F491620

General Info

Members Datasets Scaffolds Average Seq Length
1204 430 1204 294

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10029020|Ga0075433_100290202
Length 331
Sequence MCACLGAFVRTSAARNDDGEKSVANRTVGVIGLGLMGEVFSRRLIDAGQSVVGYDIDAAKGRRLANMGGRAAASIAEVACACDPIVLAVFDTSQVEDVVENHILPAVSETSRKIVLCASTCDPDRIAALGARVIPRGIRFLETPVSGTSEQVRRGDGVGLIGGDRETAAEAEAVLAILFPRRFHVGRVGDGGRTKLAVNLILGLNRMALAEGLVFARRLGLDPAAFLPVAKESAAYSQIMDVKGGKMLNGDFAPEGRVRQTLKDVHLMLEQAKRHGQSLPMLNVHCDVLEACVRAGEADLDNSAVIKEIARRQEPMLSNESHERPSQNTVV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
23 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
124 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
232 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
235 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
236 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
258 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
265 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
266 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
267 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
268 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
269 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
272 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
273 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
274 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
275 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
309 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
315 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
331 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
332 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
333 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
349 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
352 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
355 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
369 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
370 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
371 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
397 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
408 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
411 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
412 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
413 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
414 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
415 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
416 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
421 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
422 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 11.38
Rhizosphere 83.8
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214600489 2209111006 Bacteria 5547
2 ARSoilYngRDRAFT_c00009 3300000042 Bacteria 30468
3 ARcpr5yngRDRAFT_c000006 3300000043 Bacteria 44193
4 ARSoilOldRDRAFT_c000008 3300000044 Bacteria 50600
5 ARCol0yngRDRAFT_1000092 3300000652 Bacteria 16856
6 JGI24032J14994_100010 3300001430 Bacteria 6882
7 JGI24752J21851_1002004 3300001976 Bacteria 2711
8 JGI24747J21853_1000097 3300001978 Bacteria 3855
9 JGI24740J21852_10007359 3300001979 Bacteria 4480
10 JGI24739J22299_10000092 3300001989 Bacteria 26283
11 JGI24737J22298_10000325 3300001990 Bacteria 16017
12 JGI24750J21931_1000128 3300002070 Bacteria 12041
13 JGI24745J21846_1000019 3300002073 Bacteria 10205
14 JGI24738J21930_10000010 3300002075 Bacteria 37976
15 JGI24749J21850_1000390 3300002076 Bacteria 6530
16 JGI24744J21845_10003267 3300002077 Bacteria 3330
17 JGI24035J26624_1000002 3300002126 Bacteria 16706
18 JGI24033J26618_1000590 3300002155 Bacteria 3484
19 JGI24034J26672_10001363 3300002239 Bacteria 3232
20 JGI24742J22300_10000521 3300002244 Bacteria 5736
21 JGI24742J22300_10004778 3300002244 Bacteria 2224
22 JGI24751J29686_10023645 3300002459 Bacteria 1274
23 Ga0065717_1000057 3300005276 Bacteria 6757
24 Ga0065716_1001714 3300005277 Bacteria 3918
25 Ga0065712_10003774 3300005290 Bacteria 5940
26 Ga0065715_10000752 3300005293 Bacteria 15084
27 Ga0065715_10000834 3300005293 Bacteria 8809
28 Ga0070658_10478088 3300005327 Unclassified 1075
29 Ga0070676_10000041 3300005328 Bacteria 38719
30 Ga0070676_10205898 3300005328 Bacteria 1292
31 Ga0070683_100001029 3300005329 Bacteria 20930
32 Ga0070683_100258412 3300005329 Bacteria 1657
33 Ga0070690_100002808 3300005330 Bacteria 9398
34 Ga0070670_100005523 3300005331 Bacteria 10672
35 Ga0070677_10000045 3300005333 Bacteria 38826
36 Ga0068869_100000079 3300005334 Bacteria 44000
37 Ga0068869_100057061 3300005334 Bacteria 2849
38 Ga0068869_100139312 3300005334 Bacteria 1872
39 Ga0070666_10016046 3300005335 Bacteria 4787
40 Ga0070666_10131403 3300005335 Bacteria 1740
41 Ga0070680_100004008 3300005336 Bacteria 11020
42 Ga0070680_100211606 3300005336 Bacteria 1636
43 Ga0070682_100000641 3300005337 Bacteria 21233
44 Ga0070682_100017895 3300005337 Bacteria 4134
45 Ga0070682_100113330 3300005337 Unclassified 1811
46 Ga0070682_100120191 3300005337 Bacteria 1762
47 Ga0070682_100151701 3300005337 Bacteria 1591
48 Ga0070682_100320423 3300005337 Bacteria 1145
49 Ga0068868_100000588 3300005338 Bacteria 24451
50 Ga0068868_100012588 3300005338 Bacteria 6185
51 Ga0070660_100004207 3300005339 Bacteria 9935
52 Ga0070660_100034964 3300005339 Bacteria 3800
53 Ga0070660_100416820 3300005339 Unclassified 1112
54 Ga0070689_100015607 3300005340 Bacteria 5543
55 Ga0070689_100035694 3300005340 Bacteria 3799
56 Ga0070689_100122081 3300005340 Bacteria 2081
57 Ga0070691_10000161 3300005341 Bacteria 21699
58 Ga0070691_10087574 3300005341 Unclassified 1532
59 Ga0070687_100000085 3300005343 Bacteria 30647
60 Ga0070687_100011196 3300005343 Bacteria 3914
61 Ga0070687_100091140 3300005343 Bacteria 1686
62 Ga0070661_100000307 3300005344 Bacteria 39479
63 Ga0070692_10006433 3300005345 Bacteria 5100
64 Ga0070668_100000164 3300005347 Bacteria 42113
65 Ga0070668_100096461 3300005347 Bacteria 2337
66 Ga0070668_100224592 3300005347 Bacteria 1550
67 Ga0070669_100000571 3300005353 Bacteria 27367
68 Ga0070669_100072198 3300005353 Bacteria 2555
69 Ga0070675_100002553 3300005354 Bacteria 13625
70 Ga0070675_100002792 3300005354 Bacteria 13151
71 Ga0070675_100030132 3300005354 Bacteria 4378
72 Ga0070671_100000104 3300005355 Bacteria 53922
73 Ga0070674_100000238 3300005356 Bacteria 27260
74 Ga0070674_100090875 3300005356 Bacteria 2203
75 Ga0070674_100213643 3300005356 Bacteria 1497
76 Ga0070673_100000152 3300005364 Bacteria 33183
77 Ga0070673_100273366 3300005364 Bacteria 1480
78 Ga0070673_100281261 3300005364 Bacteria 1459
79 Ga0070688_100004752 3300005365 Bacteria 7097
80 Ga0070688_100009930 3300005365 Bacteria 5230
81 Ga0070688_100031492 3300005365 Bacteria 3191
82 Ga0070688_100038650 3300005365 Bacteria 2915
83 Ga0070659_100000551 3300005366 Bacteria 27372
84 Ga0070659_100258206 3300005366 Unclassified 1445
85 Ga0070667_100002365 3300005367 Bacteria 16513
86 Ga0070667_100024417 3300005367 Bacteria 5020
87 Ga0070667_100043692 3300005367 Bacteria 3762
88 Ga0070703_10017256 3300005406 Bacteria 2078
89 Ga0070703_10027189 3300005406 Bacteria 1704
90 Ga0070709_10000690 3300005434 Bacteria 19189
91 Ga0070714_100062728 3300005435 Unclassified 3194
92 Ga0070714_100085990 3300005435 Bacteria 2747
93 Ga0070713_100001316 3300005436 Bacteria 15879
94 Ga0070713_100020625 3300005436 Bacteria 5056
95 Ga0070713_100128314 3300005436 Unclassified 2234
96 Ga0070713_100144530 3300005436 Bacteria 2110
97 Ga0070713_100158666 3300005436 Bacteria 2017
98 Ga0070713_100312393 3300005436 Bacteria 1450
99 Ga0070710_10028306 3300005437 Unclassified 2996
100 Ga0070710_10055133 3300005437 Bacteria 2245
101 Ga0070701_10008875 3300005438 Bacteria 4373
102 Ga0070701_10050637 3300005438 Bacteria 2152
103 Ga0070711_100050532 3300005439 Bacteria 2852
104 Ga0070711_100182385 3300005439 Bacteria 1608
105 Ga0070705_100000148 3300005440 Bacteria 41687
106 Ga0070705_100159885 3300005440 Unclassified 1504
107 Ga0070705_100179574 3300005440 Bacteria 1433
108 Ga0070700_100000277 3300005441 Bacteria 27391
109 Ga0070700_100010208 3300005441 Bacteria 5179
110 Ga0070694_100003001 3300005444 Bacteria 10038
111 Ga0070694_100026100 3300005444 Bacteria 3783
112 Ga0070694_100155615 3300005444 Bacteria 1673
113 Ga0070694_100201486 3300005444 Bacteria 1484
114 Ga0070708_100592840 3300005445 Unclassified 1045
115 Ga0070663_100001406 3300005455 Bacteria 13151
116 Ga0070663_100021688 3300005455 Bacteria 4277
117 Ga0070663_100063026 3300005455 Bacteria 2675
118 Ga0070663_100082402 3300005455 Bacteria 2366
119 Ga0070663_100293297 3300005455 Bacteria 1300
120 Ga0070678_100008123 3300005456 Bacteria 6270
121 Ga0070678_100061191 3300005456 Bacteria 2774
122 Ga0070678_100071899 3300005456 Bacteria 2591
123 Ga0070662_100005414 3300005457 Bacteria 8152
124 Ga0070662_100010491 3300005457 Bacteria 6082
125 Ga0070662_100345103 3300005457 Unclassified 1219
126 Ga0070681_10003456 3300005458 Bacteria 14797
127 Ga0070681_10029139 3300005458 Bacteria 5542
128 Ga0070681_10105482 3300005458 Bacteria 2760
129 Ga0070681_10148193 3300005458 Bacteria 2274
130 Ga0068867_100005503 3300005459 Bacteria 8964
131 Ga0068867_100248865 3300005459 Unclassified 1444
132 Ga0070685_10001961 3300005466 Bacteria 10680
133 Ga0070685_10032054 3300005466 Bacteria 2941
134 Ga0070707_100153018 3300005468 Bacteria 2246
135 Ga0070698_100373033 3300005471 Bacteria 1359
136 Ga0070698_100422402 3300005471 Unclassified 1268
137 Ga0070699_100301497 3300005518 Bacteria 1437
138 Ga0070679_100000394 3300005530 Bacteria 37125
139 Ga0070679_100126071 3300005530 Bacteria 2543
140 Ga0070684_100001138 3300005535 Bacteria 19106
141 Ga0070684_100035598 3300005535 Bacteria 4262
142 Ga0070684_100049727 3300005535 Bacteria 3640
143 Ga0070684_100222636 3300005535 Bacteria 1721
144 Ga0070684_100234597 3300005535 Bacteria 1676
145 Ga0068853_100002891 3300005539 Bacteria 13032
146 Ga0068853_100554357 3300005539 Unclassified 1089
147 Ga0070672_100000088 3300005543 Bacteria 44394
148 Ga0070672_100026310 3300005543 Bacteria 4327
149 Ga0070672_100211392 3300005543 Bacteria 1625
150 Ga0070686_100000873 3300005544 Bacteria 17494
151 Ga0070686_100003547 3300005544 Bacteria 8558
152 Ga0070695_100000586 3300005545 Bacteria 19224
153 Ga0070695_100003316 3300005545 Bacteria 9416
154 Ga0070696_100000921 3300005546 Bacteria 19106
155 Ga0070696_100210986 3300005546 Unclassified 1453
156 Ga0070693_100000134 3300005547 Bacteria 33408
157 Ga0070693_100059816 3300005547 Bacteria 2210
158 Ga0070693_100101423 3300005547 Bacteria 1754
159 Ga0070665_100094881 3300005548 Bacteria 2988
160 Ga0070665_100295783 3300005548 Bacteria 1622
161 Ga0070704_100000026 3300005549 Bacteria 48700
162 Ga0070704_100016922 3300005549 Bacteria 4622
163 Ga0068855_100118380 3300005563 Bacteria 3034
164 Ga0070664_100001420 3300005564 Bacteria 19106
165 Ga0070664_100133235 3300005564 Bacteria 2184
166 Ga0068857_100001388 3300005577 Bacteria 19106
167 Ga0068857_100204175 3300005577 Bacteria 1802
168 Ga0068854_100000546 3300005578 Bacteria 22673
169 Ga0068854_100157970 3300005578 Bacteria 1754
170 Ga0068856_100002000 3300005614 Bacteria 21261
171 Ga0068856_100289978 3300005614 Bacteria 1653
172 Ga0070702_100000245 3300005615 Bacteria 18498
173 Ga0070702_100092063 3300005615 Bacteria 1841
174 Ga0068852_100002320 3300005616 Bacteria 13074
175 Ga0068852_100014205 3300005616 Bacteria 6117
176 Ga0068852_100453023 3300005616 Unclassified 1270
177 Ga0068859_100040069 3300005617 Bacteria 4701
178 Ga0068859_100061264 3300005617 Bacteria 3792
179 Ga0068864_100000890 3300005618 Bacteria 25145
180 Ga0068864_100048379 3300005618 Bacteria 3655
181 Ga0068866_10000221 3300005718 Bacteria 27070
182 Ga0068866_10009118 3300005718 Bacteria 4205
183 Ga0068861_100000783 3300005719 Bacteria 19106
184 Ga0068861_100027077 3300005719 Bacteria 4172
185 Ga0068861_100253255 3300005719 Bacteria 1503
186 Ga0068851_10164066 3300005834 Unclassified 1222
187 Ga0068870_10000090 3300005840 Bacteria 29559
188 Ga0068863_100009502 3300005841 Bacteria 9485
189 Ga0068863_100015046 3300005841 Bacteria 7434
190 Ga0068863_100248029 3300005841 Bacteria 1719
191 Ga0068863_100348865 3300005841 Unclassified 1441
192 Ga0068858_100000295 3300005842 Bacteria 53892
193 Ga0068858_100076704 3300005842 Bacteria 3104
194 Ga0068858_100400164 3300005842 Bacteria 1319
195 Ga0068860_100001285 3300005843 Bacteria 27247
196 Ga0068860_100069499 3300005843 Unclassified 3347
197 Ga0068860_100229161 3300005843 Bacteria 1805
198 Ga0068862_100003658 3300005844 Bacteria 13151
199 Ga0068862_100018135 3300005844 Bacteria 5861
200 Ga0068862_100610220 3300005844 Unclassified 1049
201 Ga0081455_10000007 3300005937 Bacteria 269394
202 Ga0081455_10000022 3300005937 Bacteria 159620
203 Ga0081455_10006137 3300005937 Bacteria 12982
204 Ga0081455_10009618 3300005937 Bacteria 9928
205 Ga0081455_10029855 3300005937 Bacteria 4966
206 Ga0081538_10006666 3300005981 Bacteria 10117
207 Ga0081538_10040866 3300005981 Bacteria 2952
208 Ga0081538_10070963 3300005981 Bacteria 1919
209 Ga0081540_1000703 3300005983 Bacteria 31069
210 Ga0081540_1016438 3300005983 Bacteria 4629
211 Ga0081539_10079549 3300005985 Unclassified 1727
212 Ga0070717_10009632 3300006028 Bacteria 7271
213 Ga0070717_10036947 3300006028 Bacteria 3964
214 Ga0075365_10009291 3300006038 Bacteria 5642
215 Ga0075365_10021110 3300006038 Bacteria 4056
216 Ga0075365_10125397 3300006038 Bacteria 1774
217 Ga0075368_10005383 3300006042 Bacteria 4399
218 Ga0075368_10024807 3300006042 Bacteria 2298
219 Ga0075368_10039930 3300006042 Bacteria 1841
220 Ga0075363_100016781 3300006048 Bacteria 3620
221 Ga0075363_100042104 3300006048 Bacteria 2411
222 Ga0075363_100234053 3300006048 Unclassified 1055
223 Ga0075364_10027100 3300006051 Bacteria 3659
224 Ga0075364_10090887 3300006051 Bacteria 2025
225 Ga0070715_10033433 3300006163 Bacteria 2102
226 Ga0070716_100065757 3300006173 Bacteria 2113
227 Ga0070716_100253187 3300006173 Bacteria 1201
228 Ga0070712_100004676 3300006175 Bacteria 8464
229 Ga0070712_100077315 3300006175 Bacteria 2399
230 Ga0070712_100158994 3300006175 Bacteria 1743
231 Ga0070712_100201221 3300006175 Bacteria 1565
232 Ga0070712_100210003 3300006175 Bacteria 1534
233 Ga0070712_100319090 3300006175 Bacteria 1263
234 Ga0070712_100354424 3300006175 Bacteria 1202
235 Ga0075362_10057046 3300006177 Unclassified 1759
236 Ga0075367_10001913 3300006178 Bacteria 9239
237 Ga0075367_10009093 3300006178 Bacteria 5176
238 Ga0075367_10032971 3300006178 Bacteria 2983
239 Ga0075367_10034279 3300006178 Bacteria 2931
240 Ga0075367_10199164 3300006178 Bacteria 1251
241 Ga0075427_10000021 3300006194 Bacteria 10546
242 Ga0097621_100000040 3300006237 Bacteria 66339
243 Ga0097621_100007724 3300006237 Bacteria 7711
244 Ga0075370_10003364 3300006353 Bacteria 7605
245 Ga0075370_10029978 3300006353 Bacteria 3033
246 Ga0075370_10136984 3300006353 Bacteria 1430
247 Ga0068871_100000252 3300006358 Bacteria 37355
248 Ga0075428_100002517 3300006844 Bacteria 19916
249 Ga0075428_100012162 3300006844 Bacteria 9573
250 Ga0075428_100049454 3300006844 Bacteria 4612
251 Ga0075428_100056626 3300006844 Bacteria 4294
252 Ga0075428_100064578 3300006844 Bacteria 4009
253 Ga0075428_100078608 3300006844 Bacteria 3601
254 Ga0075428_100112577 3300006844 Bacteria 2964
255 Ga0075428_100146801 3300006844 Bacteria 2563
256 Ga0075428_100211834 3300006844 Bacteria 2094
257 Ga0075428_100403846 3300006844 Bacteria 1464
258 Ga0075428_100438982 3300006844 Bacteria 1398
259 Ga0075430_100018573 3300006846 Bacteria 5917
260 Ga0075430_100024166 3300006846 Bacteria 5173
261 Ga0075430_100087554 3300006846 Bacteria 2606
262 Ga0075430_100139316 3300006846 Bacteria 2020
263 Ga0075431_100001498 3300006847 Bacteria 21626
264 Ga0075431_100003463 3300006847 Bacteria 15298
265 Ga0075431_100040358 3300006847 Bacteria 4810
266 Ga0075431_100191858 3300006847 Bacteria 2093
267 Ga0075431_100226672 3300006847 Bacteria 1905
268 Ga0075431_100300175 3300006847 Bacteria 1623
269 Ga0075431_100331567 3300006847 Bacteria 1532
270 Ga0075433_10000007 3300006852 Bacteria 75995
271 Ga0075433_10014595 3300006852 Bacteria 6422
272 Ga0075433_10029020 3300006852 Bacteria 4709
273 Ga0075433_10031256 3300006852 Bacteria 4551
274 Ga0075433_10061152 3300006852 Bacteria 3299
275 Ga0075433_10062432 3300006852 Bacteria 3263
276 Ga0075433_10197244 3300006852 Bacteria 1790
277 Ga0075434_100002477 3300006871 Bacteria 16252
278 Ga0075434_100002531 3300006871 Bacteria 16122
279 Ga0075434_100005388 3300006871 Bacteria 11640
280 Ga0075434_100036505 3300006871 Bacteria 4862
281 Ga0075434_100076946 3300006871 Bacteria 3331
282 Ga0075434_100216129 3300006871 Bacteria 1937
283 Ga0075434_100224593 3300006871 Bacteria 1898
284 Ga0075434_100283038 3300006871 Bacteria 1677
285 Ga0075429_100002081 3300006880 Bacteria 16691
286 Ga0075429_100018152 3300006880 Bacteria 6088
287 Ga0075429_100034246 3300006880 Bacteria 4412
288 Ga0075429_100071717 3300006880 Bacteria 3016
289 Ga0075429_100110877 3300006880 Bacteria 2398
290 Ga0075429_100151452 3300006880 Bacteria 2031
291 Ga0075429_100240601 3300006880 Bacteria 1585
292 Ga0068865_100000275 3300006881 Bacteria 28270
293 Ga0068865_100076123 3300006881 Bacteria 2394
294 Ga0068865_100160059 3300006881 Bacteria 1716
295 Ga0075436_100044259 3300006914 Bacteria 3069
296 Ga0075436_100111240 3300006914 Unclassified 1912
297 Ga0097620_100040078 3300006931 Bacteria 4701
298 Ga0097620_100061259 3300006931 Bacteria 3792
299 Ga0075435_100001384 3300007076 Bacteria 15669
300 Ga0075435_100055469 3300007076 Bacteria 3200
301 Ga0075435_100069480 3300007076 Bacteria 2872
302 Ga0075435_100113723 3300007076 Bacteria 2253
303 Ga0075435_100128394 3300007076 Bacteria 2120
304 Ga0075435_100153209 3300007076 Unclassified 1939
305 Ga0075435_100188926 3300007076 Bacteria 1743
306 Ga0099794_10050582 3300007265 Bacteria 1999
307 Ga0099795_10001211 3300007788 Bacteria 5446
308 Ga0111539_10000394 3300009094 Bacteria 54170
309 Ga0111539_10003483 3300009094 Bacteria 20741
310 Ga0111539_10012080 3300009094 Bacteria 10831
311 Ga0111539_10013521 3300009094 Bacteria 10201
312 Ga0111539_10029045 3300009094 Bacteria 6742
313 Ga0111539_10033922 3300009094 Bacteria 6193
314 Ga0111539_10102599 3300009094 Bacteria 3357
315 Ga0111539_10191928 3300009094 Bacteria 2383
316 Ga0105245_10000462 3300009098 Bacteria 37242
317 Ga0105245_10104051 3300009098 Bacteria 2631
318 Ga0105245_10350662 3300009098 Unclassified 1462
319 Ga0105245_10438237 3300009098 Bacteria 1313
320 Ga0105245_10520135 3300009098 Bacteria 1208
321 Ga0105247_10000442 3300009101 Bacteria 35071
322 Ga0105247_10007985 3300009101 Bacteria 6466
323 Ga0114129_10001111 3300009147 Bacteria 35464
324 Ga0114129_10006627 3300009147 Bacteria 16445
325 Ga0114129_10019114 3300009147 Bacteria 9758
326 Ga0114129_10138186 3300009147 Bacteria 3343
327 Ga0114129_10173981 3300009147 Bacteria 2933
328 Ga0114129_10196114 3300009147 Bacteria 2738
329 Ga0114129_10317456 3300009147 Bacteria 2072
330 Ga0114129_10443157 3300009147 Bacteria 1704
331 Ga0114129_10558448 3300009147 Bacteria 1488
332 Ga0114129_10981805 3300009147 Bacteria 1065
333 Ga0105243_10000282 3300009148 Bacteria 56666
334 Ga0105243_10063911 3300009148 Unclassified 2951
335 Ga0105241_10000652 3300009174 Bacteria 26004
336 Ga0105241_10049246 3300009174 Bacteria 3208
337 Ga0105242_10001726 3300009176 Bacteria 17253
338 Ga0105242_10042656 3300009176 Bacteria 3665
339 Ga0105242_10195408 3300009176 Unclassified 1794
340 Ga0105242_10521525 3300009176 Bacteria 1134
341 Ga0105248_10022138 3300009177 Bacteria 7045
342 Ga0105248_10044044 3300009177 Bacteria 5005
343 Ga0105248_10119676 3300009177 Bacteria 2970
344 Ga0105248_10170963 3300009177 Bacteria 2449
345 Ga0105248_10494882 3300009177 Bacteria 1378
346 Ga0105237_10176235 3300009545 Bacteria 2138
347 Ga0105237_10420909 3300009545 Bacteria 1341
348 Ga0105237_10470752 3300009545 Bacteria 1262
349 Ga0105238_10298302 3300009551 Bacteria 1595
350 Ga0105249_10001210 3300009553 Bacteria 22796
351 Ga0105249_10032670 3300009553 Bacteria 4709
352 Ga0105249_10075335 3300009553 Bacteria 3125
353 Ga0105249_10511409 3300009553 Bacteria 1247
354 Ga0105239_10006303 3300010375 Bacteria 13795
355 Ga0105239_10013274 3300010375 Bacteria 9154
356 Ga0105239_10110219 3300010375 Bacteria 3051
357 Ga0105239_10421191 3300010375 Unclassified 1513
358 Ga0105246_10000312 3300011119 Bacteria 25800
359 Ga0105246_10047614 3300011119 Bacteria 2928
360 Ga0105246_10105167 3300011119 Bacteria 2063
