso_pu_bacteria | 2921289301 | 2921293955 | 366 |
| 444 | iso_pu_bacteria | 2921296804 | 2921302974 | 366 |
| 445 | iso_pu_bacteria | 2923556063 | 2923560635 | 366 |
| 446 | iso_pu_bacteria | 2924144063 | 2924144784 | 366 |
| 447 | iso_pu_bacteria | 2924150972 | 2924157636 | 366 |
| 448 | iso_pu_bacteria | 2924158325 | 2924158806 | 366 |
| 449 | iso_pu_bacteria | 2924165586 | 2924168550 | 366 |
| 450 | iso_pu_bacteria | 2924172951 | 2924174282 | 366 |
| 451 | iso_pu_bacteria | 2924179722 | 2924185976 | 366 |
| 452 | iso_pu_bacteria | 2924186466 | 2924190239 | 366 |
| 453 | iso_pu_bacteria | 2924193448 | 2924193510 | 366 |
| 454 | iso_pu_bacteria | 2924200457 | 2924201422 | 366 |
| 455 | iso_pu_bacteria | 2924207177 | 2924207766 | 366 |
| 456 | iso_pu_bacteria | 2924214083 | 2924220746 | 366 |
| 457 | iso_pu_bacteria | 2924221636 | 2924227108 | 366 |
| 458 | iso_pu_bacteria | 2924228884 | 2924234060 | 366 |
| 459 | iso_pu_bacteria | 2926754445 | 2926754939 | 366 |
| 460 | iso_pu_bacteria | 2929138655 | 2929141959 | 366 |
| 461 | iso_pu_bacteria | 2933006813 | 2933010536 | 366 |
| 462 | iso_pu_bacteria | 2933011516 | 2933015792 | 366 |
| 463 | iso_pu_bacteria | 2933016740 | 2933018586 | 366 |
| 464 | iso_pu_bacteria | 2933570622 | 2933572178 | 366 |
| 465 | iso_pu_bacteria | 2933586486 | 2933592826 | 366 |
| 466 | iso_pu_bacteria | 2933594066 | 2933597470 | 366 |
| 467 | iso_pu_bacteria | 2933599457 | 2933602880 | 366 |
| 468 | iso_pu_bacteria | 2935894831 | 2935898083 | 366 |
| 469 | iso_pu_bacteria | 2935901341 | 2935903475 | 366 |
| 470 | iso_pu_bacteria | 2936367885 | 2936370051 | 366 |
| 471 | iso_pu_bacteria | 2936375103 | 2936379227 | 366 |
| 472 | iso_pu_bacteria | 2936381700 | 2936381797 | 366 |
| 473 | iso_pu_bacteria | 2936996657 | 2936997413 | 366 |
| 474 | iso_pu_bacteria | 2937002841 | 2937004124 | 366 |
| 475 | iso_pu_bacteria | 2937009748 | 2937010338 | 366 |
| 476 | iso_pu_bacteria | 2937016420 | 2937017746 | 366 |
| 477 | iso_pu_bacteria | 2937023124 | 2937023201 | 366 |
| 478 | iso_pu_bacteria | 2937029754 | 2937031749 | 366 |
| 479 | iso_pu_bacteria | 2937036028 | 2937037816 | 366 |
| 480 | iso_pu_bacteria | 2937042894 | 2937043999 | 366 |
| 481 | iso_pu_bacteria | 2937049772 | 2937053432 | 366 |
| 482 | iso_pu_bacteria | 2937056579 | 2937063020 | 366 |
| 483 | iso_pu_bacteria | 2937063883 | 2937070425 | 366 |
| 484 | iso_pu_bacteria | 2937071275 | 2937072604 | 366 |
| 485 | iso_pu_bacteria | 2937078374 | 2937082155 | 366 |
| 486 | iso_pu_bacteria | 2937084907 | 2937089927 | 366 |
| 487 | iso_pu_bacteria | 2937091812 | 2937092456 | 366 |
| 488 | iso_pu_bacteria | 2937098957 | 2937103081 | 366 |
| 489 | iso_pu_bacteria | 2937106411 | 2937113219 | 366 |
| 490 | iso_pu_bacteria | 2937113482 | 2937114220 | 366 |
| 491 | iso_pu_bacteria | 2937119839 | 2937120218 | 366 |
| 492 | iso_pu_bacteria | 2937126314 | 2937128566 | 366 |
| 493 | iso_pu_bacteria | 2957375807 | 2957376816 | 366 |
| 494 | iso_pu_bacteria | 2957382221 | 2957384946 | 366 |
| 495 | iso_pu_bacteria | 2957388812 | 2957395220 | 366 |
| 496 | iso_pu_bacteria | 2957395598 | 2957398047 | 366 |
| 497 | iso_pu_bacteria | 2957402308 | 2957405572 | 366 |
| 498 | iso_pu_bacteria | 2957408893 | 2957411736 | 366 |
| 499 | iso_pu_bacteria | 2957415311 | 2957417493 | 366 |
| 500 | iso_pu_bacteria | 2957422303 | 2957422341 | 366 |
| 501 | iso_pu_bacteria | 2957430029 | 2957430055 | 366 |
| 502 | iso_pu_bacteria | 2957437181 | 2957441646 | 366 |
| 503 | iso_pu_bacteria | 2957443900 | 2957450380 | 366 |
| 504 | iso_pu_bacteria | 2957450854 | 2957455957 | 366 |
| 505 | iso_pu_bacteria | 2957457609 | 2957460975 | 366 |
| 506 | iso_pu_bacteria | 2957464669 | 2957466531 | 366 |
| 507 | iso_pu_bacteria | 2957471148 | 2957471387 | 366 |
| 508 | iso_pu_bacteria | 2957478035 | 2957479443 | 366 |
| 509 | iso_pu_bacteria | 2957484790 | 2957491149 | 366 |
| 510 | iso_pu_bacteria | 2957491536 | 2957494458 | 366 |
| 511 | iso_pu_bacteria | 2957498199 | 2957505196 | 366 |
| 512 | iso_pu_bacteria | 2957505466 | 2957508243 | 366 |
| 513 | iso_pu_bacteria | 2960591022 | 2960592776 | 366 |
| 514 | iso_pu_bacteria | 2960597568 | 2960597922 | 366 |
| 515 | iso_pu_bacteria | 2960603979 | 2960606608 | 366 |
| 516 | iso_pu_bacteria | 2960610863 | 2960613700 | 366 |
| 517 | iso_pu_bacteria | 2960617483 | 2960623922 | 366 |
| 518 | iso_pu_bacteria | 2960624210 | 2960629875 | 366 |
| 519 | iso_pu_bacteria | 2960631154 | 2960634173 | 366 |
| 520 | iso_pu_bacteria | 2960637947 | 2960643706 | 366 |
| 521 | iso_pu_bacteria | 2960645483 | 2960646614 | 366 |
| 522 | iso_pu_bacteria | 2960652885 | 2960655644 | 366 |
| 523 | iso_pu_bacteria | 2960660292 | 2960666918 | 366 |
| 524 | iso_pu_bacteria | 2960667422 | 2960673265 | 366 |
| 525 | iso_pu_bacteria | 2960674078 | 2960674906 | 366 |
| 526 | iso_pu_bacteria | 2960680706 | 2960681701 | 366 |
| 527 | iso_pu_bacteria | 2960687367 | 2960689358 | 366 |
| 528 | iso_pu_bacteria | 2960693952 | 2960699035 | 366 |
| 529 | iso_pu_bacteria | 2964607997 | 2964615067 | 366 |
| 530 | iso_pu_bacteria | 2964615318 | 2964616990 | 366 |
| 531 | iso_pu_bacteria | 2964621998 | 2964625855 | 366 |
| 532 | iso_pu_bacteria | 2964628898 | 2964629510 | 366 |
| 533 | iso_pu_bacteria | 2964636051 | 2964641523 | 366 |
| 534 | iso_pu_bacteria | 2964643177 | 2964643633 | 366 |
| 535 | iso_pu_bacteria | 2964649959 | 2964655236 | 366 |
| 536 | iso_pu_bacteria | 2964656573 | 2964659955 | 366 |
| 537 | iso_pu_bacteria | 2964663802 | 2964669376 | 366 |
| 538 | iso_pu_bacteria | 2964670856 | 2964676969 | 366 |
| 539 | iso_pu_bacteria | 2964678106 | 2964679196 | 366 |
| 540 | iso_pu_bacteria | 2964685014 | 2964687429 | 366 |
| 541 | iso_pu_bacteria | 2964691889 | 2964695118 | 366 |
| 542 | iso_pu_bacteria | 2964698721 | 2964699135 | 366 |
| 543 | iso_pu_bacteria | 2964705432 | 2964706001 | 366 |
| 544 | iso_pu_bacteria | 2964712639 | 2964712684 | 366 |
| 545 | iso_pu_bacteria | 2964719344 | 2964719555 | 366 |
| 546 | iso_pu_bacteria | 2967664464 | 2967671092 | 366 |
| 547 | iso_pu_bacteria | 2967671571 | 2967675582 | 366 |
| 548 | iso_pu_bacteria | 2967678726 | 2967681224 | 366 |
| 549 | iso_pu_bacteria | 2967686174 | 2967692451 | 366 |
| 550 | iso_pu_bacteria | 2967693043 | 2967699375 | 366 |
| 551 | iso_pu_bacteria | 2967699805 | 2967703193 | 366 |
| 552 | iso_pu_bacteria | 2967706974 | 2967713218 | 366 |
| 553 | iso_pu_bacteria | 2967714385 | 2967721172 | 366 |
| 554 | iso_pu_bacteria | 2967721400 | 2967724987 | 366 |
| 555 | iso_pu_bacteria | 2967728569 | 2967731808 | 366 |
| 556 | iso_pu_bacteria | 2967735183 | 2967738439 | 366 |
| 557 | iso_pu_bacteria | 2967742019 | 2967743594 | 366 |
| 558 | iso_pu_bacteria | 2967748971 | 2967753464 | 366 |
| 559 | iso_pu_bacteria | 2967755722 | 2967757514 | 366 |
| 560 | iso_pu_bacteria | 2967762386 | 2967765821 | 366 |
| 561 | iso_pu_bacteria | 2967769361 | 2967770370 | 366 |
| 562 | iso_pu_bacteria | 2967775926 | 2967782340 | 366 |