361 Ga0105246_10386820 3300011119 Unclassified 1158
362 Ga0157341_1002115 3300012494 Unclassified 1278
363 Ga0157373_10020437 3300013100 Bacteria 4812
364 Ga0157371_10398737 3300013102 Unclassified 1006
365 Ga0157374_10001123 3300013296 Bacteria 23027
366 Ga0157378_10000270 3300013297 Bacteria 50517
367 Ga0157378_10278159 3300013297 Bacteria 1612
368 Ga0157378_10281096 3300013297 Bacteria 1604
369 Ga0163162_10000145 3300013306 Bacteria 65191
370 Ga0163162_10028483 3300013306 Bacteria 5527
371 Ga0163162_10270031 3300013306 Bacteria 1832
372 Ga0157372_10004025 3300013307 Bacteria 15762
373 Ga0157375_10000332 3300013308 Bacteria 42513
374 Ga0157375_10044592 3300013308 Bacteria 4310
375 Ga0157375_10289840 3300013308 Bacteria 1800
376 Ga0163163_10000865 3300014325 Bacteria 25811
377 Ga0163163_10010305 3300014325 Bacteria 8401
378 Ga0163163_10034353 3300014325 Bacteria 4909
379 Ga0163163_10455839 3300014325 Bacteria 1339
380 Ga0163163_10465553 3300014325 Bacteria 1325
381 Ga0157380_10001523 3300014326 Bacteria 15218
382 Ga0157377_10000137 3300014745 Bacteria 46698
383 Ga0157377_10027186 3300014745 Bacteria 3069
384 Ga0157377_10159819 3300014745 Bacteria 1400
385 Ga0157379_10002484 3300014968 Bacteria 15443
386 Ga0157379_10077370 3300014968 Bacteria 2979
387 Ga0157379_10321134 3300014968 Bacteria 1414
388 Ga0157376_10000088 3300014969 Bacteria 70084
389 Ga0157376_10044877 3300014969 Bacteria 3636
390 Ga0163161_10000144 3300017792 Bacteria 64771
391 Ga0163161_10033052 3300017792 Bacteria 3696
392 Ga0224572_1000107 3300024225 Bacteria 6414
393 Ga0207666_1000048 3300025271 Bacteria 23535
394 Ga0207666_1005457 3300025271 Bacteria 1625
395 Ga0207673_1001170 3300025290 Bacteria 2823
396 Ga0207697_10000136 3300025315 Bacteria 35274
397 Ga0207697_10055625 3300025315 Unclassified 1641
398 Ga0207653_10011159 3300025885 Bacteria 2804
399 Ga0207653_10028793 3300025885 Bacteria 1788
400 Ga0207653_10084406 3300025885 Unclassified 1104
401 Ga0207682_10000006 3300025893 Bacteria 94953
402 Ga0207692_10005544 3300025898 Bacteria 5063
403 Ga0207692_10054588 3300025898 Bacteria 2041
404 Ga0207642_10000628 3300025899 Bacteria 10836
405 Ga0207642_10005629 3300025899 Bacteria 4104
406 Ga0207642_10055635 3300025899 Bacteria 1811
407 Ga0207710_10014427 3300025900 Bacteria 3333
408 Ga0207710_10025874 3300025900 Bacteria 2534
409 Ga0207710_10035283 3300025900 Bacteria 2201
410 Ga0207688_10000027 3300025901 Bacteria 48448
411 Ga0207688_10003913 3300025901 Bacteria 8119
412 Ga0207688_10005223 3300025901 Bacteria 7058
413 Ga0207680_10010727 3300025903 Bacteria 4597
414 Ga0207680_10072079 3300025903 Bacteria 2143
415 Ga0207647_10005974 3300025904 Bacteria 8867
416 Ga0207647_10033429 3300025904 Unclassified 3293
417 Ga0207647_10082462 3300025904 Bacteria 1926
418 Ga0207685_10074105 3300025905 Bacteria 1389
419 Ga0207699_10016678 3300025906 Bacteria 3848
420 Ga0207645_10000100 3300025907 Bacteria 64057
421 Ga0207645_10011370 3300025907 Bacteria 6081
422 Ga0207643_10000007 3300025908 Bacteria 171706
423 Ga0207654_10000314 3300025911 Bacteria 29106
424 Ga0207654_10049690 3300025911 Bacteria 2407
425 Ga0207654_10054948 3300025911 Bacteria 2303
426 Ga0207707_10003553 3300025912 Bacteria 13808
427 Ga0207707_10079478 3300025912 Bacteria 2863
428 Ga0207707_10104369 3300025912 Bacteria 2477
429 Ga0207671_10294766 3300025914 Bacteria 1281
430 Ga0207671_10320971 3300025914 Bacteria 1225
431 Ga0207693_10007133 3300025915 Bacteria 9219
432 Ga0207693_10008588 3300025915 Bacteria 8362
433 Ga0207693_10049759 3300025915 Bacteria 3291
434 Ga0207693_10100221 3300025915 Bacteria 2271
435 Ga0207693_10121868 3300025915 Bacteria 2048
436 Ga0207693_10248582 3300025915 Bacteria 1396
437 Ga0207663_10145223 3300025916 Bacteria 1658
438 Ga0207663_10165234 3300025916 Bacteria 1567
439 Ga0207660_10000041 3300025917 Bacteria 63485
440 Ga0207660_10174387 3300025917 Bacteria 1666
441 Ga0207660_10523123 3300025917 Unclassified 963
442 Ga0207662_10000282 3300025918 Bacteria 23540
443 Ga0207662_10032258 3300025918 Bacteria 3048
444 Ga0207657_10003933 3300025919 Bacteria 15773
445 Ga0207657_10018028 3300025919 Bacteria 6753
446 Ga0207657_10022500 3300025919 Bacteria 5895
447 Ga0207649_10000451 3300025920 Bacteria 29601
448 Ga0207649_10073921 3300025920 Bacteria 2185
449 Ga0207652_10002586 3300025921 Bacteria 15184
450 Ga0207681_10000100 3300025923 Bacteria 72913
451 Ga0207681_10054375 3300025923 Bacteria 2722
452 Ga0207650_10005799 3300025925 Bacteria 8428
453 Ga0207659_10000044 3300025926 Bacteria 88759
454 Ga0207659_10089491 3300025926 Bacteria 2296
455 Ga0207659_10288669 3300025926 Unclassified 1343
456 Ga0207687_10000072 3300025927 Bacteria 76222
457 Ga0207687_10082787 3300025927 Bacteria 2322
458 Ga0207687_10182279 3300025927 Bacteria 1628
459 Ga0207700_10010428 3300025928 Bacteria 5862
460 Ga0207700_10026082 3300025928 Bacteria 4070
461 Ga0207700_10149000 3300025928 Bacteria 1932
462 Ga0207700_10227714 3300025928 Bacteria 1583
463 Ga0207664_10134516 3300025929 Bacteria 2085
464 Ga0207664_10713075 3300025929 Bacteria 902
465 Ga0207644_10001432 3300025931 Bacteria 15366
466 Ga0207644_10013238 3300025931 Bacteria 5495
467 Ga0207644_10315203 3300025931 Bacteria 1263
468 Ga0207690_10000140 3300025932 Bacteria 58923
469 Ga0207690_10214907 3300025932 Bacteria 1468
470 Ga0207706_10001913 3300025933 Bacteria 20445
471 Ga0207706_10003180 3300025933 Bacteria 15778
472 Ga0207706_10007580 3300025933 Bacteria 10038
473 Ga0207706_10036749 3300025933 Bacteria 4350
474 Ga0207686_10000448 3300025934 Bacteria 27388
475 Ga0207709_10000154 3300025935 Bacteria 93456
476 Ga0207709_10037801 3300025935 Bacteria 2870
477 Ga0207709_10189211 3300025935 Bacteria 1461
478 Ga0207709_10511446 3300025935 Unclassified 939
479 Ga0207670_10000444 3300025936 Bacteria 23206
480 Ga0207670_10105999 3300025936 Bacteria 2015
481 Ga0207670_10249020 3300025936 Unclassified 1372
482 Ga0207669_10000176 3300025937 Bacteria 29979
483 Ga0207704_10000086 3300025938 Bacteria 54866
484 Ga0207704_10118160 3300025938 Bacteria 1808
485 Ga0207704_10547754 3300025938 Bacteria 940
486 Ga0207665_10000666 3300025939 Bacteria 23108
487 Ga0207665_10002138 3300025939 Bacteria 13362
488 Ga0207665_10050922 3300025939 Bacteria 2786
489 Ga0207665_10071245 3300025939 Bacteria 2373
490 Ga0207665_10221352 3300025939 Bacteria 1387
491 Ga0207691_10000214 3300025940 Bacteria 56205
492 Ga0207691_10002482 3300025940 Bacteria 18048
493 Ga0207691_10334355 3300025940 Bacteria 1297
494 Ga0207711_10001773 3300025941 Bacteria 19760
495 Ga0207711_10023185 3300025941 Bacteria 5195
496 Ga0207711_10044737 3300025941 Bacteria 3780
497 Ga0207711_10182982 3300025941 Bacteria 1907
498 Ga0207689_10000366 3300025942 Bacteria 42711
499 Ga0207689_10021381 3300025942 Bacteria 5441
500 Ga0207689_10196951 3300025942 Bacteria 1663
501 Ga0207661_10000087 3300025944 Bacteria 63263
502 Ga0207661_10055463 3300025944 Bacteria 3179
503 Ga0207661_10278218 3300025944 Unclassified 1495
504 Ga0207679_10000029 3300025945 Bacteria 183002
505 Ga0207679_10145552 3300025945 Bacteria 1921
506 Ga0207679_10172740 3300025945 Bacteria 1781
507 Ga0207667_10315441 3300025949 Unclassified 1597
508 Ga0207651_10000264 3300025960 Bacteria 22299
509 Ga0207651_10122017 3300025960 Bacteria 1978
510 Ga0207651_10213530 3300025960 Bacteria 1555
511 Ga0207651_10281218 3300025960 Unclassified 1375
512 Ga0207712_10000129 3300025961 Bacteria 79246
513 Ga0207712_10217877 3300025961 Bacteria 1524
514 Ga0207668_10000100 3300025972 Bacteria 60574
515 Ga0207668_10088074 3300025972 Bacteria 2273
516 Ga0207640_10001280 3300025981 Bacteria 13669
517 Ga0207640_10174372 3300025981 Unclassified 1606
518 Ga0207658_10034085 3300025986 Bacteria 3636
519 Ga0207658_10177304 3300025986 Bacteria 1761
520 Ga0207677_10005747 3300026023 Bacteria 6748
521 Ga0207677_10085907 3300026023 Bacteria 2272
522 Ga0207703_10004645 3300026035 Bacteria 11217
523 Ga0207703_10099525 3300026035 Bacteria 2461
524 Ga0207703_10167710 3300026035 Bacteria 1928
525 Ga0207639_10002204 3300026041 Bacteria 13124
526 Ga0207678_10002814 3300026067 Bacteria 15778
527 Ga0207678_10005074 3300026067 Bacteria 11807
528 Ga0207678_10028585 3300026067 Bacteria 4866
529 Ga0207678_10038708 3300026067 Bacteria 4142
530 Ga0207708_10001802 3300026075 Bacteria 15778
531 Ga0207708_10002366 3300026075 Bacteria 13852
532 Ga0207708_10088090 3300026075 Bacteria 2391
533 Ga0207702_10001819 3300026078 Bacteria 20980
534 Ga0207702_10038792 3300026078 Bacteria 3990
535 Ga0207702_10213324 3300026078 Bacteria 1796
536 Ga0207641_10000476 3300026088 Bacteria 45413
537 Ga0207641_10340140 3300026088 Unclassified 1428
538 Ga0207648_10000072 3300026089 Bacteria 94957
539 Ga0207648_10002406 3300026089 Bacteria 20158
540 Ga0207648_10264927 3300026089 Bacteria 1534
541 Ga0207676_10000512 3300026095 Bacteria 32630
542 Ga0207676_10048456 3300026095 Bacteria 3298
543 Ga0207674_10000697 3300026116 Bacteria 43729
544 Ga0207675_100002384 3300026118 Bacteria 18614
545 Ga0207675_100014751 3300026118 Bacteria 7289
546 Ga0207683_10000029 3300026121 Bacteria 109665
547 Ga0207683_10019860 3300026121 Bacteria 5741
548 Ga0207683_10180352 3300026121 Bacteria 1915
549 Ga0207683_10316004 3300026121 Bacteria 1430
550 Ga0207698_10000523 3300026142 Bacteria 22323
551 Ga0207698_10399221 3300026142 Unclassified 1313
552 Ga0210002_1000410 3300027617 Bacteria 5830
553 Ga0209983_1004567 3300027665 Bacteria 2904
554 Ga0209998_10001837 3300027717 Bacteria 5033
555 Ga0209998_10002670 3300027717 Bacteria 4031
556 Ga0209813_10001159 3300027866 Bacteria 5885
557 Ga0209813_10016822 3300027866 Bacteria 2001
558 Ga0209974_10003891 3300027876 Bacteria 5347
559 Ga0207428_10000100 3300027907 Bacteria 119495
560 Ga0207428_10000115 3300027907 Bacteria 109072
561 Ga0207428_10000228 3300027907 Bacteria 77812
562 Ga0207428_10071087 3300027907 Bacteria 2734
563 Ga0207428_10110835 3300027907 Bacteria 2112
564 Ga0268266_10017979 3300028379 Bacteria 6027
565 Ga0268266_10040078 3300028379 Bacteria 3991
566 Ga0268266_10072670 3300028379 Bacteria 2983
567 Ga0268265_10000755 3300028380 Bacteria 31424
568 Ga0268265_10040639 3300028380 Bacteria 3436
569 Ga0268264_10035284 3300028381 Bacteria 4116
570 Ga0268264_10044476 3300028381 Bacteria 3683
571 Ga0268264_10249122 3300028381 Bacteria 1649
572 Ga0265338_10049467 3300028800 Bacteria 3810
573 Ga0307511_10000295 3300030521 Bacteria 52686
574 Ga0265763_1000456 3300030763 Bacteria 2465
575 Ga0265760_10002189 3300031090 Bacteria 5712
576 Ga0265332_10001020 3300031238 Bacteria 16537
577 Ga0265325_10000015 3300031241 Bacteria 131113
578 Ga0265325_10012301 3300031241 Bacteria 4896
579 Ga0265325_10025489 3300031241 Bacteria 3210
580 Ga0265325_10051836 3300031241 Bacteria 2109
581 Ga0265329_10006800 3300031242 Bacteria 4497
582 Ga0265339_10000060 3300031249 Bacteria 97276
583 Ga0265339_10002058 3300031249 Bacteria 14763
584 Ga0265316_10229111 3300031344 Bacteria 1369
585 Ga0265313_10000094 3300031595 Bacteria 89774
586 Ga0265313_10042478 3300031595 Bacteria 2232
587 Ga0265314_10007859 3300031711 Bacteria 9208
588 Ga0265314_10014199 3300031711 Bacteria 6388
589 Ga0265314_10027968 3300031711 Bacteria 4213
590 Ga0265342_10000908 3300031712 Bacteria 29504
591 Ga0265342_10046308 3300031712 Bacteria 2614
592 Ga0307412_10248251 3300031911 Bacteria 1381
593 Ga0307507_10018085 3300033179 Bacteria 8044
594 Ga0373930_0000771 3300034816 Bacteria 4553
595 Ga0373948_0000355 3300034817 Bacteria 5632
596 Ga0373948_0022558 3300034817 Unclassified 1214
597 Ga0373950_0000996 3300034818 Unclassified 3589
598 Ga0373950_0005396 3300034818 Bacteria 1908
599 Ga0373958_0000704 3300034819 Bacteria 4238
600 Ga0373958_0014054 3300034819 Bacteria 1395
601 Ga0373959_0000679 3300034820 Bacteria 5821
602 Ga0373959_0006952 3300034820 Unclassified 1894
603 Ga0373938_0000025 3300034957 Bacteria 19231
604 Ga0373938_0000565 3300034957 Bacteria 5981
605 Ga0373926_0018822 3300035083 Unclassified 2378
606 Ga0373926_0031992 3300035083 Bacteria 1856
607 Ga0373928_0000893 3300035084 Bacteria 5857
608 Ga0373928_0004298 3300035084 Bacteria 2720
609 Ga0373928_0016550 3300035084 Bacteria 1510
610 Ga0373929_0003783 3300035085 Bacteria 2710
611 Ga0373929_0009824 3300035085 Bacteria 1779
612 Ga0373934_0012658 3300035086 Bacteria 3184
613 Ga0373934_0057740 3300035086 Bacteria 1544
614 Ga0373934_0072880 3300035086 Bacteria 1375
615 Ga0373940_0001432 3300035088 Bacteria 4310
616 Ga0373940_0002052 3300035088 Bacteria 3823
617 Ga0373944_0014889 3300035089 Bacteria 2176
618 Ga0373944_0040499 3300035089 Bacteria 1438
619 Ga0373949_0000284 3300035090 Bacteria 18664
620 Ga0373949_0001993 3300035090 Bacteria 5459
621 Ga0373949_0053306 3300035090 Bacteria 1024
622 Ga0373951_0001866 3300035091 Bacteria 5430
623 Ga0373951_0002968 3300035091 Bacteria 4203
624 Ga0373952_0001907 3300035092 Bacteria 3782
625 Ga0373952_0013630 3300035092 Bacteria 1616
626 Ga0373952_0015456 3300035092 Bacteria 1541
627 Ga0373923_0002721 3300035111 Bacteria 5513
628 Ga0373923_0028795 3300035111 Bacteria 2223
629 Ga0373932_0000745 3300035112 Bacteria 9717
630 Ga0373932_0002517 3300035112 Bacteria 4607
631 Ga0373932_0002996 3300035112 Bacteria 4143
632 Ga0373932_0028565 3300035112 Bacteria 1534
633 Ga0373936_0003042 3300035113 Bacteria 6271
634 Ga0373936_0004123 3300035113 Bacteria 5478
635 Ga0373936_0010154 3300035113 Bacteria 3556
636 Ga0373936_0020559 3300035113 Bacteria 2565
637 Ga0373936_0039256 3300035113 Bacteria 1894
638 Ga0373939_0000640 3300035114 Bacteria 8717
639 Ga0373939_0002988 3300035114 Bacteria 3970
640 Ga0373941_0001556 3300035115 Bacteria 4869
641 Ga0373941_0003272 3300035115 Bacteria 3655
642 Ga0373945_0006315 3300035116 Bacteria 3817
643 Ga0373945_0010915 3300035116 Bacteria 2996
644 Ga0373953_0015536 3300035117 Bacteria 2761
645 Ga0373953_0019450 3300035117 Bacteria 2526
646 Ga0373954_0001425 3300035118 Bacteria 9690
647 Ga0373954_0010677 3300035118 Bacteria 4058
648 Ga0373954_0026696 3300035118 Bacteria 2648
649 Ga0373956_0005293 3300035119 Bacteria 5166
650 Ga0373956_0017397 3300035119 Bacteria 3030
651 Ga0373956_0031450 3300035119 Bacteria 2326
652 Ga0373956_0032517 3300035119 Bacteria 2289
653 Ga0373957_0002619 3300035120 Bacteria 5167
654 Ga0373957_0022059 3300035120 Bacteria 2265
655 Ga0373957_0124333 3300035120 Bacteria 1046
656 Ga0373960_0004701 3300035121 Bacteria 3141
657 Ga0373943_0000467 3300035170 Bacteria 17171
658 Ga0373943_0014454 3300035170 Bacteria 3575
659 Ga0373943_0043040 3300035170 Bacteria 2191
660 Ga0373946_0000540 3300035171 Bacteria 12542
661 Ga0373946_0001451 3300035171 Bacteria 8248
662 Ga0373946_0001719 3300035171 Bacteria 7639
663 Ga0373946_0012321 3300035171 Bacteria 3198
664 Ga0373955_0000039 3300035172 Bacteria 51994
665 Ga0373955_0002863 3300035172 Bacteria 7576
666 Ga0373955_0019914 3300035172 Bacteria 3364
667 Ga0373955_0034707 3300035172 Bacteria 2667
668 Ga0373955_0116083 3300035172 Bacteria 1552
669 Ga0373942_0000722 3300035207 Bacteria 9101
670 Ga0373942_0002912 3300035207 Bacteria 4055
671 Ga0373961_0000791 3300035241 Bacteria 10869
672 Ga0373961_0028250 3300035241 Bacteria 1545
673 Ga0373961_0044321 3300035241 Bacteria 1297
674 Ga0373962_0000151 3300035242 Bacteria 14355
675 Ga0373924_0001219 3300035410 Bacteria 8246
676 Ga0373924_0012363 3300035410 Bacteria 3188
677 Ga0373931_0000381 3300035691 Bacteria 18287
678 Ga0373931_0043551 3300035691 Bacteria 2364
679 Ga0373931_0079061 3300035691 Bacteria 1810
680 Ga0373931_0126874 3300035691 Bacteria 1464
681 Ga0373931_0143846 3300035691 Bacteria 1384
682 Ga0373935_0000079 3300035692 Bacteria 41989
683 Ga0373935_0000403 3300035692 Bacteria 22453
684 Ga0373935_0064931 3300035692 Bacteria 2341
685 Ga0373935_0100909 3300035692 Bacteria 1902
686 Ga0373927_0003959 3300035695 Bacteria 10487
687 Ga0373927_0006910 3300035695 Bacteria 7710
688 Ga0373927_0033684 3300035695 Bacteria 3334
689 Ga0373927_0044692 3300035695 Unclassified 2865
690 Ga0373927_0075556 3300035695 Bacteria 2182
691 Ga0373927_0224298 3300035695 Bacteria 1234
692 Ga0373933_0004299 3300035724 Bacteria 7822
693 Ga0373933_0004774 3300035724 Bacteria 7409
694 Ga0373933_0008712 3300035724 Bacteria 5531
695 Ga0373933_0042497 3300035724 Bacteria 2687
696 Ga0373933_0107869 3300035724 Bacteria 1734
697 Ga0373947_0000986 3300035725 Bacteria 17380
698 Ga0373947_0025796 3300035725 Bacteria 3428
699 Ga0373947_0068838 3300035725 Bacteria 2165
700 Ga0373947_0129533 3300035725 Bacteria 1609
701 Ga0373947_0137702 3300035725 Unclassified 1563
702 Ga0373937_0000223 3300036401 Bacteria 54957
703 Ga0373937_0012115 3300036401 Bacteria 7570
704 Ga0373937_0023630 3300036401 Bacteria 5538
705 Ga0373937_0023983 3300036401 Bacteria 5500
706 Ga0373937_0033945 3300036401 Bacteria 4638
707 Ga0373937_0043327 3300036401 Bacteria 4107
708 Ga0373937_0064259 3300036401 Bacteria 3376
709 Ga0373937_0097181 3300036401 Bacteria 2731
710 Ga0373937_0211287 3300036401 Bacteria 1826
711 Ga0373925_0000741 3300037068 Bacteria 29997
712 Ga0373925_0047234 3300037068 Bacteria 3204
713 Ga0373925_0047453 3300037068 Bacteria 3197
714 Ga0373925_0048570 3300037068 Bacteria 3162
715 Ga0373925_0089106 3300037068 Bacteria 2356
716 Ga0373925_0121249 3300037068 Bacteria 2030
717 Ga0373925_0390636 3300037068 Bacteria 1134
718 Ga0395900_0282267 3300037418 Unclassified 1652
719 Ga0395898_0113234 3300037466 Bacteria 2600
720 Ga0436363_1239658 3300039450 Bacteria 2159
721 Ga0439464_0010154 3300042439 Bacteria 2486
722 Ga0451577_0112202 3300042876 Bacteria 2440
723 Ga0451577_0296704 3300042876 Bacteria 1465
724 Ga0466963_0080802 3300044694 Bacteria 2201
725 Ga0451576_0042133 3300045051 Bacteria 4821
726 Ga0451576_0521311 3300045051 Bacteria 1249
727 Ga0466958_0027816 3300045836 Bacteria 3347
728 Ga0495592_0000188 3300046454 Bacteria 54485
729 Ga0495592_0006061 3300046454 Bacteria 8991
730 Ga0495592_0163023 3300046454 Bacteria 1532
731 Ga0495592_0209421 3300046454 Unclassified 1310
732 Ga0495603_0005805 3300046455 Bacteria 7386
733 Ga0495629_0011719 3300046459 Bacteria 6363
734 Ga0495629_0058049 3300046459 Bacteria 2705
735 Ga0495629_0119928 3300046459 Bacteria 1832
736 Ga0495629_0138852 3300046459 Bacteria 1691
737 Ga0495638_0040776 3300046460 Bacteria 2941
738 Ga0495641_0114206 3300046461 Bacteria 1205
739 Ga0495651_0001797 3300046462 Bacteria 16534
740 Ga0495651_0002458 3300046462 Bacteria 14320
741 Ga0495651_0102658 3300046462 Bacteria 2126
742 Ga0495651_0122042 3300046462 Bacteria 1913
743 Ga0495653_0000198 3300046463 Bacteria 49009
744 Ga0495653_0004136 3300046463 Bacteria 11738
745 Ga0495580_0040833 3300046472 Bacteria 3312
746 Ga0495580_0061228 3300046472 Unclassified 2643
747 Ga0495580_0119187 3300046472 Bacteria 1832
748 Ga0495582_0005522 3300046473 Bacteria 7041
749 Ga0495582_0016019 3300046473 Bacteria 4110
750 Ga0495639_0006740 3300046475 Bacteria 4938
751 Ga0495639_0008343 3300046475 Bacteria 4444
752 Ga0495662_0000120 3300046476 Bacteria 29299
753 Ga0495662_0014500 3300046476 Bacteria 3832
754 Ga0495662_0020161 3300046476 Unclassified 3225
755 Ga0495662_0054445 3300046476 Bacteria 1933
756 Ga0495664_0000002 3300046477 Bacteria 625183
757 Ga0495664_0005200 3300046477 Bacteria 7139
758 Ga0495664_0008599 3300046477 Bacteria 5694
759 Ga0495664_0013009 3300046477 Bacteria 4717
760 Ga0495664_0026579 3300046477 Bacteria 3371
761 Ga0495664_0044351 3300046477 Bacteria 2635
762 Ga0495664_0045474 3300046477 Bacteria 2604
763 Ga0495584_0031479 3300046491 Bacteria 2685
764 Ga0495584_0036372 3300046491 Bacteria 2488
765 Ga0495584_0101692 3300046491 Bacteria 1453
766 Ga0495584_0113005 3300046491 Bacteria 1374
767 Ga0495585_0000974 3300046492 Bacteria 24017
768 Ga0495585_0003315 3300046492 Bacteria 10936
769 Ga0495594_0012849 3300046499 Bacteria 4366
770 Ga0495594_0110720 3300046499 Bacteria 1548
771 Ga0495607_0011320 3300046501 Bacteria 5946
772 Ga0495607_0053322 3300046501 Bacteria 2338
773 Ga0495583_0110669 3300046506 Bacteria 1164
774 Ga0495608_0000009 3300046511 Bacteria 266614
775 Ga0495608_0014611 3300046511 Bacteria 5447
776 Ga0495618_0000005 3300046514 Bacteria 230421
777 Ga0495618_0015542 3300046514 Bacteria 4646
778 Ga0495618_0045534 3300046514 Bacteria 2768
779 Ga0495618_0047633 3300046514 Bacteria 2706
780 Ga0495618_0050474 3300046514 Bacteria 2627
781 Ga0495620_0072358 3300046515 Bacteria 1408
782 Ga0495628_0000002 3300046516 Bacteria 589399
783 Ga0495628_0003390 3300046516 Bacteria 14259
784 Ga0495628_0018942 3300046516 Bacteria 5696
785 Ga0495630_0000614 3300046517 Bacteria 25848
786 Ga0495630_0010078 3300046517 Bacteria 6810