| 563 | iso_pu_bacteria | 2970019648 | 2970021964 | 366 |
| 564 | iso_pu_bacteria | 2970026789 | 2970028702 | 366 |
| 565 | iso_pu_bacteria | 2970033650 | 2970036674 | 366 |
| 566 | iso_pu_bacteria | 2970040964 | 2970046575 | 366 |
| 567 | iso_pu_bacteria | 2970047711 | 2970049648 | 366 |
| 568 | iso_pu_bacteria | 2970054988 | 2970058860 | 366 |
| 569 | iso_pu_bacteria | 2970061556 | 2970065361 | 366 |
| 570 | iso_pu_bacteria | 2970068827 | 2970070335 | 366 |
| 571 | iso_pu_bacteria | 2970076120 | 2970076743 | 366 |
| 572 | iso_pu_bacteria | 2970082768 | 2970083998 | 366 |
| 573 | iso_pu_bacteria | 2970088815 | 2970092767 | 366 |
| 574 | iso_pu_bacteria | 2970095765 | 2970101237 | 366 |
| 575 | iso_pu_bacteria | 2970102677 | 2970106941 | 366 |
| 576 | iso_pu_bacteria | 2970109326 | 2970111087 | 366 |
| 577 | iso_pu_bacteria | 2970116247 | 2970118350 | 366 |
| 578 | iso_pu_bacteria | 2970122695 | 2970124531 | 366 |
| 579 | iso_pu_bacteria | 2970129317 | 2970133546 | 366 |
| 580 | iso_pu_bacteria | 2970136068 | 2970142222 | 366 |
| 581 | iso_pu_bacteria | 2970143518 | 2970147311 | 366 |
| 582 | iso_pu_bacteria | 2970149975 | 2970151726 | 366 |
| 583 | iso_pu_bacteria | 2970156795 | 2970158684 | 366 |
| 584 | iso_pu_bacteria | 2970164137 | 2970170779 | 366 |
| 585 | iso_pu_bacteria | 2970170962 | 2970175045 | 366 |
| 586 | iso_pu_bacteria | 2970177841 | 2970182141 | 366 |
| 587 | iso_pu_bacteria | 2970184632 | 2970185541 | 366 |
| 588 | iso_pu_bacteria | 2970191845 | 2970197938 | 366 |
| 589 | iso_pu_bacteria | 2977516862 | 2977523757 | 366 |
| 590 | iso_pu_bacteria | 2977523885 | 2977525126 | 366 |
| 591 | iso_pu_bacteria | 2977530762 | 2977531176 | 366 |
| 592 | iso_pu_bacteria | 2977537788 | 2977544495 | 366 |
| 593 | iso_pu_bacteria | 2977544691 | 2977547173 | 366 |
| 594 | iso_pu_bacteria | 2977551784 | 2977558036 | 366 |
| 595 | iso_pu_bacteria | 2977558990 | 2977564748 | 366 |
| 596 | iso_pu_bacteria | 2977565890 | 2977571287 | 366 |
| 597 | iso_pu_bacteria | 2977572785 | 2977573810 | 366 |
| 598 | iso_pu_bacteria | 2977579622 | 2977585153 | 366 |
| 599 | iso_pu_bacteria | 2979089926 | 2979092626 | 366 |
| 600 | iso_pu_bacteria | 2979095461 | 2979099983 | 366 |
| 601 | iso_pu_bacteria | 2979100975 | 2979104598 | 366 |
| 602 | iso_pu_bacteria | 2984509177 | 2984513605 | 366 |
| 603 | iso_pu_bacteria | 2984518228 | 2984522815 | 366 |
| 604 | iso_pu_bacteria | 2984537506 | 2984542121 | 366 |
| 605 | iso_pu_bacteria | 2984601300 | 2984601551 | 366 |
| 606 | iso_pu_bacteria | 2989776772 | 2989780207 | 366 |
| 607 | iso_pu_bacteria | 2996887358 | 2996890352 | 366 |
| 608 | iso_pu_bacteria | 2996893221 | 2996897056 | 366 |
| 609 | iso_pu_bacteria | 3005409236 | 3005415937 | 366 |
| 610 | iso_pu_bacteria | 3005416602 | 3005416911 | 366 |
| 611 | iso_pu_bacteria | 3005445848 | 3005449820 | 366 |
| 612 | iso_pu_bacteria | 3005452660 | 3005456047 | 366 |
| 613 | iso_pu_bacteria | 639633055 | 639650584 | 366 |
| 614 | iso_pu_bacteria | 648276728 | 648737284 | 366 |
| 615 | iso_pu_bacteria | 8003570095 | 8003573682 | 366 |
| 616 | iso_pu_bacteria | 8003992118 | 8003995430 | 366 |
| 617 | iso_pu_bacteria | 8003999396 | 8004003190 | 366 |
| 618 | iso_pu_bacteria | 8005246636 | 8005249345 | 366 |
| 619 | iso_pu_bacteria | 8005258706 | 8005262535 | 366 |
| 620 | iso_pu_bacteria | 8005275841 | 8005282580 | 366 |
| 621 | iso_pu_bacteria | 8005282627 | 8005286605 | 366 |
| 622 | iso_pu_bacteria | 8005289223 | 8005295225 | 366 |
| 623 | iso_pu_bacteria | 8005301065 | 8005306101 | 366 |
| 624 | iso_pu_bacteria | 8005307578 | 8005309671 | 366 |
| 625 | iso_pu_bacteria | 8005314921 | 8005315885 | 366 |
| 626 | iso_pu_bacteria | 8005321885 | 8005324879 | 366 |
| 627 | iso_pu_bacteria | 8005376324 | 8005381419 | 366 |
| 628 | iso_pu_bacteria | 8005382845 | 8005387632 | 366 |
| 629 | iso_pu_bacteria | 8005395548 | 8005400663 | 366 |
| 630 | iso_pu_bacteria | 8005430974 | 8005431933 | 366 |
| 631 | iso_pu_bacteria | 8005460587 | 8005465259 | 366 |
| 632 | iso_pu_bacteria | 8005484373 | 8005486972 | 366 |
| 633 | iso_pu_bacteria | 8005497431 | 8005497835 | 366 |
| 634 | iso_pu_bacteria | 8005556819 | 8005561323 | 366 |
| 635 | iso_pu_bacteria | 8005563573 | 8005565946 | 366 |
| 636 | iso_pu_bacteria | 8005570704 | 8005571994 | 366 |
| 637 | iso_pu_bacteria | 8005619151 | 8005623570 | 366 |
| 638 | iso_pu_bacteria | 8005626139 | 8005630869 | 366 |
| 639 | iso_pu_bacteria | 8005645114 | 8005645169 | 366 |
| 640 | iso_pu_bacteria | 8005668836 | 8005669241 | 366 |
| 641 | iso_pu_bacteria | 8005682033 | 8005687385 | 366 |
| 642 | iso_pu_bacteria | 8005688590 | 8005694201 | 366 |
| 643 | iso_pu_bacteria | 8005695170 | 8005695852 | 366 |
| 644 | iso_pu_bacteria | 8018127388 | 8018128693 | 366 |
| 645 | iso_pu_bacteria | 8018163183 | 8018164939 | 366 |
| 646 | iso_pu_bacteria | 8018176218 | 8018177620 | 366 |
| 647 | iso_pu_bacteria | 8023680758 | 8023686702 | 366 |
| 648 | iso_pu_bacteria | 8024479707 | 8024484521 | 366 |
| 649 | iso_pu_bacteria | 8024486573 | 8024490989 | 366 |
| 650 | iso_pu_bacteria | 8024501048 | 8024502148 | 366 |
| 651 | iso_pu_bacteria | 8046767195 | 8046768395 | 366 |
| 652 | iso_pu_bacteria | 8049293176 | 8049296375 | 366 |
| 653 | iso_pu_bacteria | 8054558443 | 8054563307 | 366 |
| 654 | iso_pu_bacteria | 8055431914 | 8055432943 | 366 |
| 655 | iso_pu_bacteria | 8056375014 | 8056380555 | 366 |
| 656 | iso_pu_bacteria | 8056382006 | 8056383386 | 366 |
| 657 | iso_pu_bacteria | 8057575449 | 8057581936 | 366 |
| 658 | iso_pu_bacteria | 8057874678 | 8057879439 | 366 |
| 659 | 3300003771 | Ga0055526_1000291 | Ga0055526_100029133 | 367 |
| 660 | 3300003775 | Ga0055524_1000068 | Ga0055524_1000068131 | 367 |
| 661 | 3300005262 | Ga0065165_1000143 | Ga0065165_100014361 | 367 |
| 662 | 3300005471 | Ga0070698_100321141 | Ga0070698_1003211412 | 367 |
| 663 | 3300005937 | Ga0081455_10001273 | Ga0081455_1000127326 | 367 |
| 664 | 3300009545 | Ga0105237_10310905 | Ga0105237_103109052 | 367 |
| 665 | 3300025273 | Ga0209673_1021903 | Ga0209673_10219031 | 367 |
| 666 | 3300025284 | Ga0209130_1000342 | Ga0209130_100034246 | 367 |
| 667 | 3300025291 | Ga0209675_1000819 | Ga0209675_100081913 | 367 |
| 668 | 3300025294 | Ga0209025_1004205 | Ga0209025_100420510 | 367 |
| 669 | 3300025295 | Ga0209564_1000041 | Ga0209564_1000041272 | 367 |
| 670 | 3300025295 | Ga0209564_1000065 | Ga0209564_1000065231 | 367 |
| 671 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014132 | 367 |
| 672 | 3300025299 | Ga0209256_1000266 | Ga0209256_100026699 | 367 |
| 673 | 3300025302 | Ga0207426_1023075 | Ga0207426_10230752 | 367 |
| 674 | 3300028794 | Ga0307515_10193442 | Ga0307515_101934422 | 367 |
| 675 | 3300031250 | Ga0265331_10066213 | Ga0265331_100662132 | 367 |
| 676 | 3300036401 | Ga0373937_0019984 | Ga0373937_0019984_113_1234 | 367 |
| 677 | 3300037312 | Ga0395899_0000288 | Ga0395899_0000288_13610_14713 | 367 |
| 678 | 3300037418 | Ga0395900_0000246 | Ga0395900_0000246_13609_14712 | 367 |
| 679 | 3300037418 | Ga0395900_0293807 | Ga0395900_0293807_193_1296 | 367 |
| 680 | 3300037466 | Ga0395898_0000447 | Ga0395898_0000447_13608_14711 | 367 |
| 681 | 3300037471 | Ga0395905_0000228 | Ga0395905_0000228_70393_71496 | 367 |
| 682 | 3300038443 | Ga0395901_0000167 | Ga0395901_0000167_71133_72236 | 367 |
| 683 | 3300048913 | Ga0496110_0285855 | Ga0496110_0285855_79_1188 | 367 |
| 684 | 3300048917 | Ga0496114_0119466 | Ga0496114_0119466_892_2001 | 367 |
| 685 | 3300048920 | Ga0496117_0020568 | Ga0496117_0020568_2053_3162 | 367 |
| 686 | 3300048926 | Ga0496123_0016752 | Ga0496123_0016752_1806_2915 | 367 |
| 687 | 3300049570 | Ga0501033_0103071 | Ga0501033_0103071_610_1713 | 367 |
| 688 | 3300049572 | Ga0501036_0116520 | Ga0501036_0116520_1052_2155 | 367 |
| 689 | 3300049573 | Ga0501037_0078465 | Ga0501037_0078465_1212_2321 | 367 |
| 690 | 3300049575 | Ga0501039_0044624 | Ga0501039_0044624_242_1345 | 367 |
| 691 | 3300049576 | Ga0501040_0024664 | Ga0501040_0024664_1569_2672 | 367 |
| 692 | 3300049577 | Ga0501041_0006354 | Ga0501041_0006354_3951_5054 | 367 |
| 693 | 3300049581 | Ga0501047_0099841 | Ga0501047_0099841_1122_2225 | 367 |
| 694 | 3300049588 | Ga0501072_0015322 | Ga0501072_0015322_2253_3356 | 367 |
| 695 | 3300049591 | Ga0501075_0000668 | Ga0501075_0000668_11396_12499 | 367 |
| 696 | 3300049592 | Ga0501076_0005133 | Ga0501076_0005133_730_1833 | 367 |
| 697 | 3300049593 | Ga0501077_0001833 | Ga0501077_0001833_669_1772 | 367 |
| 698 | 3300049742 | Ga0501080_0027940 | Ga0501080_0027940_2449_3552 | 367 |
| 699 | 3300049743 | Ga0501081_0001741 | Ga0501081_0001741_9325_10428 | 367 |
| 700 | 3300049824 | Ga0501045_0053846 | Ga0501045_0053846_915_2018 | 367 |
| 701 | 3300053084 | Ga0495595_0014098 | Ga0495595_0014098_2014_3135 | 367 |
| 702 | 3300053084 | Ga0495595_0044858 | Ga0495595_0044858_65_1171 | 367 |
| 703 | 3300053085 | Ga0495619_0017043 | Ga0495619_0017043_751_1857 | 367 |
| 704 | 3300053156 | Ga0500622_0016225 | Ga0500622_0016225_173_1282 | 367 |
| 705 | 3300054114 | Ga0501084_0000488 | Ga0501084_0000488_25217_26320 | 367 |
| 706 | 3300005548 | Ga0070665_100001650 | Ga0070665_10000165028 | 368 |
| 707 | 3300005841 | Ga0068863_100009117 | Ga0068863_1000091174 | 368 |
| 708 | 3300006038 | Ga0075365_10221104 | Ga0075365_102211041 | 368 |
| 709 | 3300013102 | Ga0157371_10004378 | Ga0157371_100043785 | 368 |
| 710 | 3300013307 | Ga0157372_10493487 | Ga0157372_104934871 | 368 |
| 711 | 3300021358 | Ga0213873_10026351 | Ga0213873_100263511 | 368 |
| 712 | 3300021384 | Ga0213876_10005281 | Ga0213876_100052814 | 368 |
| 713 | 3300021388 | Ga0213875_10009375 | Ga0213875_100093752 | 368 |
| 714 | 3300026088 | Ga0207641_10040375 | Ga0207641_100403753 | 368 |
| 715 | 3300028379 | Ga0268266_10003484 | Ga0268266_1000348417 | 368 |
| 716 | 3300031733 | Ga0316577_10187234 | Ga0316577_101872341 | 368 |
| 717 | 3300031901 | Ga0307406_10004006 | Ga0307406_100040063 | 368 |
| 718 | 3300035088 | Ga0373940_0003021 | Ga0373940_0003021_477_1583 | 368 |
| 719 | 3300037853 | Ga0436364_0469239 | Ga0436364_0469239_1781_2890 | 368 |
| 720 | 3300039437 | Ga0436365_0307172 | Ga0436365_0307172_266_1375 | 368 |
| 721 | 3300039453 | Ga0436362_1144778 | Ga0436362_1144778_362_1471 | 368 |
| 722 | 3300046455 | Ga0495603_0052773 | Ga0495603_0052773_917_2023 | 368 |
| 723 | 3300046616 | Ga0495668_0050542 | Ga0495668_0050542_517_1623 | 368 |
| 724 | 3300047472 | Ga0495686_0074514 | Ga0495686_0074514_872_1978 | 368 |
| 725 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_165329_166435 | 368 |
| 726 | 3300048920 | Ga0496117_0181360 | Ga0496117_0181360_80_1186 | 368 |
| 727 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_165240_166346 | 368 |
| 728 | 3300048929 | Ga0496126_0171418 | Ga0496126_0171418_717_1823 | 368 |
| 729 | 3300049568 | Ga0501031_0000064 | Ga0501031_0000064_19533_20639 | 368 |
| 730 | 3300049568 | Ga0501031_0002368 | Ga0501031_0002368_9703_10809 | 368 |
| 731 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_56051_57157 | 368 |
| 732 | 3300049569 | Ga0501032_0000006 | Ga0501032_0000006_6482_7588 | 368 |
| 733 | 3300049570 | Ga0501033_0000053 | Ga0501033_0000053_19533_20639 | 368 |
| 734 | 3300049570 | Ga0501033_0000077 | Ga0501033_0000077_22857_23963 | 368 |
| 735 | 3300049571 | Ga0501034_0000023 | Ga0501034_0000023_89933_91039 | 368 |
| 736 | 3300049571 | Ga0501034_0000030 | Ga0501034_0000030_227542_228648 | 368 |
| 737 | 3300049571 | Ga0501034_0250005 | Ga0501034_0250005_550_1656 | 368 |
| 738 | 3300049572 | Ga0501036_0000003 | Ga0501036_0000003_254140_255246 | 368 |
| 739 | 3300049572 | Ga0501036_0000482 | Ga0501036_0000482_3720_4826 | 368 |
| 740 | 3300049573 | Ga0501037_0000003 | Ga0501037_0000003_254140_255246 | 368 |
| 741 | 3300049573 | Ga0501037_0000065 | Ga0501037_0000065_94219_95325 | 368 |
| 742 | 3300049574 | Ga0501038_0000004 | Ga0501038_0000004_254140_255246 | 368 |
| 743 | 3300049574 | Ga0501038_0000043 | Ga0501038_0000043_51804_52910 | 368 |
| 744 | 3300049574 | Ga0501038_0050273 | Ga0501038_0050273_173_1279 | 368 |
| 745 | 3300049575 | Ga0501039_0000008 | Ga0501039_0000008_254140_255246 | 368 |
| 746 | 3300049575 | Ga0501039_0000022 | Ga0501039_0000022_121404_122510 | 368 |
| 747 | 3300049579 | Ga0501043_0000310 | Ga0501043_0000310_35758_36864 | 368 |
| 748 | 3300049579 | Ga0501043_0000365 | Ga0501043_0000365_5315_6421 | 368 |
| 749 | 3300049581 | Ga0501047_0008720 | Ga0501047_0008720_2858_3964 | 368 |
| 750 | 3300049581 | Ga0501047_0180703 | Ga0501047_0180703_390_1496 | 368 |
| 751 | 3300049581 | Ga0501047_0235623 | Ga0501047_0235623_366_1472 | 368 |
| 752 | 3300049583 | Ga0501067_0004739 | Ga0501067_0004739_2856_3962 | 368 |
| 753 | 3300049583 | Ga0501067_0012913 | Ga0501067_0012913_2226_3332 | 368 |
| 754 | 3300049586 | Ga0501070_0142952 | Ga0501070_0142952_686_1792 | 368 |
| 755 | 3300049744 | Ga0501083_0045436 | Ga0501083_0045436_1252_2358 | 368 |
| 756 | 3300049822 | Ga0501035_0000031 | Ga0501035_0000031_154953_156059 | 368 |
| 757 | 3300049822 | Ga0501035_0000234 | Ga0501035_0000234_63063_64169 | 368 |
| 758 | 3300049822 | Ga0501035_0174975 | Ga0501035_0174975_619_1725 | 368 |
| 759 | 3300049822 | Ga0501035_0179733 | Ga0501035_0179733_396_1502 | 368 |
| 760 | 3300049823 | Ga0501044_0000008 | Ga0501044_0000008_254140_255246 | 368 |
| 761 | 3300049823 | Ga0501044_0003116 | Ga0501044_0003116_133_1239 | 368 |
| 762 | 3300053178 | Ga0500637_0008150 | Ga0500637_0008150_2310_3416 | 368 |
| 763 | 3300054114 | Ga0501084_0031365 | Ga0501084_0031365_1672_2778 | 368 |
| 764 | 3300054114 | Ga0501084_0055846 | Ga0501084_0055846_1430_2536 | 368 |
| 765 | 3300061719 | Ga0466962_0064336 | Ga0466962_0064336_466_1572 | 368 |
| 766 | 3300003203 | JGI25406J46586_10047626 | JGI25406J46586_100476261 | 369 |
| 767 | 3300003781 | Ga0055536_1002919 | Ga0055536_10029195 | 369 |
| 768 | 3300003794 | Ga0055531_10005829 | Ga0055531_100058296 | 369 |