787 Ga0495630_0014768 3300046517 Bacteria 5694
788 Ga0495630_0029099 3300046517 Bacteria 4106
789 Ga0495630_0120146 3300046517 Bacteria 1993
790 Ga0495630_0198099 3300046517 Bacteria 1533
791 Ga0495630_0464014 3300046517 Bacteria 970
792 Ga0495631_0039801 3300046518 Bacteria 2084
793 Ga0495637_0028471 3300046520 Bacteria 2496
794 Ga0495644_0002940 3300046523 Bacteria 6769
795 Ga0495666_0004626 3300046526 Bacteria 6956
796 Ga0495666_0057477 3300046526 Bacteria 1862
797 Ga0495652_0000004 3300046529 Bacteria 588877
798 Ga0495652_0242432 3300046529 Unclassified 1340
799 Ga0495665_0010156 3300046531 Bacteria 5102
800 Ga0495665_0017638 3300046531 Bacteria 3839
801 Ga0495640_0000005 3300046533 Bacteria 318271
802 Ga0495640_0030306 3300046533 Bacteria 3875
803 Ga0495640_0063677 3300046533 Unclassified 2496
804 Ga0495640_0123766 3300046533 Bacteria 1678
805 Ga0495586_0008910 3300046535 Bacteria 5341
806 Ga0495586_0019766 3300046535 Bacteria 3587
807 Ga0495587_0000007 3300046536 Bacteria 290788
808 Ga0495587_0002521 3300046536 Bacteria 12231
809 Ga0495587_0015010 3300046536 Bacteria 4842
810 Ga0495587_0107890 3300046536 Bacteria 1601
811 Ga0495598_0000679 3300046537 Bacteria 6453
812 Ga0495598_0002660 3300046537 Bacteria 3702
813 Ga0495621_0010608 3300046539 Bacteria 2825
814 Ga0495645_0000003 3300046543 Bacteria 570133
815 Ga0495645_0002657 3300046543 Bacteria 12151
816 Ga0495645_0031265 3300046543 Bacteria 3878
817 Ga0495645_0140918 3300046543 Bacteria 1682
818 Ga0495645_0203422 3300046543 Bacteria 1341
819 Ga0495622_0060015 3300046557 Bacteria 1761
820 Ga0495622_0083307 3300046557 Bacteria 1471
821 Ga0495633_0002331 3300046558 Bacteria 13493
822 Ga0495633_0034464 3300046558 Bacteria 2435
823 Ga0495667_0000002 3300046559 Bacteria 437535
824 Ga0495667_0002603 3300046559 Bacteria 12042
825 Ga0495667_0009295 3300046559 Bacteria 6666
826 Ga0495667_0012554 3300046559 Bacteria 5745
827 Ga0495656_0000276 3300046615 Bacteria 18021
828 Ga0495656_0026771 3300046615 Bacteria 2299
829 Ga0495634_0000129 3300046642 Bacteria 65082
830 Ga0495634_0018616 3300046642 Bacteria 4940
831 Ga0495611_0007172 3300046648 Bacteria 4737
832 Ga0495635_0000020 3300046663 Bacteria 189698
833 Ga0495635_0000228 3300046663 Bacteria 35689
834 Ga0495635_0012601 3300046663 Bacteria 5929
835 Ga0495635_0038244 3300046663 Bacteria 3322
836 Ga0495635_0044905 3300046663 Unclassified 3048
837 Ga0495635_0053072 3300046663 Unclassified 2793
838 Ga0495659_0005354 3300046664 Bacteria 4037
839 Ga0495659_0008097 3300046664 Bacteria 3340
840 Ga0495659_0038928 3300046664 Bacteria 1690
841 Ga0495588_0075174 3300046674 Bacteria 1759
842 Ga0495657_0003205 3300046675 Bacteria 13466
843 Ga0495657_0107953 3300046675 Bacteria 1766
844 Ga0495657_0300079 3300046675 Unclassified 958
845 Ga0495599_0000001 3300046678 Bacteria 537563
846 Ga0495599_0021069 3300046678 Bacteria 4064
847 Ga0495623_0000001 3300046679 Bacteria 313861
848 Ga0495623_0002818 3300046679 Bacteria 11469
849 Ga0495646_0000013 3300046680 Bacteria 159700
850 Ga0495646_0006855 3300046680 Bacteria 7227
851 Ga0495646_0024897 3300046680 Bacteria 3765
852 Ga0495646_0162082 3300046680 Bacteria 1237
853 Ga0495647_0009865 3300046681 Bacteria 3242
854 Ga0495647_0019448 3300046681 Bacteria 2428
855 Ga0495658_0012528 3300046683 Unclassified 4299
856 Ga0495658_0035323 3300046683 Bacteria 2749
857 Ga0495658_0046832 3300046683 Bacteria 2432
858 Ga0495658_0084318 3300046683 Bacteria 1871
859 Ga0495658_0229383 3300046683 Bacteria 1164
860 Ga0495658_0242432 3300046683 Bacteria 1132
861 Ga0495669_0034594 3300046684 Bacteria 2228
862 Ga0495613_0054998 3300046689 Bacteria 2926
863 Ga0495624_0001327 3300046690 Bacteria 19374
864 Ga0495624_0006348 3300046690 Bacteria 8396
865 Ga0495624_0021998 3300046690 Bacteria 4222
866 Ga0495624_0073506 3300046690 Bacteria 2125
867 Ga0495670_0006527 3300046691 Bacteria 5733
868 Ga0495670_0100562 3300046691 Bacteria 1489
869 Ga0495670_0114477 3300046691 Bacteria 1398
870 Ga0495670_0152763 3300046691 Bacteria 1211
871 Ga0495649_0201721 3300046694 Bacteria 1033
872 Ga0495589_0121915 3300046794 Bacteria 1255
873 Ga0495600_0000233 3300046809 Bacteria 30755
874 Ga0495600_0004973 3300046809 Bacteria 7983
875 Ga0495600_0052214 3300046809 Bacteria 2669
876 Ga0495581_0008425 3300047315 Bacteria 5977
877 Ga0495581_0015024 3300047315 Bacteria 4493
878 Ga0495581_0040690 3300047315 Bacteria 2688
879 Ga0495581_0094432 3300047315 Bacteria 1736
880 Ga0495604_0000005 3300047317 Bacteria 424516
881 Ga0495604_0009051 3300047317 Bacteria 7878
882 Ga0495604_0011548 3300047317 Bacteria 7019
883 Ga0495604_0011991 3300047317 Bacteria 6890
884 Ga0495604_0046824 3300047317 Unclassified 3371
885 Ga0495674_0000003 3300047319 Bacteria 562126
886 Ga0495674_0238580 3300047319 Bacteria 1499
887 Ga0495674_0319355 3300047319 Bacteria 1265
888 Ga0495674_0411959 3300047319 Bacteria 1090
889 Ga0495676_0041475 3300047321 Bacteria 3788
890 Ga0495676_0114581 3300047321 Bacteria 1972
891 Ga0495680_0000002 3300047322 Bacteria 197533
892 Ga0495680_0004358 3300047322 Bacteria 13558
893 Ga0495680_0006209 3300047322 Bacteria 11135
894 Ga0495680_0023741 3300047322 Bacteria 5096
895 Ga0495680_0025295 3300047322 Bacteria 4916
896 Ga0495680_0030097 3300047322 Bacteria 4437
897 Ga0495675_0000437 3300047444 Bacteria 27820
898 Ga0495675_0005683 3300047444 Bacteria 7620
899 Ga0495675_0055898 3300047444 Bacteria 2503
900 Ga0495679_026104 3300047446 Bacteria 1944
901 Ga0495681_0064309 3300047470 Bacteria 1681
902 Ga0495684_0000020 3300047471 Bacteria 148507
903 Ga0495684_0001167 3300047471 Bacteria 21128
904 Ga0495684_0032210 3300047471 Bacteria 4024
905 Ga0495684_0032750 3300047471 Bacteria 3992
906 Ga0495684_0089052 3300047471 Bacteria 2339
907 Ga0495684_0134838 3300047471 Bacteria 1853
908 Ga0495684_0435367 3300047471 Bacteria 914
909 Ga0495593_0002594 3300047673 Bacteria 10863
910 Ga0495593_0008133 3300047673 Bacteria 6104
911 Ga0495593_0056054 3300047673 Bacteria 2072
912 Ga0495602_0000027 3300048088 Bacteria 145010
913 Ga0495602_0004518 3300048088 Bacteria 14518
914 Ga0495602_0007000 3300048088 Bacteria 11841
915 Ga0495602_0123396 3300048088 Bacteria 2079
916 Ga0496100_0000530 3300048903 Bacteria 18154
917 Ga0496100_0025275 3300048903 Bacteria 3631
918 Ga0496100_0035456 3300048903 Bacteria 3137
919 Ga0496100_0042520 3300048903 Bacteria 2902
920 Ga0496100_0103199 3300048903 Bacteria 1968
921 Ga0496100_0176299 3300048903 Bacteria 1543
922 Ga0496100_0270459 3300048903 Bacteria 1263
923 Ga0496101_0000189 3300048904 Bacteria 48416
924 Ga0496101_0006701 3300048904 Bacteria 7428
925 Ga0496101_0010732 3300048904 Bacteria 6058
926 Ga0496101_0026690 3300048904 Bacteria 4016
927 Ga0496101_0232010 3300048904 Bacteria 1435
928 Ga0496101_0284729 3300048904 Unclassified 1292
929 Ga0496101_0391742 3300048904 Bacteria 1093
930 Ga0496102_0007437 3300048905 Bacteria 9358
931 Ga0496102_0045796 3300048905 Bacteria 3971
932 Ga0496102_0055352 3300048905 Bacteria 3617
933 Ga0496102_0066802 3300048905 Bacteria 3296
934 Ga0496102_0143158 3300048905 Bacteria 2242
935 Ga0496102_0199994 3300048905 Bacteria 1883
936 Ga0496102_0228045 3300048905 Bacteria 1756
937 Ga0496102_0344755 3300048905 Bacteria 1403
938 Ga0496103_0007283 3300048906 Bacteria 6594
939 Ga0496103_0009462 3300048906 Bacteria 5769
940 Ga0496103_0012313 3300048906 Bacteria 5076
941 Ga0496103_0082569 3300048906 Bacteria 2022
942 Ga0496103_0094719 3300048906 Bacteria 1886
943 Ga0496103_0126318 3300048906 Bacteria 1631
944 Ga0496103_0137881 3300048906 Bacteria 1559
945 Ga0496104_0000521 3300048907 Bacteria 32903
946 Ga0496104_0000609 3300048907 Bacteria 30631
947 Ga0496104_0001668 3300048907 Bacteria 19171
948 Ga0496104_0001997 3300048907 Bacteria 17701
949 Ga0496104_0003575 3300048907 Bacteria 13418
950 Ga0496104_0040303 3300048907 Bacteria 4377
951 Ga0496104_0073768 3300048907 Unclassified 3247
952 Ga0496104_0094987 3300048907 Bacteria 2852
953 Ga0496104_0162567 3300048907 Bacteria 2141
954 Ga0496104_0194816 3300048907 Bacteria 1938
955 Ga0496104_0272366 3300048907 Bacteria 1605
956 Ga0496104_0320685 3300048907 Bacteria 1462
957 Ga0496105_0000522 3300048908 Bacteria 25377
958 Ga0496105_0004673 3300048908 Bacteria 10323
959 Ga0496105_0006301 3300048908 Bacteria 9113
960 Ga0496105_0010845 3300048908 Bacteria 7174
961 Ga0496105_0023006 3300048908 Bacteria 5053
962 Ga0496105_0044524 3300048908 Bacteria 3660
963 Ga0496105_0059404 3300048908 Bacteria 3155
964 Ga0496105_0149860 3300048908 Bacteria 1917
965 Ga0496105_0173093 3300048908 Bacteria 1769
966 Ga0496105_0208985 3300048908 Bacteria 1591
967 Ga0496105_0230454 3300048908 Bacteria 1505
968 Ga0496106_0016847 3300048909 Bacteria 5407
969 Ga0496106_0047971 3300048909 Bacteria 3215
970 Ga0496106_0063613 3300048909 Bacteria 2805
971 Ga0496106_0080493 3300048909 Bacteria 2501
972 Ga0496106_0100557 3300048909 Bacteria 2242
973 Ga0496106_0217356 3300048909 Bacteria 1523
974 Ga0496107_0011126 3300048910 Bacteria 6259
975 Ga0496107_0018052 3300048910 Bacteria 4963
976 Ga0496107_0021420 3300048910 Bacteria 4568
977 Ga0496107_0059427 3300048910 Bacteria 2766
978 Ga0496107_0072869 3300048910 Bacteria 2497
979 Ga0496107_0083486 3300048910 Bacteria 2329
980 Ga0496107_0145235 3300048910 Bacteria 1754
981 Ga0496108_0000510 3300048911 Bacteria 30463
982 Ga0496108_0004455 3300048911 Bacteria 11275
983 Ga0496108_0004887 3300048911 Bacteria 10820
984 Ga0496108_0013258 3300048911 Bacteria 6717
985 Ga0496108_0018809 3300048911 Bacteria 5663
986 Ga0496108_0021834 3300048911 Bacteria 5261
987 Ga0496108_0134439 3300048911 Bacteria 2126
988 Ga0496108_0611468 3300048911 Unclassified 949
989 Ga0496109_0000488 3300048912 Bacteria 33914
990 Ga0496109_0000549 3300048912 Bacteria 31751
991 Ga0496109_0001318 3300048912 Bacteria 20466
992 Ga0496109_0009996 3300048912 Bacteria 8100
993 Ga0496109_0012777 3300048912 Bacteria 7259
994 Ga0496109_0018377 3300048912 Bacteria 6143
995 Ga0496109_0026343 3300048912 Bacteria 5184
996 Ga0496109_0027049 3300048912 Bacteria 5118
997 Ga0496109_0056170 3300048912 Bacteria 3592
998 Ga0496109_0078046 3300048912 Bacteria 3048
999 Ga0496109_0104177 3300048912 Bacteria 2634
1000 Ga0496109_0160352 3300048912 Bacteria 2107
1001 Ga0496110_0007131 3300048913 Bacteria 8897
1002 Ga0496110_0013969 3300048913 Bacteria 6653
1003 Ga0496110_0021488 3300048913 Bacteria 5466
1004 Ga0496110_0031059 3300048913 Bacteria 4607
1005 Ga0496110_0036686 3300048913 Bacteria 4258
1006 Ga0496110_0040347 3300048913 Bacteria 4068
1007 Ga0496110_0081836 3300048913 Bacteria 2879
1008 Ga0496110_0232955 3300048913 Bacteria 1675
1009 Ga0496110_0400142 3300048913 Unclassified 1252
1010 Ga0496110_0704241 3300048913 Bacteria 911
1011 Ga0496111_0001147 3300048914 Bacteria 14708
1012 Ga0496111_0007023 3300048914 Bacteria 7355
1013 Ga0496111_0008713 3300048914 Bacteria 6731
1014 Ga0496111_0015611 3300048914 Bacteria 5218
1015 Ga0496111_0019956 3300048914 Bacteria 4662
1016 Ga0496111_0021342 3300048914 Bacteria 4521
1017 Ga0496111_0038419 3300048914 Bacteria 3430
1018 Ga0496111_0050185 3300048914 Bacteria 3008
1019 Ga0496112_0000320 3300048915 Bacteria 30902
1020 Ga0496112_0003683 3300048915 Bacteria 12779
1021 Ga0496112_0009679 3300048915 Bacteria 8697
1022 Ga0496112_0018028 3300048915 Bacteria 6643
1023 Ga0496112_0103864 3300048915 Bacteria 2812
1024 Ga0496112_0222387 3300048915 Bacteria 1843
1025 Ga0496112_0231888 3300048915 Bacteria 1800
1026 Ga0496112_0319205 3300048915 Bacteria 1498
1027 Ga0496113_0000694 3300048916 Bacteria 17181
1028 Ga0496113_0001247 3300048916 Bacteria 14000
1029 Ga0496113_0002209 3300048916 Bacteria 11223
1030 Ga0496113_0002579 3300048916 Bacteria 10584
1031 Ga0496113_0015034 3300048916 Bacteria 5301
1032 Ga0496113_0074014 3300048916 Bacteria 2596
1033 Ga0496113_0080563 3300048916 Bacteria 2494
1034 Ga0496113_0086396 3300048916 Bacteria 2410
1035 Ga0496113_0113104 3300048916 Bacteria 2115
1036 Ga0496113_0117820 3300048916 Bacteria 2074
1037 Ga0496113_0121135 3300048916 Bacteria 2045
1038 Ga0496114_0001960 3300048917 Bacteria 15650
1039 Ga0496114_0006147 3300048917 Bacteria 9448
1040 Ga0496114_0023853 3300048917 Bacteria 4992
1041 Ga0496114_0037984 3300048917 Bacteria 3983
1042 Ga0496114_0112540 3300048917 Bacteria 2333
1043 Ga0496114_0133269 3300048917 Bacteria 2147
1044 Ga0496115_0002442 3300048918 Bacteria 13349
1045 Ga0496115_0048840 3300048918 Bacteria 3386
1046 Ga0496115_0054588 3300048918 Bacteria 3208
1047 Ga0496115_0063245 3300048918 Bacteria 2985
1048 Ga0496115_0063747 3300048918 Bacteria 2973
1049 Ga0496115_0071024 3300048918 Bacteria 2823
1050 Ga0496115_0101757 3300048918 Bacteria 2356
1051 Ga0496115_0206305 3300048918 Bacteria 1623
1052 Ga0496115_0234026 3300048918 Bacteria 1514
1053 Ga0501031_0185364 3300049568 Bacteria 1359
1054 Ga0501032_0158564 3300049569 Bacteria 1486
1055 Ga0501033_0068879 3300049570 Bacteria 2601
1056 Ga0501038_0014712 3300049574 Bacteria 7129
1057 Ga0501039_0217451 3300049575 Bacteria 1502
1058 Ga0501040_0340746 3300049576 Unclassified 1073
1059 Ga0501041_0079101 3300049577 Bacteria 2024
1060 Ga0501041_0252918 3300049577 Bacteria 1108
1061 Ga0501042_0139463 3300049578 Bacteria 1748
1062 Ga0501046_0246555 3300049580 Bacteria 1316
1063 Ga0501047_0010459 3300049581 Bacteria 8782
1064 Ga0501047_0183893 3300049581 Bacteria 1956
1065 Ga0501070_0002309 3300049586 Bacteria 16740
1066 Ga0501071_0136761 3300049587 Bacteria 1823
1067 Ga0501072_0121802 3300049588 Bacteria 2078
1068 Ga0501075_0020522 3300049591 Bacteria 4809
1069 Ga0501075_0166862 3300049591 Bacteria 1680
1070 Ga0501076_0089633 3300049592 Bacteria 2473
1071 Ga0501077_0028247 3300049593 Bacteria 3565
1072 Ga0501077_0029799 3300049593 Bacteria 3470
1073 Ga0501077_0104723 3300049593 Bacteria 1793
1074 Ga0501079_0054514 3300049741 Bacteria 3084
1075 Ga0501079_0055748 3300049741 Bacteria 3050
1076 Ga0501080_0011011 3300049742 Bacteria 8280
1077 Ga0501080_0199918 3300049742 Unclassified 1835
1078 Ga0501081_0009896 3300049743 Bacteria 6210
1079 Ga0501081_0189936 3300049743 Bacteria 1487
1080 Ga0501081_0262852 3300049743 Bacteria 1261
1081 Ga0501035_0105221 3300049822 Bacteria 2474
1082 Ga0501044_0003904 3300049823 Bacteria 16712
1083 Ga0501044_0182818 3300049823 Bacteria 2062
1084 Ga0501045_0119765 3300049824 Bacteria 1954
1085 Ga0501045_0186746 3300049824 Bacteria 1544
1086 nmdc:mga03683_43898_c1 3300050489 Bacteria 1846
1087 nmdc:mga03n38_186316_c1 3300050490 Unclassified 1066
1088 nmdc:mga03n38_233718_c1 3300050490 Unclassified 965
1089 nmdc:mga03n38_3663_c1 3300050490 Bacteria 4969
1090 nmdc:mga00v17_32310_c1 3300050491 Bacteria 3093
1091 nmdc:mga00v17_4364_c1 3300050491 Bacteria 7348
1092 nmdc:mga00v17_76346_c1 3300050491 Bacteria 2084
1093 nmdc:mga0yw44_13357_c1 3300050492 Bacteria 4321
1094 nmdc:mga0yw44_18648_c1 3300050492 Bacteria 3807
1095 nmdc:mga0yw44_374004_c1 3300050492 Unclassified 961
1096 nmdc:mga0yw44_4721_c1 3300050492 Bacteria 6307
1097 nmdc:mga0yw44_6598_c1 3300050492 Bacteria 5622
1098 nmdc:mga0yw44_8031_c1 3300050492 Bacteria 5232
1099 nmdc:mga06z11_125173_c1 3300050494 Bacteria 1438
1100 nmdc:mga06z11_1492_c1 3300050494 Bacteria 8693
1101 nmdc:mga06z11_2755_c1 3300050494 Bacteria 6741
1102 nmdc:mga06z11_86011_c1 3300050494 Bacteria 1697
1103 nmdc:mga06z11_90716_c1 3300050494 Bacteria 1658
1104 nmdc:mga04h51_13548_c1 3300050495 Bacteria 2311
1105 nmdc:mga04h51_385_c1 3300050495 Bacteria 10730
1106 nmdc:mga07m45_111503_c1 3300050496 Bacteria 1576
1107 nmdc:mga05p37_257695_c1 3300050507 Bacteria 2089
1108 nmdc:mga05p37_362245_c1 3300050507 Bacteria 1704
1109 nmdc:mga05p37_505_c1 3300050507 Bacteria 42970
1110 nmdc:mga05p37_6334_c1 3300050507 Bacteria 13942
1111 nmdc:mga05p37_69662_c1 3300050507 Bacteria 4326
1112 nmdc:mga05p37_86999_c1 3300050507 Bacteria 3852
1113 nmdc:mga09592_157633_c1 3300050508 Bacteria 1960
1114 nmdc:mga09592_16963_c1 3300050508 Bacteria 5959
1115 nmdc:mga09592_219912_c1 3300050508 Bacteria 1646
1116 nmdc:mga09592_30185_c1 3300050508 Bacteria 4510
1117 nmdc:mga09592_3702_c1 3300050508 Bacteria 12324
1118 nmdc:mga09592_41127_c1 3300050508 Bacteria 3886
1119 nmdc:mga09592_81559_c1 3300050508 Bacteria 2756
1120 nmdc:mga0qj67_143429_c1 3300050509 Unclassified 1936
1121 nmdc:mga0qj67_59038_c1 3300050509 Bacteria 3042
1122 nmdc:mga0qj67_859_c1 3300050509 Bacteria 20877
1123 nmdc:mga0qj67_90403_c1 3300050509 Bacteria 2460
1124 nmdc:mga0qj67_96238_c1 3300050509 Bacteria 2384
1125 nmdc:mga06r32_135963_c1 3300050510 Bacteria 2432
1126 nmdc:mga06r32_1601_c1 3300050510 Bacteria 20404
1127 nmdc:mga06r32_20013_c1 3300050510 Bacteria 6153
1128 nmdc:mga06r32_22597_c1 3300050510 Bacteria 5816
1129 nmdc:mga06r32_406634_c1 3300050510 Bacteria 1343
1130 nmdc:mga06r32_564439_c1 3300050510 Unclassified 1111
1131 nmdc:mga06r32_57714_c1 3300050510 Bacteria 3729
1132 nmdc:mga06r32_8023_c1 3300050510 Bacteria 9495
1133 nmdc:mga06r32_84087_c1 3300050510 Bacteria 3101
1134 nmdc:mga06r32_87294_c1 3300050510 Bacteria 3044
1135 nmdc:mga08y16_11105_c1 3300050511 Bacteria 9458
1136 nmdc:mga08y16_211407_c1 3300050511 Bacteria 2009
1137 nmdc:mga08y16_290628_c1 3300050511 Unclassified 1685
1138 nmdc:mga08y16_31051_c1 3300050511 Bacteria 5619
1139 nmdc:mga08y16_33421_c1 3300050511 Bacteria 5402
1140 nmdc:mga08y16_55218_c1 3300050511 Bacteria 4151
1141 nmdc:mga08y16_7303_c1 3300050511 Bacteria 11595
1142 nmdc:mga08y16_7641_c1 3300050511 Bacteria 11313
1143 nmdc:mga0n895_125992_c1 3300050512 Bacteria 2585
1144 nmdc:mga0n895_195462_c1 3300050512 Bacteria 2054
1145 nmdc:mga0n895_2584_c1 3300050512 Bacteria 14215
1146 nmdc:mga0n895_3537_c1 3300050512 Bacteria 12632
1147 nmdc:mga0n895_41575_c1 3300050512 Bacteria 4470
1148 nmdc:mga0n895_589653_c1 3300050512 Unclassified 1115
1149 nmdc:mga0n895_637073_c1 3300050512 Bacteria 1066
1150 nmdc:mga0rr50_1087_c1 3300050513 Bacteria 14763
1151 nmdc:mga0rr50_116638_c1 3300050513 Bacteria 2120
1152 nmdc:mga0rr50_177562_c1 3300050513 Bacteria 1739
1153 nmdc:mga0rr50_486212_c1 3300050513 Unclassified 1049
1154 nmdc:mga08x19_22543_c1 3300050514 Bacteria 3900
1155 nmdc:mga08x19_29198_c1 3300050514 Bacteria 3458
1156 nmdc:mga0a205_108_c1 3300050515 Bacteria 47940
1157 nmdc:mga0a205_1492_c1 3300050515 Bacteria 19963
1158 nmdc:mga0a205_16737_c1 3300050515 Bacteria 6866
1159 nmdc:mga0a205_397110_c1 3300050515 Unclassified 1243
1160 nmdc:mga0a205_9612_c2 3300050515 Bacteria 7025
1161 nmdc:mga0sz30_27493_c1 3300050516 Bacteria 2337
1162 Ga0495601_0000010 3300053077 Bacteria 266222
1163 Ga0495601_0000958 3300053077 Bacteria 15765
1164 Ga0495601_0002291 3300053077 Bacteria 10796
1165 Ga0495601_0002987 3300053077 Bacteria 9630
1166 Ga0495601_0004285 3300053077 Bacteria 8240
1167 Ga0495601_0125081 3300053077 Bacteria 1672
1168 Ga0495601_0127933 3300053077 Bacteria 1653
1169 Ga0495612_0000002 3300053078 Bacteria 310466
1170 Ga0495612_0000276 3300053078 Bacteria 21133
1171 Ga0495612_0003620 3300053078 Bacteria 6406
1172 Ga0495612_0006758 3300053078 Bacteria 4698
1173 Ga0495612_0014054 3300053078 Bacteria 3223
1174 Ga0495612_0015295 3300053078 Bacteria 3076
1175 Ga0495655_0010583 3300053083 Bacteria 1825
1176 Ga0495595_0000596 3300053084 Bacteria 13772
1177 Ga0495595_0001532 3300053084 Bacteria 9013
1178 Ga0495595_0003189 3300053084 Bacteria 6502
1179 Ga0495595_0009479 3300053084 Bacteria 4029
1180 Ga0495595_0018002 3300053084 Bacteria 3047
1181 Ga0495619_0000002 3300053085 Bacteria 530226
1182 Ga0495619_0000108 3300053085 Bacteria 62197
1183 Ga0495619_0000681 3300053085 Bacteria 22230
1184 Ga0495619_0000763 3300053085 Bacteria 21009
1185 Ga0495619_0005840 3300053085 Bacteria 7799
1186 Ga0495619_0011867 3300053085 Bacteria 5489
1187 Ga0495619_0125536 3300053085 Bacteria 1761
1188 Ga0500643_013638 3300053087 Bacteria 2861
1189 Ga0500583_0029157 3300053092 Bacteria 2402
1190 Ga0500566_0065245 3300053094 Bacteria 2054
1191 Ga0500593_018155 3300053117 Bacteria 3063
1192 Ga0500595_000001 3300053119 Bacteria 1088438
1193 Ga0500595_015113 3300053119 Bacteria 2903
1194 Ga0500652_029920 3300053131 Bacteria 2127
1195 Ga0500616_0000001 3300053153 Bacteria 1986011
1196 Ga0500616_0108274 3300053153 Bacteria 1347
1197 Ga0500636_0084814 3300053177 Bacteria 1821
1198 Ga0500645_000165 3300053730 Bacteria 51801
1199 Ga0501084_0262452 3300054114 Bacteria 1458
1200 Ga0501082_0128696 3300060353 Bacteria 2197
1201 Ga0501082_0162101 3300060353 Bacteria 1943
1202 Ga0501082_0217372 3300060353 Bacteria 1663
1203 Ga0501082_0507886 3300060353 Bacteria 1054
1204 Ga0530510_0112859 3300061734 Bacteria 1991