| 769 | 3300005548 | Ga0070665_100039375 | Ga0070665_1000393753 | 369 |
| 770 | 3300005985 | Ga0081539_10000690 | Ga0081539_1000069020 | 369 |
| 771 | 3300006038 | Ga0075365_10015844 | Ga0075365_100158441 | 369 |
| 772 | 3300006051 | Ga0075364_10000006 | Ga0075364_1000000651 | 369 |
| 773 | 3300013104 | Ga0157370_10163666 | Ga0157370_101636663 | 369 |
| 774 | 3300025292 | Ga0209676_1015294 | Ga0209676_10152942 | 369 |
| 775 | 3300025297 | Ga0209758_1000406 | Ga0209758_100040619 | 369 |
| 776 | 3300025298 | Ga0209050_1006418 | Ga0209050_10064182 | 369 |
| 777 | 3300025303 | Ga0209051_1001684 | Ga0209051_10016847 | 369 |
| 778 | 3300025304 | Ga0209257_1001639 | Ga0209257_100163922 | 369 |
| 779 | 3300028379 | Ga0268266_10033539 | Ga0268266_100335393 | 369 |
| 780 | 3300031247 | Ga0265340_10001914 | Ga0265340_1000191411 | 369 |
| 781 | 3300031247 | Ga0265340_10004381 | Ga0265340_100043813 | 369 |
| 782 | 3300031249 | Ga0265339_10005618 | Ga0265339_100056185 | 369 |
| 783 | 3300031344 | Ga0265316_10004581 | Ga0265316_100045816 | 369 |
| 784 | 3300031595 | Ga0265313_10002093 | Ga0265313_1000209314 | 369 |
| 785 | 3300031712 | Ga0265342_10009718 | Ga0265342_100097187 | 369 |
| 786 | 3300046512 | Ga0495610_0048670 | Ga0495610_0048670_218_1330 | 369 |
| 787 | 3300046517 | Ga0495630_0036316 | Ga0495630_0036316_1140_2249 | 369 |
| 788 | 3300047471 | Ga0495684_0224847 | Ga0495684_0224847_164_1291 | 369 |
| 789 | 3300048905 | Ga0496102_0345135 | Ga0496102_0345135_192_1301 | 369 |
| 790 | 3300048914 | Ga0496111_0033578 | Ga0496111_0033578_752_1861 | 369 |
| 791 | 3300048922 | Ga0496119_0000806 | Ga0496119_0000806_39120_40235 | 369 |
| 792 | 3300048925 | Ga0496122_0000082 | Ga0496122_0000082_109021_110130 | 369 |
| 793 | 3300048925 | Ga0496122_0006697 | Ga0496122_0006697_1627_2742 | 369 |
| 794 | 3300048925 | Ga0496122_0022034 | Ga0496122_0022034_4540_5649 | 369 |
| 795 | 3300048926 | Ga0496123_0000067 | Ga0496123_0000067_99030_100139 | 369 |
| 796 | 3300048926 | Ga0496123_0001298 | Ga0496123_0001298_21716_22831 | 369 |
| 797 | 3300049571 | Ga0501034_0267162 | Ga0501034_0267162_261_1640 | 369 |
| 798 | 3300049573 | Ga0501037_0083175 | Ga0501037_0083175_1035_2144 | 369 |
| 799 | 3300049573 | Ga0501037_0103264 | Ga0501037_0103264_190_1299 | 369 |
| 800 | 3300049581 | Ga0501047_0081069 | Ga0501047_0081069_465_1772 | 369 |
| 801 | 3300049589 | Ga0501073_0123636 | Ga0501073_0123636_368_1477 | 369 |
| 802 | 3300049742 | Ga0501080_0049498 | Ga0501080_0049498_2617_3726 | 369 |
| 803 | 3300049744 | Ga0501083_0011274 | Ga0501083_0011274_3443_4552 | 369 |
| 804 | 3300050491 | nmdc:mga00v17_89_c1 | nmdc:mga00v17_89_c1_31909_33018 | 369 |
| 805 | 3300053104 | Ga0500556_0000160 | Ga0500556_0000160_23109_24224 | 369 |
| 806 | 3300053125 | Ga0500618_000573 | Ga0500618_000573_3779_4888 | 369 |
| 807 | 3300053153 | Ga0500616_0000583 | Ga0500616_0000583_39482_40591 | 369 |
| 808 | 3300060353 | Ga0501082_0037839 | Ga0501082_0037839_985_2094 | 369 |
| 809 | 3300001979 | JGI24740J21852_10004991 | JGI24740J21852_100049914 | 370 |
| 810 | 3300002705 | JGI25156J39149_1000770 | JGI25156J39149_10007705 | 370 |
| 811 | 3300002737 | JGI25162J39368_1000253 | JGI25162J39368_100025330 | 370 |
| 812 | 3300002737 | JGI25162J39368_1000485 | JGI25162J39368_10004854 | 370 |
| 813 | 3300002738 | JGI25154J39366_1000069 | JGI25154J39366_100006971 | 370 |
| 814 | 3300002739 | JGI25158J39367_1000014 | JGI25158J39367_100001443 | 370 |
| 815 | 3300002741 | JGI25157J39369_1000108 | JGI25157J39369_100010811 | 370 |
| 816 | 3300002773 | JGI25152J39213_1000644 | JGI25152J39213_100064413 | 370 |
| 817 | 3300002773 | JGI25152J39213_1001505 | JGI25152J39213_10015054 | 370 |
| 818 | 3300002773 | JGI25152J39213_1002615 | JGI25152J39213_10026152 | 370 |
| 819 | 3300002773 | JGI25152J39213_1006872 | JGI25152J39213_10068722 | 370 |
| 820 | 3300002773 | JGI25152J39213_1007167 | JGI25152J39213_10071672 | 370 |
| 821 | 3300002774 | JGI25150J39212_1000018 | JGI25150J39212_1000018134 | 370 |
| 822 | 3300002774 | JGI25150J39212_1006130 | JGI25150J39212_10061302 | 370 |
| 823 | 3300002987 | JGI25159J45721_1000388 | JGI25159J45721_10003882 | 370 |
| 824 | 3300002987 | JGI25159J45721_1000604 | JGI25159J45721_100060411 | 370 |
| 825 | 3300003187 | JGI25151J46595_10000034 | JGI25151J46595_1000003446 | 370 |
| 826 | 3300003187 | JGI25151J46595_10000939 | JGI25151J46595_100009399 | 370 |
| 827 | 3300003187 | JGI25151J46595_10029230 | JGI25151J46595_100292302 | 370 |
| 828 | 3300003214 | JGI25165J46597_1000536 | JGI25165J46597_10005369 | 370 |
| 829 | 3300003214 | JGI25165J46597_1001214 | JGI25165J46597_100121411 | 370 |
| 830 | 3300003214 | JGI25165J46597_1004655 | JGI25165J46597_10046551 | 370 |
| 831 | 3300003215 | JGI25153J46596_10001791 | JGI25153J46596_100017917 | 370 |
| 832 | 3300003215 | JGI25153J46596_10006280 | JGI25153J46596_100062803 | 370 |
| 833 | 3300003215 | JGI25153J46596_10016095 | JGI25153J46596_100160952 | 370 |
| 834 | 3300003215 | JGI25153J46596_10016737 | JGI25153J46596_100167372 | 370 |
| 835 | 3300003215 | JGI25153J46596_10042669 | JGI25153J46596_100426691 | 370 |
| 836 | 3300003354 | JGI25160J50197_1000051 | JGI25160J50197_100005190 | 370 |
| 837 | 3300003354 | JGI25160J50197_1021530 | JGI25160J50197_10215302 | 370 |
| 838 | 3300003374 | JGI25161J50226_1000011 | JGI25161J50226_1000011104 | 370 |
| 839 | 3300003374 | JGI25161J50226_1000038 | JGI25161J50226_100003827 | 370 |
| 840 | 3300003374 | JGI25161J50226_1001915 | JGI25161J50226_10019154 | 370 |
| 841 | 3300003771 | Ga0055526_1014670 | Ga0055526_10146703 | 370 |
| 842 | 3300003771 | Ga0055526_1024598 | Ga0055526_10245981 | 370 |
| 843 | 3300003775 | Ga0055524_1007723 | Ga0055524_10077233 | 370 |
| 844 | 3300003790 | Ga0055528_1000884 | Ga0055528_10008845 | 370 |
| 845 | 3300003792 | Ga0055540_1001428 | Ga0055540_100142813 | 370 |
| 846 | 3300003792 | Ga0055540_1001541 | Ga0055540_10015418 | 370 |
| 847 | 3300003856 | Ga0058692_1007084 | Ga0058692_10070842 | 370 |
| 848 | 3300004625 | Ga0055543_1000041 | Ga0055543_100004115 | 370 |
| 849 | 3300004625 | Ga0055543_1000317 | Ga0055543_10003177 | 370 |
| 850 | 3300004625 | Ga0055543_1000416 | Ga0055543_100041617 | 370 |
| 851 | 3300005262 | Ga0065165_1000135 | Ga0065165_1000135104 | 370 |
| 852 | 3300005262 | Ga0065165_1010220 | Ga0065165_10102203 | 370 |
| 853 | 3300005331 | Ga0070670_100000711 | Ga0070670_1000007114 | 370 |
| 854 | 3300005337 | Ga0070682_100109642 | Ga0070682_1001096421 | 370 |
| 855 | 3300005439 | Ga0070711_100045468 | Ga0070711_1000454682 | 370 |
| 856 | 3300005441 | Ga0070700_100028466 | Ga0070700_1000284664 | 370 |
| 857 | 3300005455 | Ga0070663_100014911 | Ga0070663_1000149114 | 370 |
| 858 | 3300005530 | Ga0070679_100026302 | Ga0070679_1000263022 | 370 |
| 859 | 3300005536 | Ga0070697_100000401 | Ga0070697_10000040112 | 370 |
| 860 | 3300005539 | Ga0068853_100025986 | Ga0068853_1000259865 | 370 |
| 861 | 3300005545 | Ga0070695_100003726 | Ga0070695_1000037266 | 370 |
| 862 | 3300005547 | Ga0070693_100009265 | Ga0070693_1000092653 | 370 |
| 863 | 3300005564 | Ga0070664_100082344 | Ga0070664_1000823442 | 370 |
| 864 | 3300005615 | Ga0070702_100014888 | Ga0070702_1000148884 | 370 |
| 865 | 3300005983 | Ga0081540_1000012 | Ga0081540_1000012152 | 370 |
| 866 | 3300006038 | Ga0075365_10000401 | Ga0075365_1000040113 | 370 |
| 867 | 3300006038 | Ga0075365_10002608 | Ga0075365_100026086 | 370 |
| 868 | 3300006042 | Ga0075368_10032369 | Ga0075368_100323692 | 370 |
| 869 | 3300006051 | Ga0075364_10051049 | Ga0075364_100510491 | 370 |
| 870 | 3300006173 | Ga0070716_100027093 | Ga0070716_1000270932 | 370 |
| 871 | 3300006175 | Ga0070712_100177143 | Ga0070712_1001771432 | 370 |
| 872 | 3300006177 | Ga0075362_10073512 | Ga0075362_100735121 | 370 |
| 873 | 3300006178 | Ga0075367_10001646 | Ga0075367_100016464 | 370 |
| 874 | 3300006178 | Ga0075367_10044097 | Ga0075367_100440972 | 370 |
| 875 | 3300006186 | Ga0075369_10000585 | Ga0075369_100005852 | 370 |
| 876 | 3300006186 | Ga0075369_10014152 | Ga0075369_100141522 | 370 |
| 877 | 3300006353 | Ga0075370_10003721 | Ga0075370_100037219 | 370 |
| 878 | 3300006844 | Ga0075428_100063506 | Ga0075428_1000635064 | 370 |
| 879 | 3300006844 | Ga0075428_100109140 | Ga0075428_1001091402 | 370 |
| 880 | 3300006847 | Ga0075431_100010527 | Ga0075431_1000105275 | 370 |
| 881 | 3300006914 | Ga0075436_100000298 | Ga0075436_1000002986 | 370 |
| 882 | 3300006946 | Ga0079104_1001513 | Ga0079104_10015135 | 370 |
| 883 | 3300006948 | Ga0099826_10000089 | Ga0099826_1000008934 | 370 |
| 884 | 3300006948 | Ga0099826_10034388 | Ga0099826_100343882 | 370 |
| 885 | 3300007076 | Ga0075435_100010189 | Ga0075435_1000101894 | 370 |
| 886 | 3300009093 | Ga0105240_10000142 | Ga0105240_1000014246 | 370 |
| 887 | 3300009094 | Ga0111539_10003050 | Ga0111539_1000305017 | 370 |
| 888 | 3300009094 | Ga0111539_10271925 | Ga0111539_102719252 | 370 |
| 889 | 3300009147 | Ga0114129_10015821 | Ga0114129_100158214 | 370 |
| 890 | 3300009147 | Ga0114129_10548344 | Ga0114129_105483441 | 370 |
| 891 | 3300009148 | Ga0105243_10019587 | Ga0105243_100195872 | 370 |
| 892 | 3300009177 | Ga0105248_10110705 | Ga0105248_101107052 | 370 |
| 893 | 3300009177 | Ga0105248_10190440 | Ga0105248_101904402 | 370 |
| 894 | 3300009545 | Ga0105237_10002652 | Ga0105237_1000265211 | 370 |
| 895 | 3300009545 | Ga0105237_10305489 | Ga0105237_103054892 | 370 |
| 896 | 3300009765 | Ga0123341_1021682 | Ga0123341_10216822 | 370 |
| 897 | 3300009766 | Ga0123342_1009626 | Ga0123342_10096263 | 370 |
| 898 | 3300009766 | Ga0123342_1028163 | Ga0123342_10281632 | 370 |
| 899 | 3300010375 | Ga0105239_10001079 | Ga0105239_1000107921 | 370 |
| 900 | 3300011119 | Ga0105246_10006247 | Ga0105246_100062472 | 370 |
| 901 | 3300011119 | Ga0105246_10067150 | Ga0105246_100671502 | 370 |
| 902 | 3300013100 | Ga0157373_10007198 | Ga0157373_100071982 | 370 |
| 903 | 3300013104 | Ga0157370_10000079 | Ga0157370_100000793 | 370 |
| 904 | 3300013104 | Ga0157370_10000855 | Ga0157370_1000085528 | 370 |
| 905 | 3300014325 | Ga0163163_10009451 | Ga0163163_100094515 | 370 |
| 906 | 3300014968 | Ga0157379_10213175 | Ga0157379_102131752 | 370 |
| 907 | 3300015262 | Ga0182007_10019600 | Ga0182007_100196002 | 370 |
| 908 | 3300021320 | Ga0214544_1005528 | Ga0214544_10055282 | 370 |
| 909 | 3300021321 | Ga0214542_1005348 | Ga0214542_100534815 | 370 |
| 910 | 3300021321 | Ga0214542_1012986 | Ga0214542_10129867 | 370 |
| 911 | 3300021327 | Ga0214543_1000015 | Ga0214543_1000015167 | 370 |
| 912 | 3300021327 | Ga0214543_1005096 | Ga0214543_100509615 | 370 |
| 913 | 3300021377 | Ga0213874_10010562 | Ga0213874_100105622 | 370 |
| 914 | 3300021388 | Ga0213875_10042001 | Ga0213875_100420012 | 370 |
| 915 | 3300022739 | Ga0228711_1000004 | Ga0228711_1000004209 | 370 |
| 916 | 3300022740 | Ga0228710_1000002 | Ga0228710_1000002157 | 370 |
| 917 | 3300025206 | Ga0209435_100031 | Ga0209435_10003154 | 370 |
| 918 | 3300025208 | Ga0209436_100013 | Ga0209436_10001326 | 370 |
| 919 | 3300025228 | Ga0209672_103539 | Ga0209672_1035392 | 370 |
| 920 | 3300025233 | Ga0209437_100179 | Ga0209437_10017995 | 370 |
| 921 | 3300025233 | Ga0209437_100181 | Ga0209437_10018193 | 370 |
| 922 | 3300025245 | Ga0207425_1000035 | Ga0207425_100003569 | 370 |
| 923 | 3300025245 | Ga0207425_1004487 | Ga0207425_10044873 | 370 |
| 924 | 3300025245 | Ga0207425_1009575 | Ga0207425_10095751 | 370 |
| 925 | 3300025246 | Ga0209646_1000102 | Ga0209646_100010254 | 370 |
| 926 | 3300025246 | Ga0209646_1004214 | Ga0209646_10042141 | 370 |
| 927 | 3300025250 | Ga0209026_1000096 | Ga0209026_100009654 | 370 |
| 928 | 3300025253 | Ga0209677_100455 | Ga0209677_10045511 | 370 |
| 929 | 3300025256 | Ga0209759_1000090 | Ga0209759_100009054 | 370 |
| 930 | 3300025256 | Ga0209759_1017442 | Ga0209759_10174422 | 370 |
| 931 | 3300025258 | Ga0209129_1000029 | Ga0209129_100002969 | 370 |
| 932 | 3300025258 | Ga0209129_1000050 | Ga0209129_100005096 | 370 |
| 933 | 3300025258 | Ga0209129_1000377 | Ga0209129_10003779 | 370 |
| 934 | 3300025258 | Ga0209129_1001450 | Ga0209129_100145012 | 370 |
| 935 | 3300025258 | Ga0209129_1001464 | Ga0209129_10014647 | 370 |
| 936 | 3300025258 | Ga0209129_1003105 | Ga0209129_10031055 | 370 |
| 937 | 3300025258 | Ga0209129_1003160 | Ga0209129_10031601 | 370 |
| 938 | 3300025261 | Ga0209233_1000185 | Ga0209233_100018594 | 370 |
| 939 | 3300025261 | Ga0209233_1000212 | Ga0209233_100021231 | 370 |
| 940 | 3300025261 | Ga0209233_1000445 | Ga0209233_100044527 | 370 |
| 941 | 3300025273 | Ga0209673_1000033 | Ga0209673_100003396 | 370 |
| 942 | 3300025273 | Ga0209673_1000050 | Ga0209673_1000050166 | 370 |
| 943 | 3300025273 | Ga0209673_1000476 | Ga0209673_100047623 | 370 |
| 944 | 3300025273 | Ga0209673_1001553 | Ga0209673_100155314 | 370 |
| 945 | 3300025273 | Ga0209673_1003936 | Ga0209673_10039367 | 370 |
| 946 | 3300025273 | Ga0209673_1005022 | Ga0209673_10050226 | 370 |
| 947 | 3300025273 | Ga0209673_1005150 | Ga0209673_10051508 | 370 |
| 948 | 3300025273 | Ga0209673_1029073 | Ga0209673_10290731 | 370 |
| 949 | 3300025284 | Ga0209130_1000009 | Ga0209130_100000997 | 370 |
| 950 | 3300025284 | Ga0209130_1000058 | Ga0209130_100005891 | 370 |
| 951 | 3300025292 | Ga0209676_1025353 | Ga0209676_10253532 | 370 |
| 952 | 3300025294 | Ga0209025_1000132 | Ga0209025_1000132137 | 370 |
| 953 | 3300025294 | Ga0209025_1000453 | Ga0209025_100045335 | 370 |
| 954 | 3300025294 | Ga0209025_1001274 | Ga0209025_100127430 | 370 |
| 955 | 3300025294 | Ga0209025_1001429 | Ga0209025_100142910 | 370 |
| 956 | 3300025294 | Ga0209025_1002399 | Ga0209025_10023997 | 370 |
| 957 | 3300025294 | Ga0209025_1003718 | Ga0209025_10037183 | 370 |
| 958 | 3300025294 | Ga0209025_1029766 | Ga0209025_10297662 | 370 |
| 959 | 3300025295 | Ga0209564_1000227 | Ga0209564_100022732 | 370 |
| 960 | 3300025295 | Ga0209564_1000284 | Ga0209564_100028437 | 370 |
| 961 | 3300025295 | Ga0209564_1000894 | Ga0209564_100089423 | 370 |