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10003364 Ga0075370_100033648 251
2 3300050496 nmdc:mga07m45_111503_c1 nmdc:mga07m45_111503_c1_608_1483 251
3 3300006844 Ga0075428_100002517 Ga0075428_1000025178 262
4 3300006846 Ga0075430_100024166 Ga0075430_1000241663 262
5 3300006847 Ga0075431_100001498 Ga0075431_10000149811 262
6 3300009147 Ga0114129_10558448 Ga0114129_105584482 262
7 3300050510 nmdc:mga06r32_22597_c1 nmdc:mga06r32_22597_c1_238_1137 262
8 3300006038 Ga0075365_10125397 Ga0075365_101253972 263
9 3300006042 Ga0075368_10005383 Ga0075368_100053834 263
10 3300006042 Ga0075368_10024807 Ga0075368_100248072 263
11 3300006051 Ga0075364_10027100 Ga0075364_100271003 263
12 3300006353 Ga0075370_10029978 Ga0075370_100299784 263
13 3300006353 Ga0075370_10136984 Ga0075370_101369842 263
14 3300027866 Ga0209813_10016822 Ga0209813_100168222 263
15 3300031911 Ga0307412_10248251 Ga0307412_102482511 263
16 3300050491 nmdc:mga00v17_32310_c1 nmdc:mga00v17_32310_c1_1519_2388 263
17 3300050492 nmdc:mga0yw44_18648_c1 nmdc:mga0yw44_18648_c1_1241_2110 263
18 3300050494 nmdc:mga06z11_125173_c1 nmdc:mga06z11_125173_c1_122_991 263
19 3300050495 nmdc:mga04h51_13548_c1 nmdc:mga04h51_13548_c1_1297_2166 263
20 3300050516 nmdc:mga0sz30_27493_c1 nmdc:mga0sz30_27493_c1_195_1064 263
21 3300050490 nmdc:mga03n38_233718_c1 nmdc:mga03n38_233718_c1_75_944 264
22 3300006844 Ga0075428_100438982 Ga0075428_1004389822 265
23 3300046491 Ga0495584_0036372 Ga0495584_0036372_953_1834 265
24 3300046615 Ga0495656_0026771 Ga0495656_0026771_591_1472 265
25 3300050510 nmdc:mga06r32_406634_c1 nmdc:mga06r32_406634_c1_440_1324 265
26 3300006880 Ga0075429_100018152 Ga0075429_1000181525 266
27 3300046691 Ga0495670_0100562 Ga0495670_0100562_420_1301 266
28 3300048907 Ga0496104_0000609 Ga0496104_0000609_23272_24153 266
29 3300048908 Ga0496105_0004673 Ga0496105_0004673_4499_5380 266
30 3300048912 Ga0496109_0160352 Ga0496109_0160352_214_1095 266
31 3300048918 Ga0496115_0054588 Ga0496115_0054588_680_1561 266
32 3300005456 Ga0070678_100071899 Ga0070678_1000718991 267
33 3300005937 Ga0081455_10029855 Ga0081455_100298554 267
34 3300005981 Ga0081538_10040866 Ga0081538_100408662 267
35 3300005981 Ga0081538_10070963 Ga0081538_100709632 267
36 3300048905 Ga0496102_0344755 Ga0496102_0344755_168_1094 267
37 3300049578 Ga0501042_0139463 Ga0501042_0139463_572_1459 267
38 3300049591 Ga0501075_0166862 Ga0501075_0166862_742_1629 267
39 3300049742 Ga0501080_0199918 Ga0501080_0199918_557_1444 267
40 3300005983 Ga0081540_1000703 Ga0081540_10007032 268
41 3300006038 Ga0075365_10009291 Ga0075365_100092914 268
42 3300006844 Ga0075428_100211834 Ga0075428_1002118342 268
43 3300009147 Ga0114129_10443157 Ga0114129_104431572 268
44 3300049576 Ga0501040_0340746 Ga0501040_0340746_108_992 268
45 3300049577 Ga0501041_0252918 Ga0501041_0252918_15_899 268
46 3300049593 Ga0501077_0104723 Ga0501077_0104723_243_1127 268
47 3300049741 Ga0501079_0055748 Ga0501079_0055748_1271_2155 268
48 3300049743 Ga0501081_0262852 Ga0501081_0262852_13_897 268
49 3300050492 nmdc:mga0yw44_8031_c1 nmdc:mga0yw44_8031_c1_2872_3756 268
50 3300050507 nmdc:mga05p37_362245_c1 nmdc:mga05p37_362245_c1_477_1370 268
51 3300050508 nmdc:mga09592_81559_c1 nmdc:mga09592_81559_c1_502_1395 268
52 3300054114 Ga0501084_0262452 Ga0501084_0262452_290_1174 268
53 3300006844 Ga0075428_100146801 Ga0075428_1001468012 269
54 3300006880 Ga0075429_100034246 Ga0075429_1000342465 269
55 3300050508 nmdc:mga09592_30185_c1 nmdc:mga09592_30185_c1_3111_4001 269
56 3300050510 nmdc:mga06r32_564439_c1 nmdc:mga06r32_564439_c1_133_1023 269
57 3300006844 Ga0075428_100403846 Ga0075428_1004038462 270
58 3300006847 Ga0075431_100003463 Ga0075431_10000346314 270
59 3300047319 Ga0495674_0411959 Ga0495674_0411959_98_976 270
60 3300050508 nmdc:mga09592_16963_c1 nmdc:mga09592_16963_c1_3796_4686 270
61 3300050510 nmdc:mga06r32_1601_c1 nmdc:mga06r32_1601_c1_18043_18933 270
62 3300006844 Ga0075428_100064578 Ga0075428_1000645783 271
63 3300006847 Ga0075431_100191858 Ga0075431_1001918583 271
64 3300006880 Ga0075429_100240601 Ga0075429_1002406013 271
65 3300047471 Ga0495684_0435367 Ga0495684_0435367_13_840 271
66 3300049824 Ga0501045_0119765 Ga0501045_0119765_54_998 271
67 3300050507 nmdc:mga05p37_257695_c1 nmdc:mga05p37_257695_c1_884_1765 271
68 3300050508 nmdc:mga09592_41127_c1 nmdc:mga09592_41127_c1_985_1866 271
69 3300050509 nmdc:mga0qj67_96238_c1 nmdc:mga0qj67_96238_c1_588_1469 271
70 3300050510 nmdc:mga06r32_87294_c1 nmdc:mga06r32_87294_c1_588_1469 271
71 3300025928 Ga0207700_10149000 Ga0207700_101490002 272
72 3300005337 Ga0070682_100151701 Ga0070682_1001517012 273
73 3300005547 Ga0070693_100101423 Ga0070693_1001014232 273
74 3300050494 nmdc:mga06z11_86011_c1 nmdc:mga06z11_86011_c1_661_1596 273
75 3300053077 Ga0495601_0125081 Ga0495601_0125081_54_932 273
76 3300035113 Ga0373936_0010154 Ga0373936_0010154_1869_2741 275
77 3300035170 Ga0373943_0000467 Ga0373943_0000467_2805_3677 275
78 3300035171 Ga0373946_0000540 Ga0373946_0000540_8067_8939 275
79 3300035692 Ga0373935_0000403 Ga0373935_0000403_14986_15858 275
80 3300035695 Ga0373927_0006910 Ga0373927_0006910_4219_5091 275
81 3300035725 Ga0373947_0000986 Ga0373947_0000986_796_1668 275
82 3300046459 Ga0495629_0138852 Ga0495629_0138852_22_894 275
83 3300046472 Ga0495580_0061228 Ga0495580_0061228_1406_2278 275
84 3300046514 Ga0495618_0047633 Ga0495618_0047633_838_1710 275
85 3300046517 Ga0495630_0010078 Ga0495630_0010078_3983_4855 275
86 3300046533 Ga0495640_0063677 Ga0495640_0063677_1379_2251 275
87 3300046663 Ga0495635_0044905 Ga0495635_0044905_1450_2322 275
88 3300046683 Ga0495658_0242432 Ga0495658_0242432_222_1094 275
89 3300046690 Ga0495624_0001327 Ga0495624_0001327_3037_3909 275
90 3300047315 Ga0495581_0008425 Ga0495581_0008425_5053_5925 275
91 3300047471 Ga0495684_0001167 Ga0495684_0001167_10701_11573 275
92 3300047471 Ga0495684_0032750 Ga0495684_0032750_1590_2426 275
93 3300047673 Ga0495593_0056054 Ga0495593_0056054_1131_2003 275
94 3300009551 Ga0105238_10298302 Ga0105238_102983021 277
95 3300006846 Ga0075430_100087554 Ga0075430_1000875543 278
96 3300006847 Ga0075431_100040358 Ga0075431_1000403582 278
97 3300006880 Ga0075429_100071717 Ga0075429_1000717173 278
98 3300009147 Ga0114129_10317456 Ga0114129_103174562 278
99 3300046678 Ga0495599_0021069 Ga0495599_0021069_633_1496 278
100 3300050508 nmdc:mga09592_219912_c1 nmdc:mga09592_219912_c1_17_898 278
101 3300050509 nmdc:mga0qj67_59038_c1 nmdc:mga0qj67_59038_c1_1757_2638 278
102 3300025938 Ga0207704_10547754 Ga0207704_105477541 279
103 3300035083 Ga0373926_0018822 Ga0373926_0018822_1522_2361 279
104 3300048907 Ga0496104_0162567 Ga0496104_0162567_39_878 279
105 3300048907 Ga0496104_0194816 Ga0496104_0194816_1061_1900 279
106 3300048908 Ga0496105_0149860 Ga0496105_0149860_1040_1879 279
107 3300048911 Ga0496108_0134439 Ga0496108_0134439_1261_2100 279
108 3300048912 Ga0496109_0027049 Ga0496109_0027049_16_855 279
109 3300048913 Ga0496110_0704241 Ga0496110_0704241_34_873 279
110 3300048916 Ga0496113_0113104 Ga0496113_0113104_1238_2077 279
111 3300048916 Ga0496113_0121135 Ga0496113_0121135_1168_2007 279
112 3300031241 Ga0265325_10025489 Ga0265325_100254892 280
113 3300034817 Ga0373948_0000355 Ga0373948_0000355_26_868 280
114 3300042439 Ga0439464_0010154 Ga0439464_0010154_91_933 280
115 3300046675 Ga0495657_0300079 Ga0495657_0300079_83_928 280
116 3300046794 Ga0495589_0121915 Ga0495589_0121915_13_855 280
117 3300047470 Ga0495681_0064309 Ga0495681_0064309_826_1668 280
118 3300048912 Ga0496109_0012777 Ga0496109_0012777_5668_6570 280
119 3300048913 Ga0496110_0013969 Ga0496110_0013969_2769_3671 280
120 3300048914 Ga0496111_0007023 Ga0496111_0007023_3613_4515 280
121 3300048916 Ga0496113_0086396 Ga0496113_0086396_981_1883 280
122 3300048918 Ga0496115_0071024 Ga0496115_0071024_30_884 280
123 3300049569 Ga0501032_0158564 Ga0501032_0158564_19_885 280
124 3300031241 Ga0265325_10051836 Ga0265325_100518362 281
125 3300046526 Ga0495666_0057477 Ga0495666_0057477_1004_1849 281
126 3300026075 Ga0207708_10088090 Ga0207708_100880902 283
127 3300030521 Ga0307511_10000295 Ga0307511_1000029522 283
128 3300053092 Ga0500583_0029157 Ga0500583_0029157_754_1683 283
129 3300005985 Ga0081539_10079549 Ga0081539_100795491 284
130 3300009094 Ga0111539_10033922 Ga0111539_100339225 285
131 3300024225 Ga0224572_1000107 Ga0224572_10001074 285
132 3300025929 Ga0207664_10713075 Ga0207664_107130751 285
133 3300028800 Ga0265338_10049467 Ga0265338_100494672 285
134 3300030763 Ga0265763_1000456 Ga0265763_10004562 285
135 3300031241 Ga0265325_10012301 Ga0265325_100123015 285
136 3300031249 Ga0265339_10000060 Ga0265339_1000006018 285
137 3300031595 Ga0265313_10000094 Ga0265313_1000009414 285
138 3300031712 Ga0265342_10046308 Ga0265342_100463082 285
139 3300044694 Ga0466963_0080802 Ga0466963_0080802_715_1581 285
140 3300045836 Ga0466958_0027816 Ga0466958_0027816_2241_3107 285
141 3300050511 nmdc:mga08y16_31051_c1 nmdc:mga08y16_31051_c1_2932_3804 285
142 3300006175 Ga0070712_100077315 Ga0070712_1000773152 286
143 3300025915 Ga0207693_10007133 Ga0207693_100071337 286
144 3300031090 Ga0265760_10002189 Ga0265760_100021895 286
145 3300037068 Ga0373925_0048570 Ga0373925_0048570_2002_2871 286
146 3300046454 Ga0495592_0209421 Ga0495592_0209421_350_1228 286
147 3300046459 Ga0495629_0058049 Ga0495629_0058049_291_1169 286
148 3300046476 Ga0495662_0000120 Ga0495662_0000120_21470_22348 286
149 3300046477 Ga0495664_0005200 Ga0495664_0005200_2861_3739 286
150 3300046517 Ga0495630_0014768 Ga0495630_0014768_2944_3822 286
151 3300046529 Ga0495652_0242432 Ga0495652_0242432_399_1277 286
152 3300046531 Ga0495665_0017638 Ga0495665_0017638_1337_2215 286
153 3300046535 Ga0495586_0008910 Ga0495586_0008910_1303_2181 286
154 3300046642 Ga0495634_0018616 Ga0495634_0018616_1747_2625 286
155 3300046663 Ga0495635_0000228 Ga0495635_0000228_34526_35404 286
156 3300048903 Ga0496100_0270459 Ga0496100_0270459_247_1107 286
157 3300053077 Ga0495601_0002987 Ga0495601_0002987_4101_4979 286
158 3300053078 Ga0495612_0015295 Ga0495612_0015295_158_1036 286
159 3300053085 Ga0495619_0000681 Ga0495619_0000681_5443_6321 286
160 3300053119 Ga0500595_015113 Ga0500595_015113_464_1333 286
161 3300025912 Ga0207707_10104369 Ga0207707_101043691 287
162 3300025940 Ga0207691_10334355 Ga0207691_103343552 287
163 3300033179 Ga0307507_10018085 Ga0307507_100180856 287
164 3300053177 Ga0500636_0084814 Ga0500636_0084814_801_1691 287
165 3300009098 Ga0105245_10520135 Ga0105245_105201351 288
166 3300031238 Ga0265332_10001020 Ga0265332_100010206 288
167 3300031242 Ga0265329_10006800 Ga0265329_100068003 288
168 3300031249 Ga0265339_10002058 Ga0265339_1000205813 288
169 3300031711 Ga0265314_10027968 Ga0265314_100279682 288
170 3300031712 Ga0265342_10000908 Ga0265342_1000090812 288
171 3300042876 Ga0451577_0112202 Ga0451577_0112202_1334_2242 288
172 3300035695 Ga0373927_0075556 Ga0373927_0075556_421_1323 289
173 3300005471 Ga0070698_100373033 Ga0070698_1003730332 290
174 3300005937 Ga0081455_10009618 Ga0081455_100096186 290
175 3300006846 Ga0075430_100139316 Ga0075430_1001393163 290
176 3300006847 Ga0075431_100331567 Ga0075431_1003315671 290
177 3300006852 Ga0075433_10029020 Ga0075433_100290202 290
178 3300006880 Ga0075429_100110877 Ga0075429_1001108774 290
179 3300007788 Ga0099795_10001211 Ga0099795_100012113 290
180 3300009147 Ga0114129_10173981 Ga0114129_101739812 290
181 3300009147 Ga0114129_10981805 Ga0114129_109818051 290
182 3300031241 Ga0265325_10000015 Ga0265325_100000157 290
183 3300031595 Ga0265313_10042478 Ga0265313_100424782 290
184 3300035695 Ga0373927_0044692 Ga0373927_0044692_172_1089 290
185 3300046683 Ga0495658_0012528 Ga0495658_0012528_686_1603 290
186 3300048907 Ga0496104_0001997 Ga0496104_0001997_12661_13551 290
187 3300048907 Ga0496104_0003575 Ga0496104_0003575_2544_3425 290
188 3300048908 Ga0496105_0010845 Ga0496105_0010845_4566_5456 290
189 3300048908 Ga0496105_0023006 Ga0496105_0023006_2037_2918 290
190 3300048909 Ga0496106_0063613 Ga0496106_0063613_829_1710 290
191 3300048916 Ga0496113_0080563 Ga0496113_0080563_621_1502 290
192 3300048918 Ga0496115_0048840 Ga0496115_0048840_2014_2904 290
193 3300049568 Ga0501031_0185364 Ga0501031_0185364_26_955 290
194 3300049575 Ga0501039_0217451 Ga0501039_0217451_69_998 290
195 3300049577 Ga0501041_0079101 Ga0501041_0079101_576_1466 290
196 3300049580 Ga0501046_0246555 Ga0501046_0246555_276_1205 290
197 3300049587 Ga0501071_0136761 Ga0501071_0136761_624_1553 290
198 3300049588 Ga0501072_0121802 Ga0501072_0121802_745_1674 290
199 3300049591 Ga0501075_0020522 Ga0501075_0020522_1459_2349 290
200 3300049593 Ga0501077_0028247 Ga0501077_0028247_261_1151 290
201 3300049741 Ga0501079_0054514 Ga0501079_0054514_135_1064 290
202 3300049743 Ga0501081_0009896 Ga0501081_0009896_1958_2848 290
203 3300049743 Ga0501081_0189936 Ga0501081_0189936_50_979 290
204 3300049824 Ga0501045_0186746 Ga0501045_0186746_581_1471 290
205 3300050508 nmdc:mga09592_157633_c1 nmdc:mga09592_157633_c1_993_1874 290
206 3300050509 nmdc:mga0qj67_90403_c1 nmdc:mga0qj67_90403_c1_588_1469 290
207 3300050510 nmdc:mga06r32_8023_c1 nmdc:mga06r32_8023_c1_2521_3402 290
208 3300060353 Ga0501082_0128696 Ga0501082_0128696_116_1045 290
209 3300060353 Ga0501082_0162101 Ga0501082_0162101_473_1363 290
210 3300061734 Ga0530510_0112859 Ga0530510_0112859_975_1904 290
211 3300002244 JGI24742J22300_10004778 JGI24742J22300_100047782 291
212 3300002459 JGI24751J29686_10023645 JGI24751J29686_100236451 291
213 3300005328 Ga0070676_10205898 Ga0070676_102058981 291
214 3300005329 Ga0070683_100258412 Ga0070683_1002584122 291
215 3300005331 Ga0070670_100005523 Ga0070670_1000055236 291
216 3300005334 Ga0068869_100057061 Ga0068869_1000570613 291
217 3300005337 Ga0070682_100320423 Ga0070682_1003204232 291
218 3300005338 Ga0068868_100012588 Ga0068868_1000125883 291
219 3300005340 Ga0070689_100122081 Ga0070689_1001220811 291
220 3300005343 Ga0070687_100091140 Ga0070687_1000911402 291
221 3300005347 Ga0070668_100224592 Ga0070668_1002245922 291
222 3300005353 Ga0070669_100072198 Ga0070669_1000721981 291
223 3300005354 Ga0070675_100002553 Ga0070675_1000025537 291
224 3300005356 Ga0070674_100090875 Ga0070674_1000908752 291
225 3300005365 Ga0070688_100031492 Ga0070688_1000314922 291
226 3300005365 Ga0070688_100038650 Ga0070688_1000386502 291
227 3300005367 Ga0070667_100024417 Ga0070667_1000244172 291
228 3300005406 Ga0070703_10017256 Ga0070703_100172562 291
229 3300005434 Ga0070709_10000690 Ga0070709_1000069019 291
230 3300005435 Ga0070714_100062728 Ga0070714_1000627283 291
231 3300005435 Ga0070714_100085990 Ga0070714_1000859901 291
232 3300005436 Ga0070713_100001316 Ga0070713_10000131615 291
233 3300005436 Ga0070713_100128314 Ga0070713_1001283142 291
234 3300005436 Ga0070713_100144530 Ga0070713_1001445302 291
235 3300005436 Ga0070713_100158666 Ga0070713_1001586662 291
236 3300005436 Ga0070713_100312393 Ga0070713_1003123932 291
237 3300005437 Ga0070710_10028306 Ga0070710_100283061 291
238 3300005437 Ga0070710_10055133 Ga0070710_100551332 291
239 3300005439 Ga0070711_100050532 Ga0070711_1000505321 291
240 3300005439 Ga0070711_100182385 Ga0070711_1001823852 291
241 3300005440 Ga0070705_100179574 Ga0070705_1001795742 291
242 3300005455 Ga0070663_100021688 Ga0070663_1000216883 291
243 3300005455 Ga0070663_100063026 Ga0070663_1000630262 291
244 3300005466 Ga0070685_10032054 Ga0070685_100320543 291
245 3300005471 Ga0070698_100422402 Ga0070698_1004224022 291
246 3300005518 Ga0070699_100301497 Ga0070699_1003014972 291
247 3300005535 Ga0070684_100035598 Ga0070684_1000355984 291
248 3300005535 Ga0070684_100222636 Ga0070684_1002226362 291
249 3300005535 Ga0070684_100234597 Ga0070684_1002345972 291
250 3300005543 Ga0070672_100026310 Ga0070672_1000263102 291
251 3300005543 Ga0070672_100211392 Ga0070672_1002113922 291
252 3300005544 Ga0070686_100003547 Ga0070686_1000035474 291
253 3300005548 Ga0070665_100295783 Ga0070665_1002957832 291
254 3300005564 Ga0070664_100133235 Ga0070664_1001332352 291
255 3300005577 Ga0068857_100204175 Ga0068857_1002041752 291
256 3300005614 Ga0068856_100289978 Ga0068856_1002899782 291
257 3300005615 Ga0070702_100092063 Ga0070702_1000920632 291
258 3300005616 Ga0068852_100014205 Ga0068852_1000142056 291
259 3300005617 Ga0068859_100040069 Ga0068859_1000400692 291
260 3300005618 Ga0068864_100048379 Ga0068864_1000483793 291
261 3300005718 Ga0068866_10009118 Ga0068866_100091185 291
262 3300005719 Ga0068861_100253255 Ga0068861_1002532552 291
263 3300005841 Ga0068863_100015046 Ga0068863_1000150466 291
264 3300005841 Ga0068863_100248029 Ga0068863_1002480292 291
265 3300005842 Ga0068858_100076704 Ga0068858_1000767042 291
266 3300005842 Ga0068858_100400164 Ga0068858_1004001642 291
267 3300005843 Ga0068860_100229161 Ga0068860_1002291611 291
268 3300005844 Ga0068862_100610220 Ga0068862_1006102201 291
269 3300005937 Ga0081455_10000022 Ga0081455_100000229 291
270 3300005937 Ga0081455_10006137 Ga0081455_100061372 291
271 3300005981 Ga0081538_10006666 Ga0081538_100066664 291
272 3300006028 Ga0070717_10009632 Ga0070717_100096325 291
273 3300006028 Ga0070717_10036947 Ga0070717_100369472 291
274 3300006038 Ga0075365_10021110 Ga0075365_100211103 291
275 3300006042 Ga0075368_10039930 Ga0075368_100399301 291
276 3300006048 Ga0075363_100016781 Ga0075363_1000167814 291
277 3300006048 Ga0075363_100042104 Ga0075363_1000421042 291
278 3300006051 Ga0075364_10090887 Ga0075364_100908872 291
279 3300006173 Ga0070716_100065757 Ga0070716_1000657572 291
280 3300006173 Ga0070716_100253187 Ga0070716_1002531872 291
281 3300006175 Ga0070712_100004676 Ga0070712_1000046766 291
282 3300006175 Ga0070712_100158994 Ga0070712_1001589941 291
283 3300006175 Ga0070712_100201221 Ga0070712_1002012212 291
284 3300006175 Ga0070712_100354424 Ga0070712_1003544242 291
285 3300006177 Ga0075362_10057046 Ga0075362_100570462 291
286 3300006178 Ga0075367_10001913 Ga0075367_100019134 291
287 3300006178 Ga0075367_10009093 Ga0075367_100090934 291
288 3300006178 Ga0075367_10034279 Ga0075367_100342793 291
289 3300006178 Ga0075367_10199164 Ga0075367_101991642 291
290 3300006237 Ga0097621_100007724 Ga0097621_1000077245 291
291 3300006844 Ga0075428_100049454 Ga0075428_1000494543 291
292 3300006844 Ga0075428_100056626 Ga0075428_1000566262 291
293 3300006844 Ga0075428_100078608 Ga0075428_1000786083 291
294 3300006844 Ga0075428_100112577 Ga0075428_1001125772 291
295 3300006847 Ga0075431_100226672 Ga0075431_1002266722 291
296 3300006847 Ga0075431_100300175 Ga0075431_1003001752 291
297 3300006852 Ga0075433_10014595 Ga0075433_100145952 291
298 3300006852 Ga0075433_10197244 Ga0075433_101972442 291
299 3300006871 Ga0075434_100005388 Ga0075434_1000053886 291
300 3300006871 Ga0075434_100036505 Ga0075434_1000365053 291
301 3300006871 Ga0075434_100076946 Ga0075434_1000769462 291
302 3300006871 Ga0075434_100216129 Ga0075434_1002161292 291
303 3300006871 Ga0075434_100224593 Ga0075434_1002245932 291
304 3300006871 Ga0075434_100283038 Ga0075434_1002830382 291
305 3300006880 Ga0075429_100151452 Ga0075429_1001514522 291
306 3300006881 Ga0068865_100076123 Ga0068865_1000761232 291
307 3300006914 Ga0075436_100044259 Ga0075436_1000442592 291
308 3300006914 Ga0075436_100111240 Ga0075436_1001112402 291
309 3300006931 Ga0097620_100040078 Ga0097620_1000400782 291
310 3300007076 Ga0075435_100055469 Ga0075435_1000554693 291
311 3300007076 Ga0075435_100069480 Ga0075435_1000694802 291
312 3300007076 Ga0075435_100153209 Ga0075435_1001532092 291
313 3300007076 Ga0075435_100188926 Ga0075435_1001889262 291
314 3300007265 Ga0099794_10050582 Ga0099794_100505823 291
315 3300009094 Ga0111539_10012080 Ga0111539_100120802 291
316 3300009094 Ga0111539_10029045 Ga0111539_100290453 291
317 3300009094 Ga0111539_10102599 Ga0111539_101025994 291
318 3300009094 Ga0111539_10191928 Ga0111539_101919283 291
319 3300009098 Ga0105245_10104051 Ga0105245_101040514 291
320 3300009147 Ga0114129_10019114 Ga0114129_100191143 291
321 3300009147 Ga0114129_10138186 Ga0114129_101381863 291
322 3300009147 Ga0114129_10196114 Ga0114129_101961142 291
323 3300009174 Ga0105241_10049246 Ga0105241_100492463 291
324 3300009176 Ga0105242_10521525 Ga0105242_105215251 291
325 3300009177 Ga0105248_10119676 Ga0105248_101196763 291
326 3300009177 Ga0105248_10494882 Ga0105248_104948821 291
327 3300009545 Ga0105237_10420909 Ga0105237_104209092 291
328 3300009545 Ga0105237_10470752 Ga0105237_104707522 291
329 3300009553 Ga0105249_10511409 Ga0105249_105114092 291
330 3300011119 Ga0105246_10047614 Ga0105246_100476142 291
331 3300011119 Ga0105246_10105167 Ga0105246_101051672 291
332 3300013297 Ga0157378_10281096 Ga0157378_102810962 291
333 3300013306 Ga0163162_10270031 Ga0163162_102700312 291
334 3300014325 Ga0163163_10034353 Ga0163163_100343535 291
335 3300014325 Ga0163163_10455839 Ga0163163_104558392 291
336 3300014325 Ga0163163_10465553 Ga0163163_104655532 291
337 3300014745 Ga0157377_10027186 Ga0157377_100271863 291
338 3300014745 Ga0157377_10159819 Ga0157377_101598191 291
339 3300014968 Ga0157379_10321134 Ga0157379_103211342 291
340 3300014969 Ga0157376_10044877 Ga0157376_100448772 291
341 3300017792 Ga0163161_10033052 Ga0163161_100330523 291
342 3300025885 Ga0207653_10028793 Ga0207653_100287931 291
343 3300025898 Ga0207692_10005544 Ga0207692_100055443 291
344 3300025898 Ga0207692_10054588 Ga0207692_100545882 291
345 3300025899 Ga0207642_10005629 Ga0207642_100056293 291
346 3300025899 Ga0207642_10055635 Ga0207642_100556352 291
347 3300025900 Ga0207710_10014427 Ga0207710_100144272 291
348 3300025900 Ga0207710_10025874 Ga0207710_100258743 291
349 3300025901 Ga0207688_10005223 Ga0207688_100052233 291
350 3300025903 Ga0207680_10072079 Ga0207680_100720792 291
351 3300025904 Ga0207647_10082462 Ga0207647_100824621 291
352 3300025905 Ga0207685_10074105 Ga0207685_100741052 291
353 3300025906 Ga0207699_10016678 Ga0207699_100166783 291
354 3300025907 Ga0207645_10011370 Ga0207645_100113706 291
355 3300025911 Ga0207654_10049690 Ga0207654_100496903 291
356 3300025911 Ga0207654_10054948 Ga0207654_100549482 291
357 3300025914 Ga0207671_10320971 Ga0207671_103209712 291
358 3300025915 Ga0207693_10008588 Ga0207693_100085884 291
359 3300025915 Ga0207693_10049759 Ga0207693_100497592 291
360 3300025915 Ga0207693_10121868 Ga0207693_101218682 291
361 3300025915 Ga0207693_10248582 Ga0207693_102485822 291
362 3300025916 Ga0207663_10145223 Ga0207663_101452231 291
363 3300025916 Ga0207663_10165234 Ga0207663_101652342 291
364 3300025919 Ga0207657_10022500 Ga0207657_100225006 291
365 3300025920 Ga0207649_10073921 Ga0207649_100739212 291
366 3300025923 Ga0207681_10054375 Ga0207681_100543751 291
367 3300025925 Ga0207650_10005799 Ga0207650_100057995 291
368 3300025926 Ga0207659_10089491 Ga0207659_100894913 291
369 3300025927 Ga0207687_10082787 Ga0207687_100827873 291
370 3300025928 Ga0207700_10010428 Ga0207700_100104285 291
371 3300025928 Ga0207700_10227714 Ga0207700_102277142 291
372 3300025929 Ga0207664_10134516 Ga0207664_101345163 291
373 3300025931 Ga0207644_10001432 Ga0207644_1000143213 291
374 3300025931 Ga0207644_10315203 Ga0207644_103152032 291
375 3300025933 Ga0207706_10007580 Ga0207706_100075807 291
376 3300025935 Ga0207709_10037801 Ga0207709_100378012 291
377 3300025935 Ga0207709_10189211 Ga0207709_101892112 291
378 3300025936 Ga0207670_10105999 Ga0207670_101059992 291
379 3300025939 Ga0207665_10000666 Ga0207665_1000066614 291
380 3300025939 Ga0207665_10002138 Ga0207665_1000213813 291
381 3300025939 Ga0207665_10050922 Ga0207665_100509222 291
382 3300025939 Ga0207665_10221352 Ga0207665_102213522 291
383 3300025940 Ga0207691_10002482 Ga0207691_1000248211 291
384 3300025941 Ga0207711_10023185 Ga0207711_100231852 291
385 3300025942 Ga0207689_10021381 Ga0207689_100213814 291
386 3300025944 Ga0207661_10055463 Ga0207661_100554633 291
387 3300025945 Ga0207679_10145552 Ga0207679_101455522 291
388 3300025945 Ga0207679_10172740 Ga0207679_101727402 291
389 3300025960 Ga0207651_10122017 Ga0207651_101220172 291
390 3300025961 Ga0207712_10217877 Ga0207712_102178772 291
391 3300025986 Ga0207658_10034085 Ga0207658_100340853 291
392 3300026035 Ga0207703_10099525 Ga0207703_100995252 291
393 3300026067 Ga0207678_10005074 Ga0207678_100050743 291
394 3300026078 Ga0207702_10038792 Ga0207702_100387925 291
395 3300026089 Ga0207648_10002406 Ga0207648_100024064 291
396 3300026095 Ga0207676_10048456 Ga0207676_100484564 291
397 3300026118 Ga0207675_100014751 Ga0207675_1000147516 291
398 3300026121 Ga0207683_10180352 Ga0207683_101803522 291
399 3300027866 Ga0209813_10001159 Ga0209813_100011594 291
400 3300027907 Ga0207428_10071087 Ga0207428_100710872 291
401 3300027907 Ga0207428_10110835 Ga0207428_101108353 291
402 3300028379 Ga0268266_10017979 Ga0268266_100179797 291
403 3300028379 Ga0268266_10072670 Ga0268266_100726702 291
404 3300028381 Ga0268264_10035284 Ga0268264_100352844 291
405 3300031711 Ga0265314_10014199 Ga0265314_100141993 291
406 3300034819 Ga0373958_0014054 Ga0373958_0014054_70_963 291
407 3300034820 Ga0373959_0006952 Ga0373959_0006952_241_1134 291
408 3300035083 Ga0373926_0031992 Ga0373926_0031992_918_1802 291
409 3300035084 Ga0373928_0016550 Ga0373928_0016550_534_1424 291
410 3300035086 Ga0373934_0057740 Ga0373934_0057740_247_1143 291
411 3300035089 Ga0373944_0040499 Ga0373944_0040499_284_1168 291
412 3300035090 Ga0373949_0053306 Ga0373949_0053306_52_945 291
413 3300035092 Ga0373952_0013630 Ga0373952_0013630_240_1130 291
414 3300035111 Ga0373923_0002721 Ga0373923_0002721_1748_2644 291
415 3300035112 Ga0373932_0002996 Ga0373932_0002996_548_1438 291
416 3300035113 Ga0373936_0003042 Ga0373936_0003042_4427_5323 291
417 3300035113 Ga0373936_0004123 Ga0373936_0004123_3670_4584 291
418 3300035113 Ga0373936_0039256 Ga0373936_0039256_108_992 291
419 3300035116 Ga0373945_0010915 Ga0373945_0010915_163_1047 291
420 3300035117 Ga0373953_0019450 Ga0373953_0019450_1368_2282 291
421 3300035118 Ga0373954_0001425 Ga0373954_0001425_1166_2080 291
422 3300035119 Ga0373956_0032517 Ga0373956_0032517_216_1130 291
423 3300035170 Ga0373943_0014454 Ga0373943_0014454_995_1885 291
424 3300035170 Ga0373943_0043040 Ga0373943_0043040_64_948 291
425 3300035171 Ga0373946_0001451 Ga0373946_0001451_3010_3924 291
426 3300035171 Ga0373946_0001719 Ga0373946_0001719_2869_3765 291
427 3300035171 Ga0373946_0012321 Ga0373946_0012321_1074_1958 291
428 3300035172 Ga0373955_0000039 Ga0373955_0000039_45231_46145 291
429 3300035241 Ga0373961_0028250 Ga0373961_0028250_575_1465 291
430 3300035241 Ga0373961_0044321 Ga0373961_0044321_330_1223 291
431 3300035410 Ga0373924_0001219 Ga0373924_0001219_2883_3797 291
432 3300035691 Ga0373931_0043551 Ga0373931_0043551_388_1278 291
433 3300035691 Ga0373931_0126874 Ga0373931_0126874_184_1077 291
434 3300035692 Ga0373935_0000079 Ga0373935_0000079_4786_5700 291
435 3300035692 Ga0373935_0064931 Ga0373935_0064931_700_1584 291
436 3300035692 Ga0373935_0100909 Ga0373935_0100909_733_1617 291
437 3300035695 Ga0373927_0003959 Ga0373927_0003959_3733_4647 291
438 3300035695 Ga0373927_0033684 Ga0373927_0033684_817_1713 291
439 3300035695 Ga0373927_0224298 Ga0373927_0224298_26_910 291
440 3300035724 Ga0373933_0004774 Ga0373933_0004774_5816_6730 291
441 3300035725 Ga0373947_0025796 Ga0373947_0025796_1164_2078 291
442 3300035725 Ga0373947_0129533 Ga0373947_0129533_173_1057 291
443 3300035725 Ga0373947_0137702 Ga0373947_0137702_605_1501 291
444 3300036401 Ga0373937_0000223 Ga0373937_0000223_38761_39675 291
445 3300036401 Ga0373937_0064259 Ga0373937_0064259_165_1091 291
446 3300036401 Ga0373937_0097181 Ga0373937_0097181_1395_2291 291
447 3300037068 Ga0373925_0000741 Ga0373925_0000741_28584_29498 291
448 3300037068 Ga0373925_0047234 Ga0373925_0047234_233_1117 291
449 3300037068 Ga0373925_0047453 Ga0373925_0047453_1795_2691 291
450 3300037068 Ga0373925_0089106 Ga0373925_0089106_113_1009 291
451 3300037068 Ga0373925_0121249 Ga0373925_0121249_834_1724 291
452 3300037068 Ga0373925_0390636 Ga0373925_0390636_209_1093 291
453 3300037418 Ga0395900_0282267 Ga0395900_0282267_61_990 291
454 3300037466 Ga0395898_0113234 Ga0395898_0113234_743_1672 291
455 3300039450 Ga0436363_1239658 Ga0436363_1239658_446_1330 291
456 3300045051 Ga0451576_0521311 Ga0451576_0521311_288_1178 291
457 3300046454 Ga0495592_0000188 Ga0495592_0000188_47207_48121 291
458 3300046455 Ga0495603_0005805 Ga0495603_0005805_4304_5194 291
459 3300046459 Ga0495629_0011719 Ga0495629_0011719_4283_5197 291
460 3300046459 Ga0495629_0119928 Ga0495629_0119928_120_1016 291
461 3300046460 Ga0495638_0040776 Ga0495638_0040776_196_1074 291
462 3300046461 Ga0495641_0114206 Ga0495641_0114206_173_1057 291
463 3300046462 Ga0495651_0001797 Ga0495651_0001797_3994_4890 291
464 3300046462 Ga0495651_0002458 Ga0495651_0002458_2510_3424 291
465 3300046463 Ga0495653_0000198 Ga0495653_0000198_6030_6944 291
466 3300046463 Ga0495653_0004136 Ga0495653_0004136_8893_9789 291
467 3300046472 Ga0495580_0040833 Ga0495580_0040833_1513_2397 291
468 3300046472 Ga0495580_0119187 Ga0495580_0119187_817_1713 291
469 3300046473 Ga0495582_0005522 Ga0495582_0005522_5690_6580 291
470 3300046473 Ga0495582_0016019 Ga0495582_0016019_3121_4005 291
471 3300046475 Ga0495639_0006740 Ga0495639_0006740_2688_3584 291
472 3300046475 Ga0495639_0008343 Ga0495639_0008343_2283_3167 291
473 3300046476 Ga0495662_0014500 Ga0495662_0014500_2105_3019 291
474 3300046476 Ga0495662_0020161 Ga0495662_0020161_113_1009 291
475 3300046476 Ga0495662_0054445 Ga0495662_0054445_839_1723 291
476 3300046477 Ga0495664_0000002 Ga0495664_0000002_404954_405868 291
477 3300046477 Ga0495664_0013009 Ga0495664_0013009_953_1849 291
478 3300046491 Ga0495584_0031479 Ga0495584_0031479_681_1565 291
479 3300046491 Ga0495584_0101692 Ga0495584_0101692_279_1172 291
480 3300046491 Ga0495584_0113005 Ga0495584_0113005_249_1139 291
481 3300046492 Ga0495585_0000974 Ga0495585_0000974_18574_19470 291
482 3300046492 Ga0495585_0003315 Ga0495585_0003315_9911_10795 291
483 3300046499 Ga0495594_0012849 Ga0495594_0012849_1612_2508 291
484 3300046499 Ga0495594_0110720 Ga0495594_0110720_347_1231 291
485 3300046501 Ga0495607_0011320 Ga0495607_0011320_1424_2320 291
486 3300046501 Ga0495607_0053322 Ga0495607_0053322_608_1492 291
487 3300046506 Ga0495583_0110669 Ga0495583_0110669_47_937 291
488 3300046511 Ga0495608_0000009 Ga0495608_0000009_74567_75481 291
489 3300046511 Ga0495608_0014611 Ga0495608_0014611_3178_4074 291
490 3300046514 Ga0495618_0000005 Ga0495618_0000005_182313_183227 291
491 3300046514 Ga0495618_0045534 Ga0495618_0045534_687_1571 291
492 3300046514 Ga0495618_0050474 Ga0495618_0050474_1127_2023 291
493 3300046515 Ga0495620_0072358 Ga0495620_0072358_314_1198 291
494 3300046516 Ga0495628_0000002 Ga0495628_0000002_369339_370253 291
495 3300046516 Ga0495628_0018942 Ga0495628_0018942_4623_5519 291
496 3300046517 Ga0495630_0000614 Ga0495630_0000614_23707_24621 291
497 3300046517 Ga0495630_0029099 Ga0495630_0029099_1984_2880 291
498 3300046517 Ga0495630_0198099 Ga0495630_0198099_240_1124 291
499 3300046518 Ga0495631_0039801 Ga0495631_0039801_390_1286 291
500 3300046520 Ga0495637_0028471 Ga0495637_0028471_861_1757 291
501 3300046523 Ga0495644_0002940 Ga0495644_0002940_231_1127 291
502 3300046526 Ga0495666_0004626 Ga0495666_0004626_3192_4088 291
503 3300046529 Ga0495652_0000004 Ga0495652_0000004_218630_219544 291
504 3300046531 Ga0495665_0010156 Ga0495665_0010156_15_911 291
505 3300046533 Ga0495640_0000005 Ga0495640_0000005_74582_75496 291
506 3300046535 Ga0495586_0019766 Ga0495586_0019766_2050_2964 291
507 3300046536 Ga0495587_0000007 Ga0495587_0000007_242746_243660 291
508 3300046537 Ga0495598_0000679 Ga0495598_0000679_2006_2890 291
509 3300046537 Ga0495598_0002660 Ga0495598_0002660_980_1876 291
510 3300046539 Ga0495621_0010608 Ga0495621_0010608_1332_2216 291
511 3300046543 Ga0495645_0000003 Ga0495645_0000003_350590_351504 291
512 3300046543 Ga0495645_0140918 Ga0495645_0140918_675_1571 291
513 3300046557 Ga0495622_0060015 Ga0495622_0060015_778_1662 291
514 3300046557 Ga0495622_0083307 Ga0495622_0083307_166_1062 291
515 3300046558 Ga0495633_0002331 Ga0495633_0002331_62_958 291
516 3300046558 Ga0495633_0034464 Ga0495633_0034464_1238_2122 291
517 3300046559 Ga0495667_0000002 Ga0495667_0000002_67470_68384 291
518 3300046559 Ga0495667_0009295 Ga0495667_0009295_2476_3372 291
519 3300046615 Ga0495656_0000276 Ga0495656_0000276_7773_8669 291
520 3300046642 Ga0495634_0000129 Ga0495634_0000129_35606_36520 291
521 3300046648 Ga0495611_0007172 Ga0495611_0007172_1297_2193 291
522 3300046663 Ga0495635_0000020 Ga0495635_0000020_178712_179626 291
523 3300046664 Ga0495659_0005354 Ga0495659_0005354_1175_2071 291
524 3300046664 Ga0495659_0008097 Ga0495659_0008097_1627_2511 291
525 3300046674 Ga0495588_0075174 Ga0495588_0075174_141_1037 291
526 3300046678 Ga0495599_0000001 Ga0495599_0000001_508017_508931 291
527 3300046679 Ga0495623_0000001 Ga0495623_0000001_276962_277876 291
528 3300046680 Ga0495646_0000013 Ga0495646_0000013_127595_128509 291
529 3300046680 Ga0495646_0024897 Ga0495646_0024897_2218_3114 291
530 3300046681 Ga0495647_0009865 Ga0495647_0009865_1220_2116 291
531 3300046681 Ga0495647_0019448 Ga0495647_0019448_1430_2314 291
532 3300046683 Ga0495658_0046832 Ga0495658_0046832_693_1577 291
533 3300046683 Ga0495658_0084318 Ga0495658_0084318_921_1805 291
534 3300046683 Ga0495658_0229383 Ga0495658_0229383_195_1091 291
535 3300046684 Ga0495669_0034594 Ga0495669_0034594_948_1832 291
536 3300046689 Ga0495613_0054998 Ga0495613_0054998_1901_2797 291
537 3300046690 Ga0495624_0006348 Ga0495624_0006348_3287_4183 291
538 3300046690 Ga0495624_0021998 Ga0495624_0021998_2794_3708 291
539 3300046690 Ga0495624_0073506 Ga0495624_0073506_364_1248 291
540 3300046691 Ga0495670_0006527 Ga0495670_0006527_3087_3983 291
541 3300046691 Ga0495670_0114477 Ga0495670_0114477_479_1363 291
542 3300046691 Ga0495670_0152763 Ga0495670_0152763_309_1193 291
543 3300046694 Ga0495649_0201721 Ga0495649_0201721_59_943 291
544 3300046809 Ga0495600_0000233 Ga0495600_0000233_1244_2158 291
545 3300046809 Ga0495600_0004973 Ga0495600_0004973_6754_7650 291
546 3300047315 Ga0495581_0015024 Ga0495581_0015024_2440_3354 291
547 3300047315 Ga0495581_0040690 Ga0495581_0040690_1355_2251 291
548 3300047315 Ga0495581_0094432 Ga0495581_0094432_104_988 291
549 3300047317 Ga0495604_0000005 Ga0495604_0000005_394983_395897 291
550 3300047319 Ga0495674_0000003 Ga0495674_0000003_191873_192787 291
551 3300047319 Ga0495674_0238580 Ga0495674_0238580_371_1255 291
552 3300047319 Ga0495674_0319355 Ga0495674_0319355_257_1153 291
553 3300047321 Ga0495676_0041475 Ga0495676_0041475_878_1762 291
554 3300047321 Ga0495676_0114581 Ga0495676_0114581_192_1076 291
555 3300047322 Ga0495680_0000002 Ga0495680_0000002_172406_173320 291
556 3300047322 Ga0495680_0004358 Ga0495680_0004358_6874_7770 291
557 3300047322 Ga0495680_0030097 Ga0495680_0030097_2063_2953 291
558 3300047444 Ga0495675_0000437 Ga0495675_0000437_25802_26716 291
559 3300047446 Ga0495679_026104 Ga0495679_026104_231_1127 291
560 3300047471 Ga0495684_0000020 Ga0495684_0000020_119008_119922 291
561 3300047471 Ga0495684_0089052 Ga0495684_0089052_948_1832 291
562 3300047673 Ga0495593_0002594 Ga0495593_0002594_5222_6136 291
563 3300047673 Ga0495593_0008133 Ga0495593_0008133_2063_2959 291
564 3300048088 Ga0495602_0000027 Ga0495602_0000027_96899_97813 291
565 3300048903 Ga0496100_0025275 Ga0496100_0025275_1814_2704 291
566 3300048903 Ga0496100_0035456 Ga0496100_0035456_1922_2806 291
567 3300048903 Ga0496100_0103199 Ga0496100_0103199_151_1041 291
568 3300048903 Ga0496100_0176299 Ga0496100_0176299_645_1529 291
569 3300048904 Ga0496101_0006701 Ga0496101_0006701_3834_4724 291
570 3300048904 Ga0496101_0010732 Ga0496101_0010732_4563_5447 291
571 3300048904 Ga0496101_0232010 Ga0496101_0232010_484_1368 291
572 3300048904 Ga0496101_0284729 Ga0496101_0284729_273_1163 291
573 3300048904 Ga0496101_0391742 Ga0496101_0391742_150_1034 291
574 3300048905 Ga0496102_0045796 Ga0496102_0045796_2511_3395 291
575 3300048905 Ga0496102_0055352 Ga0496102_0055352_2087_2971 291
576 3300048905 Ga0496102_0066802 Ga0496102_0066802_1168_2058 291
577 3300048905 Ga0496102_0143158 Ga0496102_0143158_185_1075 291
578 3300048905 Ga0496102_0199994 Ga0496102_0199994_889_1779 291
579 3300048906 Ga0496103_0007283 Ga0496103_0007283_4527_5411 291
580 3300048906 Ga0496103_0009462 Ga0496103_0009462_2870_3754 291
581 3300048906 Ga0496103_0012313 Ga0496103_0012313_2274_3164 291
582 3300048906 Ga0496103_0094719 Ga0496103_0094719_69_959 291
583 3300048906 Ga0496103_0137881 Ga0496103_0137881_444_1334 291
584 3300048907 Ga0496104_0000521 Ga0496104_0000521_6319_7212 291
585 3300048907 Ga0496104_0001668 Ga0496104_0001668_15698_16582 291
586 3300048907 Ga0496104_0040303 Ga0496104_0040303_1498_2388 291
587 3300048907 Ga0496104_0272366 Ga0496104_0272366_423_1307 291
588 3300048907 Ga0496104_0320685 Ga0496104_0320685_456_1340 291
589 3300048908 Ga0496105_0000522 Ga0496105_0000522_488_1372 291
590 3300048908 Ga0496105_0006301 Ga0496105_0006301_4471_5361 291
591 3300048908 Ga0496105_0044524 Ga0496105_0044524_1628_2518 291
592 3300048908 Ga0496105_0059404 Ga0496105_0059404_237_1130 291
593 3300048908 Ga0496105_0208985 Ga0496105_0208985_434_1324 291
594 3300048909 Ga0496106_0016847 Ga0496106_0016847_1012_1902 291
595 3300048909 Ga0496106_0047971 Ga0496106_0047971_1738_2622 291
596 3300048909 Ga0496106_0080493 Ga0496106_0080493_922_1806 291
597 3300048910 Ga0496107_0011126 Ga0496107_0011126_1408_2298 291
598 3300048910 Ga0496107_0021420 Ga0496107_0021420_135_1019 291
599 3300048911 Ga0496108_0000510 Ga0496108_0000510_7188_8072 291
600 3300048911 Ga0496108_0004887 Ga0496108_0004887_3748_4638 291
601 3300048911 Ga0496108_0013258 Ga0496108_0013258_4888_5781 291
602 3300048912 Ga0496109_0000549 Ga0496109_0000549_2997_3881 291
603 3300048912 Ga0496109_0009996 Ga0496109_0009996_1168_2058 291
604 3300048912 Ga0496109_0018377 Ga0496109_0018377_3745_4638 291
605 3300048912 Ga0496109_0026343 Ga0496109_0026343_3582_4466 291