| 962 | 3300025295 | Ga0209564_1004855 | Ga0209564_10048552 | 370 |
| 963 | 3300025297 | Ga0209758_1000255 | Ga0209758_100025534 | 370 |
| 964 | 3300025297 | Ga0209758_1000563 | Ga0209758_100056323 | 370 |
| 965 | 3300025297 | Ga0209758_1000780 | Ga0209758_100078012 | 370 |
| 966 | 3300025297 | Ga0209758_1001039 | Ga0209758_10010399 | 370 |
| 967 | 3300025297 | Ga0209758_1001297 | Ga0209758_100129732 | 370 |
| 968 | 3300025297 | Ga0209758_1004746 | Ga0209758_10047468 | 370 |
| 969 | 3300025297 | Ga0209758_1024172 | Ga0209758_10241722 | 370 |
| 970 | 3300025298 | Ga0209050_1010967 | Ga0209050_10109673 | 370 |
| 971 | 3300025299 | Ga0209256_1001149 | Ga0209256_100114925 | 370 |
| 972 | 3300025299 | Ga0209256_1002933 | Ga0209256_10029332 | 370 |
| 973 | 3300025299 | Ga0209256_1003784 | Ga0209256_100378410 | 370 |
| 974 | 3300025302 | Ga0207426_1000041 | Ga0207426_100004135 | 370 |
| 975 | 3300025302 | Ga0207426_1000131 | Ga0207426_100013191 | 370 |
| 976 | 3300025302 | Ga0207426_1000214 | Ga0207426_100021498 | 370 |
| 977 | 3300025302 | Ga0207426_1000798 | Ga0207426_100079825 | 370 |
| 978 | 3300025303 | Ga0209051_1000118 | Ga0209051_100011848 | 370 |
| 979 | 3300025303 | Ga0209051_1004711 | Ga0209051_10047111 | 370 |
| 980 | 3300025303 | Ga0209051_1004805 | Ga0209051_10048056 | 370 |
| 981 | 3300025304 | Ga0209257_1006038 | Ga0209257_10060387 | 370 |
| 982 | 3300025913 | Ga0207695_10000234 | Ga0207695_1000023447 | 370 |
| 983 | 3300025914 | Ga0207671_10000043 | Ga0207671_1000004321 | 370 |
| 984 | 3300025914 | Ga0207671_10148460 | Ga0207671_101484602 | 370 |
| 985 | 3300025915 | Ga0207693_10004461 | Ga0207693_1000446110 | 370 |
| 986 | 3300025916 | Ga0207663_10054708 | Ga0207663_100547082 | 370 |
| 987 | 3300025925 | Ga0207650_10001757 | Ga0207650_100017575 | 370 |
| 988 | 3300025929 | Ga0207664_10027534 | Ga0207664_100275343 | 370 |
| 989 | 3300025939 | Ga0207665_10027798 | Ga0207665_100277984 | 370 |
| 990 | 3300025941 | Ga0207711_10169391 | Ga0207711_101693912 | 370 |
| 991 | 3300025945 | Ga0207679_10209680 | Ga0207679_102096802 | 370 |
| 992 | 3300025972 | Ga0207668_10200000 | Ga0207668_102000002 | 370 |
| 993 | 3300026041 | Ga0207639_10036187 | Ga0207639_100361873 | 370 |
| 994 | 3300026067 | Ga0207678_10000231 | Ga0207678_1000023124 | 370 |
| 995 | 3300026067 | Ga0207678_10285375 | Ga0207678_102853752 | 370 |
| 996 | 3300026075 | Ga0207708_10046003 | Ga0207708_100460034 | 370 |
| 997 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030102 | 370 |
| 998 | 3300027111 | Ga0209281_1000144 | Ga0209281_100014462 | 370 |
| 999 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037232 | 370 |
| 1000 | 3300027312 | Ga0209371_1002602 | Ga0209371_10026022 | 370 |
| 1001 | 3300027312 | Ga0209371_1005786 | Ga0209371_10057863 | 370 |
| 1002 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004102 | 370 |
| 1003 | 3300027666 | Ga0209282_1000960 | Ga0209282_100096010 | 370 |
| 1004 | 3300027666 | Ga0209282_1037870 | Ga0209282_10378702 | 370 |
| 1005 | 3300027866 | Ga0209813_10000521 | Ga0209813_1000052111 | 370 |
| 1006 | 3300028794 | Ga0307515_10001049 | Ga0307515_1000104947 | 370 |
| 1007 | 3300028794 | Ga0307515_10002808 | Ga0307515_1000280827 | 370 |
| 1008 | 3300030500 | Ga0268256_1000039 | Ga0268256_100003976 | 370 |
| 1009 | 3300030500 | Ga0268256_1005001 | Ga0268256_10050013 | 370 |
| 1010 | 3300030500 | Ga0268256_1020498 | Ga0268256_10204981 | 370 |
| 1011 | 3300031239 | Ga0265328_10000806 | Ga0265328_100008065 | 370 |
| 1012 | 3300031250 | Ga0265331_10046737 | Ga0265331_100467372 | 370 |
| 1013 | 3300031548 | Ga0307408_100086903 | Ga0307408_1000869032 | 370 |
| 1014 | 3300031711 | Ga0265314_10059431 | Ga0265314_100594312 | 370 |
| 1015 | 3300031852 | Ga0307410_10379912 | Ga0307410_103799121 | 370 |
| 1016 | 3300031901 | Ga0307406_10001514 | Ga0307406_100015146 | 370 |
| 1017 | 3300031911 | Ga0307412_10131130 | Ga0307412_101311302 | 370 |
| 1018 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001281 | 370 |
| 1019 | 3300031995 | Ga0307409_100021452 | Ga0307409_1000214523 | 370 |
| 1020 | 3300031995 | Ga0307409_100367464 | Ga0307409_1003674641 | 370 |
| 1021 | 3300032126 | Ga0307415_100037032 | Ga0307415_1000370324 | 370 |
| 1022 | 3300033430 | Ga0315913_1000004 | Ga0315913_100000420 | 370 |
| 1023 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002103 | 370 |
| 1024 | 3300034819 | Ga0373958_0002411 | Ga0373958_0002411_1357_2469 | 370 |
| 1025 | 3300034820 | Ga0373959_0006566 | Ga0373959_0006566_603_1715 | 370 |
| 1026 | 3300034957 | Ga0373938_0002090 | Ga0373938_0002090_1840_2952 | 370 |
| 1027 | 3300035092 | Ga0373952_0013131 | Ga0373952_0013131_439_1551 | 370 |
| 1028 | 3300035170 | Ga0373943_0013738 | Ga0373943_0013738_961_2073 | 370 |
| 1029 | 3300035170 | Ga0373943_0070322 | Ga0373943_0070322_125_1237 | 370 |
| 1030 | 3300035171 | Ga0373946_0008626 | Ga0373946_0008626_1384_2496 | 370 |
| 1031 | 3300035207 | Ga0373942_0008587 | Ga0373942_0008587_334_1446 | 370 |
| 1032 | 3300035241 | Ga0373961_0001703 | Ga0373961_0001703_3083_4195 | 370 |
| 1033 | 3300035242 | Ga0373962_0018219 | Ga0373962_0018219_283_1395 | 370 |
| 1034 | 3300035691 | Ga0373931_0035801 | Ga0373931_0035801_172_1284 | 370 |
| 1035 | 3300035692 | Ga0373935_0087224 | Ga0373935_0087224_233_1345 | 370 |
| 1036 | 3300035695 | Ga0373927_0046776 | Ga0373927_0046776_1122_2234 | 370 |
| 1037 | 3300035725 | Ga0373947_0027685 | Ga0373947_0027685_1800_2912 | 370 |
| 1038 | 3300037312 | Ga0395899_0064282 | Ga0395899_0064282_1484_2596 | 370 |
| 1039 | 3300037418 | Ga0395900_0017621 | Ga0395900_0017621_980_2095 | 370 |
| 1040 | 3300037466 | Ga0395898_0242408 | Ga0395898_0242408_579_1694 | 370 |
| 1041 | 3300037853 | Ga0436364_0095273 | Ga0436364_0095273_988_2109 | 370 |
| 1042 | 3300038443 | Ga0395901_0011053 | Ga0395901_0011053_7383_8495 | 370 |
| 1043 | 3300039437 | Ga0436365_1156422 | Ga0436365_1156422_965_2077 | 370 |
| 1044 | 3300039438 | Ga0436360_0420029 | Ga0436360_0420029_97_1209 | 370 |
| 1045 | 3300041404 | Ga0439436_0002227 | Ga0439436_0002227_4107_5219 | 370 |
| 1046 | 3300041492 | Ga0451835_0131822 | Ga0451835_0131822_973_2085 | 370 |
| 1047 | 3300041509 | Ga0451843_0374774 | Ga0451843_0374774_373_1485 | 370 |
| 1048 | 3300042007 | Ga0439449_0001844 | Ga0439449_0001844_6967_8079 | 370 |
| 1049 | 3300042007 | Ga0439449_0045378 | Ga0439449_0045378_374_1486 | 370 |
| 1050 | 3300044683 | Ga0466965_0001568 | Ga0466965_0001568_1589_2701 | 370 |
| 1051 | 3300044735 | Ga0466968_0017536 | Ga0466968_0017536_1546_2658 | 370 |
| 1052 | 3300044765 | Ga0466970_0009635 | Ga0466970_0009635_3423_4535 | 370 |
| 1053 | 3300046459 | Ga0495629_0046729 | Ga0495629_0046729_41_1153 | 370 |
| 1054 | 3300046459 | Ga0495629_0051882 | Ga0495629_0051882_522_1634 | 370 |
| 1055 | 3300046460 | Ga0495638_0000110 | Ga0495638_0000110_28337_29449 | 370 |
| 1056 | 3300046460 | Ga0495638_0022742 | Ga0495638_0022742_1836_2948 | 370 |