606 3300048912 Ga0496109_0056170 Ga0496109_0056170_1535_2425 291
607 3300048912 Ga0496109_0078046 Ga0496109_0078046_921_1811 291
608 3300048913 Ga0496110_0007131 Ga0496110_0007131_288_1181 291
609 3300048913 Ga0496110_0036686 Ga0496110_0036686_787_1671 291
610 3300048913 Ga0496110_0040347 Ga0496110_0040347_1937_2827 291
611 3300048913 Ga0496110_0081836 Ga0496110_0081836_50_940 291
612 3300048913 Ga0496110_0400142 Ga0496110_0400142_308_1192 291
613 3300048914 Ga0496111_0001147 Ga0496111_0001147_1756_2640 291
614 3300048914 Ga0496111_0008713 Ga0496111_0008713_4044_4934 291
615 3300048914 Ga0496111_0015611 Ga0496111_0015611_2824_3717 291
616 3300048914 Ga0496111_0019956 Ga0496111_0019956_3736_4620 291
617 3300048914 Ga0496111_0050185 Ga0496111_0050185_1121_2011 291
618 3300048915 Ga0496112_0000320 Ga0496112_0000320_3036_3920 291
619 3300048915 Ga0496112_0003683 Ga0496112_0003683_5610_6503 291
620 3300048915 Ga0496112_0009679 Ga0496112_0009679_928_1818 291
621 3300048915 Ga0496112_0018028 Ga0496112_0018028_1673_2563 291
622 3300048915 Ga0496112_0222387 Ga0496112_0222387_533_1417 291
623 3300048915 Ga0496112_0231888 Ga0496112_0231888_279_1169 291
624 3300048915 Ga0496112_0319205 Ga0496112_0319205_273_1157 291
625 3300048916 Ga0496113_0000694 Ga0496113_0000694_9998_10891 291
626 3300048916 Ga0496113_0001247 Ga0496113_0001247_10559_11443 291
627 3300048916 Ga0496113_0002579 Ga0496113_0002579_8527_9417 291
628 3300048916 Ga0496113_0015034 Ga0496113_0015034_3582_4466 291
629 3300048916 Ga0496113_0074014 Ga0496113_0074014_1359_2249 291
630 3300048917 Ga0496114_0006147 Ga0496114_0006147_8471_9361 291
631 3300048917 Ga0496114_0023853 Ga0496114_0023853_108_992 291
632 3300048917 Ga0496114_0037984 Ga0496114_0037984_2284_3174 291
633 3300048917 Ga0496114_0133269 Ga0496114_0133269_1109_1993 291
634 3300048918 Ga0496115_0063245 Ga0496115_0063245_1168_2058 291
635 3300048918 Ga0496115_0063747 Ga0496115_0063747_928_1818 291
636 3300048918 Ga0496115_0101757 Ga0496115_0101757_1315_2199 291
637 3300048918 Ga0496115_0234026 Ga0496115_0234026_299_1183 291
638 3300049570 Ga0501033_0068879 Ga0501033_0068879_798_1718 291
639 3300049574 Ga0501038_0014712 Ga0501038_0014712_4324_5244 291
640 3300049581 Ga0501047_0010459 Ga0501047_0010459_3317_4237 291
641 3300049581 Ga0501047_0183893 Ga0501047_0183893_608_1504 291
642 3300049586 Ga0501070_0002309 Ga0501070_0002309_14197_15117 291
643 3300049742 Ga0501080_0011011 Ga0501080_0011011_3782_4702 291
644 3300049822 Ga0501035_0105221 Ga0501035_0105221_435_1355 291
645 3300049823 Ga0501044_0003904 Ga0501044_0003904_7426_8346 291
646 3300049823 Ga0501044_0182818 Ga0501044_0182818_546_1466 291
647 3300050489 nmdc:mga03683_43898_c1 nmdc:mga03683_43898_c1_651_1535 291
648 3300050490 nmdc:mga03n38_3663_c1 nmdc:mga03n38_3663_c1_2320_3219 291
649 3300050491 nmdc:mga00v17_4364_c1 nmdc:mga00v17_4364_c1_3268_4167 291
650 3300050491 nmdc:mga00v17_76346_c1 nmdc:mga00v17_76346_c1_598_1482 291
651 3300050492 nmdc:mga0yw44_13357_c1 nmdc:mga0yw44_13357_c1_1634_2518 291
652 3300050492 nmdc:mga0yw44_374004_c1 nmdc:mga0yw44_374004_c1_67_951 291
653 3300050492 nmdc:mga0yw44_4721_c1 nmdc:mga0yw44_4721_c1_1163_2047 291
654 3300050492 nmdc:mga0yw44_6598_c1 nmdc:mga0yw44_6598_c1_4649_5539 291
655 3300050494 nmdc:mga06z11_1492_c1 nmdc:mga06z11_1492_c1_5203_6096 291
656 3300050494 nmdc:mga06z11_2755_c1 nmdc:mga06z11_2755_c1_2963_3862 291
657 3300050495 nmdc:mga04h51_385_c1 nmdc:mga04h51_385_c1_6569_7462 291
658 3300050507 nmdc:mga05p37_6334_c1 nmdc:mga05p37_6334_c1_4635_5519 291
659 3300050507 nmdc:mga05p37_69662_c1 nmdc:mga05p37_69662_c1_2164_3057 291
660 3300050507 nmdc:mga05p37_86999_c1 nmdc:mga05p37_86999_c1_2385_3314 291
661 3300050509 nmdc:mga0qj67_143429_c1 nmdc:mga0qj67_143429_c1_14_895 291
662 3300050510 nmdc:mga06r32_135963_c1 nmdc:mga06r32_135963_c1_1448_2329 291
663 3300050510 nmdc:mga06r32_57714_c1 nmdc:mga06r32_57714_c1_2396_3280 291
664 3300050510 nmdc:mga06r32_84087_c1 nmdc:mga06r32_84087_c1_1731_2615 291
665 3300050511 nmdc:mga08y16_211407_c1 nmdc:mga08y16_211407_c1_696_1580 291
666 3300050511 nmdc:mga08y16_290628_c1 nmdc:mga08y16_290628_c1_208_1092 291
667 3300050511 nmdc:mga08y16_55218_c1 nmdc:mga08y16_55218_c1_1600_2529 291
668 3300050511 nmdc:mga08y16_7303_c1 nmdc:mga08y16_7303_c1_10045_10932 291
669 3300050512 nmdc:mga0n895_125992_c1 nmdc:mga0n895_125992_c1_1010_1903 291
670 3300050512 nmdc:mga0n895_195462_c1 nmdc:mga0n895_195462_c1_655_1605 291
671 3300050512 nmdc:mga0n895_41575_c1 nmdc:mga0n895_41575_c1_1577_2482 291
672 3300050512 nmdc:mga0n895_589653_c1 nmdc:mga0n895_589653_c1_133_1023 291
673 3300050512 nmdc:mga0n895_637073_c1 nmdc:mga0n895_637073_c1_33_929 291
674 3300050513 nmdc:mga0rr50_177562_c1 nmdc:mga0rr50_177562_c1_305_1201 291
675 3300050514 nmdc:mga08x19_22543_c1 nmdc:mga08x19_22543_c1_468_1358 291
676 3300050514 nmdc:mga08x19_29198_c1 nmdc:mga08x19_29198_c1_749_1645 291
677 3300050515 nmdc:mga0a205_16737_c1 nmdc:mga0a205_16737_c1_5057_5950 291
678 3300053077 Ga0495601_0000010 Ga0495601_0000010_218584_219498 291
679 3300053077 Ga0495601_0127933 Ga0495601_0127933_93_977 291
680 3300053078 Ga0495612_0000002 Ga0495612_0000002_280935_281849 291
681 3300053078 Ga0495612_0006758 Ga0495612_0006758_3546_4442 291
682 3300053083 Ga0495655_0010583 Ga0495655_0010583_854_1738 291
683 3300053084 Ga0495595_0001532 Ga0495595_0001532_7608_8522 291
684 3300053084 Ga0495595_0003189 Ga0495595_0003189_3389_4285 291
685 3300053084 Ga0495595_0018002 Ga0495595_0018002_701_1585 291
686 3300053085 Ga0495619_0000002 Ga0495619_0000002_369342_370256 291
687 3300053085 Ga0495619_0011867 Ga0495619_0011867_3680_4576 291
688 3300053085 Ga0495619_0125536 Ga0495619_0125536_70_954 291
689 3300053087 Ga0500643_013638 Ga0500643_013638_1319_2197 291
690 3300053094 Ga0500566_0065245 Ga0500566_0065245_977_1855 291
691 3300053119 Ga0500595_000001 Ga0500595_000001_1014182_1015060 291
692 3300053131 Ga0500652_029920 Ga0500652_029920_1017_1895 291
693 3300053153 Ga0500616_0000001 Ga0500616_0000001_975251_976129 291
694 3300053153 Ga0500616_0108274 Ga0500616_0108274_141_1040 291
695 3300053730 Ga0500645_000165 Ga0500645_000165_1113_1991 291
696 3300060353 Ga0501082_0507886 Ga0501082_0507886_47_952 291
697 2209111006 2214600489 2213637872 292
698 3300000042 ARSoilYngRDRAFT_c00009 ARSoilYngRDRAFT_0000924 292
699 3300000043 ARcpr5yngRDRAFT_c000006 ARcpr5yngRDRAFT_00000624 292
700 3300000044 ARSoilOldRDRAFT_c000008 ARSoilOldRDRAFT_00000850 292
701 3300000652 ARCol0yngRDRAFT_1000092 ARCol0yngRDRAFT_10000924 292
702 3300001430 JGI24032J14994_100010 JGI24032J14994_1000104 292
703 3300001976 JGI24752J21851_1002004 JGI24752J21851_10020041 292
704 3300001978 JGI24747J21853_1000097 JGI24747J21853_10000974 292
705 3300001979 JGI24740J21852_10007359 JGI24740J21852_100073593 292
706 3300001989 JGI24739J22299_10000092 JGI24739J22299_1000009220 292
707 3300001990 JGI24737J22298_10000325 JGI24737J22298_1000032510 292
708 3300002070 JGI24750J21931_1000128 JGI24750J21931_100012814 292
709 3300002073 JGI24745J21846_1000019 JGI24745J21846_10000195 292
710 3300002075 JGI24738J21930_10000010 JGI24738J21930_1000001021 292
711 3300002076 JGI24749J21850_1000390 JGI24749J21850_10003903 292
712 3300002077 JGI24744J21845_10003267 JGI24744J21845_100032673 292
713 3300002126 JGI24035J26624_1000002 JGI24035J26624_100000214 292
714 3300002155 JGI24033J26618_1000590 JGI24033J26618_10005904 292
715 3300002239 JGI24034J26672_10001363 JGI24034J26672_100013632 292
716 3300002244 JGI24742J22300_10000521 JGI24742J22300_100005212 292
717 3300005276 Ga0065717_1000057 Ga0065717_10000572 292
718 3300005277 Ga0065716_1001714 Ga0065716_10017142 292
719 3300005290 Ga0065712_10003774 Ga0065712_100037743 292
720 3300005293 Ga0065715_10000752 Ga0065715_1000075214 292
721 3300005293 Ga0065715_10000834 Ga0065715_100008347 292
722 3300005327 Ga0070658_10478088 Ga0070658_104780882 292
723 3300005328 Ga0070676_10000041 Ga0070676_100000413 292
724 3300005329 Ga0070683_100001029 Ga0070683_10000102914 292
725 3300005330 Ga0070690_100002808 Ga0070690_1000028084 292
726 3300005333 Ga0070677_10000045 Ga0070677_100000457 292
727 3300005334 Ga0068869_100000079 Ga0068869_10000007914 292
728 3300005334 Ga0068869_100139312 Ga0068869_1001393122 292
729 3300005335 Ga0070666_10016046 Ga0070666_100160462 292
730 3300005335 Ga0070666_10131403 Ga0070666_101314032 292
731 3300005336 Ga0070680_100004008 Ga0070680_1000040084 292
732 3300005336 Ga0070680_100211606 Ga0070680_1002116061 292
733 3300005337 Ga0070682_100000641 Ga0070682_1000006414 292
734 3300005337 Ga0070682_100017895 Ga0070682_1000178952 292
735 3300005337 Ga0070682_100113330 Ga0070682_1001133302 292
736 3300005337 Ga0070682_100120191 Ga0070682_1001201912 292
737 3300005338 Ga0068868_100000588 Ga0068868_10000058830 292
738 3300005339 Ga0070660_100004207 Ga0070660_1000042077 292
739 3300005339 Ga0070660_100034964 Ga0070660_1000349642 292
740 3300005339 Ga0070660_100416820 Ga0070660_1004168201 292
741 3300005340 Ga0070689_100015607 Ga0070689_1000156076 292
742 3300005340 Ga0070689_100035694 Ga0070689_1000356944 292
743 3300005341 Ga0070691_10000161 Ga0070691_1000016115 292
744 3300005341 Ga0070691_10087574 Ga0070691_100875742 292
745 3300005343 Ga0070687_100000085 Ga0070687_10000008529 292
746 3300005343 Ga0070687_100011196 Ga0070687_1000111963 292
747 3300005344 Ga0070661_100000307 Ga0070661_10000030719 292
748 3300005345 Ga0070692_10006433 Ga0070692_100064332 292
749 3300005347 Ga0070668_100000164 Ga0070668_1000001647 292
750 3300005347 Ga0070668_100096461 Ga0070668_1000964612 292
751 3300005353 Ga0070669_100000571 Ga0070669_10000057121 292
752 3300005354 Ga0070675_100002792 Ga0070675_1000027927 292
753 3300005354 Ga0070675_100030132 Ga0070675_1000301322 292
754 3300005355 Ga0070671_100000104 Ga0070671_10000010441 292
755 3300005356 Ga0070674_100000238 Ga0070674_10000023821 292
756 3300005356 Ga0070674_100213643 Ga0070674_1002136432 292
757 3300005364 Ga0070673_100000152 Ga0070673_10000015231 292
758 3300005364 Ga0070673_100273366 Ga0070673_1002733661 292
759 3300005364 Ga0070673_100281261 Ga0070673_1002812612 292
760 3300005365 Ga0070688_100004752 Ga0070688_1000047522 292
761 3300005365 Ga0070688_100009930 Ga0070688_1000099306 292
762 3300005366 Ga0070659_100000551 Ga0070659_10000055121 292
763 3300005366 Ga0070659_100258206 Ga0070659_1002582062 292
764 3300005367 Ga0070667_100002365 Ga0070667_10000236513 292
765 3300005367 Ga0070667_100043692 Ga0070667_1000436922 292
766 3300005406 Ga0070703_10027189 Ga0070703_100271891 292
767 3300005436 Ga0070713_100020625 Ga0070713_1000206252 292
768 3300005438 Ga0070701_10008875 Ga0070701_100088754 292
769 3300005438 Ga0070701_10050637 Ga0070701_100506372 292
770 3300005440 Ga0070705_100000148 Ga0070705_10000014820 292
771 3300005440 Ga0070705_100159885 Ga0070705_1001598852 292
772 3300005441 Ga0070700_100000277 Ga0070700_10000027712 292
773 3300005441 Ga0070700_100010208 Ga0070700_1000102083 292
774 3300005444 Ga0070694_100003001 Ga0070694_1000030015 292
775 3300005444 Ga0070694_100026100 Ga0070694_1000261002 292
776 3300005444 Ga0070694_100155615 Ga0070694_1001556152 292
777 3300005444 Ga0070694_100201486 Ga0070694_1002014862 292
778 3300005445 Ga0070708_100592840 Ga0070708_1005928402 292
779 3300005455 Ga0070663_100001406 Ga0070663_10000140611 292
780 3300005455 Ga0070663_100082402 Ga0070663_1000824022 292
781 3300005455 Ga0070663_100293297 Ga0070663_1002932971 292
782 3300005456 Ga0070678_100008123 Ga0070678_1000081232 292
783 3300005456 Ga0070678_100061191 Ga0070678_1000611913 292
784 3300005457 Ga0070662_100005414 Ga0070662_1000054142 292
785 3300005457 Ga0070662_100010491 Ga0070662_1000104915 292
786 3300005457 Ga0070662_100345103 Ga0070662_1003451032 292
787 3300005458 Ga0070681_10003456 Ga0070681_1000345614 292
788 3300005458 Ga0070681_10029139 Ga0070681_100291394 292
789 3300005458 Ga0070681_10105482 Ga0070681_101054822 292
790 3300005458 Ga0070681_10148193 Ga0070681_101481931 292
791 3300005459 Ga0068867_100005503 Ga0068867_10000550310 292
792 3300005459 Ga0068867_100248865 Ga0068867_1002488652 292
793 3300005466 Ga0070685_10001961 Ga0070685_100019618 292
794 3300005468 Ga0070707_100153018 Ga0070707_1001530182 292
795 3300005530 Ga0070679_100000394 Ga0070679_10000039441 292
796 3300005530 Ga0070679_100126071 Ga0070679_1001260713 292
797 3300005535 Ga0070684_100001138 Ga0070684_1000011387 292
798 3300005535 Ga0070684_100049727 Ga0070684_1000497274 292
799 3300005539 Ga0068853_100002891 Ga0068853_1000028912 292
800 3300005539 Ga0068853_100554357 Ga0068853_1005543571 292
801 3300005543 Ga0070672_100000088 Ga0070672_10000008833 292
802 3300005544 Ga0070686_100000873 Ga0070686_10000087320 292
803 3300005545 Ga0070695_100000586 Ga0070695_1000005867 292
804 3300005545 Ga0070695_100003316 Ga0070695_1000033169 292
805 3300005546 Ga0070696_100000921 Ga0070696_1000009217 292
806 3300005546 Ga0070696_100210986 Ga0070696_1002109862 292
807 3300005547 Ga0070693_100000134 Ga0070693_10000013428 292
808 3300005547 Ga0070693_100059816 Ga0070693_1000598161 292
809 3300005548 Ga0070665_100094881 Ga0070665_1000948813 292
810 3300005549 Ga0070704_100000026 Ga0070704_10000002614 292
811 3300005549 Ga0070704_100016922 Ga0070704_1000169222 292
812 3300005563 Ga0068855_100118380 Ga0068855_1001183802 292
813 3300005564 Ga0070664_100001420 Ga0070664_10000142019 292
814 3300005577 Ga0068857_100001388 Ga0068857_1000013887 292
815 3300005578 Ga0068854_100000546 Ga0068854_10000054616 292
816 3300005578 Ga0068854_100157970 Ga0068854_1001579702 292
817 3300005614 Ga0068856_100002000 Ga0068856_1000020002 292
818 3300005615 Ga0070702_100000245 Ga0070702_10000024512 292
819 3300005616 Ga0068852_100002320 Ga0068852_1000023207 292
820 3300005616 Ga0068852_100453023 Ga0068852_1004530232 292
821 3300005617 Ga0068859_100061264 Ga0068859_1000612644 292
822 3300005618 Ga0068864_100000890 Ga0068864_10000089014 292
823 3300005718 Ga0068866_10000221 Ga0068866_1000022114 292
824 3300005719 Ga0068861_100000783 Ga0068861_1000007837 292
825 3300005719 Ga0068861_100027077 Ga0068861_1000270772 292
826 3300005834 Ga0068851_10164066 Ga0068851_101640662 292
827 3300005840 Ga0068870_10000090 Ga0068870_1000009032 292
828 3300005841 Ga0068863_100009502 Ga0068863_1000095022 292
829 3300005841 Ga0068863_100348865 Ga0068863_1003488652 292
830 3300005842 Ga0068858_100000295 Ga0068858_10000029543 292
831 3300005843 Ga0068860_100001285 Ga0068860_10000128511 292
832 3300005843 Ga0068860_100069499 Ga0068860_1000694994 292
833 3300005844 Ga0068862_100003658 Ga0068862_1000036587 292
834 3300005844 Ga0068862_100018135 Ga0068862_1000181355 292
835 3300005937 Ga0081455_10000007 Ga0081455_10000007232 292
836 3300005983 Ga0081540_1016438 Ga0081540_10164385 292
837 3300006048 Ga0075363_100234053 Ga0075363_1002340532 292
838 3300006163 Ga0070715_10033433 Ga0070715_100334332 292
839 3300006175 Ga0070712_100210003 Ga0070712_1002100032 292
840 3300006175 Ga0070712_100319090 Ga0070712_1003190902 292
841 3300006178 Ga0075367_10032971 Ga0075367_100329714 292
842 3300006194 Ga0075427_10000021 Ga0075427_100000213 292
843 3300006237 Ga0097621_100000040 Ga0097621_10000004048 292
844 3300006358 Ga0068871_100000252 Ga0068871_10000025241 292
845 3300006844 Ga0075428_100012162 Ga0075428_1000121628 292
846 3300006846 Ga0075430_100018573 Ga0075430_1000185736 292
847 3300006852 Ga0075433_10000007 Ga0075433_1000000716 292
848 3300006852 Ga0075433_10031256 Ga0075433_100312565 292
849 3300006852 Ga0075433_10061152 Ga0075433_100611524 292
850 3300006852 Ga0075433_10062432 Ga0075433_100624322 292
851 3300006871 Ga0075434_100002477 Ga0075434_10000247711 292
852 3300006871 Ga0075434_100002531 Ga0075434_1000025316 292
853 3300006880 Ga0075429_100002081 Ga0075429_1000020812 292
854 3300006881 Ga0068865_100000275 Ga0068865_10000027528 292
855 3300006881 Ga0068865_100160059 Ga0068865_1001600592 292
856 3300006931 Ga0097620_100061259 Ga0097620_1000612594 292
857 3300007076 Ga0075435_100001384 Ga0075435_10000138411 292
858 3300007076 Ga0075435_100113723 Ga0075435_1001137234 292
859 3300007076 Ga0075435_100128394 Ga0075435_1001283942 292
860 3300009094 Ga0111539_10000394 Ga0111539_1000039438 292
861 3300009094 Ga0111539_10003483 Ga0111539_1000348312 292
862 3300009094 Ga0111539_10013521 Ga0111539_100135219 292
863 3300009098 Ga0105245_10000462 Ga0105245_1000046225 292
864 3300009098 Ga0105245_10350662 Ga0105245_103506622 292
865 3300009098 Ga0105245_10438237 Ga0105245_104382372 292
866 3300009101 Ga0105247_10000442 Ga0105247_1000044216 292
867 3300009101 Ga0105247_10007985 Ga0105247_100079857 292
868 3300009147 Ga0114129_10001111 Ga0114129_1000111121 292
869 3300009147 Ga0114129_10006627 Ga0114129_100066274 292
870 3300009148 Ga0105243_10000282 Ga0105243_1000028242 292
871 3300009148 Ga0105243_10063911 Ga0105243_100639114 292
872 3300009174 Ga0105241_10000652 Ga0105241_1000065224 292
873 3300009176 Ga0105242_10001726 Ga0105242_1000172611 292
874 3300009176 Ga0105242_10042656 Ga0105242_100426562 292
875 3300009176 Ga0105242_10195408 Ga0105242_101954082 292
876 3300009177 Ga0105248_10022138 Ga0105248_100221387 292
877 3300009177 Ga0105248_10044044 Ga0105248_100440446 292
878 3300009177 Ga0105248_10170963 Ga0105248_101709633 292
879 3300009545 Ga0105237_10176235 Ga0105237_101762353 292
880 3300009553 Ga0105249_10001210 Ga0105249_100012105 292
881 3300009553 Ga0105249_10032670 Ga0105249_100326702 292
882 3300009553 Ga0105249_10075335 Ga0105249_100753353 292
883 3300010375 Ga0105239_10006303 Ga0105239_1000630314 292
884 3300010375 Ga0105239_10013274 Ga0105239_100132745 292
885 3300010375 Ga0105239_10110219 Ga0105239_101102192 292
886 3300010375 Ga0105239_10421191 Ga0105239_104211912 292
887 3300011119 Ga0105246_10000312 Ga0105246_1000031214 292
888 3300011119 Ga0105246_10386820 Ga0105246_103868202 292
889 3300012494 Ga0157341_1002115 Ga0157341_10021152 292
890 3300013100 Ga0157373_10020437 Ga0157373_100204372 292
891 3300013102 Ga0157371_10398737 Ga0157371_103987372 292
892 3300013296 Ga0157374_10001123 Ga0157374_1000112312 292
893 3300013297 Ga0157378_10000270 Ga0157378_1000027021 292
894 3300013297 Ga0157378_10278159 Ga0157378_102781592 292
895 3300013306 Ga0163162_10000145 Ga0163162_1000014523 292
896 3300013306 Ga0163162_10028483 Ga0163162_100284832 292
897 3300013307 Ga0157372_10004025 Ga0157372_1000402514 292
898 3300013308 Ga0157375_10000332 Ga0157375_1000033220 292
899 3300013308 Ga0157375_10044592 Ga0157375_100445925 292
900 3300013308 Ga0157375_10289840 Ga0157375_102898402 292
901 3300014325 Ga0163163_10000865 Ga0163163_1000086526 292
902 3300014325 Ga0163163_10010305 Ga0163163_100103057 292
903 3300014326 Ga0157380_10001523 Ga0157380_100015232 292
904 3300014745 Ga0157377_10000137 Ga0157377_1000013724 292
905 3300014968 Ga0157379_10002484 Ga0157379_100024842 292
906 3300014968 Ga0157379_10077370 Ga0157379_100773702 292
907 3300014969 Ga0157376_10000088 Ga0157376_1000008842 292
908 3300017792 Ga0163161_10000144 Ga0163161_1000014429 292
909 3300025271 Ga0207666_1000048 Ga0207666_10000487 292
910 3300025271 Ga0207666_1005457 Ga0207666_10054572 292
911 3300025290 Ga0207673_1001170 Ga0207673_10011702 292
912 3300025315 Ga0207697_10000136 Ga0207697_1000013614 292
913 3300025315 Ga0207697_10055625 Ga0207697_100556252 292
914 3300025885 Ga0207653_10011159 Ga0207653_100111591 292
915 3300025885 Ga0207653_10084406 Ga0207653_100844062 292
916 3300025893 Ga0207682_10000006 Ga0207682_1000000613 292
917 3300025899 Ga0207642_10000628 Ga0207642_100006285 292
918 3300025900 Ga0207710_10035283 Ga0207710_100352832 292
919 3300025901 Ga0207688_10000027 Ga0207688_1000002742 292
920 3300025901 Ga0207688_10003913 Ga0207688_100039137 292
921 3300025903 Ga0207680_10010727 Ga0207680_100107272 292
922 3300025904 Ga0207647_10005974 Ga0207647_100059744 292
923 3300025904 Ga0207647_10033429 Ga0207647_100334294 292
924 3300025907 Ga0207645_10000100 Ga0207645_1000010042 292
925 3300025908 Ga0207643_10000007 Ga0207643_10000007153 292
926 3300025911 Ga0207654_10000314 Ga0207654_1000031427 292
927 3300025912 Ga0207707_10003553 Ga0207707_100035533 292
928 3300025912 Ga0207707_10079478 Ga0207707_100794782 292
929 3300025914 Ga0207671_10294766 Ga0207671_102947662 292
930 3300025915 Ga0207693_10100221 Ga0207693_101002212 292
931 3300025917 Ga0207660_10000041 Ga0207660_1000004130 292
932 3300025917 Ga0207660_10174387 Ga0207660_101743872 292
933 3300025917 Ga0207660_10523123 Ga0207660_105231231 292
934 3300025918 Ga0207662_10000282 Ga0207662_100002827 292
935 3300025918 Ga0207662_10032258 Ga0207662_100322582 292
936 3300025919 Ga0207657_10003933 Ga0207657_100039337 292
937 3300025919 Ga0207657_10018028 Ga0207657_100180282 292
938 3300025920 Ga0207649_10000451 Ga0207649_100004512 292
939 3300025921 Ga0207652_10002586 Ga0207652_1000258617 292
940 3300025923 Ga0207681_10000100 Ga0207681_1000010073 292
941 3300025926 Ga0207659_10000044 Ga0207659_1000004488 292
942 3300025926 Ga0207659_10288669 Ga0207659_102886692 292
943 3300025927 Ga0207687_10000072 Ga0207687_1000007244 292
944 3300025927 Ga0207687_10182279 Ga0207687_101822792 292
945 3300025928 Ga0207700_10026082 Ga0207700_100260825 292
946 3300025931 Ga0207644_10013238 Ga0207644_100132387 292
947 3300025932 Ga0207690_10000140 Ga0207690_1000014047 292
948 3300025932 Ga0207690_10214907 Ga0207690_102149072 292
949 3300025933 Ga0207706_10001913 Ga0207706_1000191320 292
950 3300025933 Ga0207706_10003180 Ga0207706_1000318014 292
951 3300025933 Ga0207706_10036749 Ga0207706_100367492 292
952 3300025934 Ga0207686_10000448 Ga0207686_1000044826 292
953 3300025935 Ga0207709_10000154 Ga0207709_1000015491 292
954 3300025935 Ga0207709_10511446 Ga0207709_105114461 292
955 3300025936 Ga0207670_10000444 Ga0207670_1000044416 292
956 3300025936 Ga0207670_10249020 Ga0207670_102490202 292
957 3300025937 Ga0207669_10000176 Ga0207669_100001762 292
958 3300025938 Ga0207704_10000086 Ga0207704_1000008621 292
959 3300025938 Ga0207704_10118160 Ga0207704_101181602 292
960 3300025939 Ga0207665_10071245 Ga0207665_100712452 292
961 3300025940 Ga0207691_10000214 Ga0207691_1000021442 292
962 3300025941 Ga0207711_10001773 Ga0207711_1000177314 292
963 3300025941 Ga0207711_10044737 Ga0207711_100447374 292
964 3300025941 Ga0207711_10182982 Ga0207711_101829822 292
965 3300025942 Ga0207689_10000366 Ga0207689_1000036644 292
966 3300025942 Ga0207689_10196951 Ga0207689_101969512 292
967 3300025944 Ga0207661_10000087 Ga0207661_1000008729 292
968 3300025944 Ga0207661_10278218 Ga0207661_102782182 292
969 3300025945 Ga0207679_10000029 Ga0207679_1000002944 292
970 3300025949 Ga0207667_10315441 Ga0207667_103154412 292
971 3300025960 Ga0207651_10000264 Ga0207651_100002645 292
972 3300025960 Ga0207651_10213530 Ga0207651_102135302 292
973 3300025960 Ga0207651_10281218 Ga0207651_102812182 292
974 3300025961 Ga0207712_10000129 Ga0207712_1000012979 292
975 3300025972 Ga0207668_10000100 Ga0207668_1000010057 292
976 3300025972 Ga0207668_10088074 Ga0207668_100880742 292
977 3300025981 Ga0207640_10001280 Ga0207640_100012804 292
978 3300025981 Ga0207640_10174372 Ga0207640_101743722 292
979 3300025986 Ga0207658_10177304 Ga0207658_101773041 292
980 3300026023 Ga0207677_10005747 Ga0207677_100057472 292
981 3300026023 Ga0207677_10085907 Ga0207677_100859072 292
982 3300026035 Ga0207703_10004645 Ga0207703_1000464513 292
983 3300026035 Ga0207703_10167710 Ga0207703_101677102 292
984 3300026041 Ga0207639_10002204 Ga0207639_1000220414 292
985 3300026067 Ga0207678_10002814 Ga0207678_1000281414 292
986 3300026067 Ga0207678_10028585 Ga0207678_100285854 292
987 3300026067 Ga0207678_10038708 Ga0207678_100387084 292
988 3300026075 Ga0207708_10001802 Ga0207708_100018027 292
989 3300026075 Ga0207708_10002366 Ga0207708_100023664 292
990 3300026078 Ga0207702_10001819 Ga0207702_1000181917 292
991 3300026078 Ga0207702_10213324 Ga0207702_102133242 292
992 3300026088 Ga0207641_10000476 Ga0207641_1000047621 292
993 3300026088 Ga0207641_10340140 Ga0207641_103401402 292
994 3300026089 Ga0207648_10000072 Ga0207648_1000007221 292
995 3300026089 Ga0207648_10264927 Ga0207648_102649272 292
996 3300026095 Ga0207676_10000512 Ga0207676_1000051218 292
997 3300026116 Ga0207674_10000697 Ga0207674_1000069722 292
998 3300026118 Ga0207675_100002384 Ga0207675_10000238416 292
999 3300026121 Ga0207683_10000029 Ga0207683_1000002931 292
1000 3300026121 Ga0207683_10019860 Ga0207683_100198606 292
1001 3300026121 Ga0207683_10316004 Ga0207683_103160042 292
1002 3300026142 Ga0207698_10000523 Ga0207698_1000052324 292
1003 3300026142 Ga0207698_10399221 Ga0207698_103992212 292
1004 3300027617 Ga0210002_1000410 Ga0210002_10004104 292
1005 3300027665 Ga0209983_1004567 Ga0209983_10045673 292
1006 3300027717 Ga0209998_10001837 Ga0209998_100018375 292
1007 3300027717 Ga0209998_10002670 Ga0209998_100026704 292
1008 3300027876 Ga0209974_10003891 Ga0209974_100038914 292
1009 3300027907 Ga0207428_10000100 Ga0207428_10000100105 292
1010 3300027907 Ga0207428_10000115 Ga0207428_1000011566 292
1011 3300027907 Ga0207428_10000228 Ga0207428_1000022843 292
1012 3300028379 Ga0268266_10040078 Ga0268266_100400783 292
1013 3300028380 Ga0268265_10000755 Ga0268265_1000075538 292
1014 3300028380 Ga0268265_10040639 Ga0268265_100406394 292
1015 3300028381 Ga0268264_10044476 Ga0268264_100444763 292
1016 3300028381 Ga0268264_10249122 Ga0268264_102491222 292
1017 3300031344 Ga0265316_10229111 Ga0265316_102291112 292
1018 3300031711 Ga0265314_10007859 Ga0265314_100078594 292
1019 3300034816 Ga0373930_0000771 Ga0373930_0000771_449_1327 292
1020 3300034817 Ga0373948_0022558 Ga0373948_0022558_213_1091 292
1021 3300034818 Ga0373950_0000996 Ga0373950_0000996_94_972 292
1022 3300034818 Ga0373950_0005396 Ga0373950_0005396_846_1724 292
1023 3300034819 Ga0373958_0000704 Ga0373958_0000704_1926_2804 292
1024 3300034820 Ga0373959_0000679 Ga0373959_0000679_1147_2025 292
1025 3300034957 Ga0373938_0000025 Ga0373938_0000025_931_1809 292
1026 3300034957 Ga0373938_0000565 Ga0373938_0000565_2131_3009 292
1027 3300035084 Ga0373928_0000893 Ga0373928_0000893_3821_4699 292
1028 3300035084 Ga0373928_0004298 Ga0373928_0004298_1306_2184 292
1029 3300035085 Ga0373929_0003783 Ga0373929_0003783_276_1154 292
1030 3300035085 Ga0373929_0009824 Ga0373929_0009824_266_1144 292
1031 3300035086 Ga0373934_0012658 Ga0373934_0012658_1724_2614 292
1032 3300035086 Ga0373934_0072880 Ga0373934_0072880_36_926 292
1033 3300035088 Ga0373940_0001432 Ga0373940_0001432_2204_3082 292
1034 3300035088 Ga0373940_0002052 Ga0373940_0002052_2565_3443 292
1035 3300035089 Ga0373944_0014889 Ga0373944_0014889_19_909 292
1036 3300035090 Ga0373949_0000284 Ga0373949_0000284_14023_14901 292
1037 3300035090 Ga0373949_0001993 Ga0373949_0001993_2803_3681 292
1038 3300035091 Ga0373951_0001866 Ga0373951_0001866_2827_3705 292
1039 3300035091 Ga0373951_0002968 Ga0373951_0002968_2395_3273 292
1040 3300035092 Ga0373952_0001907 Ga0373952_0001907_171_1049 292
1041 3300035092 Ga0373952_0015456 Ga0373952_0015456_617_1495 292
1042 3300035111 Ga0373923_0028795 Ga0373923_0028795_833_1723 292
1043 3300035112 Ga0373932_0000745 Ga0373932_0000745_8792_9670 292
1044 3300035112 Ga0373932_0002517 Ga0373932_0002517_1032_1910 292
1045 3300035112 Ga0373932_0028565 Ga0373932_0028565_622_1512 292
1046 3300035113 Ga0373936_0020559 Ga0373936_0020559_25_915 292
1047 3300035114 Ga0373939_0000640 Ga0373939_0000640_447_1325 292
1048 3300035114 Ga0373939_0002988 Ga0373939_0002988_575_1453 292
1049 3300035115 Ga0373941_0001556 Ga0373941_0001556_1835_2713 292
1050 3300035115 Ga0373941_0003272 Ga0373941_0003272_931_1809 292
1051 3300035116 Ga0373945_0006315 Ga0373945_0006315_2146_3036 292
1052 3300035117 Ga0373953_0015536 Ga0373953_0015536_177_1067 292
1053 3300035118 Ga0373954_0010677 Ga0373954_0010677_2002_2886 292
1054 3300035118 Ga0373954_0026696 Ga0373954_0026696_553_1443 292
1055 3300035119 Ga0373956_0005293 Ga0373956_0005293_3876_4760 292
1056 3300035119 Ga0373956_0017397 Ga0373956_0017397_357_1247 292
1057 3300035119 Ga0373956_0031450 Ga0373956_0031450_404_1294 292
1058 3300035120 Ga0373957_0002619 Ga0373957_0002619_2361_3251 292
1059 3300035120 Ga0373957_0022059 Ga0373957_0022059_1205_2089 292
1060 3300035120 Ga0373957_0124333 Ga0373957_0124333_114_1019 292
1061 3300035121 Ga0373960_0004701 Ga0373960_0004701_1185_2063 292
1062 3300035172 Ga0373955_0002863 Ga0373955_0002863_4659_5564 292
1063 3300035172 Ga0373955_0019914 Ga0373955_0019914_913_1797 292
1064 3300035172 Ga0373955_0034707 Ga0373955_0034707_1213_2103 292
1065 3300035172 Ga0373955_0116083 Ga0373955_0116083_218_1102 292
1066 3300035207 Ga0373942_0000722 Ga0373942_0000722_1059_1937 292
1067 3300035207 Ga0373942_0002912 Ga0373942_0002912_1112_1990 292
1068 3300035241 Ga0373961_0000791 Ga0373961_0000791_47_925 292
1069 3300035242 Ga0373962_0000151 Ga0373962_0000151_2335_3213 292
1070 3300035410 Ga0373924_0012363 Ga0373924_0012363_407_1297 292
1071 3300035691 Ga0373931_0000381 Ga0373931_0000381_565_1443 292
1072 3300035691 Ga0373931_0079061 Ga0373931_0079061_771_1649 292
1073 3300035691 Ga0373931_0143846 Ga0373931_0143846_367_1257 292
1074 3300035724 Ga0373933_0004299 Ga0373933_0004299_3118_4008 292
1075 3300035724 Ga0373933_0008712 Ga0373933_0008712_4219_5124 292
1076 3300035724 Ga0373933_0042497 Ga0373933_0042497_1459_2343 292
1077 3300035724 Ga0373933_0107869 Ga0373933_0107869_599_1489 292
1078 3300035725 Ga0373947_0068838 Ga0373947_0068838_1048_1938 292
1079 3300036401 Ga0373937_0012115 Ga0373937_0012115_5240_6130 292
1080 3300036401 Ga0373937_0023630 Ga0373937_0023630_1805_2710 292
1081 3300036401 Ga0373937_0023983 Ga0373937_0023983_2408_3298 292
1082 3300036401 Ga0373937_0033945 Ga0373937_0033945_1313_2197 292
1083 3300036401 Ga0373937_0043327 Ga0373937_0043327_433_1338 292
1084 3300036401 Ga0373937_0211287 Ga0373937_0211287_902_1801 292
1085 3300042876 Ga0451577_0296704 Ga0451577_0296704_106_984 292
1086 3300045051 Ga0451576_0042133 Ga0451576_0042133_651_1529 292
1087 3300046454 Ga0495592_0006061 Ga0495592_0006061_6389_7294 292
1088 3300046454 Ga0495592_0163023 Ga0495592_0163023_143_1048 292
1089 3300046462 Ga0495651_0102658 Ga0495651_0102658_46_930 292
1090 3300046462 Ga0495651_0122042 Ga0495651_0122042_581_1465 292
1091 3300046477 Ga0495664_0008599 Ga0495664_0008599_2635_3525 292
1092 3300046477 Ga0495664_0026579 Ga0495664_0026579_2250_3155 292
1093 3300046477 Ga0495664_0044351 Ga0495664_0044351_375_1265 292
1094 3300046477 Ga0495664_0045474 Ga0495664_0045474_1136_2041 292
1095 3300046514 Ga0495618_0015542 Ga0495618_0015542_2949_3839 292
1096 3300046516 Ga0495628_0003390 Ga0495628_0003390_10262_11167 292
1097 3300046517 Ga0495630_0120146 Ga0495630_0120146_116_1006 292
1098 3300046517 Ga0495630_0464014 Ga0495630_0464014_20_910 292
1099 3300046533 Ga0495640_0030306 Ga0495640_0030306_1492_2397 292
1100 3300046533 Ga0495640_0123766 Ga0495640_0123766_548_1438 292
1101 3300046536 Ga0495587_0002521 Ga0495587_0002521_2772_3662 292
1102 3300046536 Ga0495587_0015010 Ga0495587_0015010_872_1756 292
1103 3300046536 Ga0495587_0107890 Ga0495587_0107890_586_1491 292
1104 3300046543 Ga0495645_0002657 Ga0495645_0002657_3731_4621 292
1105 3300046543 Ga0495645_0031265 Ga0495645_0031265_197_1102 292
1106 3300046543 Ga0495645_0203422 Ga0495645_0203422_152_1042 292
1107 3300046559 Ga0495667_0002603 Ga0495667_0002603_3584_4474 292
1108 3300046559 Ga0495667_0012554 Ga0495667_0012554_588_1472 292
1109 3300046663 Ga0495635_0012601 Ga0495635_0012601_4761_5651 292
1110 3300046663 Ga0495635_0038244 Ga0495635_0038244_2002_2892 292
1111 3300046663 Ga0495635_0053072 Ga0495635_0053072_1872_2777 292
1112 3300046664 Ga0495659_0038928 Ga0495659_0038928_654_1544 292
1113 3300046675 Ga0495657_0003205 Ga0495657_0003205_12063_12953 292
1114 3300046675 Ga0495657_0107953 Ga0495657_0107953_64_948 292
1115 3300046679 Ga0495623_0002818 Ga0495623_0002818_9721_10611 292
1116 3300046680 Ga0495646_0006855 Ga0495646_0006855_3255_4145 292
1117 3300046680 Ga0495646_0162082 Ga0495646_0162082_50_955 292
1118 3300046683 Ga0495658_0035323 Ga0495658_0035323_260_1165 292
1119 3300046809 Ga0495600_0052214 Ga0495600_0052214_1249_2139 292
1120 3300047317 Ga0495604_0009051 Ga0495604_0009051_3468_4352 292
1121 3300047317 Ga0495604_0011548 Ga0495604_0011548_2009_2914 292
1122 3300047317 Ga0495604_0011991 Ga0495604_0011991_2746_3636 292
1123 3300047317 Ga0495604_0046824 Ga0495604_0046824_2305_3210 292
1124 3300047322 Ga0495680_0006209 Ga0495680_0006209_5395_6285 292
1125 3300047322 Ga0495680_0023741 Ga0495680_0023741_956_1861 292
1126 3300047322 Ga0495680_0025295 Ga0495680_0025295_2426_3310 292
1127 3300047444 Ga0495675_0005683 Ga0495675_0005683_4908_5798 292
1128 3300047444 Ga0495675_0055898 Ga0495675_0055898_322_1227 292
1129 3300047471 Ga0495684_0032210 Ga0495684_0032210_1339_2244 292
1130 3300047471 Ga0495684_0134838 Ga0495684_0134838_383_1288 292
1131 3300048088 Ga0495602_0004518 Ga0495602_0004518_569_1474 292
1132 3300048088 Ga0495602_0007000 Ga0495602_0007000_3096_3986 292
1133 3300048088 Ga0495602_0123396 Ga0495602_0123396_896_1780 292
1134 3300048903 Ga0496100_0000530 Ga0496100_0000530_17102_17980 292
1135 3300048903 Ga0496100_0042520 Ga0496100_0042520_1097_1987 292
1136 3300048904 Ga0496101_0000189 Ga0496101_0000189_26032_26910 292
1137 3300048904 Ga0496101_0026690 Ga0496101_0026690_1088_1978 292
1138 3300048905 Ga0496102_0007437 Ga0496102_0007437_934_1824 292
1139 3300048905 Ga0496102_0228045 Ga0496102_0228045_494_1384 292
1140 3300048906 Ga0496103_0082569 Ga0496103_0082569_338_1216 292
1141 3300048906 Ga0496103_0126318 Ga0496103_0126318_563_1453 292
1142 3300048907 Ga0496104_0073768 Ga0496104_0073768_2243_3121 292
1143 3300048907 Ga0496104_0094987 Ga0496104_0094987_1420_2310 292
1144 3300048908 Ga0496105_0173093 Ga0496105_0173093_256_1134 292
1145 3300048908 Ga0496105_0230454 Ga0496105_0230454_461_1351 292
1146 3300048909 Ga0496106_0100557 Ga0496106_0100557_792_1682 292
1147 3300048909 Ga0496106_0217356 Ga0496106_0217356_260_1150 292
1148 3300048910 Ga0496107_0018052 Ga0496107_0018052_595_1473 292
1149 3300048910 Ga0496107_0059427 Ga0496107_0059427_1191_2081 292
1150 3300048910 Ga0496107_0072869 Ga0496107_0072869_541_1431 292
1151 3300048910 Ga0496107_0083486 Ga0496107_0083486_1114_1992 292
1152 3300048910 Ga0496107_0145235 Ga0496107_0145235_82_960 292
1153 3300048911 Ga0496108_0004455 Ga0496108_0004455_6484_7362 292
1154 3300048911 Ga0496108_0018809 Ga0496108_0018809_3703_4593 292
1155 3300048911 Ga0496108_0021834 Ga0496108_0021834_626_1504 292
1156 3300048911 Ga0496108_0611468 Ga0496108_0611468_31_909 292
1157 3300048912 Ga0496109_0000488 Ga0496109_0000488_7423_8301 292
1158 3300048912 Ga0496109_0001318 Ga0496109_0001318_17879_18757 292
1159 3300048912 Ga0496109_0104177 Ga0496109_0104177_1566_2456 292
1160 3300048913 Ga0496110_0021488 Ga0496110_0021488_3332_4210 292
1161 3300048913 Ga0496110_0031059 Ga0496110_0031059_363_1241 292
1162 3300048913 Ga0496110_0232955 Ga0496110_0232955_770_1660 292
1163 3300048914 Ga0496111_0021342 Ga0496111_0021342_1091_1969 292
1164 3300048914 Ga0496111_0038419 Ga0496111_0038419_1956_2834 292
1165 3300048915 Ga0496112_0103864 Ga0496112_0103864_1354_2232 292
1166 3300048916 Ga0496113_0002209 Ga0496113_0002209_6918_7796 292
1167 3300048916 Ga0496113_0117820 Ga0496113_0117820_763_1641 292
1168 3300048917 Ga0496114_0001960 Ga0496114_0001960_11462_12340 292
1169 3300048917 Ga0496114_0112540 Ga0496114_0112540_594_1484 292
1170 3300048918 Ga0496115_0002442 Ga0496115_0002442_3081_3959 292
1171 3300048918 Ga0496115_0206305 Ga0496115_0206305_272_1162 292
1172 3300049592 Ga0501076_0089633 Ga0501076_0089633_895_1773 292
1173 3300049593 Ga0501077_0029799 Ga0501077_0029799_2001_2879 292
1174 3300050490 nmdc:mga03n38_186316_c1 nmdc:mga03n38_186316_c1_43_921 292
1175 3300050494 nmdc:mga06z11_90716_c1 nmdc:mga06z11_90716_c1_692_1570 292
1176 3300050507 nmdc:mga05p37_505_c1 nmdc:mga05p37_505_c1_13260_14180 292
1177 3300050508 nmdc:mga09592_3702_c1 nmdc:mga09592_3702_c1_2122_3042 292
1178 3300050509 nmdc:mga0qj67_859_c1 nmdc:mga0qj67_859_c1_15288_16208 292
1179 3300050510 nmdc:mga06r32_20013_c1 nmdc:mga06r32_20013_c1_1793_2713 292
1180 3300050511 nmdc:mga08y16_11105_c1 nmdc:mga08y16_11105_c1_175_1053 292
1181 3300050511 nmdc:mga08y16_33421_c1 nmdc:mga08y16_33421_c1_397_1275 292
1182 3300050511 nmdc:mga08y16_7641_c1 nmdc:mga08y16_7641_c1_1665_2585 292
1183 3300050512 nmdc:mga0n895_2584_c1 nmdc:mga0n895_2584_c1_7945_8823 292
1184 3300050512 nmdc:mga0n895_3537_c1 nmdc:mga0n895_3537_c1_5692_6612 292
1185 3300050513 nmdc:mga0rr50_1087_c1 nmdc:mga0rr50_1087_c1_10873_11793 292
1186 3300050513 nmdc:mga0rr50_116638_c1 nmdc:mga0rr50_116638_c1_1025_1903 292
1187 3300050513 nmdc:mga0rr50_486212_c1 nmdc:mga0rr50_486212_c1_53_979 292
1188 3300050515 nmdc:mga0a205_108_c1 nmdc:mga0a205_108_c1_44771_45691 292
1189 3300050515 nmdc:mga0a205_1492_c1 nmdc:mga0a205_1492_c1_3425_4303 292
1190 3300050515 nmdc:mga0a205_397110_c1 nmdc:mga0a205_397110_c1_92_970 292
1191 3300050515 nmdc:mga0a205_9612_c2 nmdc:mga0a205_9612_c2_1806_2732 292
1192 3300053077 Ga0495601_0000958 Ga0495601_0000958_14516_15421 292
1193 3300053077 Ga0495601_0002291 Ga0495601_0002291_3979_4869 292
1194 3300053077 Ga0495601_0004285 Ga0495601_0004285_4143_5033 292
1195 3300053078 Ga0495612_0000276 Ga0495612_0000276_12221_13126 292
1196 3300053078 Ga0495612_0003620 Ga0495612_0003620_2181_3071 292
1197 3300053078 Ga0495612_0014054 Ga0495612_0014054_202_1092 292
1198 3300053084 Ga0495595_0000596 Ga0495595_0000596_9953_10858 292
1199 3300053084 Ga0495595_0009479 Ga0495595_0009479_903_1808 292
1200 3300053085 Ga0495619_0000108 Ga0495619_0000108_11366_12271 292
1201 3300053085 Ga0495619_0000763 Ga0495619_0000763_6324_7229 292
1202 3300053085 Ga0495619_0005840 Ga0495619_0005840_3267_4157 292
1203 3300053117 Ga0500593_018155 Ga0500593_018155_1517_2404 292
1204 3300060353 Ga0501082_0217372 Ga0501082_0217372_124_1002 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