| 1057 | 3300046463 | Ga0495653_0093160 | Ga0495653_0093160_912_2024 | 370 |
| 1058 | 3300046476 | Ga0495662_0026233 | Ga0495662_0026233_251_1363 | 370 |
| 1059 | 3300046477 | Ga0495664_0000434 | Ga0495664_0000434_4455_5567 | 370 |
| 1060 | 3300046512 | Ga0495610_0001935 | Ga0495610_0001935_13234_14346 | 370 |
| 1061 | 3300046522 | Ga0495643_0015274 | Ga0495643_0015274_2448_3560 | 370 |
| 1062 | 3300046524 | Ga0495648_0097720 | Ga0495648_0097720_425_1537 | 370 |
| 1063 | 3300046529 | Ga0495652_0028653 | Ga0495652_0028653_2069_3181 | 370 |
| 1064 | 3300046531 | Ga0495665_0106603 | Ga0495665_0106603_22_1134 | 370 |
| 1065 | 3300046533 | Ga0495640_0003016 | Ga0495640_0003016_10607_11719 | 370 |
| 1066 | 3300046535 | Ga0495586_0004850 | Ga0495586_0004850_5925_7037 | 370 |
| 1067 | 3300046543 | Ga0495645_0000746 | Ga0495645_0000746_13130_14242 | 370 |
| 1068 | 3300046557 | Ga0495622_0024841 | Ga0495622_0024841_181_1293 | 370 |
| 1069 | 3300046642 | Ga0495634_0064876 | Ga0495634_0064876_465_1577 | 370 |
| 1070 | 3300046660 | Ga0495625_0064017 | Ga0495625_0064017_302_1414 | 370 |
| 1071 | 3300046663 | Ga0495635_0018303 | Ga0495635_0018303_2532_3644 | 370 |
| 1072 | 3300046681 | Ga0495647_0070964 | Ga0495647_0070964_74_1186 | 370 |
| 1073 | 3300046689 | Ga0495613_0066634 | Ga0495613_0066634_1023_2135 | 370 |
| 1074 | 3300046690 | Ga0495624_0023367 | Ga0495624_0023367_221_1333 | 370 |
| 1075 | 3300046694 | Ga0495649_0070966 | Ga0495649_0070966_418_1530 | 370 |
| 1076 | 3300046810 | Ga0495660_0062980 | Ga0495660_0062980_317_1429 | 370 |
| 1077 | 3300047315 | Ga0495581_0072176 | Ga0495581_0072176_105_1217 | 370 |
| 1078 | 3300047317 | Ga0495604_0206357 | Ga0495604_0206357_105_1217 | 370 |
| 1079 | 3300047319 | Ga0495674_0003969 | Ga0495674_0003969_10704_11816 | 370 |
| 1080 | 3300047471 | Ga0495684_0018874 | Ga0495684_0018874_3260_4372 | 370 |
| 1081 | 3300047472 | Ga0495686_0001104 | Ga0495686_0001104_5066_6178 | 370 |
| 1082 | 3300047472 | Ga0495686_0014411 | Ga0495686_0014411_3739_4851 | 370 |
| 1083 | 3300048903 | Ga0496100_0151761 | Ga0496100_0151761_224_1342 | 370 |
| 1084 | 3300048905 | Ga0496102_0008097 | Ga0496102_0008097_4331_5443 | 370 |
| 1085 | 3300048907 | Ga0496104_0072583 | Ga0496104_0072583_223_1335 | 370 |
| 1086 | 3300048908 | Ga0496105_0005515 | Ga0496105_0005515_4343_5461 | 370 |
| 1087 | 3300048908 | Ga0496105_0042963 | Ga0496105_0042963_669_1781 | 370 |
| 1088 | 3300048909 | Ga0496106_0002165 | Ga0496106_0002165_11205_12317 | 370 |
| 1089 | 3300048911 | Ga0496108_0015803 | Ga0496108_0015803_4958_6076 | 370 |
| 1090 | 3300048912 | Ga0496109_0000839 | Ga0496109_0000839_7885_9003 | 370 |
| 1091 | 3300048913 | Ga0496110_0050718 | Ga0496110_0050718_2073_3185 | 370 |
| 1092 | 3300048913 | Ga0496110_0394571 | Ga0496110_0394571_85_1197 | 370 |
| 1093 | 3300048914 | Ga0496111_0002183 | Ga0496111_0002183_4327_5439 | 370 |
| 1094 | 3300048915 | Ga0496112_0022574 | Ga0496112_0022574_581_1699 | 370 |
| 1095 | 3300048916 | Ga0496113_0011161 | Ga0496113_0011161_581_1699 | 370 |
| 1096 | 3300048916 | Ga0496113_0106304 | Ga0496113_0106304_491_1609 | 370 |
| 1097 | 3300048917 | Ga0496114_0085342 | Ga0496114_0085342_1280_2395 | 370 |
| 1098 | 3300048917 | Ga0496114_0087202 | Ga0496114_0087202_391_1503 | 370 |
| 1099 | 3300048918 | Ga0496115_0008711 | Ga0496115_0008711_2002_3120 | 370 |
| 1100 | 3300048918 | Ga0496115_0304758 | Ga0496115_0304758_87_1205 | 370 |
| 1101 | 3300048919 | Ga0496116_0002318 | Ga0496116_0002318_892_2004 | 370 |
| 1102 | 3300048919 | Ga0496116_0019030 | Ga0496116_0019030_2106_3218 | 370 |
| 1103 | 3300048919 | Ga0496116_0020748 | Ga0496116_0020748_3447_4559 | 370 |
| 1104 | 3300048919 | Ga0496116_0041103 | Ga0496116_0041103_971_2083 | 370 |
| 1105 | 3300048919 | Ga0496116_0044265 | Ga0496116_0044265_1866_2978 | 370 |
| 1106 | 3300048919 | Ga0496116_0053222 | Ga0496116_0053222_1486_2598 | 370 |
| 1107 | 3300048919 | Ga0496116_0143395 | Ga0496116_0143395_54_1166 | 370 |
| 1108 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_275175_276287 | 370 |
| 1109 | 3300048920 | Ga0496117_0003198 | Ga0496117_0003198_15055_16167 | 370 |
| 1110 | 3300048920 | Ga0496117_0034978 | Ga0496117_0034978_2268_3380 | 370 |
| 1111 | 3300048921 | Ga0496118_0000208 | Ga0496118_0000208_19576_20688 | 370 |
| 1112 | 3300048921 | Ga0496118_0003362 | Ga0496118_0003362_14675_15787 | 370 |
| 1113 | 3300048921 | Ga0496118_0029801 | Ga0496118_0029801_1282_2394 | 370 |
| 1114 | 3300048922 | Ga0496119_0004232 | Ga0496119_0004232_5023_6135 | 370 |
| 1115 | 3300048922 | Ga0496119_0004341 | Ga0496119_0004341_9286_10398 | 370 |
| 1116 | 3300048922 | Ga0496119_0029169 | Ga0496119_0029169_1903_3015 | 370 |
| 1117 | 3300048923 | Ga0496120_0001041 | Ga0496120_0001041_26361_27473 | 370 |
| 1118 | 3300048923 | Ga0496120_0007227 | Ga0496120_0007227_3351_4463 | 370 |
| 1119 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_115022_116134 | 370 |
| 1120 | 3300048924 | Ga0496121_0002668 | Ga0496121_0002668_13855_14967 | 370 |
| 1121 | 3300048924 | Ga0496121_0080886 | Ga0496121_0080886_1447_2559 | 370 |
| 1122 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_275163_276275 | 370 |
| 1123 | 3300048925 | Ga0496122_0007207 | Ga0496122_0007207_4455_5567 | 370 |
| 1124 | 3300048925 | Ga0496122_0026691 | Ga0496122_0026691_1157_2269 | 370 |
| 1125 | 3300048925 | Ga0496122_0081780 | Ga0496122_0081780_1097_2209 | 370 |
| 1126 | 3300048925 | Ga0496122_0114119 | Ga0496122_0114119_447_1559 | 370 |
| 1127 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_104761_105873 | 370 |
| 1128 | 3300048926 | Ga0496123_0026186 | Ga0496123_0026186_1277_2389 | 370 |
| 1129 | 3300048926 | Ga0496123_0026533 | Ga0496123_0026533_1229_2341 | 370 |
| 1130 | 3300048926 | Ga0496123_0028835 | Ga0496123_0028835_2805_3917 | 370 |
| 1131 | 3300048927 | Ga0496124_0000174 | Ga0496124_0000174_124200_125312 | 370 |
| 1132 | 3300048927 | Ga0496124_0007057 | Ga0496124_0007057_2014_3126 | 370 |
| 1133 | 3300048927 | Ga0496124_0015700 | Ga0496124_0015700_1316_2428 | 370 |
| 1134 | 3300048927 | Ga0496124_0016245 | Ga0496124_0016245_1305_2417 | 370 |
| 1135 | 3300048927 | Ga0496124_0041570 | Ga0496124_0041570_1246_2358 | 370 |
| 1136 | 3300048927 | Ga0496124_0046198 | Ga0496124_0046198_2557_3669 | 370 |
| 1137 | 3300048927 | Ga0496124_0083378 | Ga0496124_0083378_1495_2607 | 370 |
| 1138 | 3300048927 | Ga0496124_0127019 | Ga0496124_0127019_563_1675 | 370 |
| 1139 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_258362_259474 | 370 |
| 1140 | 3300048928 | Ga0496125_0003344 | Ga0496125_0003344_3411_4523 | 370 |
| 1141 | 3300048928 | Ga0496125_0005733 | Ga0496125_0005733_10682_11794 | 370 |
| 1142 | 3300048928 | Ga0496125_0008873 | Ga0496125_0008873_5993_7174 | 370 |
| 1143 | 3300048928 | Ga0496125_0083844 | Ga0496125_0083844_1045_2157 | 370 |
| 1144 | 3300048929 | Ga0496126_0043592 | Ga0496126_0043592_509_1621 | 370 |
| 1145 | 3300048929 | Ga0496126_0058720 | Ga0496126_0058720_93_1205 | 370 |