189

309

0.97

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

27

186

0.94

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

22

120

0.89

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

5

117

0.88

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

27

119

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zcd-assembly3.cif.gz_B renalase in complex with nad+ 0.9667 4 32
7d6x-assembly1.cif.gz_A mycobacterium smegmatis sdh1 complex in the apo form 0.9612 4 31
4zcc-assembly2.cif.gz_C renalase in complex with nadh 0.9611 4 32
3doj-assembly1.cif.gz_A structure of glyoxylate reductase 1 from arabidopsis (atglyr1) 0.9592 4 287
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9565 4 288
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9817 5 32 3.50.50.60
af_A0A1D6NCX6_182_311_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9804 166 288 1.10.1040.10
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9749 162 288 1.10.1040.10
af_F4IAP5_485_617_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9711 166 290 1.10.1040.10
af_Q4DFE2_166_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9704 166 288 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A395WE70-F1-model_v4 HAD family hydrolase 0.9735 3 285 GO:0016054
GO:0016787
GO:0050661
GO:0051287
AF-A0A3N5PJN0-F1-model_v4 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) 0.9734 192 288 GO:0008679
GO:0051287
AF-A0A094E1N2-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9728 160 284 GO:0051287
AF-A0A2M8J2P9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9727 3 292 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A7S1LNM2-F1-model_v4 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein 0.9719 89 287 GO:0050661
GO:0051287

Feature Viewer

pLDDT pTM Quality
95.25 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map