| 1146 | 3300048929 | Ga0496126_0170453 | Ga0496126_0170453_717_1829 | 370 |
| 1147 | 3300049568 | Ga0501031_0201824 | Ga0501031_0201824_136_1248 | 370 |
| 1148 | 3300049569 | Ga0501032_0016646 | Ga0501032_0016646_1754_2869 | 370 |
| 1149 | 3300049570 | Ga0501033_0000120 | Ga0501033_0000120_64679_65791 | 370 |
| 1150 | 3300049571 | Ga0501034_0000166 | Ga0501034_0000166_105722_106837 | 370 |
| 1151 | 3300049571 | Ga0501034_0000702 | Ga0501034_0000702_42920_44032 | 370 |
| 1152 | 3300049571 | Ga0501034_0035613 | Ga0501034_0035613_3824_4948 | 370 |
| 1153 | 3300049572 | Ga0501036_0020693 | Ga0501036_0020693_2993_4108 | 370 |
| 1154 | 3300049573 | Ga0501037_0003608 | Ga0501037_0003608_7810_8925 | 370 |
| 1155 | 3300049574 | Ga0501038_0125249 | Ga0501038_0125249_420_1535 | 370 |
| 1156 | 3300049575 | Ga0501039_0000758 | Ga0501039_0000758_17521_18636 | 370 |
| 1157 | 3300049576 | Ga0501040_0028701 | Ga0501040_0028701_1601_2716 | 370 |
| 1158 | 3300049579 | Ga0501043_0040770 | Ga0501043_0040770_2360_3475 | 370 |
| 1159 | 3300049580 | Ga0501046_0000033 | Ga0501046_0000033_59785_60903 | 370 |
| 1160 | 3300049580 | Ga0501046_0095375 | Ga0501046_0095375_455_1579 | 370 |
| 1161 | 3300049581 | Ga0501047_0001189 | Ga0501047_0001189_860_1975 | 370 |
| 1162 | 3300049581 | Ga0501047_0030041 | Ga0501047_0030041_2183_3307 | 370 |
| 1163 | 3300049581 | Ga0501047_0088783 | Ga0501047_0088783_1163_2275 | 370 |
| 1164 | 3300049582 | Ga0501048_0000324 | Ga0501048_0000324_12931_14046 | 370 |
| 1165 | 3300049586 | Ga0501070_0001033 | Ga0501070_0001033_2985_4097 | 370 |
| 1166 | 3300049586 | Ga0501070_0022645 | Ga0501070_0022645_1160_2275 | 370 |
| 1167 | 3300049589 | Ga0501073_0005082 | Ga0501073_0005082_63_1175 | 370 |
| 1168 | 3300049590 | Ga0501074_0008675 | Ga0501074_0008675_4501_5613 | 370 |
| 1169 | 3300049592 | Ga0501076_0022154 | Ga0501076_0022154_3146_4258 | 370 |
| 1170 | 3300049742 | Ga0501080_0001688 | Ga0501080_0001688_2005_3120 | 370 |
| 1171 | 3300049742 | Ga0501080_0006905 | Ga0501080_0006905_5214_6326 | 370 |
| 1172 | 3300049744 | Ga0501083_0058689 | Ga0501083_0058689_972_2084 | 370 |
| 1173 | 3300049822 | Ga0501035_0000084 | Ga0501035_0000084_99405_100520 | 370 |
| 1174 | 3300049822 | Ga0501035_0000479 | Ga0501035_0000479_7991_9103 | 370 |
| 1175 | 3300049822 | Ga0501035_0000897 | Ga0501035_0000897_29205_30317 | 370 |
| 1176 | 3300049823 | Ga0501044_0000073 | Ga0501044_0000073_15671_16786 | 370 |
| 1177 | 3300049823 | Ga0501044_0061367 | Ga0501044_0061367_21_1133 | 370 |
| 1178 | 3300049823 | Ga0501044_0228289 | Ga0501044_0228289_266_1390 | 370 |
| 1179 | 3300049823 | Ga0501044_0303876 | Ga0501044_0303876_137_1249 | 370 |
| 1180 | 3300049824 | Ga0501045_0032669 | Ga0501045_0032669_1575_2690 | 370 |
| 1181 | 3300050489 | nmdc:mga03683_24084_c1 | nmdc:mga03683_24084_c1_395_1507 | 370 |
| 1182 | 3300050490 | nmdc:mga03n38_71584_c1 | nmdc:mga03n38_71584_c1_138_1250 | 370 |
| 1183 | 3300050491 | nmdc:mga00v17_15_c1 | nmdc:mga00v17_15_c1_23228_24340 | 370 |
| 1184 | 3300050507 | nmdc:mga05p37_20638_c1 | nmdc:mga05p37_20638_c1_2990_4102 | 370 |
| 1185 | 3300050510 | nmdc:mga06r32_152475_c1 | nmdc:mga06r32_152475_c1_1165_2277 | 370 |
| 1186 | 3300050510 | nmdc:mga06r32_24194_c1 | nmdc:mga06r32_24194_c1_124_1236 | 370 |
| 1187 | 3300050511 | nmdc:mga08y16_132152_c1 | nmdc:mga08y16_132152_c1_662_1774 | 370 |
| 1188 | 3300050511 | nmdc:mga08y16_193049_c1 | nmdc:mga08y16_193049_c1_356_1468 | 370 |
| 1189 | 3300050513 | nmdc:mga0rr50_7458_c1 | nmdc:mga0rr50_7458_c1_4009_5136 | 370 |
| 1190 | 3300050514 | nmdc:mga08x19_18_c1 | nmdc:mga08x19_18_c1_61000_62127 | 370 |
| 1191 | 3300050516 | nmdc:mga0sz30_36660_c1 | nmdc:mga0sz30_36660_c1_328_1440 | 370 |
| 1192 | 3300050516 | nmdc:mga0sz30_81_c1 | nmdc:mga0sz30_81_c1_23156_24268 | 370 |
| 1193 | 3300053078 | Ga0495612_0000152 | Ga0495612_0000152_7454_8566 | 370 |
| 1194 | 3300053085 | Ga0495619_0003543 | Ga0495619_0003543_747_1859 | 370 |
| 1195 | 3300053104 | Ga0500556_0000092 | Ga0500556_0000092_34986_36098 | 370 |
| 1196 | 3300053109 | Ga0500569_002816 | Ga0500569_002816_2218_3330 | 370 |
| 1197 | 3300053134 | Ga0500658_0000093 | Ga0500658_0000093_5276_6388 | 370 |
| 1198 | 3300053137 | Ga0500561_0000421 | Ga0500561_0000421_5433_6545 | 370 |
| 1199 | 3300053139 | Ga0500568_0000421 | Ga0500568_0000421_26503_27615 | 370 |
| 1200 | 3300053140 | Ga0500573_0000379 | Ga0500573_0000379_12827_13942 | 370 |
| 1201 | 3300053140 | Ga0500573_0007703 | Ga0500573_0007703_3913_5028 | 370 |
| 1202 | 3300053153 | Ga0500616_0001279 | Ga0500616_0001279_18453_19565 | 370 |
| 1203 | 3300053153 | Ga0500616_0003758 | Ga0500616_0003758_7118_8233 | 370 |
| 1204 | 3300053153 | Ga0500616_0020342 | Ga0500616_0020342_2063_3175 | 370 |
| 1205 | 3300053153 | Ga0500616_0036018 | Ga0500616_0036018_636_1748 | 370 |
| 1206 | 3300053161 | Ga0500634_0015039 | Ga0500634_0015039_1467_2579 | 370 |
| 1207 | 3300059510 | Ga0587090_000500 | Ga0587090_000500_1270_2382 | 370 |
| 1208 | 3300060353 | Ga0501082_0070911 | Ga0501082_0070911_1339_2454 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1a05-assembly1.cif.gz_B | crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate | 0.9667 | 3 | 366 |
| 5j33-assembly3.cif.gz_F | isopropylmalate dehydrogenase in complex with nad+ | 0.9656 | 2 | 366 |
| 5j33-assembly3.cif.gz_F | isopropylmalate dehydrogenase in complex with nad+ | 0.9604 | 2 | 366 |
| 1a05-assembly1.cif.gz_B | crystal structure of the complex of 3-isopropylmalate dehydrogenase from thiobacillus ferrooxidans with 3-isopropylmalate | 0.9588 | 3 | 366 |
| 4wuo-assembly1.cif.gz_B | structure of the e270a mutant isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh | 0.9566 | 5 | 365 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9537 | 4 | 370 | 3.40.718.10 |
| 3u1hA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9407 | 4 | 370 | 3.40.718.10 |
| 5hn5A00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9323 | 3 | 368 | 3.40.718.10 |
| 1w0dB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9258 | 3 | 364 | 3.40.718.10 |
| 1x0lB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9214 | 3 | 367 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528BRB6-F1-model_v4 | 3-isopropylmalate dehydrogenase | 0.9986 | 269 | 366 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A5R2MUI9-F1-model_v4 | 3-isopropylmalate dehydrogenase | 0.9976 | 158 | 259 |
GO:0003862
GO:0005829 GO:0009098 GO:0046872 |
| AF-A0A4R1S1M7-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) | 0.9938 | 1 | 370 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-I9NE03-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) | 0.9936 | 1 | 370 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
| AF-P24404-F1-model_v4 | 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (3-IPM-DH) (Beta-IPM dehydrogenase) (IMDH) | 0.9934 | 1 | 370 |
GO:0000287
GO:0003862 GO:0005829 GO:0009098 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar