F491620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1204 | 430 | 1204 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10029020|Ga0075433_100290202 |
| Length | 331 |
| Sequence | MCACLGAFVRTSAARNDDGEKSVANRTVGVIGLGLMGEVFSRRLIDAGQSVVGYDIDAAKGRRLANMGGRAAASIAEVACACDPIVLAVFDTSQVEDVVENHILPAVSETSRKIVLCASTCDPDRIAALGARVIPRGIRFLETPVSGTSEQVRRGDGVGLIGGDRETAAEAEAVLAILFPRRFHVGRVGDGGRTKLAVNLILGLNRMALAEGLVFARRLGLDPAAFLPVAKESAAYSQIMDVKGGKMLNGDFAPEGRVRQTLKDVHLMLEQAKRHGQSLPMLNVHCDVLEACVRAGEADLDNSAVIKEIARRQEPMLSNESHERPSQNTVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 7 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 19 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 22 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 124 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 232 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 236 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 244 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 288 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 370 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 371 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 421 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 423 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0 |
| Rhizoplane | 11.38 |
| Rhizosphere | 83.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214600489 | 2209111006 | Bacteria | 5547 |
| 2 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 3 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 4 | ARSoilOldRDRAFT_c000008 | 3300000044 | Bacteria | 50600 |
| 5 | ARCol0yngRDRAFT_1000092 | 3300000652 | Bacteria | 16856 |
| 6 | JGI24032J14994_100010 | 3300001430 | Bacteria | 6882 |
| 7 | JGI24752J21851_1002004 | 3300001976 | Bacteria | 2711 |
| 8 | JGI24747J21853_1000097 | 3300001978 | Bacteria | 3855 |
| 9 | JGI24740J21852_10007359 | 3300001979 | Bacteria | 4480 |
| 10 | JGI24739J22299_10000092 | 3300001989 | Bacteria | 26283 |
| 11 | JGI24737J22298_10000325 | 3300001990 | Bacteria | 16017 |
| 12 | JGI24750J21931_1000128 | 3300002070 | Bacteria | 12041 |
| 13 | JGI24745J21846_1000019 | 3300002073 | Bacteria | 10205 |
| 14 | JGI24738J21930_10000010 | 3300002075 | Bacteria | 37976 |
| 15 | JGI24749J21850_1000390 | 3300002076 | Bacteria | 6530 |
| 16 | JGI24744J21845_10003267 | 3300002077 | Bacteria | 3330 |
| 17 | JGI24035J26624_1000002 | 3300002126 | Bacteria | 16706 |
| 18 | JGI24033J26618_1000590 | 3300002155 | Bacteria | 3484 |
| 19 | JGI24034J26672_10001363 | 3300002239 | Bacteria | 3232 |
| 20 | JGI24742J22300_10000521 | 3300002244 | Bacteria | 5736 |
| 21 | JGI24742J22300_10004778 | 3300002244 | Bacteria | 2224 |
| 22 | JGI24751J29686_10023645 | 3300002459 | Bacteria | 1274 |
| 23 | Ga0065717_1000057 | 3300005276 | Bacteria | 6757 |
| 24 | Ga0065716_1001714 | 3300005277 | Bacteria | 3918 |
| 25 | Ga0065712_10003774 | 3300005290 | Bacteria | 5940 |
| 26 | Ga0065715_10000752 | 3300005293 | Bacteria | 15084 |
| 27 | Ga0065715_10000834 | 3300005293 | Bacteria | 8809 |
| 28 | Ga0070658_10478088 | 3300005327 | Unclassified | 1075 |
| 29 | Ga0070676_10000041 | 3300005328 | Bacteria | 38719 |
| 30 | Ga0070676_10205898 | 3300005328 | Bacteria | 1292 |
| 31 | Ga0070683_100001029 | 3300005329 | Bacteria | 20930 |
| 32 | Ga0070683_100258412 | 3300005329 | Bacteria | 1657 |
| 33 | Ga0070690_100002808 | 3300005330 | Bacteria | 9398 |
| 34 | Ga0070670_100005523 | 3300005331 | Bacteria | 10672 |
| 35 | Ga0070677_10000045 | 3300005333 | Bacteria | 38826 |
| 36 | Ga0068869_100000079 | 3300005334 | Bacteria | 44000 |
| 37 | Ga0068869_100057061 | 3300005334 | Bacteria | 2849 |
| 38 | Ga0068869_100139312 | 3300005334 | Bacteria | 1872 |
| 39 | Ga0070666_10016046 | 3300005335 | Bacteria | 4787 |
| 40 | Ga0070666_10131403 | 3300005335 | Bacteria | 1740 |
| 41 | Ga0070680_100004008 | 3300005336 | Bacteria | 11020 |
| 42 | Ga0070680_100211606 | 3300005336 | Bacteria | 1636 |
| 43 | Ga0070682_100000641 | 3300005337 | Bacteria | 21233 |
| 44 | Ga0070682_100017895 | 3300005337 | Bacteria | 4134 |
| 45 | Ga0070682_100113330 | 3300005337 | Unclassified | 1811 |
| 46 | Ga0070682_100120191 | 3300005337 | Bacteria | 1762 |
| 47 | Ga0070682_100151701 | 3300005337 | Bacteria | 1591 |
| 48 | Ga0070682_100320423 | 3300005337 | Bacteria | 1145 |
| 49 | Ga0068868_100000588 | 3300005338 | Bacteria | 24451 |
| 50 | Ga0068868_100012588 | 3300005338 | Bacteria | 6185 |
| 51 | Ga0070660_100004207 | 3300005339 | Bacteria | 9935 |
| 52 | Ga0070660_100034964 | 3300005339 | Bacteria | 3800 |
| 53 | Ga0070660_100416820 | 3300005339 | Unclassified | 1112 |
| 54 | Ga0070689_100015607 | 3300005340 | Bacteria | 5543 |
| 55 | Ga0070689_100035694 | 3300005340 | Bacteria | 3799 |
| 56 | Ga0070689_100122081 | 3300005340 | Bacteria | 2081 |
| 57 | Ga0070691_10000161 | 3300005341 | Bacteria | 21699 |
| 58 | Ga0070691_10087574 | 3300005341 | Unclassified | 1532 |
| 59 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 60 | Ga0070687_100011196 | 3300005343 | Bacteria | 3914 |
| 61 | Ga0070687_100091140 | 3300005343 | Bacteria | 1686 |
| 62 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 63 | Ga0070692_10006433 | 3300005345 | Bacteria | 5100 |
| 64 | Ga0070668_100000164 | 3300005347 | Bacteria | 42113 |
| 65 | Ga0070668_100096461 | 3300005347 | Bacteria | 2337 |
| 66 | Ga0070668_100224592 | 3300005347 | Bacteria | 1550 |
| 67 | Ga0070669_100000571 | 3300005353 | Bacteria | 27367 |
| 68 | Ga0070669_100072198 | 3300005353 | Bacteria | 2555 |
| 69 | Ga0070675_100002553 | 3300005354 | Bacteria | 13625 |
| 70 | Ga0070675_100002792 | 3300005354 | Bacteria | 13151 |
| 71 | Ga0070675_100030132 | 3300005354 | Bacteria | 4378 |
| 72 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 73 | Ga0070674_100000238 | 3300005356 | Bacteria | 27260 |
| 74 | Ga0070674_100090875 | 3300005356 | Bacteria | 2203 |
| 75 | Ga0070674_100213643 | 3300005356 | Bacteria | 1497 |
| 76 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 77 | Ga0070673_100273366 | 3300005364 | Bacteria | 1480 |
| 78 | Ga0070673_100281261 | 3300005364 | Bacteria | 1459 |
| 79 | Ga0070688_100004752 | 3300005365 | Bacteria | 7097 |
| 80 | Ga0070688_100009930 | 3300005365 | Bacteria | 5230 |
| 81 | Ga0070688_100031492 | 3300005365 | Bacteria | 3191 |
| 82 | Ga0070688_100038650 | 3300005365 | Bacteria | 2915 |
| 83 | Ga0070659_100000551 | 3300005366 | Bacteria | 27372 |
| 84 | Ga0070659_100258206 | 3300005366 | Unclassified | 1445 |
| 85 | Ga0070667_100002365 | 3300005367 | Bacteria | 16513 |
| 86 | Ga0070667_100024417 | 3300005367 | Bacteria | 5020 |
| 87 | Ga0070667_100043692 | 3300005367 | Bacteria | 3762 |
| 88 | Ga0070703_10017256 | 3300005406 | Bacteria | 2078 |
| 89 | Ga0070703_10027189 | 3300005406 | Bacteria | 1704 |
| 90 | Ga0070709_10000690 | 3300005434 | Bacteria | 19189 |
| 91 | Ga0070714_100062728 | 3300005435 | Unclassified | 3194 |
| 92 | Ga0070714_100085990 | 3300005435 | Bacteria | 2747 |
| 93 | Ga0070713_100001316 | 3300005436 | Bacteria | 15879 |
| 94 | Ga0070713_100020625 | 3300005436 | Bacteria | 5056 |
| 95 | Ga0070713_100128314 | 3300005436 | Unclassified | 2234 |
| 96 | Ga0070713_100144530 | 3300005436 | Bacteria | 2110 |
| 97 | Ga0070713_100158666 | 3300005436 | Bacteria | 2017 |
| 98 | Ga0070713_100312393 | 3300005436 | Bacteria | 1450 |
| 99 | Ga0070710_10028306 | 3300005437 | Unclassified | 2996 |
| 100 | Ga0070710_10055133 | 3300005437 | Bacteria | 2245 |
| 101 | Ga0070701_10008875 | 3300005438 | Bacteria | 4373 |
| 102 | Ga0070701_10050637 | 3300005438 | Bacteria | 2152 |
| 103 | Ga0070711_100050532 | 3300005439 | Bacteria | 2852 |
| 104 | Ga0070711_100182385 | 3300005439 | Bacteria | 1608 |
| 105 | Ga0070705_100000148 | 3300005440 | Bacteria | 41687 |
| 106 | Ga0070705_100159885 | 3300005440 | Unclassified | 1504 |
| 107 | Ga0070705_100179574 | 3300005440 | Bacteria | 1433 |
| 108 | Ga0070700_100000277 | 3300005441 | Bacteria | 27391 |
| 109 | Ga0070700_100010208 | 3300005441 | Bacteria | 5179 |
| 110 | Ga0070694_100003001 | 3300005444 | Bacteria | 10038 |
| 111 | Ga0070694_100026100 | 3300005444 | Bacteria | 3783 |
| 112 | Ga0070694_100155615 | 3300005444 | Bacteria | 1673 |
| 113 | Ga0070694_100201486 | 3300005444 | Bacteria | 1484 |
| 114 | Ga0070708_100592840 | 3300005445 | Unclassified | 1045 |
| 115 | Ga0070663_100001406 | 3300005455 | Bacteria | 13151 |
| 116 | Ga0070663_100021688 | 3300005455 | Bacteria | 4277 |
| 117 | Ga0070663_100063026 | 3300005455 | Bacteria | 2675 |
| 118 | Ga0070663_100082402 | 3300005455 | Bacteria | 2366 |
| 119 | Ga0070663_100293297 | 3300005455 | Bacteria | 1300 |
| 120 | Ga0070678_100008123 | 3300005456 | Bacteria | 6270 |
| 121 | Ga0070678_100061191 | 3300005456 | Bacteria | 2774 |
| 122 | Ga0070678_100071899 | 3300005456 | Bacteria | 2591 |
| 123 | Ga0070662_100005414 | 3300005457 | Bacteria | 8152 |
| 124 | Ga0070662_100010491 | 3300005457 | Bacteria | 6082 |
| 125 | Ga0070662_100345103 | 3300005457 | Unclassified | 1219 |
| 126 | Ga0070681_10003456 | 3300005458 | Bacteria | 14797 |
| 127 | Ga0070681_10029139 | 3300005458 | Bacteria | 5542 |
| 128 | Ga0070681_10105482 | 3300005458 | Bacteria | 2760 |
| 129 | Ga0070681_10148193 | 3300005458 | Bacteria | 2274 |
| 130 | Ga0068867_100005503 | 3300005459 | Bacteria | 8964 |
| 131 | Ga0068867_100248865 | 3300005459 | Unclassified | 1444 |
| 132 | Ga0070685_10001961 | 3300005466 | Bacteria | 10680 |
| 133 | Ga0070685_10032054 | 3300005466 | Bacteria | 2941 |
| 134 | Ga0070707_100153018 | 3300005468 | Bacteria | 2246 |
| 135 | Ga0070698_100373033 | 3300005471 | Bacteria | 1359 |
| 136 | Ga0070698_100422402 | 3300005471 | Unclassified | 1268 |
| 137 | Ga0070699_100301497 | 3300005518 | Bacteria | 1437 |
| 138 | Ga0070679_100000394 | 3300005530 | Bacteria | 37125 |
| 139 | Ga0070679_100126071 | 3300005530 | Bacteria | 2543 |
| 140 | Ga0070684_100001138 | 3300005535 | Bacteria | 19106 |
| 141 | Ga0070684_100035598 | 3300005535 | Bacteria | 4262 |
| 142 | Ga0070684_100049727 | 3300005535 | Bacteria | 3640 |
| 143 | Ga0070684_100222636 | 3300005535 | Bacteria | 1721 |
| 144 | Ga0070684_100234597 | 3300005535 | Bacteria | 1676 |
| 145 | Ga0068853_100002891 | 3300005539 | Bacteria | 13032 |
| 146 | Ga0068853_100554357 | 3300005539 | Unclassified | 1089 |
| 147 | Ga0070672_100000088 | 3300005543 | Bacteria | 44394 |
| 148 | Ga0070672_100026310 | 3300005543 | Bacteria | 4327 |
| 149 | Ga0070672_100211392 | 3300005543 | Bacteria | 1625 |
| 150 | Ga0070686_100000873 | 3300005544 | Bacteria | 17494 |
| 151 | Ga0070686_100003547 | 3300005544 | Bacteria | 8558 |
| 152 | Ga0070695_100000586 | 3300005545 | Bacteria | 19224 |
| 153 | Ga0070695_100003316 | 3300005545 | Bacteria | 9416 |
| 154 | Ga0070696_100000921 | 3300005546 | Bacteria | 19106 |
| 155 | Ga0070696_100210986 | 3300005546 | Unclassified | 1453 |
| 156 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 157 | Ga0070693_100059816 | 3300005547 | Bacteria | 2210 |
| 158 | Ga0070693_100101423 | 3300005547 | Bacteria | 1754 |
| 159 | Ga0070665_100094881 | 3300005548 | Bacteria | 2988 |
| 160 | Ga0070665_100295783 | 3300005548 | Bacteria | 1622 |
| 161 | Ga0070704_100000026 | 3300005549 | Bacteria | 48700 |
| 162 | Ga0070704_100016922 | 3300005549 | Bacteria | 4622 |
| 163 | Ga0068855_100118380 | 3300005563 | Bacteria | 3034 |
| 164 | Ga0070664_100001420 | 3300005564 | Bacteria | 19106 |
| 165 | Ga0070664_100133235 | 3300005564 | Bacteria | 2184 |
| 166 | Ga0068857_100001388 | 3300005577 | Bacteria | 19106 |
| 167 | Ga0068857_100204175 | 3300005577 | Bacteria | 1802 |
| 168 | Ga0068854_100000546 | 3300005578 | Bacteria | 22673 |
| 169 | Ga0068854_100157970 | 3300005578 | Bacteria | 1754 |
| 170 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 171 | Ga0068856_100289978 | 3300005614 | Bacteria | 1653 |
| 172 | Ga0070702_100000245 | 3300005615 | Bacteria | 18498 |
| 173 | Ga0070702_100092063 | 3300005615 | Bacteria | 1841 |
| 174 | Ga0068852_100002320 | 3300005616 | Bacteria | 13074 |
| 175 | Ga0068852_100014205 | 3300005616 | Bacteria | 6117 |
| 176 | Ga0068852_100453023 | 3300005616 | Unclassified | 1270 |
| 177 | Ga0068859_100040069 | 3300005617 | Bacteria | 4701 |
| 178 | Ga0068859_100061264 | 3300005617 | Bacteria | 3792 |
| 179 | Ga0068864_100000890 | 3300005618 | Bacteria | 25145 |
| 180 | Ga0068864_100048379 | 3300005618 | Bacteria | 3655 |
| 181 | Ga0068866_10000221 | 3300005718 | Bacteria | 27070 |
| 182 | Ga0068866_10009118 | 3300005718 | Bacteria | 4205 |
| 183 | Ga0068861_100000783 | 3300005719 | Bacteria | 19106 |
| 184 | Ga0068861_100027077 | 3300005719 | Bacteria | 4172 |
| 185 | Ga0068861_100253255 | 3300005719 | Bacteria | 1503 |
| 186 | Ga0068851_10164066 | 3300005834 | Unclassified | 1222 |
| 187 | Ga0068870_10000090 | 3300005840 | Bacteria | 29559 |
| 188 | Ga0068863_100009502 | 3300005841 | Bacteria | 9485 |
| 189 | Ga0068863_100015046 | 3300005841 | Bacteria | 7434 |
| 190 | Ga0068863_100248029 | 3300005841 | Bacteria | 1719 |
| 191 | Ga0068863_100348865 | 3300005841 | Unclassified | 1441 |
| 192 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 193 | Ga0068858_100076704 | 3300005842 | Bacteria | 3104 |
| 194 | Ga0068858_100400164 | 3300005842 | Bacteria | 1319 |
| 195 | Ga0068860_100001285 | 3300005843 | Bacteria | 27247 |
| 196 | Ga0068860_100069499 | 3300005843 | Unclassified | 3347 |
| 197 | Ga0068860_100229161 | 3300005843 | Bacteria | 1805 |
| 198 | Ga0068862_100003658 | 3300005844 | Bacteria | 13151 |
| 199 | Ga0068862_100018135 | 3300005844 | Bacteria | 5861 |
| 200 | Ga0068862_100610220 | 3300005844 | Unclassified | 1049 |
| 201 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 202 | Ga0081455_10000022 | 3300005937 | Bacteria | 159620 |
| 203 | Ga0081455_10006137 | 3300005937 | Bacteria | 12982 |
| 204 | Ga0081455_10009618 | 3300005937 | Bacteria | 9928 |
| 205 | Ga0081455_10029855 | 3300005937 | Bacteria | 4966 |
| 206 | Ga0081538_10006666 | 3300005981 | Bacteria | 10117 |
| 207 | Ga0081538_10040866 | 3300005981 | Bacteria | 2952 |
| 208 | Ga0081538_10070963 | 3300005981 | Bacteria | 1919 |
| 209 | Ga0081540_1000703 | 3300005983 | Bacteria | 31069 |
| 210 | Ga0081540_1016438 | 3300005983 | Bacteria | 4629 |
| 211 | Ga0081539_10079549 | 3300005985 | Unclassified | 1727 |
| 212 | Ga0070717_10009632 | 3300006028 | Bacteria | 7271 |
| 213 | Ga0070717_10036947 | 3300006028 | Bacteria | 3964 |
| 214 | Ga0075365_10009291 | 3300006038 | Bacteria | 5642 |
| 215 | Ga0075365_10021110 | 3300006038 | Bacteria | 4056 |
| 216 | Ga0075365_10125397 | 3300006038 | Bacteria | 1774 |
| 217 | Ga0075368_10005383 | 3300006042 | Bacteria | 4399 |
| 218 | Ga0075368_10024807 | 3300006042 | Bacteria | 2298 |
| 219 | Ga0075368_10039930 | 3300006042 | Bacteria | 1841 |
| 220 | Ga0075363_100016781 | 3300006048 | Bacteria | 3620 |
| 221 | Ga0075363_100042104 | 3300006048 | Bacteria | 2411 |
| 222 | Ga0075363_100234053 | 3300006048 | Unclassified | 1055 |
| 223 | Ga0075364_10027100 | 3300006051 | Bacteria | 3659 |
| 224 | Ga0075364_10090887 | 3300006051 | Bacteria | 2025 |
| 225 | Ga0070715_10033433 | 3300006163 | Bacteria | 2102 |
| 226 | Ga0070716_100065757 | 3300006173 | Bacteria | 2113 |
| 227 | Ga0070716_100253187 | 3300006173 | Bacteria | 1201 |
| 228 | Ga0070712_100004676 | 3300006175 | Bacteria | 8464 |
| 229 | Ga0070712_100077315 | 3300006175 | Bacteria | 2399 |
| 230 | Ga0070712_100158994 | 3300006175 | Bacteria | 1743 |
| 231 | Ga0070712_100201221 | 3300006175 | Bacteria | 1565 |
| 232 | Ga0070712_100210003 | 3300006175 | Bacteria | 1534 |
| 233 | Ga0070712_100319090 | 3300006175 | Bacteria | 1263 |
| 234 | Ga0070712_100354424 | 3300006175 | Bacteria | 1202 |
| 235 | Ga0075362_10057046 | 3300006177 | Unclassified | 1759 |
| 236 | Ga0075367_10001913 | 3300006178 | Bacteria | 9239 |
| 237 | Ga0075367_10009093 | 3300006178 | Bacteria | 5176 |
| 238 | Ga0075367_10032971 | 3300006178 | Bacteria | 2983 |
| 239 | Ga0075367_10034279 | 3300006178 | Bacteria | 2931 |
| 240 | Ga0075367_10199164 | 3300006178 | Bacteria | 1251 |
| 241 | Ga0075427_10000021 | 3300006194 | Bacteria | 10546 |
| 242 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 243 | Ga0097621_100007724 | 3300006237 | Bacteria | 7711 |
| 244 | Ga0075370_10003364 | 3300006353 | Bacteria | 7605 |
| 245 | Ga0075370_10029978 | 3300006353 | Bacteria | 3033 |
| 246 | Ga0075370_10136984 | 3300006353 | Bacteria | 1430 |
| 247 | Ga0068871_100000252 | 3300006358 | Bacteria | 37355 |
| 248 | Ga0075428_100002517 | 3300006844 | Bacteria | 19916 |
| 249 | Ga0075428_100012162 | 3300006844 | Bacteria | 9573 |
| 250 | Ga0075428_100049454 | 3300006844 | Bacteria | 4612 |
| 251 | Ga0075428_100056626 | 3300006844 | Bacteria | 4294 |
| 252 | Ga0075428_100064578 | 3300006844 | Bacteria | 4009 |
| 253 | Ga0075428_100078608 | 3300006844 | Bacteria | 3601 |
| 254 | Ga0075428_100112577 | 3300006844 | Bacteria | 2964 |
| 255 | Ga0075428_100146801 | 3300006844 | Bacteria | 2563 |
| 256 | Ga0075428_100211834 | 3300006844 | Bacteria | 2094 |
| 257 | Ga0075428_100403846 | 3300006844 | Bacteria | 1464 |
| 258 | Ga0075428_100438982 | 3300006844 | Bacteria | 1398 |
| 259 | Ga0075430_100018573 | 3300006846 | Bacteria | 5917 |
| 260 | Ga0075430_100024166 | 3300006846 | Bacteria | 5173 |
| 261 | Ga0075430_100087554 | 3300006846 | Bacteria | 2606 |
| 262 | Ga0075430_100139316 | 3300006846 | Bacteria | 2020 |
| 263 | Ga0075431_100001498 | 3300006847 | Bacteria | 21626 |
| 264 | Ga0075431_100003463 | 3300006847 | Bacteria | 15298 |
| 265 | Ga0075431_100040358 | 3300006847 | Bacteria | 4810 |
| 266 | Ga0075431_100191858 | 3300006847 | Bacteria | 2093 |
| 267 | Ga0075431_100226672 | 3300006847 | Bacteria | 1905 |
| 268 | Ga0075431_100300175 | 3300006847 | Bacteria | 1623 |
| 269 | Ga0075431_100331567 | 3300006847 | Bacteria | 1532 |
| 270 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 271 | Ga0075433_10014595 | 3300006852 | Bacteria | 6422 |
| 272 | Ga0075433_10029020 | 3300006852 | Bacteria | 4709 |
| 273 | Ga0075433_10031256 | 3300006852 | Bacteria | 4551 |
| 274 | Ga0075433_10061152 | 3300006852 | Bacteria | 3299 |
| 275 | Ga0075433_10062432 | 3300006852 | Bacteria | 3263 |
| 276 | Ga0075433_10197244 | 3300006852 | Bacteria | 1790 |
| 277 | Ga0075434_100002477 | 3300006871 | Bacteria | 16252 |
| 278 | Ga0075434_100002531 | 3300006871 | Bacteria | 16122 |
| 279 | Ga0075434_100005388 | 3300006871 | Bacteria | 11640 |
| 280 | Ga0075434_100036505 | 3300006871 | Bacteria | 4862 |
| 281 | Ga0075434_100076946 | 3300006871 | Bacteria | 3331 |
| 282 | Ga0075434_100216129 | 3300006871 | Bacteria | 1937 |
| 283 | Ga0075434_100224593 | 3300006871 | Bacteria | 1898 |
| 284 | Ga0075434_100283038 | 3300006871 | Bacteria | 1677 |
| 285 | Ga0075429_100002081 | 3300006880 | Bacteria | 16691 |
| 286 | Ga0075429_100018152 | 3300006880 | Bacteria | 6088 |
| 287 | Ga0075429_100034246 | 3300006880 | Bacteria | 4412 |
| 288 | Ga0075429_100071717 | 3300006880 | Bacteria | 3016 |
| 289 | Ga0075429_100110877 | 3300006880 | Bacteria | 2398 |
| 290 | Ga0075429_100151452 | 3300006880 | Bacteria | 2031 |
| 291 | Ga0075429_100240601 | 3300006880 | Bacteria | 1585 |
| 292 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 293 | Ga0068865_100076123 | 3300006881 | Bacteria | 2394 |
| 294 | Ga0068865_100160059 | 3300006881 | Bacteria | 1716 |
| 295 | Ga0075436_100044259 | 3300006914 | Bacteria | 3069 |
| 296 | Ga0075436_100111240 | 3300006914 | Unclassified | 1912 |
| 297 | Ga0097620_100040078 | 3300006931 | Bacteria | 4701 |
| 298 | Ga0097620_100061259 | 3300006931 | Bacteria | 3792 |
| 299 | Ga0075435_100001384 | 3300007076 | Bacteria | 15669 |
| 300 | Ga0075435_100055469 | 3300007076 | Bacteria | 3200 |
| 301 | Ga0075435_100069480 | 3300007076 | Bacteria | 2872 |
| 302 | Ga0075435_100113723 | 3300007076 | Bacteria | 2253 |
| 303 | Ga0075435_100128394 | 3300007076 | Bacteria | 2120 |
| 304 | Ga0075435_100153209 | 3300007076 | Unclassified | 1939 |
| 305 | Ga0075435_100188926 | 3300007076 | Bacteria | 1743 |
| 306 | Ga0099794_10050582 | 3300007265 | Bacteria | 1999 |
| 307 | Ga0099795_10001211 | 3300007788 | Bacteria | 5446 |
| 308 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 309 | Ga0111539_10003483 | 3300009094 | Bacteria | 20741 |
| 310 | Ga0111539_10012080 | 3300009094 | Bacteria | 10831 |
| 311 | Ga0111539_10013521 | 3300009094 | Bacteria | 10201 |
| 312 | Ga0111539_10029045 | 3300009094 | Bacteria | 6742 |
| 313 | Ga0111539_10033922 | 3300009094 | Bacteria | 6193 |
| 314 | Ga0111539_10102599 | 3300009094 | Bacteria | 3357 |
| 315 | Ga0111539_10191928 | 3300009094 | Bacteria | 2383 |
| 316 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 317 | Ga0105245_10104051 | 3300009098 | Bacteria | 2631 |
| 318 | Ga0105245_10350662 | 3300009098 | Unclassified | 1462 |
| 319 | Ga0105245_10438237 | 3300009098 | Bacteria | 1313 |
| 320 | Ga0105245_10520135 | 3300009098 | Bacteria | 1208 |
| 321 | Ga0105247_10000442 | 3300009101 | Bacteria | 35071 |
| 322 | Ga0105247_10007985 | 3300009101 | Bacteria | 6466 |
| 323 | Ga0114129_10001111 | 3300009147 | Bacteria | 35464 |
| 324 | Ga0114129_10006627 | 3300009147 | Bacteria | 16445 |
| 325 | Ga0114129_10019114 | 3300009147 | Bacteria | 9758 |
| 326 | Ga0114129_10138186 | 3300009147 | Bacteria | 3343 |
| 327 | Ga0114129_10173981 | 3300009147 | Bacteria | 2933 |
| 328 | Ga0114129_10196114 | 3300009147 | Bacteria | 2738 |
| 329 | Ga0114129_10317456 | 3300009147 | Bacteria | 2072 |
| 330 | Ga0114129_10443157 | 3300009147 | Bacteria | 1704 |
| 331 | Ga0114129_10558448 | 3300009147 | Bacteria | 1488 |
| 332 | Ga0114129_10981805 | 3300009147 | Bacteria | 1065 |
| 333 | Ga0105243_10000282 | 3300009148 | Bacteria | 56666 |
| 334 | Ga0105243_10063911 | 3300009148 | Unclassified | 2951 |
| 335 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 336 | Ga0105241_10049246 | 3300009174 | Bacteria | 3208 |
| 337 | Ga0105242_10001726 | 3300009176 | Bacteria | 17253 |
| 338 | Ga0105242_10042656 | 3300009176 | Bacteria | 3665 |
| 339 | Ga0105242_10195408 | 3300009176 | Unclassified | 1794 |
| 340 | Ga0105242_10521525 | 3300009176 | Bacteria | 1134 |
| 341 | Ga0105248_10022138 | 3300009177 | Bacteria | 7045 |
| 342 | Ga0105248_10044044 | 3300009177 | Bacteria | 5005 |
| 343 | Ga0105248_10119676 | 3300009177 | Bacteria | 2970 |
| 344 | Ga0105248_10170963 | 3300009177 | Bacteria | 2449 |
| 345 | Ga0105248_10494882 | 3300009177 | Bacteria | 1378 |
| 346 | Ga0105237_10176235 | 3300009545 | Bacteria | 2138 |
| 347 | Ga0105237_10420909 | 3300009545 | Bacteria | 1341 |
| 348 | Ga0105237_10470752 | 3300009545 | Bacteria | 1262 |
| 349 | Ga0105238_10298302 | 3300009551 | Bacteria | 1595 |
| 350 | Ga0105249_10001210 | 3300009553 | Bacteria | 22796 |
| 351 | Ga0105249_10032670 | 3300009553 | Bacteria | 4709 |
| 352 | Ga0105249_10075335 | 3300009553 | Bacteria | 3125 |
| 353 | Ga0105249_10511409 | 3300009553 | Bacteria | 1247 |
| 354 | Ga0105239_10006303 | 3300010375 | Bacteria | 13795 |
| 355 | Ga0105239_10013274 | 3300010375 | Bacteria | 9154 |
| 356 | Ga0105239_10110219 | 3300010375 | Bacteria | 3051 |
| 357 | Ga0105239_10421191 | 3300010375 | Unclassified | 1513 |
| 358 | Ga0105246_10000312 | 3300011119 | Bacteria | 25800 |
| 359 | Ga0105246_10047614 | 3300011119 | Bacteria | 2928 |
| 360 | Ga0105246_10105167 | 3300011119 | Bacteria | 2063 |
| 361 | Ga0105246_10386820 | 3300011119 | Unclassified | 1158 |
| 362 | Ga0157341_1002115 | 3300012494 | Unclassified | 1278 |
| 363 | Ga0157373_10020437 | 3300013100 | Bacteria | 4812 |
| 364 | Ga0157371_10398737 | 3300013102 | Unclassified | 1006 |
| 365 | Ga0157374_10001123 | 3300013296 | Bacteria | 23027 |
| 366 | Ga0157378_10000270 | 3300013297 | Bacteria | 50517 |
| 367 | Ga0157378_10278159 | 3300013297 | Bacteria | 1612 |
| 368 | Ga0157378_10281096 | 3300013297 | Bacteria | 1604 |
| 369 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 370 | Ga0163162_10028483 | 3300013306 | Bacteria | 5527 |
| 371 | Ga0163162_10270031 | 3300013306 | Bacteria | 1832 |
| 372 | Ga0157372_10004025 | 3300013307 | Bacteria | 15762 |
| 373 | Ga0157375_10000332 | 3300013308 | Bacteria | 42513 |
| 374 | Ga0157375_10044592 | 3300013308 | Bacteria | 4310 |
| 375 | Ga0157375_10289840 | 3300013308 | Bacteria | 1800 |
| 376 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 377 | Ga0163163_10010305 | 3300014325 | Bacteria | 8401 |
| 378 | Ga0163163_10034353 | 3300014325 | Bacteria | 4909 |
| 379 | Ga0163163_10455839 | 3300014325 | Bacteria | 1339 |
| 380 | Ga0163163_10465553 | 3300014325 | Bacteria | 1325 |
| 381 | Ga0157380_10001523 | 3300014326 | Bacteria | 15218 |
| 382 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 383 | Ga0157377_10027186 | 3300014745 | Bacteria | 3069 |
| 384 | Ga0157377_10159819 | 3300014745 | Bacteria | 1400 |
| 385 | Ga0157379_10002484 | 3300014968 | Bacteria | 15443 |
| 386 | Ga0157379_10077370 | 3300014968 | Bacteria | 2979 |
| 387 | Ga0157379_10321134 | 3300014968 | Bacteria | 1414 |
| 388 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 389 | Ga0157376_10044877 | 3300014969 | Bacteria | 3636 |
| 390 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 391 | Ga0163161_10033052 | 3300017792 | Bacteria | 3696 |
| 392 | Ga0224572_1000107 | 3300024225 | Bacteria | 6414 |
| 393 | Ga0207666_1000048 | 3300025271 | Bacteria | 23535 |
| 394 | Ga0207666_1005457 | 3300025271 | Bacteria | 1625 |
| 395 | Ga0207673_1001170 | 3300025290 | Bacteria | 2823 |
| 396 | Ga0207697_10000136 | 3300025315 | Bacteria | 35274 |
| 397 | Ga0207697_10055625 | 3300025315 | Unclassified | 1641 |
| 398 | Ga0207653_10011159 | 3300025885 | Bacteria | 2804 |
| 399 | Ga0207653_10028793 | 3300025885 | Bacteria | 1788 |
| 400 | Ga0207653_10084406 | 3300025885 | Unclassified | 1104 |
| 401 | Ga0207682_10000006 | 3300025893 | Bacteria | 94953 |
| 402 | Ga0207692_10005544 | 3300025898 | Bacteria | 5063 |
| 403 | Ga0207692_10054588 | 3300025898 | Bacteria | 2041 |
| 404 | Ga0207642_10000628 | 3300025899 | Bacteria | 10836 |
| 405 | Ga0207642_10005629 | 3300025899 | Bacteria | 4104 |
| 406 | Ga0207642_10055635 | 3300025899 | Bacteria | 1811 |
| 407 | Ga0207710_10014427 | 3300025900 | Bacteria | 3333 |
| 408 | Ga0207710_10025874 | 3300025900 | Bacteria | 2534 |
| 409 | Ga0207710_10035283 | 3300025900 | Bacteria | 2201 |
| 410 | Ga0207688_10000027 | 3300025901 | Bacteria | 48448 |
| 411 | Ga0207688_10003913 | 3300025901 | Bacteria | 8119 |
| 412 | Ga0207688_10005223 | 3300025901 | Bacteria | 7058 |
| 413 | Ga0207680_10010727 | 3300025903 | Bacteria | 4597 |
| 414 | Ga0207680_10072079 | 3300025903 | Bacteria | 2143 |
| 415 | Ga0207647_10005974 | 3300025904 | Bacteria | 8867 |
| 416 | Ga0207647_10033429 | 3300025904 | Unclassified | 3293 |
| 417 | Ga0207647_10082462 | 3300025904 | Bacteria | 1926 |
| 418 | Ga0207685_10074105 | 3300025905 | Bacteria | 1389 |
| 419 | Ga0207699_10016678 | 3300025906 | Bacteria | 3848 |
| 420 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 421 | Ga0207645_10011370 | 3300025907 | Bacteria | 6081 |
| 422 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 423 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 424 | Ga0207654_10049690 | 3300025911 | Bacteria | 2407 |
| 425 | Ga0207654_10054948 | 3300025911 | Bacteria | 2303 |
| 426 | Ga0207707_10003553 | 3300025912 | Bacteria | 13808 |
| 427 | Ga0207707_10079478 | 3300025912 | Bacteria | 2863 |
| 428 | Ga0207707_10104369 | 3300025912 | Bacteria | 2477 |
| 429 | Ga0207671_10294766 | 3300025914 | Bacteria | 1281 |
| 430 | Ga0207671_10320971 | 3300025914 | Bacteria | 1225 |
| 431 | Ga0207693_10007133 | 3300025915 | Bacteria | 9219 |
| 432 | Ga0207693_10008588 | 3300025915 | Bacteria | 8362 |
| 433 | Ga0207693_10049759 | 3300025915 | Bacteria | 3291 |
| 434 | Ga0207693_10100221 | 3300025915 | Bacteria | 2271 |
| 435 | Ga0207693_10121868 | 3300025915 | Bacteria | 2048 |
| 436 | Ga0207693_10248582 | 3300025915 | Bacteria | 1396 |
| 437 | Ga0207663_10145223 | 3300025916 | Bacteria | 1658 |
| 438 | Ga0207663_10165234 | 3300025916 | Bacteria | 1567 |
| 439 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 440 | Ga0207660_10174387 | 3300025917 | Bacteria | 1666 |
| 441 | Ga0207660_10523123 | 3300025917 | Unclassified | 963 |
| 442 | Ga0207662_10000282 | 3300025918 | Bacteria | 23540 |
| 443 | Ga0207662_10032258 | 3300025918 | Bacteria | 3048 |
| 444 | Ga0207657_10003933 | 3300025919 | Bacteria | 15773 |
| 445 | Ga0207657_10018028 | 3300025919 | Bacteria | 6753 |
| 446 | Ga0207657_10022500 | 3300025919 | Bacteria | 5895 |
| 447 | Ga0207649_10000451 | 3300025920 | Bacteria | 29601 |
| 448 | Ga0207649_10073921 | 3300025920 | Bacteria | 2185 |
| 449 | Ga0207652_10002586 | 3300025921 | Bacteria | 15184 |
| 450 | Ga0207681_10000100 | 3300025923 | Bacteria | 72913 |
| 451 | Ga0207681_10054375 | 3300025923 | Bacteria | 2722 |
| 452 | Ga0207650_10005799 | 3300025925 | Bacteria | 8428 |
| 453 | Ga0207659_10000044 | 3300025926 | Bacteria | 88759 |
| 454 | Ga0207659_10089491 | 3300025926 | Bacteria | 2296 |
| 455 | Ga0207659_10288669 | 3300025926 | Unclassified | 1343 |
| 456 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 457 | Ga0207687_10082787 | 3300025927 | Bacteria | 2322 |
| 458 | Ga0207687_10182279 | 3300025927 | Bacteria | 1628 |
| 459 | Ga0207700_10010428 | 3300025928 | Bacteria | 5862 |
| 460 | Ga0207700_10026082 | 3300025928 | Bacteria | 4070 |
| 461 | Ga0207700_10149000 | 3300025928 | Bacteria | 1932 |
| 462 | Ga0207700_10227714 | 3300025928 | Bacteria | 1583 |
| 463 | Ga0207664_10134516 | 3300025929 | Bacteria | 2085 |
| 464 | Ga0207664_10713075 | 3300025929 | Bacteria | 902 |
| 465 | Ga0207644_10001432 | 3300025931 | Bacteria | 15366 |
| 466 | Ga0207644_10013238 | 3300025931 | Bacteria | 5495 |
| 467 | Ga0207644_10315203 | 3300025931 | Bacteria | 1263 |
| 468 | Ga0207690_10000140 | 3300025932 | Bacteria | 58923 |
| 469 | Ga0207690_10214907 | 3300025932 | Bacteria | 1468 |
| 470 | Ga0207706_10001913 | 3300025933 | Bacteria | 20445 |
| 471 | Ga0207706_10003180 | 3300025933 | Bacteria | 15778 |
| 472 | Ga0207706_10007580 | 3300025933 | Bacteria | 10038 |
| 473 | Ga0207706_10036749 | 3300025933 | Bacteria | 4350 |
| 474 | Ga0207686_10000448 | 3300025934 | Bacteria | 27388 |
| 475 | Ga0207709_10000154 | 3300025935 | Bacteria | 93456 |
| 476 | Ga0207709_10037801 | 3300025935 | Bacteria | 2870 |
| 477 | Ga0207709_10189211 | 3300025935 | Bacteria | 1461 |
| 478 | Ga0207709_10511446 | 3300025935 | Unclassified | 939 |
| 479 | Ga0207670_10000444 | 3300025936 | Bacteria | 23206 |
| 480 | Ga0207670_10105999 | 3300025936 | Bacteria | 2015 |
| 481 | Ga0207670_10249020 | 3300025936 | Unclassified | 1372 |
| 482 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 483 | Ga0207704_10000086 | 3300025938 | Bacteria | 54866 |
| 484 | Ga0207704_10118160 | 3300025938 | Bacteria | 1808 |
| 485 | Ga0207704_10547754 | 3300025938 | Bacteria | 940 |
| 486 | Ga0207665_10000666 | 3300025939 | Bacteria | 23108 |
| 487 | Ga0207665_10002138 | 3300025939 | Bacteria | 13362 |
| 488 | Ga0207665_10050922 | 3300025939 | Bacteria | 2786 |
| 489 | Ga0207665_10071245 | 3300025939 | Bacteria | 2373 |
| 490 | Ga0207665_10221352 | 3300025939 | Bacteria | 1387 |
| 491 | Ga0207691_10000214 | 3300025940 | Bacteria | 56205 |
| 492 | Ga0207691_10002482 | 3300025940 | Bacteria | 18048 |
| 493 | Ga0207691_10334355 | 3300025940 | Bacteria | 1297 |
| 494 | Ga0207711_10001773 | 3300025941 | Bacteria | 19760 |
| 495 | Ga0207711_10023185 | 3300025941 | Bacteria | 5195 |
| 496 | Ga0207711_10044737 | 3300025941 | Bacteria | 3780 |
| 497 | Ga0207711_10182982 | 3300025941 | Bacteria | 1907 |
| 498 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 499 | Ga0207689_10021381 | 3300025942 | Bacteria | 5441 |
| 500 | Ga0207689_10196951 | 3300025942 | Bacteria | 1663 |
| 501 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 502 | Ga0207661_10055463 | 3300025944 | Bacteria | 3179 |
| 503 | Ga0207661_10278218 | 3300025944 | Unclassified | 1495 |
| 504 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 505 | Ga0207679_10145552 | 3300025945 | Bacteria | 1921 |
| 506 | Ga0207679_10172740 | 3300025945 | Bacteria | 1781 |
| 507 | Ga0207667_10315441 | 3300025949 | Unclassified | 1597 |
| 508 | Ga0207651_10000264 | 3300025960 | Bacteria | 22299 |
| 509 | Ga0207651_10122017 | 3300025960 | Bacteria | 1978 |
| 510 | Ga0207651_10213530 | 3300025960 | Bacteria | 1555 |
| 511 | Ga0207651_10281218 | 3300025960 | Unclassified | 1375 |
| 512 | Ga0207712_10000129 | 3300025961 | Bacteria | 79246 |
| 513 | Ga0207712_10217877 | 3300025961 | Bacteria | 1524 |
| 514 | Ga0207668_10000100 | 3300025972 | Bacteria | 60574 |
| 515 | Ga0207668_10088074 | 3300025972 | Bacteria | 2273 |
| 516 | Ga0207640_10001280 | 3300025981 | Bacteria | 13669 |
| 517 | Ga0207640_10174372 | 3300025981 | Unclassified | 1606 |
| 518 | Ga0207658_10034085 | 3300025986 | Bacteria | 3636 |
| 519 | Ga0207658_10177304 | 3300025986 | Bacteria | 1761 |
| 520 | Ga0207677_10005747 | 3300026023 | Bacteria | 6748 |
| 521 | Ga0207677_10085907 | 3300026023 | Bacteria | 2272 |
| 522 | Ga0207703_10004645 | 3300026035 | Bacteria | 11217 |
| 523 | Ga0207703_10099525 | 3300026035 | Bacteria | 2461 |
| 524 | Ga0207703_10167710 | 3300026035 | Bacteria | 1928 |
| 525 | Ga0207639_10002204 | 3300026041 | Bacteria | 13124 |
| 526 | Ga0207678_10002814 | 3300026067 | Bacteria | 15778 |
| 527 | Ga0207678_10005074 | 3300026067 | Bacteria | 11807 |
| 528 | Ga0207678_10028585 | 3300026067 | Bacteria | 4866 |
| 529 | Ga0207678_10038708 | 3300026067 | Bacteria | 4142 |
| 530 | Ga0207708_10001802 | 3300026075 | Bacteria | 15778 |
| 531 | Ga0207708_10002366 | 3300026075 | Bacteria | 13852 |
| 532 | Ga0207708_10088090 | 3300026075 | Bacteria | 2391 |
| 533 | Ga0207702_10001819 | 3300026078 | Bacteria | 20980 |
| 534 | Ga0207702_10038792 | 3300026078 | Bacteria | 3990 |
| 535 | Ga0207702_10213324 | 3300026078 | Bacteria | 1796 |
| 536 | Ga0207641_10000476 | 3300026088 | Bacteria | 45413 |
| 537 | Ga0207641_10340140 | 3300026088 | Unclassified | 1428 |
| 538 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 539 | Ga0207648_10002406 | 3300026089 | Bacteria | 20158 |
| 540 | Ga0207648_10264927 | 3300026089 | Bacteria | 1534 |
| 541 | Ga0207676_10000512 | 3300026095 | Bacteria | 32630 |
| 542 | Ga0207676_10048456 | 3300026095 | Bacteria | 3298 |
| 543 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 544 | Ga0207675_100002384 | 3300026118 | Bacteria | 18614 |
| 545 | Ga0207675_100014751 | 3300026118 | Bacteria | 7289 |
| 546 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 547 | Ga0207683_10019860 | 3300026121 | Bacteria | 5741 |
| 548 | Ga0207683_10180352 | 3300026121 | Bacteria | 1915 |
| 549 | Ga0207683_10316004 | 3300026121 | Bacteria | 1430 |
| 550 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 551 | Ga0207698_10399221 | 3300026142 | Unclassified | 1313 |
| 552 | Ga0210002_1000410 | 3300027617 | Bacteria | 5830 |
| 553 | Ga0209983_1004567 | 3300027665 | Bacteria | 2904 |
| 554 | Ga0209998_10001837 | 3300027717 | Bacteria | 5033 |
| 555 | Ga0209998_10002670 | 3300027717 | Bacteria | 4031 |
| 556 | Ga0209813_10001159 | 3300027866 | Bacteria | 5885 |
| 557 | Ga0209813_10016822 | 3300027866 | Bacteria | 2001 |
| 558 | Ga0209974_10003891 | 3300027876 | Bacteria | 5347 |
| 559 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 560 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 561 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 562 | Ga0207428_10071087 | 3300027907 | Bacteria | 2734 |
| 563 | Ga0207428_10110835 | 3300027907 | Bacteria | 2112 |
| 564 | Ga0268266_10017979 | 3300028379 | Bacteria | 6027 |
| 565 | Ga0268266_10040078 | 3300028379 | Bacteria | 3991 |
| 566 | Ga0268266_10072670 | 3300028379 | Bacteria | 2983 |
| 567 | Ga0268265_10000755 | 3300028380 | Bacteria | 31424 |
| 568 | Ga0268265_10040639 | 3300028380 | Bacteria | 3436 |
| 569 | Ga0268264_10035284 | 3300028381 | Bacteria | 4116 |
| 570 | Ga0268264_10044476 | 3300028381 | Bacteria | 3683 |
| 571 | Ga0268264_10249122 | 3300028381 | Bacteria | 1649 |
| 572 | Ga0265338_10049467 | 3300028800 | Bacteria | 3810 |
| 573 | Ga0307511_10000295 | 3300030521 | Bacteria | 52686 |
| 574 | Ga0265763_1000456 | 3300030763 | Bacteria | 2465 |
| 575 | Ga0265760_10002189 | 3300031090 | Bacteria | 5712 |
| 576 | Ga0265332_10001020 | 3300031238 | Bacteria | 16537 |
| 577 | Ga0265325_10000015 | 3300031241 | Bacteria | 131113 |
| 578 | Ga0265325_10012301 | 3300031241 | Bacteria | 4896 |
| 579 | Ga0265325_10025489 | 3300031241 | Bacteria | 3210 |
| 580 | Ga0265325_10051836 | 3300031241 | Bacteria | 2109 |
| 581 | Ga0265329_10006800 | 3300031242 | Bacteria | 4497 |
| 582 | Ga0265339_10000060 | 3300031249 | Bacteria | 97276 |
| 583 | Ga0265339_10002058 | 3300031249 | Bacteria | 14763 |
| 584 | Ga0265316_10229111 | 3300031344 | Bacteria | 1369 |
| 585 | Ga0265313_10000094 | 3300031595 | Bacteria | 89774 |
| 586 | Ga0265313_10042478 | 3300031595 | Bacteria | 2232 |
| 587 | Ga0265314_10007859 | 3300031711 | Bacteria | 9208 |
| 588 | Ga0265314_10014199 | 3300031711 | Bacteria | 6388 |
| 589 | Ga0265314_10027968 | 3300031711 | Bacteria | 4213 |
| 590 | Ga0265342_10000908 | 3300031712 | Bacteria | 29504 |
| 591 | Ga0265342_10046308 | 3300031712 | Bacteria | 2614 |
| 592 | Ga0307412_10248251 | 3300031911 | Bacteria | 1381 |
| 593 | Ga0307507_10018085 | 3300033179 | Bacteria | 8044 |
| 594 | Ga0373930_0000771 | 3300034816 | Bacteria | 4553 |
| 595 | Ga0373948_0000355 | 3300034817 | Bacteria | 5632 |
| 596 | Ga0373948_0022558 | 3300034817 | Unclassified | 1214 |
| 597 | Ga0373950_0000996 | 3300034818 | Unclassified | 3589 |
| 598 | Ga0373950_0005396 | 3300034818 | Bacteria | 1908 |
| 599 | Ga0373958_0000704 | 3300034819 | Bacteria | 4238 |
| 600 | Ga0373958_0014054 | 3300034819 | Bacteria | 1395 |
| 601 | Ga0373959_0000679 | 3300034820 | Bacteria | 5821 |
| 602 | Ga0373959_0006952 | 3300034820 | Unclassified | 1894 |
| 603 | Ga0373938_0000025 | 3300034957 | Bacteria | 19231 |
| 604 | Ga0373938_0000565 | 3300034957 | Bacteria | 5981 |
| 605 | Ga0373926_0018822 | 3300035083 | Unclassified | 2378 |
| 606 | Ga0373926_0031992 | 3300035083 | Bacteria | 1856 |
| 607 | Ga0373928_0000893 | 3300035084 | Bacteria | 5857 |
| 608 | Ga0373928_0004298 | 3300035084 | Bacteria | 2720 |
| 609 | Ga0373928_0016550 | 3300035084 | Bacteria | 1510 |
| 610 | Ga0373929_0003783 | 3300035085 | Bacteria | 2710 |
| 611 | Ga0373929_0009824 | 3300035085 | Bacteria | 1779 |
| 612 | Ga0373934_0012658 | 3300035086 | Bacteria | 3184 |
| 613 | Ga0373934_0057740 | 3300035086 | Bacteria | 1544 |
| 614 | Ga0373934_0072880 | 3300035086 | Bacteria | 1375 |
| 615 | Ga0373940_0001432 | 3300035088 | Bacteria | 4310 |
| 616 | Ga0373940_0002052 | 3300035088 | Bacteria | 3823 |
| 617 | Ga0373944_0014889 | 3300035089 | Bacteria | 2176 |
| 618 | Ga0373944_0040499 | 3300035089 | Bacteria | 1438 |
| 619 | Ga0373949_0000284 | 3300035090 | Bacteria | 18664 |
| 620 | Ga0373949_0001993 | 3300035090 | Bacteria | 5459 |
| 621 | Ga0373949_0053306 | 3300035090 | Bacteria | 1024 |
| 622 | Ga0373951_0001866 | 3300035091 | Bacteria | 5430 |
| 623 | Ga0373951_0002968 | 3300035091 | Bacteria | 4203 |
| 624 | Ga0373952_0001907 | 3300035092 | Bacteria | 3782 |
| 625 | Ga0373952_0013630 | 3300035092 | Bacteria | 1616 |
| 626 | Ga0373952_0015456 | 3300035092 | Bacteria | 1541 |
| 627 | Ga0373923_0002721 | 3300035111 | Bacteria | 5513 |
| 628 | Ga0373923_0028795 | 3300035111 | Bacteria | 2223 |
| 629 | Ga0373932_0000745 | 3300035112 | Bacteria | 9717 |
| 630 | Ga0373932_0002517 | 3300035112 | Bacteria | 4607 |
| 631 | Ga0373932_0002996 | 3300035112 | Bacteria | 4143 |
| 632 | Ga0373932_0028565 | 3300035112 | Bacteria | 1534 |
| 633 | Ga0373936_0003042 | 3300035113 | Bacteria | 6271 |
| 634 | Ga0373936_0004123 | 3300035113 | Bacteria | 5478 |
| 635 | Ga0373936_0010154 | 3300035113 | Bacteria | 3556 |
| 636 | Ga0373936_0020559 | 3300035113 | Bacteria | 2565 |
| 637 | Ga0373936_0039256 | 3300035113 | Bacteria | 1894 |
| 638 | Ga0373939_0000640 | 3300035114 | Bacteria | 8717 |
| 639 | Ga0373939_0002988 | 3300035114 | Bacteria | 3970 |
| 640 | Ga0373941_0001556 | 3300035115 | Bacteria | 4869 |
| 641 | Ga0373941_0003272 | 3300035115 | Bacteria | 3655 |
| 642 | Ga0373945_0006315 | 3300035116 | Bacteria | 3817 |
| 643 | Ga0373945_0010915 | 3300035116 | Bacteria | 2996 |
| 644 | Ga0373953_0015536 | 3300035117 | Bacteria | 2761 |
| 645 | Ga0373953_0019450 | 3300035117 | Bacteria | 2526 |
| 646 | Ga0373954_0001425 | 3300035118 | Bacteria | 9690 |
| 647 | Ga0373954_0010677 | 3300035118 | Bacteria | 4058 |
| 648 | Ga0373954_0026696 | 3300035118 | Bacteria | 2648 |
| 649 | Ga0373956_0005293 | 3300035119 | Bacteria | 5166 |
| 650 | Ga0373956_0017397 | 3300035119 | Bacteria | 3030 |
| 651 | Ga0373956_0031450 | 3300035119 | Bacteria | 2326 |
| 652 | Ga0373956_0032517 | 3300035119 | Bacteria | 2289 |
| 653 | Ga0373957_0002619 | 3300035120 | Bacteria | 5167 |
| 654 | Ga0373957_0022059 | 3300035120 | Bacteria | 2265 |
| 655 | Ga0373957_0124333 | 3300035120 | Bacteria | 1046 |
| 656 | Ga0373960_0004701 | 3300035121 | Bacteria | 3141 |
| 657 | Ga0373943_0000467 | 3300035170 | Bacteria | 17171 |
| 658 | Ga0373943_0014454 | 3300035170 | Bacteria | 3575 |
| 659 | Ga0373943_0043040 | 3300035170 | Bacteria | 2191 |
| 660 | Ga0373946_0000540 | 3300035171 | Bacteria | 12542 |
| 661 | Ga0373946_0001451 | 3300035171 | Bacteria | 8248 |
| 662 | Ga0373946_0001719 | 3300035171 | Bacteria | 7639 |
| 663 | Ga0373946_0012321 | 3300035171 | Bacteria | 3198 |
| 664 | Ga0373955_0000039 | 3300035172 | Bacteria | 51994 |
| 665 | Ga0373955_0002863 | 3300035172 | Bacteria | 7576 |
| 666 | Ga0373955_0019914 | 3300035172 | Bacteria | 3364 |
| 667 | Ga0373955_0034707 | 3300035172 | Bacteria | 2667 |
| 668 | Ga0373955_0116083 | 3300035172 | Bacteria | 1552 |
| 669 | Ga0373942_0000722 | 3300035207 | Bacteria | 9101 |
| 670 | Ga0373942_0002912 | 3300035207 | Bacteria | 4055 |
| 671 | Ga0373961_0000791 | 3300035241 | Bacteria | 10869 |
| 672 | Ga0373961_0028250 | 3300035241 | Bacteria | 1545 |
| 673 | Ga0373961_0044321 | 3300035241 | Bacteria | 1297 |
| 674 | Ga0373962_0000151 | 3300035242 | Bacteria | 14355 |
| 675 | Ga0373924_0001219 | 3300035410 | Bacteria | 8246 |
| 676 | Ga0373924_0012363 | 3300035410 | Bacteria | 3188 |
| 677 | Ga0373931_0000381 | 3300035691 | Bacteria | 18287 |
| 678 | Ga0373931_0043551 | 3300035691 | Bacteria | 2364 |
| 679 | Ga0373931_0079061 | 3300035691 | Bacteria | 1810 |
| 680 | Ga0373931_0126874 | 3300035691 | Bacteria | 1464 |
| 681 | Ga0373931_0143846 | 3300035691 | Bacteria | 1384 |
| 682 | Ga0373935_0000079 | 3300035692 | Bacteria | 41989 |
| 683 | Ga0373935_0000403 | 3300035692 | Bacteria | 22453 |
| 684 | Ga0373935_0064931 | 3300035692 | Bacteria | 2341 |
| 685 | Ga0373935_0100909 | 3300035692 | Bacteria | 1902 |
| 686 | Ga0373927_0003959 | 3300035695 | Bacteria | 10487 |
| 687 | Ga0373927_0006910 | 3300035695 | Bacteria | 7710 |
| 688 | Ga0373927_0033684 | 3300035695 | Bacteria | 3334 |
| 689 | Ga0373927_0044692 | 3300035695 | Unclassified | 2865 |
| 690 | Ga0373927_0075556 | 3300035695 | Bacteria | 2182 |
| 691 | Ga0373927_0224298 | 3300035695 | Bacteria | 1234 |
| 692 | Ga0373933_0004299 | 3300035724 | Bacteria | 7822 |
| 693 | Ga0373933_0004774 | 3300035724 | Bacteria | 7409 |
| 694 | Ga0373933_0008712 | 3300035724 | Bacteria | 5531 |
| 695 | Ga0373933_0042497 | 3300035724 | Bacteria | 2687 |
| 696 | Ga0373933_0107869 | 3300035724 | Bacteria | 1734 |
| 697 | Ga0373947_0000986 | 3300035725 | Bacteria | 17380 |
| 698 | Ga0373947_0025796 | 3300035725 | Bacteria | 3428 |
| 699 | Ga0373947_0068838 | 3300035725 | Bacteria | 2165 |
| 700 | Ga0373947_0129533 | 3300035725 | Bacteria | 1609 |
| 701 | Ga0373947_0137702 | 3300035725 | Unclassified | 1563 |
| 702 | Ga0373937_0000223 | 3300036401 | Bacteria | 54957 |
| 703 | Ga0373937_0012115 | 3300036401 | Bacteria | 7570 |
| 704 | Ga0373937_0023630 | 3300036401 | Bacteria | 5538 |
| 705 | Ga0373937_0023983 | 3300036401 | Bacteria | 5500 |
| 706 | Ga0373937_0033945 | 3300036401 | Bacteria | 4638 |
| 707 | Ga0373937_0043327 | 3300036401 | Bacteria | 4107 |
| 708 | Ga0373937_0064259 | 3300036401 | Bacteria | 3376 |
| 709 | Ga0373937_0097181 | 3300036401 | Bacteria | 2731 |
| 710 | Ga0373937_0211287 | 3300036401 | Bacteria | 1826 |
| 711 | Ga0373925_0000741 | 3300037068 | Bacteria | 29997 |
| 712 | Ga0373925_0047234 | 3300037068 | Bacteria | 3204 |
| 713 | Ga0373925_0047453 | 3300037068 | Bacteria | 3197 |
| 714 | Ga0373925_0048570 | 3300037068 | Bacteria | 3162 |
| 715 | Ga0373925_0089106 | 3300037068 | Bacteria | 2356 |
| 716 | Ga0373925_0121249 | 3300037068 | Bacteria | 2030 |
| 717 | Ga0373925_0390636 | 3300037068 | Bacteria | 1134 |
| 718 | Ga0395900_0282267 | 3300037418 | Unclassified | 1652 |
| 719 | Ga0395898_0113234 | 3300037466 | Bacteria | 2600 |
| 720 | Ga0436363_1239658 | 3300039450 | Bacteria | 2159 |
| 721 | Ga0439464_0010154 | 3300042439 | Bacteria | 2486 |
| 722 | Ga0451577_0112202 | 3300042876 | Bacteria | 2440 |
| 723 | Ga0451577_0296704 | 3300042876 | Bacteria | 1465 |
| 724 | Ga0466963_0080802 | 3300044694 | Bacteria | 2201 |
| 725 | Ga0451576_0042133 | 3300045051 | Bacteria | 4821 |
| 726 | Ga0451576_0521311 | 3300045051 | Bacteria | 1249 |
| 727 | Ga0466958_0027816 | 3300045836 | Bacteria | 3347 |
| 728 | Ga0495592_0000188 | 3300046454 | Bacteria | 54485 |
| 729 | Ga0495592_0006061 | 3300046454 | Bacteria | 8991 |
| 730 | Ga0495592_0163023 | 3300046454 | Bacteria | 1532 |
| 731 | Ga0495592_0209421 | 3300046454 | Unclassified | 1310 |
| 732 | Ga0495603_0005805 | 3300046455 | Bacteria | 7386 |
| 733 | Ga0495629_0011719 | 3300046459 | Bacteria | 6363 |
| 734 | Ga0495629_0058049 | 3300046459 | Bacteria | 2705 |
| 735 | Ga0495629_0119928 | 3300046459 | Bacteria | 1832 |
| 736 | Ga0495629_0138852 | 3300046459 | Bacteria | 1691 |
| 737 | Ga0495638_0040776 | 3300046460 | Bacteria | 2941 |
| 738 | Ga0495641_0114206 | 3300046461 | Bacteria | 1205 |
| 739 | Ga0495651_0001797 | 3300046462 | Bacteria | 16534 |
| 740 | Ga0495651_0002458 | 3300046462 | Bacteria | 14320 |
| 741 | Ga0495651_0102658 | 3300046462 | Bacteria | 2126 |
| 742 | Ga0495651_0122042 | 3300046462 | Bacteria | 1913 |
| 743 | Ga0495653_0000198 | 3300046463 | Bacteria | 49009 |
| 744 | Ga0495653_0004136 | 3300046463 | Bacteria | 11738 |
| 745 | Ga0495580_0040833 | 3300046472 | Bacteria | 3312 |
| 746 | Ga0495580_0061228 | 3300046472 | Unclassified | 2643 |
| 747 | Ga0495580_0119187 | 3300046472 | Bacteria | 1832 |
| 748 | Ga0495582_0005522 | 3300046473 | Bacteria | 7041 |
| 749 | Ga0495582_0016019 | 3300046473 | Bacteria | 4110 |
| 750 | Ga0495639_0006740 | 3300046475 | Bacteria | 4938 |
| 751 | Ga0495639_0008343 | 3300046475 | Bacteria | 4444 |
| 752 | Ga0495662_0000120 | 3300046476 | Bacteria | 29299 |
| 753 | Ga0495662_0014500 | 3300046476 | Bacteria | 3832 |
| 754 | Ga0495662_0020161 | 3300046476 | Unclassified | 3225 |
| 755 | Ga0495662_0054445 | 3300046476 | Bacteria | 1933 |
| 756 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 757 | Ga0495664_0005200 | 3300046477 | Bacteria | 7139 |
| 758 | Ga0495664_0008599 | 3300046477 | Bacteria | 5694 |
| 759 | Ga0495664_0013009 | 3300046477 | Bacteria | 4717 |
| 760 | Ga0495664_0026579 | 3300046477 | Bacteria | 3371 |
| 761 | Ga0495664_0044351 | 3300046477 | Bacteria | 2635 |
| 762 | Ga0495664_0045474 | 3300046477 | Bacteria | 2604 |
| 763 | Ga0495584_0031479 | 3300046491 | Bacteria | 2685 |
| 764 | Ga0495584_0036372 | 3300046491 | Bacteria | 2488 |
| 765 | Ga0495584_0101692 | 3300046491 | Bacteria | 1453 |
| 766 | Ga0495584_0113005 | 3300046491 | Bacteria | 1374 |
| 767 | Ga0495585_0000974 | 3300046492 | Bacteria | 24017 |
| 768 | Ga0495585_0003315 | 3300046492 | Bacteria | 10936 |
| 769 | Ga0495594_0012849 | 3300046499 | Bacteria | 4366 |
| 770 | Ga0495594_0110720 | 3300046499 | Bacteria | 1548 |
| 771 | Ga0495607_0011320 | 3300046501 | Bacteria | 5946 |
| 772 | Ga0495607_0053322 | 3300046501 | Bacteria | 2338 |
| 773 | Ga0495583_0110669 | 3300046506 | Bacteria | 1164 |
| 774 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 775 | Ga0495608_0014611 | 3300046511 | Bacteria | 5447 |
| 776 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 777 | Ga0495618_0015542 | 3300046514 | Bacteria | 4646 |
| 778 | Ga0495618_0045534 | 3300046514 | Bacteria | 2768 |
| 779 | Ga0495618_0047633 | 3300046514 | Bacteria | 2706 |
| 780 | Ga0495618_0050474 | 3300046514 | Bacteria | 2627 |
| 781 | Ga0495620_0072358 | 3300046515 | Bacteria | 1408 |
| 782 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 783 | Ga0495628_0003390 | 3300046516 | Bacteria | 14259 |
| 784 | Ga0495628_0018942 | 3300046516 | Bacteria | 5696 |
| 785 | Ga0495630_0000614 | 3300046517 | Bacteria | 25848 |
| 786 | Ga0495630_0010078 | 3300046517 | Bacteria | 6810 |
| 787 | Ga0495630_0014768 | 3300046517 | Bacteria | 5694 |
| 788 | Ga0495630_0029099 | 3300046517 | Bacteria | 4106 |
| 789 | Ga0495630_0120146 | 3300046517 | Bacteria | 1993 |
| 790 | Ga0495630_0198099 | 3300046517 | Bacteria | 1533 |
| 791 | Ga0495630_0464014 | 3300046517 | Bacteria | 970 |
| 792 | Ga0495631_0039801 | 3300046518 | Bacteria | 2084 |
| 793 | Ga0495637_0028471 | 3300046520 | Bacteria | 2496 |
| 794 | Ga0495644_0002940 | 3300046523 | Bacteria | 6769 |
| 795 | Ga0495666_0004626 | 3300046526 | Bacteria | 6956 |
| 796 | Ga0495666_0057477 | 3300046526 | Bacteria | 1862 |
| 797 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 798 | Ga0495652_0242432 | 3300046529 | Unclassified | 1340 |
| 799 | Ga0495665_0010156 | 3300046531 | Bacteria | 5102 |
| 800 | Ga0495665_0017638 | 3300046531 | Bacteria | 3839 |
| 801 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 802 | Ga0495640_0030306 | 3300046533 | Bacteria | 3875 |
| 803 | Ga0495640_0063677 | 3300046533 | Unclassified | 2496 |
| 804 | Ga0495640_0123766 | 3300046533 | Bacteria | 1678 |
| 805 | Ga0495586_0008910 | 3300046535 | Bacteria | 5341 |
| 806 | Ga0495586_0019766 | 3300046535 | Bacteria | 3587 |
| 807 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 808 | Ga0495587_0002521 | 3300046536 | Bacteria | 12231 |
| 809 | Ga0495587_0015010 | 3300046536 | Bacteria | 4842 |
| 810 | Ga0495587_0107890 | 3300046536 | Bacteria | 1601 |
| 811 | Ga0495598_0000679 | 3300046537 | Bacteria | 6453 |
| 812 | Ga0495598_0002660 | 3300046537 | Bacteria | 3702 |
| 813 | Ga0495621_0010608 | 3300046539 | Bacteria | 2825 |
| 814 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 815 | Ga0495645_0002657 | 3300046543 | Bacteria | 12151 |
| 816 | Ga0495645_0031265 | 3300046543 | Bacteria | 3878 |
| 817 | Ga0495645_0140918 | 3300046543 | Bacteria | 1682 |
| 818 | Ga0495645_0203422 | 3300046543 | Bacteria | 1341 |
| 819 | Ga0495622_0060015 | 3300046557 | Bacteria | 1761 |
| 820 | Ga0495622_0083307 | 3300046557 | Bacteria | 1471 |
| 821 | Ga0495633_0002331 | 3300046558 | Bacteria | 13493 |
| 822 | Ga0495633_0034464 | 3300046558 | Bacteria | 2435 |
| 823 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 824 | Ga0495667_0002603 | 3300046559 | Bacteria | 12042 |
| 825 | Ga0495667_0009295 | 3300046559 | Bacteria | 6666 |
| 826 | Ga0495667_0012554 | 3300046559 | Bacteria | 5745 |
| 827 | Ga0495656_0000276 | 3300046615 | Bacteria | 18021 |
| 828 | Ga0495656_0026771 | 3300046615 | Bacteria | 2299 |
| 829 | Ga0495634_0000129 | 3300046642 | Bacteria | 65082 |
| 830 | Ga0495634_0018616 | 3300046642 | Bacteria | 4940 |
| 831 | Ga0495611_0007172 | 3300046648 | Bacteria | 4737 |
| 832 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 833 | Ga0495635_0000228 | 3300046663 | Bacteria | 35689 |
| 834 | Ga0495635_0012601 | 3300046663 | Bacteria | 5929 |
| 835 | Ga0495635_0038244 | 3300046663 | Bacteria | 3322 |
| 836 | Ga0495635_0044905 | 3300046663 | Unclassified | 3048 |
| 837 | Ga0495635_0053072 | 3300046663 | Unclassified | 2793 |
| 838 | Ga0495659_0005354 | 3300046664 | Bacteria | 4037 |
| 839 | Ga0495659_0008097 | 3300046664 | Bacteria | 3340 |
| 840 | Ga0495659_0038928 | 3300046664 | Bacteria | 1690 |
| 841 | Ga0495588_0075174 | 3300046674 | Bacteria | 1759 |
| 842 | Ga0495657_0003205 | 3300046675 | Bacteria | 13466 |
| 843 | Ga0495657_0107953 | 3300046675 | Bacteria | 1766 |
| 844 | Ga0495657_0300079 | 3300046675 | Unclassified | 958 |
| 845 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 846 | Ga0495599_0021069 | 3300046678 | Bacteria | 4064 |
| 847 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 848 | Ga0495623_0002818 | 3300046679 | Bacteria | 11469 |
| 849 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 850 | Ga0495646_0006855 | 3300046680 | Bacteria | 7227 |
| 851 | Ga0495646_0024897 | 3300046680 | Bacteria | 3765 |
| 852 | Ga0495646_0162082 | 3300046680 | Bacteria | 1237 |
| 853 | Ga0495647_0009865 | 3300046681 | Bacteria | 3242 |
| 854 | Ga0495647_0019448 | 3300046681 | Bacteria | 2428 |
| 855 | Ga0495658_0012528 | 3300046683 | Unclassified | 4299 |
| 856 | Ga0495658_0035323 | 3300046683 | Bacteria | 2749 |
| 857 | Ga0495658_0046832 | 3300046683 | Bacteria | 2432 |
| 858 | Ga0495658_0084318 | 3300046683 | Bacteria | 1871 |
| 859 | Ga0495658_0229383 | 3300046683 | Bacteria | 1164 |
| 860 | Ga0495658_0242432 | 3300046683 | Bacteria | 1132 |
| 861 | Ga0495669_0034594 | 3300046684 | Bacteria | 2228 |
| 862 | Ga0495613_0054998 | 3300046689 | Bacteria | 2926 |
| 863 | Ga0495624_0001327 | 3300046690 | Bacteria | 19374 |
| 864 | Ga0495624_0006348 | 3300046690 | Bacteria | 8396 |
| 865 | Ga0495624_0021998 | 3300046690 | Bacteria | 4222 |
| 866 | Ga0495624_0073506 | 3300046690 | Bacteria | 2125 |
| 867 | Ga0495670_0006527 | 3300046691 | Bacteria | 5733 |
| 868 | Ga0495670_0100562 | 3300046691 | Bacteria | 1489 |
| 869 | Ga0495670_0114477 | 3300046691 | Bacteria | 1398 |
| 870 | Ga0495670_0152763 | 3300046691 | Bacteria | 1211 |
| 871 | Ga0495649_0201721 | 3300046694 | Bacteria | 1033 |
| 872 | Ga0495589_0121915 | 3300046794 | Bacteria | 1255 |
| 873 | Ga0495600_0000233 | 3300046809 | Bacteria | 30755 |
| 874 | Ga0495600_0004973 | 3300046809 | Bacteria | 7983 |
| 875 | Ga0495600_0052214 | 3300046809 | Bacteria | 2669 |
| 876 | Ga0495581_0008425 | 3300047315 | Bacteria | 5977 |
| 877 | Ga0495581_0015024 | 3300047315 | Bacteria | 4493 |
| 878 | Ga0495581_0040690 | 3300047315 | Bacteria | 2688 |
| 879 | Ga0495581_0094432 | 3300047315 | Bacteria | 1736 |
| 880 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 881 | Ga0495604_0009051 | 3300047317 | Bacteria | 7878 |
| 882 | Ga0495604_0011548 | 3300047317 | Bacteria | 7019 |
| 883 | Ga0495604_0011991 | 3300047317 | Bacteria | 6890 |
| 884 | Ga0495604_0046824 | 3300047317 | Unclassified | 3371 |
| 885 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 886 | Ga0495674_0238580 | 3300047319 | Bacteria | 1499 |
| 887 | Ga0495674_0319355 | 3300047319 | Bacteria | 1265 |
| 888 | Ga0495674_0411959 | 3300047319 | Bacteria | 1090 |
| 889 | Ga0495676_0041475 | 3300047321 | Bacteria | 3788 |
| 890 | Ga0495676_0114581 | 3300047321 | Bacteria | 1972 |
| 891 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 892 | Ga0495680_0004358 | 3300047322 | Bacteria | 13558 |
| 893 | Ga0495680_0006209 | 3300047322 | Bacteria | 11135 |
| 894 | Ga0495680_0023741 | 3300047322 | Bacteria | 5096 |
| 895 | Ga0495680_0025295 | 3300047322 | Bacteria | 4916 |
| 896 | Ga0495680_0030097 | 3300047322 | Bacteria | 4437 |
| 897 | Ga0495675_0000437 | 3300047444 | Bacteria | 27820 |
| 898 | Ga0495675_0005683 | 3300047444 | Bacteria | 7620 |
| 899 | Ga0495675_0055898 | 3300047444 | Bacteria | 2503 |
| 900 | Ga0495679_026104 | 3300047446 | Bacteria | 1944 |
| 901 | Ga0495681_0064309 | 3300047470 | Bacteria | 1681 |
| 902 | Ga0495684_0000020 | 3300047471 | Bacteria | 148507 |
| 903 | Ga0495684_0001167 | 3300047471 | Bacteria | 21128 |
| 904 | Ga0495684_0032210 | 3300047471 | Bacteria | 4024 |
| 905 | Ga0495684_0032750 | 3300047471 | Bacteria | 3992 |
| 906 | Ga0495684_0089052 | 3300047471 | Bacteria | 2339 |
| 907 | Ga0495684_0134838 | 3300047471 | Bacteria | 1853 |
| 908 | Ga0495684_0435367 | 3300047471 | Bacteria | 914 |
| 909 | Ga0495593_0002594 | 3300047673 | Bacteria | 10863 |
| 910 | Ga0495593_0008133 | 3300047673 | Bacteria | 6104 |
| 911 | Ga0495593_0056054 | 3300047673 | Bacteria | 2072 |
| 912 | Ga0495602_0000027 | 3300048088 | Bacteria | 145010 |
| 913 | Ga0495602_0004518 | 3300048088 | Bacteria | 14518 |
| 914 | Ga0495602_0007000 | 3300048088 | Bacteria | 11841 |
| 915 | Ga0495602_0123396 | 3300048088 | Bacteria | 2079 |
| 916 | Ga0496100_0000530 | 3300048903 | Bacteria | 18154 |
| 917 | Ga0496100_0025275 | 3300048903 | Bacteria | 3631 |
| 918 | Ga0496100_0035456 | 3300048903 | Bacteria | 3137 |
| 919 | Ga0496100_0042520 | 3300048903 | Bacteria | 2902 |
| 920 | Ga0496100_0103199 | 3300048903 | Bacteria | 1968 |
| 921 | Ga0496100_0176299 | 3300048903 | Bacteria | 1543 |
| 922 | Ga0496100_0270459 | 3300048903 | Bacteria | 1263 |
| 923 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 924 | Ga0496101_0006701 | 3300048904 | Bacteria | 7428 |
| 925 | Ga0496101_0010732 | 3300048904 | Bacteria | 6058 |
| 926 | Ga0496101_0026690 | 3300048904 | Bacteria | 4016 |
| 927 | Ga0496101_0232010 | 3300048904 | Bacteria | 1435 |
| 928 | Ga0496101_0284729 | 3300048904 | Unclassified | 1292 |
| 929 | Ga0496101_0391742 | 3300048904 | Bacteria | 1093 |
| 930 | Ga0496102_0007437 | 3300048905 | Bacteria | 9358 |
| 931 | Ga0496102_0045796 | 3300048905 | Bacteria | 3971 |
| 932 | Ga0496102_0055352 | 3300048905 | Bacteria | 3617 |
| 933 | Ga0496102_0066802 | 3300048905 | Bacteria | 3296 |
| 934 | Ga0496102_0143158 | 3300048905 | Bacteria | 2242 |
| 935 | Ga0496102_0199994 | 3300048905 | Bacteria | 1883 |
| 936 | Ga0496102_0228045 | 3300048905 | Bacteria | 1756 |
| 937 | Ga0496102_0344755 | 3300048905 | Bacteria | 1403 |
| 938 | Ga0496103_0007283 | 3300048906 | Bacteria | 6594 |
| 939 | Ga0496103_0009462 | 3300048906 | Bacteria | 5769 |
| 940 | Ga0496103_0012313 | 3300048906 | Bacteria | 5076 |
| 941 | Ga0496103_0082569 | 3300048906 | Bacteria | 2022 |
| 942 | Ga0496103_0094719 | 3300048906 | Bacteria | 1886 |
| 943 | Ga0496103_0126318 | 3300048906 | Bacteria | 1631 |
| 944 | Ga0496103_0137881 | 3300048906 | Bacteria | 1559 |
| 945 | Ga0496104_0000521 | 3300048907 | Bacteria | 32903 |
| 946 | Ga0496104_0000609 | 3300048907 | Bacteria | 30631 |
| 947 | Ga0496104_0001668 | 3300048907 | Bacteria | 19171 |
| 948 | Ga0496104_0001997 | 3300048907 | Bacteria | 17701 |
| 949 | Ga0496104_0003575 | 3300048907 | Bacteria | 13418 |
| 950 | Ga0496104_0040303 | 3300048907 | Bacteria | 4377 |
| 951 | Ga0496104_0073768 | 3300048907 | Unclassified | 3247 |
| 952 | Ga0496104_0094987 | 3300048907 | Bacteria | 2852 |
| 953 | Ga0496104_0162567 | 3300048907 | Bacteria | 2141 |
| 954 | Ga0496104_0194816 | 3300048907 | Bacteria | 1938 |
| 955 | Ga0496104_0272366 | 3300048907 | Bacteria | 1605 |
| 956 | Ga0496104_0320685 | 3300048907 | Bacteria | 1462 |
| 957 | Ga0496105_0000522 | 3300048908 | Bacteria | 25377 |
| 958 | Ga0496105_0004673 | 3300048908 | Bacteria | 10323 |
| 959 | Ga0496105_0006301 | 3300048908 | Bacteria | 9113 |
| 960 | Ga0496105_0010845 | 3300048908 | Bacteria | 7174 |
| 961 | Ga0496105_0023006 | 3300048908 | Bacteria | 5053 |
| 962 | Ga0496105_0044524 | 3300048908 | Bacteria | 3660 |
| 963 | Ga0496105_0059404 | 3300048908 | Bacteria | 3155 |
| 964 | Ga0496105_0149860 | 3300048908 | Bacteria | 1917 |
| 965 | Ga0496105_0173093 | 3300048908 | Bacteria | 1769 |
| 966 | Ga0496105_0208985 | 3300048908 | Bacteria | 1591 |
| 967 | Ga0496105_0230454 | 3300048908 | Bacteria | 1505 |
| 968 | Ga0496106_0016847 | 3300048909 | Bacteria | 5407 |
| 969 | Ga0496106_0047971 | 3300048909 | Bacteria | 3215 |
| 970 | Ga0496106_0063613 | 3300048909 | Bacteria | 2805 |
| 971 | Ga0496106_0080493 | 3300048909 | Bacteria | 2501 |
| 972 | Ga0496106_0100557 | 3300048909 | Bacteria | 2242 |
| 973 | Ga0496106_0217356 | 3300048909 | Bacteria | 1523 |
| 974 | Ga0496107_0011126 | 3300048910 | Bacteria | 6259 |
| 975 | Ga0496107_0018052 | 3300048910 | Bacteria | 4963 |
| 976 | Ga0496107_0021420 | 3300048910 | Bacteria | 4568 |
| 977 | Ga0496107_0059427 | 3300048910 | Bacteria | 2766 |
| 978 | Ga0496107_0072869 | 3300048910 | Bacteria | 2497 |
| 979 | Ga0496107_0083486 | 3300048910 | Bacteria | 2329 |
| 980 | Ga0496107_0145235 | 3300048910 | Bacteria | 1754 |
| 981 | Ga0496108_0000510 | 3300048911 | Bacteria | 30463 |
| 982 | Ga0496108_0004455 | 3300048911 | Bacteria | 11275 |
| 983 | Ga0496108_0004887 | 3300048911 | Bacteria | 10820 |
| 984 | Ga0496108_0013258 | 3300048911 | Bacteria | 6717 |
| 985 | Ga0496108_0018809 | 3300048911 | Bacteria | 5663 |
| 986 | Ga0496108_0021834 | 3300048911 | Bacteria | 5261 |
| 987 | Ga0496108_0134439 | 3300048911 | Bacteria | 2126 |
| 988 | Ga0496108_0611468 | 3300048911 | Unclassified | 949 |
| 989 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 990 | Ga0496109_0000549 | 3300048912 | Bacteria | 31751 |
| 991 | Ga0496109_0001318 | 3300048912 | Bacteria | 20466 |
| 992 | Ga0496109_0009996 | 3300048912 | Bacteria | 8100 |
| 993 | Ga0496109_0012777 | 3300048912 | Bacteria | 7259 |
| 994 | Ga0496109_0018377 | 3300048912 | Bacteria | 6143 |
| 995 | Ga0496109_0026343 | 3300048912 | Bacteria | 5184 |
| 996 | Ga0496109_0027049 | 3300048912 | Bacteria | 5118 |
| 997 | Ga0496109_0056170 | 3300048912 | Bacteria | 3592 |
| 998 | Ga0496109_0078046 | 3300048912 | Bacteria | 3048 |
| 999 | Ga0496109_0104177 | 3300048912 | Bacteria | 2634 |
| 1000 | Ga0496109_0160352 | 3300048912 | Bacteria | 2107 |
| 1001 | Ga0496110_0007131 | 3300048913 | Bacteria | 8897 |
| 1002 | Ga0496110_0013969 | 3300048913 | Bacteria | 6653 |
| 1003 | Ga0496110_0021488 | 3300048913 | Bacteria | 5466 |
| 1004 | Ga0496110_0031059 | 3300048913 | Bacteria | 4607 |
| 1005 | Ga0496110_0036686 | 3300048913 | Bacteria | 4258 |
| 1006 | Ga0496110_0040347 | 3300048913 | Bacteria | 4068 |
| 1007 | Ga0496110_0081836 | 3300048913 | Bacteria | 2879 |
| 1008 | Ga0496110_0232955 | 3300048913 | Bacteria | 1675 |
| 1009 | Ga0496110_0400142 | 3300048913 | Unclassified | 1252 |
| 1010 | Ga0496110_0704241 | 3300048913 | Bacteria | 911 |
| 1011 | Ga0496111_0001147 | 3300048914 | Bacteria | 14708 |
| 1012 | Ga0496111_0007023 | 3300048914 | Bacteria | 7355 |
| 1013 | Ga0496111_0008713 | 3300048914 | Bacteria | 6731 |
| 1014 | Ga0496111_0015611 | 3300048914 | Bacteria | 5218 |
| 1015 | Ga0496111_0019956 | 3300048914 | Bacteria | 4662 |
| 1016 | Ga0496111_0021342 | 3300048914 | Bacteria | 4521 |
| 1017 | Ga0496111_0038419 | 3300048914 | Bacteria | 3430 |
| 1018 | Ga0496111_0050185 | 3300048914 | Bacteria | 3008 |
| 1019 | Ga0496112_0000320 | 3300048915 | Bacteria | 30902 |
| 1020 | Ga0496112_0003683 | 3300048915 | Bacteria | 12779 |
| 1021 | Ga0496112_0009679 | 3300048915 | Bacteria | 8697 |
| 1022 | Ga0496112_0018028 | 3300048915 | Bacteria | 6643 |
| 1023 | Ga0496112_0103864 | 3300048915 | Bacteria | 2812 |
| 1024 | Ga0496112_0222387 | 3300048915 | Bacteria | 1843 |
| 1025 | Ga0496112_0231888 | 3300048915 | Bacteria | 1800 |
| 1026 | Ga0496112_0319205 | 3300048915 | Bacteria | 1498 |
| 1027 | Ga0496113_0000694 | 3300048916 | Bacteria | 17181 |
| 1028 | Ga0496113_0001247 | 3300048916 | Bacteria | 14000 |
| 1029 | Ga0496113_0002209 | 3300048916 | Bacteria | 11223 |
| 1030 | Ga0496113_0002579 | 3300048916 | Bacteria | 10584 |
| 1031 | Ga0496113_0015034 | 3300048916 | Bacteria | 5301 |
| 1032 | Ga0496113_0074014 | 3300048916 | Bacteria | 2596 |
| 1033 | Ga0496113_0080563 | 3300048916 | Bacteria | 2494 |
| 1034 | Ga0496113_0086396 | 3300048916 | Bacteria | 2410 |
| 1035 | Ga0496113_0113104 | 3300048916 | Bacteria | 2115 |
| 1036 | Ga0496113_0117820 | 3300048916 | Bacteria | 2074 |
| 1037 | Ga0496113_0121135 | 3300048916 | Bacteria | 2045 |
| 1038 | Ga0496114_0001960 | 3300048917 | Bacteria | 15650 |
| 1039 | Ga0496114_0006147 | 3300048917 | Bacteria | 9448 |
| 1040 | Ga0496114_0023853 | 3300048917 | Bacteria | 4992 |
| 1041 | Ga0496114_0037984 | 3300048917 | Bacteria | 3983 |
| 1042 | Ga0496114_0112540 | 3300048917 | Bacteria | 2333 |
| 1043 | Ga0496114_0133269 | 3300048917 | Bacteria | 2147 |
| 1044 | Ga0496115_0002442 | 3300048918 | Bacteria | 13349 |
| 1045 | Ga0496115_0048840 | 3300048918 | Bacteria | 3386 |
| 1046 | Ga0496115_0054588 | 3300048918 | Bacteria | 3208 |
| 1047 | Ga0496115_0063245 | 3300048918 | Bacteria | 2985 |
| 1048 | Ga0496115_0063747 | 3300048918 | Bacteria | 2973 |
| 1049 | Ga0496115_0071024 | 3300048918 | Bacteria | 2823 |
| 1050 | Ga0496115_0101757 | 3300048918 | Bacteria | 2356 |
| 1051 | Ga0496115_0206305 | 3300048918 | Bacteria | 1623 |
| 1052 | Ga0496115_0234026 | 3300048918 | Bacteria | 1514 |
| 1053 | Ga0501031_0185364 | 3300049568 | Bacteria | 1359 |
| 1054 | Ga0501032_0158564 | 3300049569 | Bacteria | 1486 |
| 1055 | Ga0501033_0068879 | 3300049570 | Bacteria | 2601 |
| 1056 | Ga0501038_0014712 | 3300049574 | Bacteria | 7129 |
| 1057 | Ga0501039_0217451 | 3300049575 | Bacteria | 1502 |
| 1058 | Ga0501040_0340746 | 3300049576 | Unclassified | 1073 |
| 1059 | Ga0501041_0079101 | 3300049577 | Bacteria | 2024 |
| 1060 | Ga0501041_0252918 | 3300049577 | Bacteria | 1108 |
| 1061 | Ga0501042_0139463 | 3300049578 | Bacteria | 1748 |
| 1062 | Ga0501046_0246555 | 3300049580 | Bacteria | 1316 |
| 1063 | Ga0501047_0010459 | 3300049581 | Bacteria | 8782 |
| 1064 | Ga0501047_0183893 | 3300049581 | Bacteria | 1956 |
| 1065 | Ga0501070_0002309 | 3300049586 | Bacteria | 16740 |
| 1066 | Ga0501071_0136761 | 3300049587 | Bacteria | 1823 |
| 1067 | Ga0501072_0121802 | 3300049588 | Bacteria | 2078 |
| 1068 | Ga0501075_0020522 | 3300049591 | Bacteria | 4809 |
| 1069 | Ga0501075_0166862 | 3300049591 | Bacteria | 1680 |
| 1070 | Ga0501076_0089633 | 3300049592 | Bacteria | 2473 |
| 1071 | Ga0501077_0028247 | 3300049593 | Bacteria | 3565 |
| 1072 | Ga0501077_0029799 | 3300049593 | Bacteria | 3470 |
| 1073 | Ga0501077_0104723 | 3300049593 | Bacteria | 1793 |
| 1074 | Ga0501079_0054514 | 3300049741 | Bacteria | 3084 |
| 1075 | Ga0501079_0055748 | 3300049741 | Bacteria | 3050 |
| 1076 | Ga0501080_0011011 | 3300049742 | Bacteria | 8280 |
| 1077 | Ga0501080_0199918 | 3300049742 | Unclassified | 1835 |
| 1078 | Ga0501081_0009896 | 3300049743 | Bacteria | 6210 |
| 1079 | Ga0501081_0189936 | 3300049743 | Bacteria | 1487 |
| 1080 | Ga0501081_0262852 | 3300049743 | Bacteria | 1261 |
| 1081 | Ga0501035_0105221 | 3300049822 | Bacteria | 2474 |
| 1082 | Ga0501044_0003904 | 3300049823 | Bacteria | 16712 |
| 1083 | Ga0501044_0182818 | 3300049823 | Bacteria | 2062 |
| 1084 | Ga0501045_0119765 | 3300049824 | Bacteria | 1954 |
| 1085 | Ga0501045_0186746 | 3300049824 | Bacteria | 1544 |
| 1086 | nmdc:mga03683_43898_c1 | 3300050489 | Bacteria | 1846 |
| 1087 | nmdc:mga03n38_186316_c1 | 3300050490 | Unclassified | 1066 |
| 1088 | nmdc:mga03n38_233718_c1 | 3300050490 | Unclassified | 965 |
| 1089 | nmdc:mga03n38_3663_c1 | 3300050490 | Bacteria | 4969 |
| 1090 | nmdc:mga00v17_32310_c1 | 3300050491 | Bacteria | 3093 |
| 1091 | nmdc:mga00v17_4364_c1 | 3300050491 | Bacteria | 7348 |
| 1092 | nmdc:mga00v17_76346_c1 | 3300050491 | Bacteria | 2084 |
| 1093 | nmdc:mga0yw44_13357_c1 | 3300050492 | Bacteria | 4321 |
| 1094 | nmdc:mga0yw44_18648_c1 | 3300050492 | Bacteria | 3807 |
| 1095 | nmdc:mga0yw44_374004_c1 | 3300050492 | Unclassified | 961 |
| 1096 | nmdc:mga0yw44_4721_c1 | 3300050492 | Bacteria | 6307 |
| 1097 | nmdc:mga0yw44_6598_c1 | 3300050492 | Bacteria | 5622 |
| 1098 | nmdc:mga0yw44_8031_c1 | 3300050492 | Bacteria | 5232 |
| 1099 | nmdc:mga06z11_125173_c1 | 3300050494 | Bacteria | 1438 |
| 1100 | nmdc:mga06z11_1492_c1 | 3300050494 | Bacteria | 8693 |
| 1101 | nmdc:mga06z11_2755_c1 | 3300050494 | Bacteria | 6741 |
| 1102 | nmdc:mga06z11_86011_c1 | 3300050494 | Bacteria | 1697 |
| 1103 | nmdc:mga06z11_90716_c1 | 3300050494 | Bacteria | 1658 |
| 1104 | nmdc:mga04h51_13548_c1 | 3300050495 | Bacteria | 2311 |
| 1105 | nmdc:mga04h51_385_c1 | 3300050495 | Bacteria | 10730 |
| 1106 | nmdc:mga07m45_111503_c1 | 3300050496 | Bacteria | 1576 |
| 1107 | nmdc:mga05p37_257695_c1 | 3300050507 | Bacteria | 2089 |
| 1108 | nmdc:mga05p37_362245_c1 | 3300050507 | Bacteria | 1704 |
| 1109 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 1110 | nmdc:mga05p37_6334_c1 | 3300050507 | Bacteria | 13942 |
| 1111 | nmdc:mga05p37_69662_c1 | 3300050507 | Bacteria | 4326 |
| 1112 | nmdc:mga05p37_86999_c1 | 3300050507 | Bacteria | 3852 |
| 1113 | nmdc:mga09592_157633_c1 | 3300050508 | Bacteria | 1960 |
| 1114 | nmdc:mga09592_16963_c1 | 3300050508 | Bacteria | 5959 |
| 1115 | nmdc:mga09592_219912_c1 | 3300050508 | Bacteria | 1646 |
| 1116 | nmdc:mga09592_30185_c1 | 3300050508 | Bacteria | 4510 |
| 1117 | nmdc:mga09592_3702_c1 | 3300050508 | Bacteria | 12324 |
| 1118 | nmdc:mga09592_41127_c1 | 3300050508 | Bacteria | 3886 |
| 1119 | nmdc:mga09592_81559_c1 | 3300050508 | Bacteria | 2756 |
| 1120 | nmdc:mga0qj67_143429_c1 | 3300050509 | Unclassified | 1936 |
| 1121 | nmdc:mga0qj67_59038_c1 | 3300050509 | Bacteria | 3042 |
| 1122 | nmdc:mga0qj67_859_c1 | 3300050509 | Bacteria | 20877 |
| 1123 | nmdc:mga0qj67_90403_c1 | 3300050509 | Bacteria | 2460 |
| 1124 | nmdc:mga0qj67_96238_c1 | 3300050509 | Bacteria | 2384 |
| 1125 | nmdc:mga06r32_135963_c1 | 3300050510 | Bacteria | 2432 |
| 1126 | nmdc:mga06r32_1601_c1 | 3300050510 | Bacteria | 20404 |
| 1127 | nmdc:mga06r32_20013_c1 | 3300050510 | Bacteria | 6153 |
| 1128 | nmdc:mga06r32_22597_c1 | 3300050510 | Bacteria | 5816 |
| 1129 | nmdc:mga06r32_406634_c1 | 3300050510 | Bacteria | 1343 |
| 1130 | nmdc:mga06r32_564439_c1 | 3300050510 | Unclassified | 1111 |
| 1131 | nmdc:mga06r32_57714_c1 | 3300050510 | Bacteria | 3729 |
| 1132 | nmdc:mga06r32_8023_c1 | 3300050510 | Bacteria | 9495 |
| 1133 | nmdc:mga06r32_84087_c1 | 3300050510 | Bacteria | 3101 |
| 1134 | nmdc:mga06r32_87294_c1 | 3300050510 | Bacteria | 3044 |
| 1135 | nmdc:mga08y16_11105_c1 | 3300050511 | Bacteria | 9458 |
| 1136 | nmdc:mga08y16_211407_c1 | 3300050511 | Bacteria | 2009 |
| 1137 | nmdc:mga08y16_290628_c1 | 3300050511 | Unclassified | 1685 |
| 1138 | nmdc:mga08y16_31051_c1 | 3300050511 | Bacteria | 5619 |
| 1139 | nmdc:mga08y16_33421_c1 | 3300050511 | Bacteria | 5402 |
| 1140 | nmdc:mga08y16_55218_c1 | 3300050511 | Bacteria | 4151 |
| 1141 | nmdc:mga08y16_7303_c1 | 3300050511 | Bacteria | 11595 |
| 1142 | nmdc:mga08y16_7641_c1 | 3300050511 | Bacteria | 11313 |
| 1143 | nmdc:mga0n895_125992_c1 | 3300050512 | Bacteria | 2585 |
| 1144 | nmdc:mga0n895_195462_c1 | 3300050512 | Bacteria | 2054 |
| 1145 | nmdc:mga0n895_2584_c1 | 3300050512 | Bacteria | 14215 |
| 1146 | nmdc:mga0n895_3537_c1 | 3300050512 | Bacteria | 12632 |
| 1147 | nmdc:mga0n895_41575_c1 | 3300050512 | Bacteria | 4470 |
| 1148 | nmdc:mga0n895_589653_c1 | 3300050512 | Unclassified | 1115 |
| 1149 | nmdc:mga0n895_637073_c1 | 3300050512 | Bacteria | 1066 |
| 1150 | nmdc:mga0rr50_1087_c1 | 3300050513 | Bacteria | 14763 |
| 1151 | nmdc:mga0rr50_116638_c1 | 3300050513 | Bacteria | 2120 |
| 1152 | nmdc:mga0rr50_177562_c1 | 3300050513 | Bacteria | 1739 |
| 1153 | nmdc:mga0rr50_486212_c1 | 3300050513 | Unclassified | 1049 |
| 1154 | nmdc:mga08x19_22543_c1 | 3300050514 | Bacteria | 3900 |
| 1155 | nmdc:mga08x19_29198_c1 | 3300050514 | Bacteria | 3458 |
| 1156 | nmdc:mga0a205_108_c1 | 3300050515 | Bacteria | 47940 |
| 1157 | nmdc:mga0a205_1492_c1 | 3300050515 | Bacteria | 19963 |
| 1158 | nmdc:mga0a205_16737_c1 | 3300050515 | Bacteria | 6866 |
| 1159 | nmdc:mga0a205_397110_c1 | 3300050515 | Unclassified | 1243 |
| 1160 | nmdc:mga0a205_9612_c2 | 3300050515 | Bacteria | 7025 |
| 1161 | nmdc:mga0sz30_27493_c1 | 3300050516 | Bacteria | 2337 |
| 1162 | Ga0495601_0000010 | 3300053077 | Bacteria | 266222 |
| 1163 | Ga0495601_0000958 | 3300053077 | Bacteria | 15765 |
| 1164 | Ga0495601_0002291 | 3300053077 | Bacteria | 10796 |
| 1165 | Ga0495601_0002987 | 3300053077 | Bacteria | 9630 |
| 1166 | Ga0495601_0004285 | 3300053077 | Bacteria | 8240 |
| 1167 | Ga0495601_0125081 | 3300053077 | Bacteria | 1672 |
| 1168 | Ga0495601_0127933 | 3300053077 | Bacteria | 1653 |
| 1169 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 1170 | Ga0495612_0000276 | 3300053078 | Bacteria | 21133 |
| 1171 | Ga0495612_0003620 | 3300053078 | Bacteria | 6406 |
| 1172 | Ga0495612_0006758 | 3300053078 | Bacteria | 4698 |
| 1173 | Ga0495612_0014054 | 3300053078 | Bacteria | 3223 |
| 1174 | Ga0495612_0015295 | 3300053078 | Bacteria | 3076 |
| 1175 | Ga0495655_0010583 | 3300053083 | Bacteria | 1825 |
| 1176 | Ga0495595_0000596 | 3300053084 | Bacteria | 13772 |
| 1177 | Ga0495595_0001532 | 3300053084 | Bacteria | 9013 |
| 1178 | Ga0495595_0003189 | 3300053084 | Bacteria | 6502 |
| 1179 | Ga0495595_0009479 | 3300053084 | Bacteria | 4029 |
| 1180 | Ga0495595_0018002 | 3300053084 | Bacteria | 3047 |
| 1181 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1182 | Ga0495619_0000108 | 3300053085 | Bacteria | 62197 |
| 1183 | Ga0495619_0000681 | 3300053085 | Bacteria | 22230 |
| 1184 | Ga0495619_0000763 | 3300053085 | Bacteria | 21009 |
| 1185 | Ga0495619_0005840 | 3300053085 | Bacteria | 7799 |
| 1186 | Ga0495619_0011867 | 3300053085 | Bacteria | 5489 |
| 1187 | Ga0495619_0125536 | 3300053085 | Bacteria | 1761 |
| 1188 | Ga0500643_013638 | 3300053087 | Bacteria | 2861 |
| 1189 | Ga0500583_0029157 | 3300053092 | Bacteria | 2402 |
| 1190 | Ga0500566_0065245 | 3300053094 | Bacteria | 2054 |
| 1191 | Ga0500593_018155 | 3300053117 | Bacteria | 3063 |
| 1192 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1193 | Ga0500595_015113 | 3300053119 | Bacteria | 2903 |
| 1194 | Ga0500652_029920 | 3300053131 | Bacteria | 2127 |
| 1195 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1196 | Ga0500616_0108274 | 3300053153 | Bacteria | 1347 |
| 1197 | Ga0500636_0084814 | 3300053177 | Bacteria | 1821 |
| 1198 | Ga0500645_000165 | 3300053730 | Bacteria | 51801 |
| 1199 | Ga0501084_0262452 | 3300054114 | Bacteria | 1458 |
| 1200 | Ga0501082_0128696 | 3300060353 | Bacteria | 2197 |
| 1201 | Ga0501082_0162101 | 3300060353 | Bacteria | 1943 |
| 1202 | Ga0501082_0217372 | 3300060353 | Bacteria | 1663 |
| 1203 | Ga0501082_0507886 | 3300060353 | Bacteria | 1054 |
| 1204 | Ga0530510_0112859 | 3300061734 | Bacteria | 1991 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006353 | Ga0075370_10003364 | Ga0075370_100033648 | 251 |
| 2 | 3300050496 | nmdc:mga07m45_111503_c1 | nmdc:mga07m45_111503_c1_608_1483 | 251 |
| 3 | 3300006844 | Ga0075428_100002517 | Ga0075428_1000025178 | 262 |
| 4 | 3300006846 | Ga0075430_100024166 | Ga0075430_1000241663 | 262 |
| 5 | 3300006847 | Ga0075431_100001498 | Ga0075431_10000149811 | 262 |
| 6 | 3300009147 | Ga0114129_10558448 | Ga0114129_105584482 | 262 |
| 7 | 3300050510 | nmdc:mga06r32_22597_c1 | nmdc:mga06r32_22597_c1_238_1137 | 262 |
| 8 | 3300006038 | Ga0075365_10125397 | Ga0075365_101253972 | 263 |
| 9 | 3300006042 | Ga0075368_10005383 | Ga0075368_100053834 | 263 |
| 10 | 3300006042 | Ga0075368_10024807 | Ga0075368_100248072 | 263 |
| 11 | 3300006051 | Ga0075364_10027100 | Ga0075364_100271003 | 263 |
| 12 | 3300006353 | Ga0075370_10029978 | Ga0075370_100299784 | 263 |
| 13 | 3300006353 | Ga0075370_10136984 | Ga0075370_101369842 | 263 |
| 14 | 3300027866 | Ga0209813_10016822 | Ga0209813_100168222 | 263 |
| 15 | 3300031911 | Ga0307412_10248251 | Ga0307412_102482511 | 263 |
| 16 | 3300050491 | nmdc:mga00v17_32310_c1 | nmdc:mga00v17_32310_c1_1519_2388 | 263 |
| 17 | 3300050492 | nmdc:mga0yw44_18648_c1 | nmdc:mga0yw44_18648_c1_1241_2110 | 263 |
| 18 | 3300050494 | nmdc:mga06z11_125173_c1 | nmdc:mga06z11_125173_c1_122_991 | 263 |
| 19 | 3300050495 | nmdc:mga04h51_13548_c1 | nmdc:mga04h51_13548_c1_1297_2166 | 263 |
| 20 | 3300050516 | nmdc:mga0sz30_27493_c1 | nmdc:mga0sz30_27493_c1_195_1064 | 263 |
| 21 | 3300050490 | nmdc:mga03n38_233718_c1 | nmdc:mga03n38_233718_c1_75_944 | 264 |
| 22 | 3300006844 | Ga0075428_100438982 | Ga0075428_1004389822 | 265 |
| 23 | 3300046491 | Ga0495584_0036372 | Ga0495584_0036372_953_1834 | 265 |
| 24 | 3300046615 | Ga0495656_0026771 | Ga0495656_0026771_591_1472 | 265 |
| 25 | 3300050510 | nmdc:mga06r32_406634_c1 | nmdc:mga06r32_406634_c1_440_1324 | 265 |
| 26 | 3300006880 | Ga0075429_100018152 | Ga0075429_1000181525 | 266 |
| 27 | 3300046691 | Ga0495670_0100562 | Ga0495670_0100562_420_1301 | 266 |
| 28 | 3300048907 | Ga0496104_0000609 | Ga0496104_0000609_23272_24153 | 266 |
| 29 | 3300048908 | Ga0496105_0004673 | Ga0496105_0004673_4499_5380 | 266 |
| 30 | 3300048912 | Ga0496109_0160352 | Ga0496109_0160352_214_1095 | 266 |
| 31 | 3300048918 | Ga0496115_0054588 | Ga0496115_0054588_680_1561 | 266 |
| 32 | 3300005456 | Ga0070678_100071899 | Ga0070678_1000718991 | 267 |
| 33 | 3300005937 | Ga0081455_10029855 | Ga0081455_100298554 | 267 |
| 34 | 3300005981 | Ga0081538_10040866 | Ga0081538_100408662 | 267 |
| 35 | 3300005981 | Ga0081538_10070963 | Ga0081538_100709632 | 267 |
| 36 | 3300048905 | Ga0496102_0344755 | Ga0496102_0344755_168_1094 | 267 |
| 37 | 3300049578 | Ga0501042_0139463 | Ga0501042_0139463_572_1459 | 267 |
| 38 | 3300049591 | Ga0501075_0166862 | Ga0501075_0166862_742_1629 | 267 |
| 39 | 3300049742 | Ga0501080_0199918 | Ga0501080_0199918_557_1444 | 267 |
| 40 | 3300005983 | Ga0081540_1000703 | Ga0081540_10007032 | 268 |
| 41 | 3300006038 | Ga0075365_10009291 | Ga0075365_100092914 | 268 |
| 42 | 3300006844 | Ga0075428_100211834 | Ga0075428_1002118342 | 268 |
| 43 | 3300009147 | Ga0114129_10443157 | Ga0114129_104431572 | 268 |
| 44 | 3300049576 | Ga0501040_0340746 | Ga0501040_0340746_108_992 | 268 |
| 45 | 3300049577 | Ga0501041_0252918 | Ga0501041_0252918_15_899 | 268 |
| 46 | 3300049593 | Ga0501077_0104723 | Ga0501077_0104723_243_1127 | 268 |
| 47 | 3300049741 | Ga0501079_0055748 | Ga0501079_0055748_1271_2155 | 268 |
| 48 | 3300049743 | Ga0501081_0262852 | Ga0501081_0262852_13_897 | 268 |
| 49 | 3300050492 | nmdc:mga0yw44_8031_c1 | nmdc:mga0yw44_8031_c1_2872_3756 | 268 |
| 50 | 3300050507 | nmdc:mga05p37_362245_c1 | nmdc:mga05p37_362245_c1_477_1370 | 268 |
| 51 | 3300050508 | nmdc:mga09592_81559_c1 | nmdc:mga09592_81559_c1_502_1395 | 268 |
| 52 | 3300054114 | Ga0501084_0262452 | Ga0501084_0262452_290_1174 | 268 |
| 53 | 3300006844 | Ga0075428_100146801 | Ga0075428_1001468012 | 269 |
| 54 | 3300006880 | Ga0075429_100034246 | Ga0075429_1000342465 | 269 |
| 55 | 3300050508 | nmdc:mga09592_30185_c1 | nmdc:mga09592_30185_c1_3111_4001 | 269 |
| 56 | 3300050510 | nmdc:mga06r32_564439_c1 | nmdc:mga06r32_564439_c1_133_1023 | 269 |
| 57 | 3300006844 | Ga0075428_100403846 | Ga0075428_1004038462 | 270 |
| 58 | 3300006847 | Ga0075431_100003463 | Ga0075431_10000346314 | 270 |
| 59 | 3300047319 | Ga0495674_0411959 | Ga0495674_0411959_98_976 | 270 |
| 60 | 3300050508 | nmdc:mga09592_16963_c1 | nmdc:mga09592_16963_c1_3796_4686 | 270 |
| 61 | 3300050510 | nmdc:mga06r32_1601_c1 | nmdc:mga06r32_1601_c1_18043_18933 | 270 |
| 62 | 3300006844 | Ga0075428_100064578 | Ga0075428_1000645783 | 271 |
| 63 | 3300006847 | Ga0075431_100191858 | Ga0075431_1001918583 | 271 |
| 64 | 3300006880 | Ga0075429_100240601 | Ga0075429_1002406013 | 271 |
| 65 | 3300047471 | Ga0495684_0435367 | Ga0495684_0435367_13_840 | 271 |
| 66 | 3300049824 | Ga0501045_0119765 | Ga0501045_0119765_54_998 | 271 |
| 67 | 3300050507 | nmdc:mga05p37_257695_c1 | nmdc:mga05p37_257695_c1_884_1765 | 271 |
| 68 | 3300050508 | nmdc:mga09592_41127_c1 | nmdc:mga09592_41127_c1_985_1866 | 271 |
| 69 | 3300050509 | nmdc:mga0qj67_96238_c1 | nmdc:mga0qj67_96238_c1_588_1469 | 271 |
| 70 | 3300050510 | nmdc:mga06r32_87294_c1 | nmdc:mga06r32_87294_c1_588_1469 | 271 |
| 71 | 3300025928 | Ga0207700_10149000 | Ga0207700_101490002 | 272 |
| 72 | 3300005337 | Ga0070682_100151701 | Ga0070682_1001517012 | 273 |
| 73 | 3300005547 | Ga0070693_100101423 | Ga0070693_1001014232 | 273 |
| 74 | 3300050494 | nmdc:mga06z11_86011_c1 | nmdc:mga06z11_86011_c1_661_1596 | 273 |
| 75 | 3300053077 | Ga0495601_0125081 | Ga0495601_0125081_54_932 | 273 |
| 76 | 3300035113 | Ga0373936_0010154 | Ga0373936_0010154_1869_2741 | 275 |
| 77 | 3300035170 | Ga0373943_0000467 | Ga0373943_0000467_2805_3677 | 275 |
| 78 | 3300035171 | Ga0373946_0000540 | Ga0373946_0000540_8067_8939 | 275 |
| 79 | 3300035692 | Ga0373935_0000403 | Ga0373935_0000403_14986_15858 | 275 |
| 80 | 3300035695 | Ga0373927_0006910 | Ga0373927_0006910_4219_5091 | 275 |
| 81 | 3300035725 | Ga0373947_0000986 | Ga0373947_0000986_796_1668 | 275 |
| 82 | 3300046459 | Ga0495629_0138852 | Ga0495629_0138852_22_894 | 275 |
| 83 | 3300046472 | Ga0495580_0061228 | Ga0495580_0061228_1406_2278 | 275 |
| 84 | 3300046514 | Ga0495618_0047633 | Ga0495618_0047633_838_1710 | 275 |
| 85 | 3300046517 | Ga0495630_0010078 | Ga0495630_0010078_3983_4855 | 275 |
| 86 | 3300046533 | Ga0495640_0063677 | Ga0495640_0063677_1379_2251 | 275 |
| 87 | 3300046663 | Ga0495635_0044905 | Ga0495635_0044905_1450_2322 | 275 |
| 88 | 3300046683 | Ga0495658_0242432 | Ga0495658_0242432_222_1094 | 275 |
| 89 | 3300046690 | Ga0495624_0001327 | Ga0495624_0001327_3037_3909 | 275 |
| 90 | 3300047315 | Ga0495581_0008425 | Ga0495581_0008425_5053_5925 | 275 |
| 91 | 3300047471 | Ga0495684_0001167 | Ga0495684_0001167_10701_11573 | 275 |
| 92 | 3300047471 | Ga0495684_0032750 | Ga0495684_0032750_1590_2426 | 275 |
| 93 | 3300047673 | Ga0495593_0056054 | Ga0495593_0056054_1131_2003 | 275 |
| 94 | 3300009551 | Ga0105238_10298302 | Ga0105238_102983021 | 277 |
| 95 | 3300006846 | Ga0075430_100087554 | Ga0075430_1000875543 | 278 |
| 96 | 3300006847 | Ga0075431_100040358 | Ga0075431_1000403582 | 278 |
| 97 | 3300006880 | Ga0075429_100071717 | Ga0075429_1000717173 | 278 |
| 98 | 3300009147 | Ga0114129_10317456 | Ga0114129_103174562 | 278 |
| 99 | 3300046678 | Ga0495599_0021069 | Ga0495599_0021069_633_1496 | 278 |
| 100 | 3300050508 | nmdc:mga09592_219912_c1 | nmdc:mga09592_219912_c1_17_898 | 278 |
| 101 | 3300050509 | nmdc:mga0qj67_59038_c1 | nmdc:mga0qj67_59038_c1_1757_2638 | 278 |
| 102 | 3300025938 | Ga0207704_10547754 | Ga0207704_105477541 | 279 |
| 103 | 3300035083 | Ga0373926_0018822 | Ga0373926_0018822_1522_2361 | 279 |
| 104 | 3300048907 | Ga0496104_0162567 | Ga0496104_0162567_39_878 | 279 |
| 105 | 3300048907 | Ga0496104_0194816 | Ga0496104_0194816_1061_1900 | 279 |
| 106 | 3300048908 | Ga0496105_0149860 | Ga0496105_0149860_1040_1879 | 279 |
| 107 | 3300048911 | Ga0496108_0134439 | Ga0496108_0134439_1261_2100 | 279 |
| 108 | 3300048912 | Ga0496109_0027049 | Ga0496109_0027049_16_855 | 279 |
| 109 | 3300048913 | Ga0496110_0704241 | Ga0496110_0704241_34_873 | 279 |
| 110 | 3300048916 | Ga0496113_0113104 | Ga0496113_0113104_1238_2077 | 279 |
| 111 | 3300048916 | Ga0496113_0121135 | Ga0496113_0121135_1168_2007 | 279 |
| 112 | 3300031241 | Ga0265325_10025489 | Ga0265325_100254892 | 280 |
| 113 | 3300034817 | Ga0373948_0000355 | Ga0373948_0000355_26_868 | 280 |
| 114 | 3300042439 | Ga0439464_0010154 | Ga0439464_0010154_91_933 | 280 |
| 115 | 3300046675 | Ga0495657_0300079 | Ga0495657_0300079_83_928 | 280 |
| 116 | 3300046794 | Ga0495589_0121915 | Ga0495589_0121915_13_855 | 280 |
| 117 | 3300047470 | Ga0495681_0064309 | Ga0495681_0064309_826_1668 | 280 |
| 118 | 3300048912 | Ga0496109_0012777 | Ga0496109_0012777_5668_6570 | 280 |
| 119 | 3300048913 | Ga0496110_0013969 | Ga0496110_0013969_2769_3671 | 280 |
| 120 | 3300048914 | Ga0496111_0007023 | Ga0496111_0007023_3613_4515 | 280 |
| 121 | 3300048916 | Ga0496113_0086396 | Ga0496113_0086396_981_1883 | 280 |
| 122 | 3300048918 | Ga0496115_0071024 | Ga0496115_0071024_30_884 | 280 |
| 123 | 3300049569 | Ga0501032_0158564 | Ga0501032_0158564_19_885 | 280 |
| 124 | 3300031241 | Ga0265325_10051836 | Ga0265325_100518362 | 281 |
| 125 | 3300046526 | Ga0495666_0057477 | Ga0495666_0057477_1004_1849 | 281 |
| 126 | 3300026075 | Ga0207708_10088090 | Ga0207708_100880902 | 283 |
| 127 | 3300030521 | Ga0307511_10000295 | Ga0307511_1000029522 | 283 |
| 128 | 3300053092 | Ga0500583_0029157 | Ga0500583_0029157_754_1683 | 283 |
| 129 | 3300005985 | Ga0081539_10079549 | Ga0081539_100795491 | 284 |
| 130 | 3300009094 | Ga0111539_10033922 | Ga0111539_100339225 | 285 |
| 131 | 3300024225 | Ga0224572_1000107 | Ga0224572_10001074 | 285 |
| 132 | 3300025929 | Ga0207664_10713075 | Ga0207664_107130751 | 285 |
| 133 | 3300028800 | Ga0265338_10049467 | Ga0265338_100494672 | 285 |
| 134 | 3300030763 | Ga0265763_1000456 | Ga0265763_10004562 | 285 |
| 135 | 3300031241 | Ga0265325_10012301 | Ga0265325_100123015 | 285 |
| 136 | 3300031249 | Ga0265339_10000060 | Ga0265339_1000006018 | 285 |
| 137 | 3300031595 | Ga0265313_10000094 | Ga0265313_1000009414 | 285 |
| 138 | 3300031712 | Ga0265342_10046308 | Ga0265342_100463082 | 285 |
| 139 | 3300044694 | Ga0466963_0080802 | Ga0466963_0080802_715_1581 | 285 |
| 140 | 3300045836 | Ga0466958_0027816 | Ga0466958_0027816_2241_3107 | 285 |
| 141 | 3300050511 | nmdc:mga08y16_31051_c1 | nmdc:mga08y16_31051_c1_2932_3804 | 285 |
| 142 | 3300006175 | Ga0070712_100077315 | Ga0070712_1000773152 | 286 |
| 143 | 3300025915 | Ga0207693_10007133 | Ga0207693_100071337 | 286 |
| 144 | 3300031090 | Ga0265760_10002189 | Ga0265760_100021895 | 286 |
| 145 | 3300037068 | Ga0373925_0048570 | Ga0373925_0048570_2002_2871 | 286 |
| 146 | 3300046454 | Ga0495592_0209421 | Ga0495592_0209421_350_1228 | 286 |
| 147 | 3300046459 | Ga0495629_0058049 | Ga0495629_0058049_291_1169 | 286 |
| 148 | 3300046476 | Ga0495662_0000120 | Ga0495662_0000120_21470_22348 | 286 |
| 149 | 3300046477 | Ga0495664_0005200 | Ga0495664_0005200_2861_3739 | 286 |
| 150 | 3300046517 | Ga0495630_0014768 | Ga0495630_0014768_2944_3822 | 286 |
| 151 | 3300046529 | Ga0495652_0242432 | Ga0495652_0242432_399_1277 | 286 |
| 152 | 3300046531 | Ga0495665_0017638 | Ga0495665_0017638_1337_2215 | 286 |
| 153 | 3300046535 | Ga0495586_0008910 | Ga0495586_0008910_1303_2181 | 286 |
| 154 | 3300046642 | Ga0495634_0018616 | Ga0495634_0018616_1747_2625 | 286 |
| 155 | 3300046663 | Ga0495635_0000228 | Ga0495635_0000228_34526_35404 | 286 |
| 156 | 3300048903 | Ga0496100_0270459 | Ga0496100_0270459_247_1107 | 286 |
| 157 | 3300053077 | Ga0495601_0002987 | Ga0495601_0002987_4101_4979 | 286 |
| 158 | 3300053078 | Ga0495612_0015295 | Ga0495612_0015295_158_1036 | 286 |
| 159 | 3300053085 | Ga0495619_0000681 | Ga0495619_0000681_5443_6321 | 286 |
| 160 | 3300053119 | Ga0500595_015113 | Ga0500595_015113_464_1333 | 286 |
| 161 | 3300025912 | Ga0207707_10104369 | Ga0207707_101043691 | 287 |
| 162 | 3300025940 | Ga0207691_10334355 | Ga0207691_103343552 | 287 |
| 163 | 3300033179 | Ga0307507_10018085 | Ga0307507_100180856 | 287 |
| 164 | 3300053177 | Ga0500636_0084814 | Ga0500636_0084814_801_1691 | 287 |
| 165 | 3300009098 | Ga0105245_10520135 | Ga0105245_105201351 | 288 |
| 166 | 3300031238 | Ga0265332_10001020 | Ga0265332_100010206 | 288 |
| 167 | 3300031242 | Ga0265329_10006800 | Ga0265329_100068003 | 288 |
| 168 | 3300031249 | Ga0265339_10002058 | Ga0265339_1000205813 | 288 |
| 169 | 3300031711 | Ga0265314_10027968 | Ga0265314_100279682 | 288 |
| 170 | 3300031712 | Ga0265342_10000908 | Ga0265342_1000090812 | 288 |
| 171 | 3300042876 | Ga0451577_0112202 | Ga0451577_0112202_1334_2242 | 288 |
| 172 | 3300035695 | Ga0373927_0075556 | Ga0373927_0075556_421_1323 | 289 |
| 173 | 3300005471 | Ga0070698_100373033 | Ga0070698_1003730332 | 290 |
| 174 | 3300005937 | Ga0081455_10009618 | Ga0081455_100096186 | 290 |
| 175 | 3300006846 | Ga0075430_100139316 | Ga0075430_1001393163 | 290 |
| 176 | 3300006847 | Ga0075431_100331567 | Ga0075431_1003315671 | 290 |
| 177 | 3300006852 | Ga0075433_10029020 | Ga0075433_100290202 | 290 |
| 178 | 3300006880 | Ga0075429_100110877 | Ga0075429_1001108774 | 290 |
| 179 | 3300007788 | Ga0099795_10001211 | Ga0099795_100012113 | 290 |
| 180 | 3300009147 | Ga0114129_10173981 | Ga0114129_101739812 | 290 |
| 181 | 3300009147 | Ga0114129_10981805 | Ga0114129_109818051 | 290 |
| 182 | 3300031241 | Ga0265325_10000015 | Ga0265325_100000157 | 290 |
| 183 | 3300031595 | Ga0265313_10042478 | Ga0265313_100424782 | 290 |
| 184 | 3300035695 | Ga0373927_0044692 | Ga0373927_0044692_172_1089 | 290 |
| 185 | 3300046683 | Ga0495658_0012528 | Ga0495658_0012528_686_1603 | 290 |
| 186 | 3300048907 | Ga0496104_0001997 | Ga0496104_0001997_12661_13551 | 290 |
| 187 | 3300048907 | Ga0496104_0003575 | Ga0496104_0003575_2544_3425 | 290 |
| 188 | 3300048908 | Ga0496105_0010845 | Ga0496105_0010845_4566_5456 | 290 |
| 189 | 3300048908 | Ga0496105_0023006 | Ga0496105_0023006_2037_2918 | 290 |
| 190 | 3300048909 | Ga0496106_0063613 | Ga0496106_0063613_829_1710 | 290 |
| 191 | 3300048916 | Ga0496113_0080563 | Ga0496113_0080563_621_1502 | 290 |
| 192 | 3300048918 | Ga0496115_0048840 | Ga0496115_0048840_2014_2904 | 290 |
| 193 | 3300049568 | Ga0501031_0185364 | Ga0501031_0185364_26_955 | 290 |
| 194 | 3300049575 | Ga0501039_0217451 | Ga0501039_0217451_69_998 | 290 |
| 195 | 3300049577 | Ga0501041_0079101 | Ga0501041_0079101_576_1466 | 290 |
| 196 | 3300049580 | Ga0501046_0246555 | Ga0501046_0246555_276_1205 | 290 |
| 197 | 3300049587 | Ga0501071_0136761 | Ga0501071_0136761_624_1553 | 290 |
| 198 | 3300049588 | Ga0501072_0121802 | Ga0501072_0121802_745_1674 | 290 |
| 199 | 3300049591 | Ga0501075_0020522 | Ga0501075_0020522_1459_2349 | 290 |
| 200 | 3300049593 | Ga0501077_0028247 | Ga0501077_0028247_261_1151 | 290 |
| 201 | 3300049741 | Ga0501079_0054514 | Ga0501079_0054514_135_1064 | 290 |
| 202 | 3300049743 | Ga0501081_0009896 | Ga0501081_0009896_1958_2848 | 290 |
| 203 | 3300049743 | Ga0501081_0189936 | Ga0501081_0189936_50_979 | 290 |
| 204 | 3300049824 | Ga0501045_0186746 | Ga0501045_0186746_581_1471 | 290 |
| 205 | 3300050508 | nmdc:mga09592_157633_c1 | nmdc:mga09592_157633_c1_993_1874 | 290 |
| 206 | 3300050509 | nmdc:mga0qj67_90403_c1 | nmdc:mga0qj67_90403_c1_588_1469 | 290 |
| 207 | 3300050510 | nmdc:mga06r32_8023_c1 | nmdc:mga06r32_8023_c1_2521_3402 | 290 |
| 208 | 3300060353 | Ga0501082_0128696 | Ga0501082_0128696_116_1045 | 290 |
| 209 | 3300060353 | Ga0501082_0162101 | Ga0501082_0162101_473_1363 | 290 |
| 210 | 3300061734 | Ga0530510_0112859 | Ga0530510_0112859_975_1904 | 290 |
| 211 | 3300002244 | JGI24742J22300_10004778 | JGI24742J22300_100047782 | 291 |
| 212 | 3300002459 | JGI24751J29686_10023645 | JGI24751J29686_100236451 | 291 |
| 213 | 3300005328 | Ga0070676_10205898 | Ga0070676_102058981 | 291 |
| 214 | 3300005329 | Ga0070683_100258412 | Ga0070683_1002584122 | 291 |
| 215 | 3300005331 | Ga0070670_100005523 | Ga0070670_1000055236 | 291 |
| 216 | 3300005334 | Ga0068869_100057061 | Ga0068869_1000570613 | 291 |
| 217 | 3300005337 | Ga0070682_100320423 | Ga0070682_1003204232 | 291 |
| 218 | 3300005338 | Ga0068868_100012588 | Ga0068868_1000125883 | 291 |
| 219 | 3300005340 | Ga0070689_100122081 | Ga0070689_1001220811 | 291 |
| 220 | 3300005343 | Ga0070687_100091140 | Ga0070687_1000911402 | 291 |
| 221 | 3300005347 | Ga0070668_100224592 | Ga0070668_1002245922 | 291 |
| 222 | 3300005353 | Ga0070669_100072198 | Ga0070669_1000721981 | 291 |
| 223 | 3300005354 | Ga0070675_100002553 | Ga0070675_1000025537 | 291 |
| 224 | 3300005356 | Ga0070674_100090875 | Ga0070674_1000908752 | 291 |
| 225 | 3300005365 | Ga0070688_100031492 | Ga0070688_1000314922 | 291 |
| 226 | 3300005365 | Ga0070688_100038650 | Ga0070688_1000386502 | 291 |
| 227 | 3300005367 | Ga0070667_100024417 | Ga0070667_1000244172 | 291 |
| 228 | 3300005406 | Ga0070703_10017256 | Ga0070703_100172562 | 291 |
| 229 | 3300005434 | Ga0070709_10000690 | Ga0070709_1000069019 | 291 |
| 230 | 3300005435 | Ga0070714_100062728 | Ga0070714_1000627283 | 291 |
| 231 | 3300005435 | Ga0070714_100085990 | Ga0070714_1000859901 | 291 |
| 232 | 3300005436 | Ga0070713_100001316 | Ga0070713_10000131615 | 291 |
| 233 | 3300005436 | Ga0070713_100128314 | Ga0070713_1001283142 | 291 |
| 234 | 3300005436 | Ga0070713_100144530 | Ga0070713_1001445302 | 291 |
| 235 | 3300005436 | Ga0070713_100158666 | Ga0070713_1001586662 | 291 |
| 236 | 3300005436 | Ga0070713_100312393 | Ga0070713_1003123932 | 291 |
| 237 | 3300005437 | Ga0070710_10028306 | Ga0070710_100283061 | 291 |
| 238 | 3300005437 | Ga0070710_10055133 | Ga0070710_100551332 | 291 |
| 239 | 3300005439 | Ga0070711_100050532 | Ga0070711_1000505321 | 291 |
| 240 | 3300005439 | Ga0070711_100182385 | Ga0070711_1001823852 | 291 |
| 241 | 3300005440 | Ga0070705_100179574 | Ga0070705_1001795742 | 291 |
| 242 | 3300005455 | Ga0070663_100021688 | Ga0070663_1000216883 | 291 |
| 243 | 3300005455 | Ga0070663_100063026 | Ga0070663_1000630262 | 291 |
| 244 | 3300005466 | Ga0070685_10032054 | Ga0070685_100320543 | 291 |
| 245 | 3300005471 | Ga0070698_100422402 | Ga0070698_1004224022 | 291 |
| 246 | 3300005518 | Ga0070699_100301497 | Ga0070699_1003014972 | 291 |
| 247 | 3300005535 | Ga0070684_100035598 | Ga0070684_1000355984 | 291 |
| 248 | 3300005535 | Ga0070684_100222636 | Ga0070684_1002226362 | 291 |
| 249 | 3300005535 | Ga0070684_100234597 | Ga0070684_1002345972 | 291 |
| 250 | 3300005543 | Ga0070672_100026310 | Ga0070672_1000263102 | 291 |
| 251 | 3300005543 | Ga0070672_100211392 | Ga0070672_1002113922 | 291 |
| 252 | 3300005544 | Ga0070686_100003547 | Ga0070686_1000035474 | 291 |
| 253 | 3300005548 | Ga0070665_100295783 | Ga0070665_1002957832 | 291 |
| 254 | 3300005564 | Ga0070664_100133235 | Ga0070664_1001332352 | 291 |
| 255 | 3300005577 | Ga0068857_100204175 | Ga0068857_1002041752 | 291 |
| 256 | 3300005614 | Ga0068856_100289978 | Ga0068856_1002899782 | 291 |
| 257 | 3300005615 | Ga0070702_100092063 | Ga0070702_1000920632 | 291 |
| 258 | 3300005616 | Ga0068852_100014205 | Ga0068852_1000142056 | 291 |
| 259 | 3300005617 | Ga0068859_100040069 | Ga0068859_1000400692 | 291 |
| 260 | 3300005618 | Ga0068864_100048379 | Ga0068864_1000483793 | 291 |
| 261 | 3300005718 | Ga0068866_10009118 | Ga0068866_100091185 | 291 |
| 262 | 3300005719 | Ga0068861_100253255 | Ga0068861_1002532552 | 291 |
| 263 | 3300005841 | Ga0068863_100015046 | Ga0068863_1000150466 | 291 |
| 264 | 3300005841 | Ga0068863_100248029 | Ga0068863_1002480292 | 291 |
| 265 | 3300005842 | Ga0068858_100076704 | Ga0068858_1000767042 | 291 |
| 266 | 3300005842 | Ga0068858_100400164 | Ga0068858_1004001642 | 291 |
| 267 | 3300005843 | Ga0068860_100229161 | Ga0068860_1002291611 | 291 |
| 268 | 3300005844 | Ga0068862_100610220 | Ga0068862_1006102201 | 291 |
| 269 | 3300005937 | Ga0081455_10000022 | Ga0081455_100000229 | 291 |
| 270 | 3300005937 | Ga0081455_10006137 | Ga0081455_100061372 | 291 |
| 271 | 3300005981 | Ga0081538_10006666 | Ga0081538_100066664 | 291 |
| 272 | 3300006028 | Ga0070717_10009632 | Ga0070717_100096325 | 291 |
| 273 | 3300006028 | Ga0070717_10036947 | Ga0070717_100369472 | 291 |
| 274 | 3300006038 | Ga0075365_10021110 | Ga0075365_100211103 | 291 |
| 275 | 3300006042 | Ga0075368_10039930 | Ga0075368_100399301 | 291 |
| 276 | 3300006048 | Ga0075363_100016781 | Ga0075363_1000167814 | 291 |
| 277 | 3300006048 | Ga0075363_100042104 | Ga0075363_1000421042 | 291 |
| 278 | 3300006051 | Ga0075364_10090887 | Ga0075364_100908872 | 291 |
| 279 | 3300006173 | Ga0070716_100065757 | Ga0070716_1000657572 | 291 |
| 280 | 3300006173 | Ga0070716_100253187 | Ga0070716_1002531872 | 291 |
| 281 | 3300006175 | Ga0070712_100004676 | Ga0070712_1000046766 | 291 |
| 282 | 3300006175 | Ga0070712_100158994 | Ga0070712_1001589941 | 291 |
| 283 | 3300006175 | Ga0070712_100201221 | Ga0070712_1002012212 | 291 |
| 284 | 3300006175 | Ga0070712_100354424 | Ga0070712_1003544242 | 291 |
| 285 | 3300006177 | Ga0075362_10057046 | Ga0075362_100570462 | 291 |
| 286 | 3300006178 | Ga0075367_10001913 | Ga0075367_100019134 | 291 |
| 287 | 3300006178 | Ga0075367_10009093 | Ga0075367_100090934 | 291 |
| 288 | 3300006178 | Ga0075367_10034279 | Ga0075367_100342793 | 291 |
| 289 | 3300006178 | Ga0075367_10199164 | Ga0075367_101991642 | 291 |
| 290 | 3300006237 | Ga0097621_100007724 | Ga0097621_1000077245 | 291 |
| 291 | 3300006844 | Ga0075428_100049454 | Ga0075428_1000494543 | 291 |
| 292 | 3300006844 | Ga0075428_100056626 | Ga0075428_1000566262 | 291 |
| 293 | 3300006844 | Ga0075428_100078608 | Ga0075428_1000786083 | 291 |
| 294 | 3300006844 | Ga0075428_100112577 | Ga0075428_1001125772 | 291 |
| 295 | 3300006847 | Ga0075431_100226672 | Ga0075431_1002266722 | 291 |
| 296 | 3300006847 | Ga0075431_100300175 | Ga0075431_1003001752 | 291 |
| 297 | 3300006852 | Ga0075433_10014595 | Ga0075433_100145952 | 291 |
| 298 | 3300006852 | Ga0075433_10197244 | Ga0075433_101972442 | 291 |
| 299 | 3300006871 | Ga0075434_100005388 | Ga0075434_1000053886 | 291 |
| 300 | 3300006871 | Ga0075434_100036505 | Ga0075434_1000365053 | 291 |
| 301 | 3300006871 | Ga0075434_100076946 | Ga0075434_1000769462 | 291 |
| 302 | 3300006871 | Ga0075434_100216129 | Ga0075434_1002161292 | 291 |
| 303 | 3300006871 | Ga0075434_100224593 | Ga0075434_1002245932 | 291 |
| 304 | 3300006871 | Ga0075434_100283038 | Ga0075434_1002830382 | 291 |
| 305 | 3300006880 | Ga0075429_100151452 | Ga0075429_1001514522 | 291 |
| 306 | 3300006881 | Ga0068865_100076123 | Ga0068865_1000761232 | 291 |
| 307 | 3300006914 | Ga0075436_100044259 | Ga0075436_1000442592 | 291 |
| 308 | 3300006914 | Ga0075436_100111240 | Ga0075436_1001112402 | 291 |
| 309 | 3300006931 | Ga0097620_100040078 | Ga0097620_1000400782 | 291 |
| 310 | 3300007076 | Ga0075435_100055469 | Ga0075435_1000554693 | 291 |
| 311 | 3300007076 | Ga0075435_100069480 | Ga0075435_1000694802 | 291 |
| 312 | 3300007076 | Ga0075435_100153209 | Ga0075435_1001532092 | 291 |
| 313 | 3300007076 | Ga0075435_100188926 | Ga0075435_1001889262 | 291 |
| 314 | 3300007265 | Ga0099794_10050582 | Ga0099794_100505823 | 291 |
| 315 | 3300009094 | Ga0111539_10012080 | Ga0111539_100120802 | 291 |
| 316 | 3300009094 | Ga0111539_10029045 | Ga0111539_100290453 | 291 |
| 317 | 3300009094 | Ga0111539_10102599 | Ga0111539_101025994 | 291 |
| 318 | 3300009094 | Ga0111539_10191928 | Ga0111539_101919283 | 291 |
| 319 | 3300009098 | Ga0105245_10104051 | Ga0105245_101040514 | 291 |
| 320 | 3300009147 | Ga0114129_10019114 | Ga0114129_100191143 | 291 |
| 321 | 3300009147 | Ga0114129_10138186 | Ga0114129_101381863 | 291 |
| 322 | 3300009147 | Ga0114129_10196114 | Ga0114129_101961142 | 291 |
| 323 | 3300009174 | Ga0105241_10049246 | Ga0105241_100492463 | 291 |
| 324 | 3300009176 | Ga0105242_10521525 | Ga0105242_105215251 | 291 |
| 325 | 3300009177 | Ga0105248_10119676 | Ga0105248_101196763 | 291 |
| 326 | 3300009177 | Ga0105248_10494882 | Ga0105248_104948821 | 291 |
| 327 | 3300009545 | Ga0105237_10420909 | Ga0105237_104209092 | 291 |
| 328 | 3300009545 | Ga0105237_10470752 | Ga0105237_104707522 | 291 |
| 329 | 3300009553 | Ga0105249_10511409 | Ga0105249_105114092 | 291 |
| 330 | 3300011119 | Ga0105246_10047614 | Ga0105246_100476142 | 291 |
| 331 | 3300011119 | Ga0105246_10105167 | Ga0105246_101051672 | 291 |
| 332 | 3300013297 | Ga0157378_10281096 | Ga0157378_102810962 | 291 |
| 333 | 3300013306 | Ga0163162_10270031 | Ga0163162_102700312 | 291 |
| 334 | 3300014325 | Ga0163163_10034353 | Ga0163163_100343535 | 291 |
| 335 | 3300014325 | Ga0163163_10455839 | Ga0163163_104558392 | 291 |
| 336 | 3300014325 | Ga0163163_10465553 | Ga0163163_104655532 | 291 |
| 337 | 3300014745 | Ga0157377_10027186 | Ga0157377_100271863 | 291 |
| 338 | 3300014745 | Ga0157377_10159819 | Ga0157377_101598191 | 291 |
| 339 | 3300014968 | Ga0157379_10321134 | Ga0157379_103211342 | 291 |
| 340 | 3300014969 | Ga0157376_10044877 | Ga0157376_100448772 | 291 |
| 341 | 3300017792 | Ga0163161_10033052 | Ga0163161_100330523 | 291 |
| 342 | 3300025885 | Ga0207653_10028793 | Ga0207653_100287931 | 291 |
| 343 | 3300025898 | Ga0207692_10005544 | Ga0207692_100055443 | 291 |
| 344 | 3300025898 | Ga0207692_10054588 | Ga0207692_100545882 | 291 |
| 345 | 3300025899 | Ga0207642_10005629 | Ga0207642_100056293 | 291 |
| 346 | 3300025899 | Ga0207642_10055635 | Ga0207642_100556352 | 291 |
| 347 | 3300025900 | Ga0207710_10014427 | Ga0207710_100144272 | 291 |
| 348 | 3300025900 | Ga0207710_10025874 | Ga0207710_100258743 | 291 |
| 349 | 3300025901 | Ga0207688_10005223 | Ga0207688_100052233 | 291 |
| 350 | 3300025903 | Ga0207680_10072079 | Ga0207680_100720792 | 291 |
| 351 | 3300025904 | Ga0207647_10082462 | Ga0207647_100824621 | 291 |
| 352 | 3300025905 | Ga0207685_10074105 | Ga0207685_100741052 | 291 |
| 353 | 3300025906 | Ga0207699_10016678 | Ga0207699_100166783 | 291 |
| 354 | 3300025907 | Ga0207645_10011370 | Ga0207645_100113706 | 291 |
| 355 | 3300025911 | Ga0207654_10049690 | Ga0207654_100496903 | 291 |
| 356 | 3300025911 | Ga0207654_10054948 | Ga0207654_100549482 | 291 |
| 357 | 3300025914 | Ga0207671_10320971 | Ga0207671_103209712 | 291 |
| 358 | 3300025915 | Ga0207693_10008588 | Ga0207693_100085884 | 291 |
| 359 | 3300025915 | Ga0207693_10049759 | Ga0207693_100497592 | 291 |
| 360 | 3300025915 | Ga0207693_10121868 | Ga0207693_101218682 | 291 |
| 361 | 3300025915 | Ga0207693_10248582 | Ga0207693_102485822 | 291 |
| 362 | 3300025916 | Ga0207663_10145223 | Ga0207663_101452231 | 291 |
| 363 | 3300025916 | Ga0207663_10165234 | Ga0207663_101652342 | 291 |
| 364 | 3300025919 | Ga0207657_10022500 | Ga0207657_100225006 | 291 |
| 365 | 3300025920 | Ga0207649_10073921 | Ga0207649_100739212 | 291 |
| 366 | 3300025923 | Ga0207681_10054375 | Ga0207681_100543751 | 291 |
| 367 | 3300025925 | Ga0207650_10005799 | Ga0207650_100057995 | 291 |
| 368 | 3300025926 | Ga0207659_10089491 | Ga0207659_100894913 | 291 |
| 369 | 3300025927 | Ga0207687_10082787 | Ga0207687_100827873 | 291 |
| 370 | 3300025928 | Ga0207700_10010428 | Ga0207700_100104285 | 291 |
| 371 | 3300025928 | Ga0207700_10227714 | Ga0207700_102277142 | 291 |
| 372 | 3300025929 | Ga0207664_10134516 | Ga0207664_101345163 | 291 |
| 373 | 3300025931 | Ga0207644_10001432 | Ga0207644_1000143213 | 291 |
| 374 | 3300025931 | Ga0207644_10315203 | Ga0207644_103152032 | 291 |
| 375 | 3300025933 | Ga0207706_10007580 | Ga0207706_100075807 | 291 |
| 376 | 3300025935 | Ga0207709_10037801 | Ga0207709_100378012 | 291 |
| 377 | 3300025935 | Ga0207709_10189211 | Ga0207709_101892112 | 291 |
| 378 | 3300025936 | Ga0207670_10105999 | Ga0207670_101059992 | 291 |
| 379 | 3300025939 | Ga0207665_10000666 | Ga0207665_1000066614 | 291 |
| 380 | 3300025939 | Ga0207665_10002138 | Ga0207665_1000213813 | 291 |
| 381 | 3300025939 | Ga0207665_10050922 | Ga0207665_100509222 | 291 |
| 382 | 3300025939 | Ga0207665_10221352 | Ga0207665_102213522 | 291 |
| 383 | 3300025940 | Ga0207691_10002482 | Ga0207691_1000248211 | 291 |
| 384 | 3300025941 | Ga0207711_10023185 | Ga0207711_100231852 | 291 |
| 385 | 3300025942 | Ga0207689_10021381 | Ga0207689_100213814 | 291 |
| 386 | 3300025944 | Ga0207661_10055463 | Ga0207661_100554633 | 291 |
| 387 | 3300025945 | Ga0207679_10145552 | Ga0207679_101455522 | 291 |
| 388 | 3300025945 | Ga0207679_10172740 | Ga0207679_101727402 | 291 |
| 389 | 3300025960 | Ga0207651_10122017 | Ga0207651_101220172 | 291 |
| 390 | 3300025961 | Ga0207712_10217877 | Ga0207712_102178772 | 291 |
| 391 | 3300025986 | Ga0207658_10034085 | Ga0207658_100340853 | 291 |
| 392 | 3300026035 | Ga0207703_10099525 | Ga0207703_100995252 | 291 |
| 393 | 3300026067 | Ga0207678_10005074 | Ga0207678_100050743 | 291 |
| 394 | 3300026078 | Ga0207702_10038792 | Ga0207702_100387925 | 291 |
| 395 | 3300026089 | Ga0207648_10002406 | Ga0207648_100024064 | 291 |
| 396 | 3300026095 | Ga0207676_10048456 | Ga0207676_100484564 | 291 |
| 397 | 3300026118 | Ga0207675_100014751 | Ga0207675_1000147516 | 291 |
| 398 | 3300026121 | Ga0207683_10180352 | Ga0207683_101803522 | 291 |
| 399 | 3300027866 | Ga0209813_10001159 | Ga0209813_100011594 | 291 |
| 400 | 3300027907 | Ga0207428_10071087 | Ga0207428_100710872 | 291 |
| 401 | 3300027907 | Ga0207428_10110835 | Ga0207428_101108353 | 291 |
| 402 | 3300028379 | Ga0268266_10017979 | Ga0268266_100179797 | 291 |
| 403 | 3300028379 | Ga0268266_10072670 | Ga0268266_100726702 | 291 |
| 404 | 3300028381 | Ga0268264_10035284 | Ga0268264_100352844 | 291 |
| 405 | 3300031711 | Ga0265314_10014199 | Ga0265314_100141993 | 291 |
| 406 | 3300034819 | Ga0373958_0014054 | Ga0373958_0014054_70_963 | 291 |
| 407 | 3300034820 | Ga0373959_0006952 | Ga0373959_0006952_241_1134 | 291 |
| 408 | 3300035083 | Ga0373926_0031992 | Ga0373926_0031992_918_1802 | 291 |
| 409 | 3300035084 | Ga0373928_0016550 | Ga0373928_0016550_534_1424 | 291 |
| 410 | 3300035086 | Ga0373934_0057740 | Ga0373934_0057740_247_1143 | 291 |
| 411 | 3300035089 | Ga0373944_0040499 | Ga0373944_0040499_284_1168 | 291 |
| 412 | 3300035090 | Ga0373949_0053306 | Ga0373949_0053306_52_945 | 291 |
| 413 | 3300035092 | Ga0373952_0013630 | Ga0373952_0013630_240_1130 | 291 |
| 414 | 3300035111 | Ga0373923_0002721 | Ga0373923_0002721_1748_2644 | 291 |
| 415 | 3300035112 | Ga0373932_0002996 | Ga0373932_0002996_548_1438 | 291 |
| 416 | 3300035113 | Ga0373936_0003042 | Ga0373936_0003042_4427_5323 | 291 |
| 417 | 3300035113 | Ga0373936_0004123 | Ga0373936_0004123_3670_4584 | 291 |
| 418 | 3300035113 | Ga0373936_0039256 | Ga0373936_0039256_108_992 | 291 |
| 419 | 3300035116 | Ga0373945_0010915 | Ga0373945_0010915_163_1047 | 291 |
| 420 | 3300035117 | Ga0373953_0019450 | Ga0373953_0019450_1368_2282 | 291 |
| 421 | 3300035118 | Ga0373954_0001425 | Ga0373954_0001425_1166_2080 | 291 |
| 422 | 3300035119 | Ga0373956_0032517 | Ga0373956_0032517_216_1130 | 291 |
| 423 | 3300035170 | Ga0373943_0014454 | Ga0373943_0014454_995_1885 | 291 |
| 424 | 3300035170 | Ga0373943_0043040 | Ga0373943_0043040_64_948 | 291 |
| 425 | 3300035171 | Ga0373946_0001451 | Ga0373946_0001451_3010_3924 | 291 |
| 426 | 3300035171 | Ga0373946_0001719 | Ga0373946_0001719_2869_3765 | 291 |
| 427 | 3300035171 | Ga0373946_0012321 | Ga0373946_0012321_1074_1958 | 291 |
| 428 | 3300035172 | Ga0373955_0000039 | Ga0373955_0000039_45231_46145 | 291 |
| 429 | 3300035241 | Ga0373961_0028250 | Ga0373961_0028250_575_1465 | 291 |
| 430 | 3300035241 | Ga0373961_0044321 | Ga0373961_0044321_330_1223 | 291 |
| 431 | 3300035410 | Ga0373924_0001219 | Ga0373924_0001219_2883_3797 | 291 |
| 432 | 3300035691 | Ga0373931_0043551 | Ga0373931_0043551_388_1278 | 291 |
| 433 | 3300035691 | Ga0373931_0126874 | Ga0373931_0126874_184_1077 | 291 |
| 434 | 3300035692 | Ga0373935_0000079 | Ga0373935_0000079_4786_5700 | 291 |
| 435 | 3300035692 | Ga0373935_0064931 | Ga0373935_0064931_700_1584 | 291 |
| 436 | 3300035692 | Ga0373935_0100909 | Ga0373935_0100909_733_1617 | 291 |
| 437 | 3300035695 | Ga0373927_0003959 | Ga0373927_0003959_3733_4647 | 291 |
| 438 | 3300035695 | Ga0373927_0033684 | Ga0373927_0033684_817_1713 | 291 |
| 439 | 3300035695 | Ga0373927_0224298 | Ga0373927_0224298_26_910 | 291 |
| 440 | 3300035724 | Ga0373933_0004774 | Ga0373933_0004774_5816_6730 | 291 |
| 441 | 3300035725 | Ga0373947_0025796 | Ga0373947_0025796_1164_2078 | 291 |
| 442 | 3300035725 | Ga0373947_0129533 | Ga0373947_0129533_173_1057 | 291 |
| 443 | 3300035725 | Ga0373947_0137702 | Ga0373947_0137702_605_1501 | 291 |
| 444 | 3300036401 | Ga0373937_0000223 | Ga0373937_0000223_38761_39675 | 291 |
| 445 | 3300036401 | Ga0373937_0064259 | Ga0373937_0064259_165_1091 | 291 |
| 446 | 3300036401 | Ga0373937_0097181 | Ga0373937_0097181_1395_2291 | 291 |
| 447 | 3300037068 | Ga0373925_0000741 | Ga0373925_0000741_28584_29498 | 291 |
| 448 | 3300037068 | Ga0373925_0047234 | Ga0373925_0047234_233_1117 | 291 |
| 449 | 3300037068 | Ga0373925_0047453 | Ga0373925_0047453_1795_2691 | 291 |
| 450 | 3300037068 | Ga0373925_0089106 | Ga0373925_0089106_113_1009 | 291 |
| 451 | 3300037068 | Ga0373925_0121249 | Ga0373925_0121249_834_1724 | 291 |
| 452 | 3300037068 | Ga0373925_0390636 | Ga0373925_0390636_209_1093 | 291 |
| 453 | 3300037418 | Ga0395900_0282267 | Ga0395900_0282267_61_990 | 291 |
| 454 | 3300037466 | Ga0395898_0113234 | Ga0395898_0113234_743_1672 | 291 |
| 455 | 3300039450 | Ga0436363_1239658 | Ga0436363_1239658_446_1330 | 291 |
| 456 | 3300045051 | Ga0451576_0521311 | Ga0451576_0521311_288_1178 | 291 |
| 457 | 3300046454 | Ga0495592_0000188 | Ga0495592_0000188_47207_48121 | 291 |
| 458 | 3300046455 | Ga0495603_0005805 | Ga0495603_0005805_4304_5194 | 291 |
| 459 | 3300046459 | Ga0495629_0011719 | Ga0495629_0011719_4283_5197 | 291 |
| 460 | 3300046459 | Ga0495629_0119928 | Ga0495629_0119928_120_1016 | 291 |
| 461 | 3300046460 | Ga0495638_0040776 | Ga0495638_0040776_196_1074 | 291 |
| 462 | 3300046461 | Ga0495641_0114206 | Ga0495641_0114206_173_1057 | 291 |
| 463 | 3300046462 | Ga0495651_0001797 | Ga0495651_0001797_3994_4890 | 291 |
| 464 | 3300046462 | Ga0495651_0002458 | Ga0495651_0002458_2510_3424 | 291 |
| 465 | 3300046463 | Ga0495653_0000198 | Ga0495653_0000198_6030_6944 | 291 |
| 466 | 3300046463 | Ga0495653_0004136 | Ga0495653_0004136_8893_9789 | 291 |
| 467 | 3300046472 | Ga0495580_0040833 | Ga0495580_0040833_1513_2397 | 291 |
| 468 | 3300046472 | Ga0495580_0119187 | Ga0495580_0119187_817_1713 | 291 |
| 469 | 3300046473 | Ga0495582_0005522 | Ga0495582_0005522_5690_6580 | 291 |
| 470 | 3300046473 | Ga0495582_0016019 | Ga0495582_0016019_3121_4005 | 291 |
| 471 | 3300046475 | Ga0495639_0006740 | Ga0495639_0006740_2688_3584 | 291 |
| 472 | 3300046475 | Ga0495639_0008343 | Ga0495639_0008343_2283_3167 | 291 |
| 473 | 3300046476 | Ga0495662_0014500 | Ga0495662_0014500_2105_3019 | 291 |
| 474 | 3300046476 | Ga0495662_0020161 | Ga0495662_0020161_113_1009 | 291 |
| 475 | 3300046476 | Ga0495662_0054445 | Ga0495662_0054445_839_1723 | 291 |
| 476 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_404954_405868 | 291 |
| 477 | 3300046477 | Ga0495664_0013009 | Ga0495664_0013009_953_1849 | 291 |
| 478 | 3300046491 | Ga0495584_0031479 | Ga0495584_0031479_681_1565 | 291 |
| 479 | 3300046491 | Ga0495584_0101692 | Ga0495584_0101692_279_1172 | 291 |
| 480 | 3300046491 | Ga0495584_0113005 | Ga0495584_0113005_249_1139 | 291 |
| 481 | 3300046492 | Ga0495585_0000974 | Ga0495585_0000974_18574_19470 | 291 |
| 482 | 3300046492 | Ga0495585_0003315 | Ga0495585_0003315_9911_10795 | 291 |
| 483 | 3300046499 | Ga0495594_0012849 | Ga0495594_0012849_1612_2508 | 291 |
| 484 | 3300046499 | Ga0495594_0110720 | Ga0495594_0110720_347_1231 | 291 |
| 485 | 3300046501 | Ga0495607_0011320 | Ga0495607_0011320_1424_2320 | 291 |
| 486 | 3300046501 | Ga0495607_0053322 | Ga0495607_0053322_608_1492 | 291 |
| 487 | 3300046506 | Ga0495583_0110669 | Ga0495583_0110669_47_937 | 291 |
| 488 | 3300046511 | Ga0495608_0000009 | Ga0495608_0000009_74567_75481 | 291 |
| 489 | 3300046511 | Ga0495608_0014611 | Ga0495608_0014611_3178_4074 | 291 |
| 490 | 3300046514 | Ga0495618_0000005 | Ga0495618_0000005_182313_183227 | 291 |
| 491 | 3300046514 | Ga0495618_0045534 | Ga0495618_0045534_687_1571 | 291 |
| 492 | 3300046514 | Ga0495618_0050474 | Ga0495618_0050474_1127_2023 | 291 |
| 493 | 3300046515 | Ga0495620_0072358 | Ga0495620_0072358_314_1198 | 291 |
| 494 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_369339_370253 | 291 |
| 495 | 3300046516 | Ga0495628_0018942 | Ga0495628_0018942_4623_5519 | 291 |
| 496 | 3300046517 | Ga0495630_0000614 | Ga0495630_0000614_23707_24621 | 291 |
| 497 | 3300046517 | Ga0495630_0029099 | Ga0495630_0029099_1984_2880 | 291 |
| 498 | 3300046517 | Ga0495630_0198099 | Ga0495630_0198099_240_1124 | 291 |
| 499 | 3300046518 | Ga0495631_0039801 | Ga0495631_0039801_390_1286 | 291 |
| 500 | 3300046520 | Ga0495637_0028471 | Ga0495637_0028471_861_1757 | 291 |
| 501 | 3300046523 | Ga0495644_0002940 | Ga0495644_0002940_231_1127 | 291 |
| 502 | 3300046526 | Ga0495666_0004626 | Ga0495666_0004626_3192_4088 | 291 |
| 503 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_218630_219544 | 291 |
| 504 | 3300046531 | Ga0495665_0010156 | Ga0495665_0010156_15_911 | 291 |
| 505 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_74582_75496 | 291 |
| 506 | 3300046535 | Ga0495586_0019766 | Ga0495586_0019766_2050_2964 | 291 |
| 507 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_242746_243660 | 291 |
| 508 | 3300046537 | Ga0495598_0000679 | Ga0495598_0000679_2006_2890 | 291 |
| 509 | 3300046537 | Ga0495598_0002660 | Ga0495598_0002660_980_1876 | 291 |
| 510 | 3300046539 | Ga0495621_0010608 | Ga0495621_0010608_1332_2216 | 291 |
| 511 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_350590_351504 | 291 |
| 512 | 3300046543 | Ga0495645_0140918 | Ga0495645_0140918_675_1571 | 291 |
| 513 | 3300046557 | Ga0495622_0060015 | Ga0495622_0060015_778_1662 | 291 |
| 514 | 3300046557 | Ga0495622_0083307 | Ga0495622_0083307_166_1062 | 291 |
| 515 | 3300046558 | Ga0495633_0002331 | Ga0495633_0002331_62_958 | 291 |
| 516 | 3300046558 | Ga0495633_0034464 | Ga0495633_0034464_1238_2122 | 291 |
| 517 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_67470_68384 | 291 |
| 518 | 3300046559 | Ga0495667_0009295 | Ga0495667_0009295_2476_3372 | 291 |
| 519 | 3300046615 | Ga0495656_0000276 | Ga0495656_0000276_7773_8669 | 291 |
| 520 | 3300046642 | Ga0495634_0000129 | Ga0495634_0000129_35606_36520 | 291 |
| 521 | 3300046648 | Ga0495611_0007172 | Ga0495611_0007172_1297_2193 | 291 |
| 522 | 3300046663 | Ga0495635_0000020 | Ga0495635_0000020_178712_179626 | 291 |
| 523 | 3300046664 | Ga0495659_0005354 | Ga0495659_0005354_1175_2071 | 291 |
| 524 | 3300046664 | Ga0495659_0008097 | Ga0495659_0008097_1627_2511 | 291 |
| 525 | 3300046674 | Ga0495588_0075174 | Ga0495588_0075174_141_1037 | 291 |
| 526 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_508017_508931 | 291 |
| 527 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_276962_277876 | 291 |
| 528 | 3300046680 | Ga0495646_0000013 | Ga0495646_0000013_127595_128509 | 291 |
| 529 | 3300046680 | Ga0495646_0024897 | Ga0495646_0024897_2218_3114 | 291 |
| 530 | 3300046681 | Ga0495647_0009865 | Ga0495647_0009865_1220_2116 | 291 |
| 531 | 3300046681 | Ga0495647_0019448 | Ga0495647_0019448_1430_2314 | 291 |
| 532 | 3300046683 | Ga0495658_0046832 | Ga0495658_0046832_693_1577 | 291 |
| 533 | 3300046683 | Ga0495658_0084318 | Ga0495658_0084318_921_1805 | 291 |
| 534 | 3300046683 | Ga0495658_0229383 | Ga0495658_0229383_195_1091 | 291 |
| 535 | 3300046684 | Ga0495669_0034594 | Ga0495669_0034594_948_1832 | 291 |
| 536 | 3300046689 | Ga0495613_0054998 | Ga0495613_0054998_1901_2797 | 291 |
| 537 | 3300046690 | Ga0495624_0006348 | Ga0495624_0006348_3287_4183 | 291 |
| 538 | 3300046690 | Ga0495624_0021998 | Ga0495624_0021998_2794_3708 | 291 |
| 539 | 3300046690 | Ga0495624_0073506 | Ga0495624_0073506_364_1248 | 291 |
| 540 | 3300046691 | Ga0495670_0006527 | Ga0495670_0006527_3087_3983 | 291 |
| 541 | 3300046691 | Ga0495670_0114477 | Ga0495670_0114477_479_1363 | 291 |
| 542 | 3300046691 | Ga0495670_0152763 | Ga0495670_0152763_309_1193 | 291 |
| 543 | 3300046694 | Ga0495649_0201721 | Ga0495649_0201721_59_943 | 291 |
| 544 | 3300046809 | Ga0495600_0000233 | Ga0495600_0000233_1244_2158 | 291 |
| 545 | 3300046809 | Ga0495600_0004973 | Ga0495600_0004973_6754_7650 | 291 |
| 546 | 3300047315 | Ga0495581_0015024 | Ga0495581_0015024_2440_3354 | 291 |
| 547 | 3300047315 | Ga0495581_0040690 | Ga0495581_0040690_1355_2251 | 291 |
| 548 | 3300047315 | Ga0495581_0094432 | Ga0495581_0094432_104_988 | 291 |
| 549 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_394983_395897 | 291 |
| 550 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_191873_192787 | 291 |
| 551 | 3300047319 | Ga0495674_0238580 | Ga0495674_0238580_371_1255 | 291 |
| 552 | 3300047319 | Ga0495674_0319355 | Ga0495674_0319355_257_1153 | 291 |
| 553 | 3300047321 | Ga0495676_0041475 | Ga0495676_0041475_878_1762 | 291 |
| 554 | 3300047321 | Ga0495676_0114581 | Ga0495676_0114581_192_1076 | 291 |
| 555 | 3300047322 | Ga0495680_0000002 | Ga0495680_0000002_172406_173320 | 291 |
| 556 | 3300047322 | Ga0495680_0004358 | Ga0495680_0004358_6874_7770 | 291 |
| 557 | 3300047322 | Ga0495680_0030097 | Ga0495680_0030097_2063_2953 | 291 |
| 558 | 3300047444 | Ga0495675_0000437 | Ga0495675_0000437_25802_26716 | 291 |
| 559 | 3300047446 | Ga0495679_026104 | Ga0495679_026104_231_1127 | 291 |
| 560 | 3300047471 | Ga0495684_0000020 | Ga0495684_0000020_119008_119922 | 291 |
| 561 | 3300047471 | Ga0495684_0089052 | Ga0495684_0089052_948_1832 | 291 |
| 562 | 3300047673 | Ga0495593_0002594 | Ga0495593_0002594_5222_6136 | 291 |
| 563 | 3300047673 | Ga0495593_0008133 | Ga0495593_0008133_2063_2959 | 291 |
| 564 | 3300048088 | Ga0495602_0000027 | Ga0495602_0000027_96899_97813 | 291 |
| 565 | 3300048903 | Ga0496100_0025275 | Ga0496100_0025275_1814_2704 | 291 |
| 566 | 3300048903 | Ga0496100_0035456 | Ga0496100_0035456_1922_2806 | 291 |
| 567 | 3300048903 | Ga0496100_0103199 | Ga0496100_0103199_151_1041 | 291 |
| 568 | 3300048903 | Ga0496100_0176299 | Ga0496100_0176299_645_1529 | 291 |
| 569 | 3300048904 | Ga0496101_0006701 | Ga0496101_0006701_3834_4724 | 291 |
| 570 | 3300048904 | Ga0496101_0010732 | Ga0496101_0010732_4563_5447 | 291 |
| 571 | 3300048904 | Ga0496101_0232010 | Ga0496101_0232010_484_1368 | 291 |
| 572 | 3300048904 | Ga0496101_0284729 | Ga0496101_0284729_273_1163 | 291 |
| 573 | 3300048904 | Ga0496101_0391742 | Ga0496101_0391742_150_1034 | 291 |
| 574 | 3300048905 | Ga0496102_0045796 | Ga0496102_0045796_2511_3395 | 291 |
| 575 | 3300048905 | Ga0496102_0055352 | Ga0496102_0055352_2087_2971 | 291 |
| 576 | 3300048905 | Ga0496102_0066802 | Ga0496102_0066802_1168_2058 | 291 |
| 577 | 3300048905 | Ga0496102_0143158 | Ga0496102_0143158_185_1075 | 291 |
| 578 | 3300048905 | Ga0496102_0199994 | Ga0496102_0199994_889_1779 | 291 |
| 579 | 3300048906 | Ga0496103_0007283 | Ga0496103_0007283_4527_5411 | 291 |
| 580 | 3300048906 | Ga0496103_0009462 | Ga0496103_0009462_2870_3754 | 291 |
| 581 | 3300048906 | Ga0496103_0012313 | Ga0496103_0012313_2274_3164 | 291 |
| 582 | 3300048906 | Ga0496103_0094719 | Ga0496103_0094719_69_959 | 291 |
| 583 | 3300048906 | Ga0496103_0137881 | Ga0496103_0137881_444_1334 | 291 |
| 584 | 3300048907 | Ga0496104_0000521 | Ga0496104_0000521_6319_7212 | 291 |
| 585 | 3300048907 | Ga0496104_0001668 | Ga0496104_0001668_15698_16582 | 291 |
| 586 | 3300048907 | Ga0496104_0040303 | Ga0496104_0040303_1498_2388 | 291 |
| 587 | 3300048907 | Ga0496104_0272366 | Ga0496104_0272366_423_1307 | 291 |
| 588 | 3300048907 | Ga0496104_0320685 | Ga0496104_0320685_456_1340 | 291 |
| 589 | 3300048908 | Ga0496105_0000522 | Ga0496105_0000522_488_1372 | 291 |
| 590 | 3300048908 | Ga0496105_0006301 | Ga0496105_0006301_4471_5361 | 291 |
| 591 | 3300048908 | Ga0496105_0044524 | Ga0496105_0044524_1628_2518 | 291 |
| 592 | 3300048908 | Ga0496105_0059404 | Ga0496105_0059404_237_1130 | 291 |
| 593 | 3300048908 | Ga0496105_0208985 | Ga0496105_0208985_434_1324 | 291 |
| 594 | 3300048909 | Ga0496106_0016847 | Ga0496106_0016847_1012_1902 | 291 |
| 595 | 3300048909 | Ga0496106_0047971 | Ga0496106_0047971_1738_2622 | 291 |
| 596 | 3300048909 | Ga0496106_0080493 | Ga0496106_0080493_922_1806 | 291 |
| 597 | 3300048910 | Ga0496107_0011126 | Ga0496107_0011126_1408_2298 | 291 |
| 598 | 3300048910 | Ga0496107_0021420 | Ga0496107_0021420_135_1019 | 291 |
| 599 | 3300048911 | Ga0496108_0000510 | Ga0496108_0000510_7188_8072 | 291 |
| 600 | 3300048911 | Ga0496108_0004887 | Ga0496108_0004887_3748_4638 | 291 |
| 601 | 3300048911 | Ga0496108_0013258 | Ga0496108_0013258_4888_5781 | 291 |
| 602 | 3300048912 | Ga0496109_0000549 | Ga0496109_0000549_2997_3881 | 291 |
| 603 | 3300048912 | Ga0496109_0009996 | Ga0496109_0009996_1168_2058 | 291 |
| 604 | 3300048912 | Ga0496109_0018377 | Ga0496109_0018377_3745_4638 | 291 |
| 605 | 3300048912 | Ga0496109_0026343 | Ga0496109_0026343_3582_4466 | 291 |
| 606 | 3300048912 | Ga0496109_0056170 | Ga0496109_0056170_1535_2425 | 291 |
| 607 | 3300048912 | Ga0496109_0078046 | Ga0496109_0078046_921_1811 | 291 |
| 608 | 3300048913 | Ga0496110_0007131 | Ga0496110_0007131_288_1181 | 291 |
| 609 | 3300048913 | Ga0496110_0036686 | Ga0496110_0036686_787_1671 | 291 |
| 610 | 3300048913 | Ga0496110_0040347 | Ga0496110_0040347_1937_2827 | 291 |
| 611 | 3300048913 | Ga0496110_0081836 | Ga0496110_0081836_50_940 | 291 |
| 612 | 3300048913 | Ga0496110_0400142 | Ga0496110_0400142_308_1192 | 291 |
| 613 | 3300048914 | Ga0496111_0001147 | Ga0496111_0001147_1756_2640 | 291 |
| 614 | 3300048914 | Ga0496111_0008713 | Ga0496111_0008713_4044_4934 | 291 |
| 615 | 3300048914 | Ga0496111_0015611 | Ga0496111_0015611_2824_3717 | 291 |
| 616 | 3300048914 | Ga0496111_0019956 | Ga0496111_0019956_3736_4620 | 291 |
| 617 | 3300048914 | Ga0496111_0050185 | Ga0496111_0050185_1121_2011 | 291 |
| 618 | 3300048915 | Ga0496112_0000320 | Ga0496112_0000320_3036_3920 | 291 |
| 619 | 3300048915 | Ga0496112_0003683 | Ga0496112_0003683_5610_6503 | 291 |
| 620 | 3300048915 | Ga0496112_0009679 | Ga0496112_0009679_928_1818 | 291 |
| 621 | 3300048915 | Ga0496112_0018028 | Ga0496112_0018028_1673_2563 | 291 |
| 622 | 3300048915 | Ga0496112_0222387 | Ga0496112_0222387_533_1417 | 291 |
| 623 | 3300048915 | Ga0496112_0231888 | Ga0496112_0231888_279_1169 | 291 |
| 624 | 3300048915 | Ga0496112_0319205 | Ga0496112_0319205_273_1157 | 291 |
| 625 | 3300048916 | Ga0496113_0000694 | Ga0496113_0000694_9998_10891 | 291 |
| 626 | 3300048916 | Ga0496113_0001247 | Ga0496113_0001247_10559_11443 | 291 |
| 627 | 3300048916 | Ga0496113_0002579 | Ga0496113_0002579_8527_9417 | 291 |
| 628 | 3300048916 | Ga0496113_0015034 | Ga0496113_0015034_3582_4466 | 291 |
| 629 | 3300048916 | Ga0496113_0074014 | Ga0496113_0074014_1359_2249 | 291 |
| 630 | 3300048917 | Ga0496114_0006147 | Ga0496114_0006147_8471_9361 | 291 |
| 631 | 3300048917 | Ga0496114_0023853 | Ga0496114_0023853_108_992 | 291 |
| 632 | 3300048917 | Ga0496114_0037984 | Ga0496114_0037984_2284_3174 | 291 |
| 633 | 3300048917 | Ga0496114_0133269 | Ga0496114_0133269_1109_1993 | 291 |
| 634 | 3300048918 | Ga0496115_0063245 | Ga0496115_0063245_1168_2058 | 291 |
| 635 | 3300048918 | Ga0496115_0063747 | Ga0496115_0063747_928_1818 | 291 |
| 636 | 3300048918 | Ga0496115_0101757 | Ga0496115_0101757_1315_2199 | 291 |
| 637 | 3300048918 | Ga0496115_0234026 | Ga0496115_0234026_299_1183 | 291 |
| 638 | 3300049570 | Ga0501033_0068879 | Ga0501033_0068879_798_1718 | 291 |
| 639 | 3300049574 | Ga0501038_0014712 | Ga0501038_0014712_4324_5244 | 291 |
| 640 | 3300049581 | Ga0501047_0010459 | Ga0501047_0010459_3317_4237 | 291 |
| 641 | 3300049581 | Ga0501047_0183893 | Ga0501047_0183893_608_1504 | 291 |
| 642 | 3300049586 | Ga0501070_0002309 | Ga0501070_0002309_14197_15117 | 291 |
| 643 | 3300049742 | Ga0501080_0011011 | Ga0501080_0011011_3782_4702 | 291 |
| 644 | 3300049822 | Ga0501035_0105221 | Ga0501035_0105221_435_1355 | 291 |
| 645 | 3300049823 | Ga0501044_0003904 | Ga0501044_0003904_7426_8346 | 291 |
| 646 | 3300049823 | Ga0501044_0182818 | Ga0501044_0182818_546_1466 | 291 |
| 647 | 3300050489 | nmdc:mga03683_43898_c1 | nmdc:mga03683_43898_c1_651_1535 | 291 |
| 648 | 3300050490 | nmdc:mga03n38_3663_c1 | nmdc:mga03n38_3663_c1_2320_3219 | 291 |
| 649 | 3300050491 | nmdc:mga00v17_4364_c1 | nmdc:mga00v17_4364_c1_3268_4167 | 291 |
| 650 | 3300050491 | nmdc:mga00v17_76346_c1 | nmdc:mga00v17_76346_c1_598_1482 | 291 |
| 651 | 3300050492 | nmdc:mga0yw44_13357_c1 | nmdc:mga0yw44_13357_c1_1634_2518 | 291 |
| 652 | 3300050492 | nmdc:mga0yw44_374004_c1 | nmdc:mga0yw44_374004_c1_67_951 | 291 |
| 653 | 3300050492 | nmdc:mga0yw44_4721_c1 | nmdc:mga0yw44_4721_c1_1163_2047 | 291 |
| 654 | 3300050492 | nmdc:mga0yw44_6598_c1 | nmdc:mga0yw44_6598_c1_4649_5539 | 291 |
| 655 | 3300050494 | nmdc:mga06z11_1492_c1 | nmdc:mga06z11_1492_c1_5203_6096 | 291 |
| 656 | 3300050494 | nmdc:mga06z11_2755_c1 | nmdc:mga06z11_2755_c1_2963_3862 | 291 |
| 657 | 3300050495 | nmdc:mga04h51_385_c1 | nmdc:mga04h51_385_c1_6569_7462 | 291 |
| 658 | 3300050507 | nmdc:mga05p37_6334_c1 | nmdc:mga05p37_6334_c1_4635_5519 | 291 |
| 659 | 3300050507 | nmdc:mga05p37_69662_c1 | nmdc:mga05p37_69662_c1_2164_3057 | 291 |
| 660 | 3300050507 | nmdc:mga05p37_86999_c1 | nmdc:mga05p37_86999_c1_2385_3314 | 291 |
| 661 | 3300050509 | nmdc:mga0qj67_143429_c1 | nmdc:mga0qj67_143429_c1_14_895 | 291 |
| 662 | 3300050510 | nmdc:mga06r32_135963_c1 | nmdc:mga06r32_135963_c1_1448_2329 | 291 |
| 663 | 3300050510 | nmdc:mga06r32_57714_c1 | nmdc:mga06r32_57714_c1_2396_3280 | 291 |
| 664 | 3300050510 | nmdc:mga06r32_84087_c1 | nmdc:mga06r32_84087_c1_1731_2615 | 291 |
| 665 | 3300050511 | nmdc:mga08y16_211407_c1 | nmdc:mga08y16_211407_c1_696_1580 | 291 |
| 666 | 3300050511 | nmdc:mga08y16_290628_c1 | nmdc:mga08y16_290628_c1_208_1092 | 291 |
| 667 | 3300050511 | nmdc:mga08y16_55218_c1 | nmdc:mga08y16_55218_c1_1600_2529 | 291 |
| 668 | 3300050511 | nmdc:mga08y16_7303_c1 | nmdc:mga08y16_7303_c1_10045_10932 | 291 |
| 669 | 3300050512 | nmdc:mga0n895_125992_c1 | nmdc:mga0n895_125992_c1_1010_1903 | 291 |
| 670 | 3300050512 | nmdc:mga0n895_195462_c1 | nmdc:mga0n895_195462_c1_655_1605 | 291 |
| 671 | 3300050512 | nmdc:mga0n895_41575_c1 | nmdc:mga0n895_41575_c1_1577_2482 | 291 |
| 672 | 3300050512 | nmdc:mga0n895_589653_c1 | nmdc:mga0n895_589653_c1_133_1023 | 291 |
| 673 | 3300050512 | nmdc:mga0n895_637073_c1 | nmdc:mga0n895_637073_c1_33_929 | 291 |
| 674 | 3300050513 | nmdc:mga0rr50_177562_c1 | nmdc:mga0rr50_177562_c1_305_1201 | 291 |
| 675 | 3300050514 | nmdc:mga08x19_22543_c1 | nmdc:mga08x19_22543_c1_468_1358 | 291 |
| 676 | 3300050514 | nmdc:mga08x19_29198_c1 | nmdc:mga08x19_29198_c1_749_1645 | 291 |
| 677 | 3300050515 | nmdc:mga0a205_16737_c1 | nmdc:mga0a205_16737_c1_5057_5950 | 291 |
| 678 | 3300053077 | Ga0495601_0000010 | Ga0495601_0000010_218584_219498 | 291 |
| 679 | 3300053077 | Ga0495601_0127933 | Ga0495601_0127933_93_977 | 291 |
| 680 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_280935_281849 | 291 |
| 681 | 3300053078 | Ga0495612_0006758 | Ga0495612_0006758_3546_4442 | 291 |
| 682 | 3300053083 | Ga0495655_0010583 | Ga0495655_0010583_854_1738 | 291 |
| 683 | 3300053084 | Ga0495595_0001532 | Ga0495595_0001532_7608_8522 | 291 |
| 684 | 3300053084 | Ga0495595_0003189 | Ga0495595_0003189_3389_4285 | 291 |
| 685 | 3300053084 | Ga0495595_0018002 | Ga0495595_0018002_701_1585 | 291 |
| 686 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_369342_370256 | 291 |
| 687 | 3300053085 | Ga0495619_0011867 | Ga0495619_0011867_3680_4576 | 291 |
| 688 | 3300053085 | Ga0495619_0125536 | Ga0495619_0125536_70_954 | 291 |
| 689 | 3300053087 | Ga0500643_013638 | Ga0500643_013638_1319_2197 | 291 |
| 690 | 3300053094 | Ga0500566_0065245 | Ga0500566_0065245_977_1855 | 291 |
| 691 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_1014182_1015060 | 291 |
| 692 | 3300053131 | Ga0500652_029920 | Ga0500652_029920_1017_1895 | 291 |
| 693 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_975251_976129 | 291 |
| 694 | 3300053153 | Ga0500616_0108274 | Ga0500616_0108274_141_1040 | 291 |
| 695 | 3300053730 | Ga0500645_000165 | Ga0500645_000165_1113_1991 | 291 |
| 696 | 3300060353 | Ga0501082_0507886 | Ga0501082_0507886_47_952 | 291 |
| 697 | 2209111006 | 2214600489 | 2213637872 | 292 |
| 698 | 3300000042 | ARSoilYngRDRAFT_c00009 | ARSoilYngRDRAFT_0000924 | 292 |
| 699 | 3300000043 | ARcpr5yngRDRAFT_c000006 | ARcpr5yngRDRAFT_00000624 | 292 |
| 700 | 3300000044 | ARSoilOldRDRAFT_c000008 | ARSoilOldRDRAFT_00000850 | 292 |
| 701 | 3300000652 | ARCol0yngRDRAFT_1000092 | ARCol0yngRDRAFT_10000924 | 292 |
| 702 | 3300001430 | JGI24032J14994_100010 | JGI24032J14994_1000104 | 292 |
| 703 | 3300001976 | JGI24752J21851_1002004 | JGI24752J21851_10020041 | 292 |
| 704 | 3300001978 | JGI24747J21853_1000097 | JGI24747J21853_10000974 | 292 |
| 705 | 3300001979 | JGI24740J21852_10007359 | JGI24740J21852_100073593 | 292 |
| 706 | 3300001989 | JGI24739J22299_10000092 | JGI24739J22299_1000009220 | 292 |
| 707 | 3300001990 | JGI24737J22298_10000325 | JGI24737J22298_1000032510 | 292 |
| 708 | 3300002070 | JGI24750J21931_1000128 | JGI24750J21931_100012814 | 292 |
| 709 | 3300002073 | JGI24745J21846_1000019 | JGI24745J21846_10000195 | 292 |
| 710 | 3300002075 | JGI24738J21930_10000010 | JGI24738J21930_1000001021 | 292 |
| 711 | 3300002076 | JGI24749J21850_1000390 | JGI24749J21850_10003903 | 292 |
| 712 | 3300002077 | JGI24744J21845_10003267 | JGI24744J21845_100032673 | 292 |
| 713 | 3300002126 | JGI24035J26624_1000002 | JGI24035J26624_100000214 | 292 |
| 714 | 3300002155 | JGI24033J26618_1000590 | JGI24033J26618_10005904 | 292 |
| 715 | 3300002239 | JGI24034J26672_10001363 | JGI24034J26672_100013632 | 292 |
| 716 | 3300002244 | JGI24742J22300_10000521 | JGI24742J22300_100005212 | 292 |
| 717 | 3300005276 | Ga0065717_1000057 | Ga0065717_10000572 | 292 |
| 718 | 3300005277 | Ga0065716_1001714 | Ga0065716_10017142 | 292 |
| 719 | 3300005290 | Ga0065712_10003774 | Ga0065712_100037743 | 292 |
| 720 | 3300005293 | Ga0065715_10000752 | Ga0065715_1000075214 | 292 |
| 721 | 3300005293 | Ga0065715_10000834 | Ga0065715_100008347 | 292 |
| 722 | 3300005327 | Ga0070658_10478088 | Ga0070658_104780882 | 292 |
| 723 | 3300005328 | Ga0070676_10000041 | Ga0070676_100000413 | 292 |
| 724 | 3300005329 | Ga0070683_100001029 | Ga0070683_10000102914 | 292 |
| 725 | 3300005330 | Ga0070690_100002808 | Ga0070690_1000028084 | 292 |
| 726 | 3300005333 | Ga0070677_10000045 | Ga0070677_100000457 | 292 |
| 727 | 3300005334 | Ga0068869_100000079 | Ga0068869_10000007914 | 292 |
| 728 | 3300005334 | Ga0068869_100139312 | Ga0068869_1001393122 | 292 |
| 729 | 3300005335 | Ga0070666_10016046 | Ga0070666_100160462 | 292 |
| 730 | 3300005335 | Ga0070666_10131403 | Ga0070666_101314032 | 292 |
| 731 | 3300005336 | Ga0070680_100004008 | Ga0070680_1000040084 | 292 |
| 732 | 3300005336 | Ga0070680_100211606 | Ga0070680_1002116061 | 292 |
| 733 | 3300005337 | Ga0070682_100000641 | Ga0070682_1000006414 | 292 |
| 734 | 3300005337 | Ga0070682_100017895 | Ga0070682_1000178952 | 292 |
| 735 | 3300005337 | Ga0070682_100113330 | Ga0070682_1001133302 | 292 |
| 736 | 3300005337 | Ga0070682_100120191 | Ga0070682_1001201912 | 292 |
| 737 | 3300005338 | Ga0068868_100000588 | Ga0068868_10000058830 | 292 |
| 738 | 3300005339 | Ga0070660_100004207 | Ga0070660_1000042077 | 292 |
| 739 | 3300005339 | Ga0070660_100034964 | Ga0070660_1000349642 | 292 |
| 740 | 3300005339 | Ga0070660_100416820 | Ga0070660_1004168201 | 292 |
| 741 | 3300005340 | Ga0070689_100015607 | Ga0070689_1000156076 | 292 |
| 742 | 3300005340 | Ga0070689_100035694 | Ga0070689_1000356944 | 292 |
| 743 | 3300005341 | Ga0070691_10000161 | Ga0070691_1000016115 | 292 |
| 744 | 3300005341 | Ga0070691_10087574 | Ga0070691_100875742 | 292 |
| 745 | 3300005343 | Ga0070687_100000085 | Ga0070687_10000008529 | 292 |
| 746 | 3300005343 | Ga0070687_100011196 | Ga0070687_1000111963 | 292 |
| 747 | 3300005344 | Ga0070661_100000307 | Ga0070661_10000030719 | 292 |
| 748 | 3300005345 | Ga0070692_10006433 | Ga0070692_100064332 | 292 |
| 749 | 3300005347 | Ga0070668_100000164 | Ga0070668_1000001647 | 292 |
| 750 | 3300005347 | Ga0070668_100096461 | Ga0070668_1000964612 | 292 |
| 751 | 3300005353 | Ga0070669_100000571 | Ga0070669_10000057121 | 292 |
| 752 | 3300005354 | Ga0070675_100002792 | Ga0070675_1000027927 | 292 |
| 753 | 3300005354 | Ga0070675_100030132 | Ga0070675_1000301322 | 292 |
| 754 | 3300005355 | Ga0070671_100000104 | Ga0070671_10000010441 | 292 |
| 755 | 3300005356 | Ga0070674_100000238 | Ga0070674_10000023821 | 292 |
| 756 | 3300005356 | Ga0070674_100213643 | Ga0070674_1002136432 | 292 |
| 757 | 3300005364 | Ga0070673_100000152 | Ga0070673_10000015231 | 292 |
| 758 | 3300005364 | Ga0070673_100273366 | Ga0070673_1002733661 | 292 |
| 759 | 3300005364 | Ga0070673_100281261 | Ga0070673_1002812612 | 292 |
| 760 | 3300005365 | Ga0070688_100004752 | Ga0070688_1000047522 | 292 |
| 761 | 3300005365 | Ga0070688_100009930 | Ga0070688_1000099306 | 292 |
| 762 | 3300005366 | Ga0070659_100000551 | Ga0070659_10000055121 | 292 |
| 763 | 3300005366 | Ga0070659_100258206 | Ga0070659_1002582062 | 292 |
| 764 | 3300005367 | Ga0070667_100002365 | Ga0070667_10000236513 | 292 |
| 765 | 3300005367 | Ga0070667_100043692 | Ga0070667_1000436922 | 292 |
| 766 | 3300005406 | Ga0070703_10027189 | Ga0070703_100271891 | 292 |
| 767 | 3300005436 | Ga0070713_100020625 | Ga0070713_1000206252 | 292 |
| 768 | 3300005438 | Ga0070701_10008875 | Ga0070701_100088754 | 292 |
| 769 | 3300005438 | Ga0070701_10050637 | Ga0070701_100506372 | 292 |
| 770 | 3300005440 | Ga0070705_100000148 | Ga0070705_10000014820 | 292 |
| 771 | 3300005440 | Ga0070705_100159885 | Ga0070705_1001598852 | 292 |
| 772 | 3300005441 | Ga0070700_100000277 | Ga0070700_10000027712 | 292 |
| 773 | 3300005441 | Ga0070700_100010208 | Ga0070700_1000102083 | 292 |
| 774 | 3300005444 | Ga0070694_100003001 | Ga0070694_1000030015 | 292 |
| 775 | 3300005444 | Ga0070694_100026100 | Ga0070694_1000261002 | 292 |
| 776 | 3300005444 | Ga0070694_100155615 | Ga0070694_1001556152 | 292 |
| 777 | 3300005444 | Ga0070694_100201486 | Ga0070694_1002014862 | 292 |
| 778 | 3300005445 | Ga0070708_100592840 | Ga0070708_1005928402 | 292 |
| 779 | 3300005455 | Ga0070663_100001406 | Ga0070663_10000140611 | 292 |
| 780 | 3300005455 | Ga0070663_100082402 | Ga0070663_1000824022 | 292 |
| 781 | 3300005455 | Ga0070663_100293297 | Ga0070663_1002932971 | 292 |
| 782 | 3300005456 | Ga0070678_100008123 | Ga0070678_1000081232 | 292 |
| 783 | 3300005456 | Ga0070678_100061191 | Ga0070678_1000611913 | 292 |
| 784 | 3300005457 | Ga0070662_100005414 | Ga0070662_1000054142 | 292 |
| 785 | 3300005457 | Ga0070662_100010491 | Ga0070662_1000104915 | 292 |
| 786 | 3300005457 | Ga0070662_100345103 | Ga0070662_1003451032 | 292 |
| 787 | 3300005458 | Ga0070681_10003456 | Ga0070681_1000345614 | 292 |
| 788 | 3300005458 | Ga0070681_10029139 | Ga0070681_100291394 | 292 |
| 789 | 3300005458 | Ga0070681_10105482 | Ga0070681_101054822 | 292 |
| 790 | 3300005458 | Ga0070681_10148193 | Ga0070681_101481931 | 292 |
| 791 | 3300005459 | Ga0068867_100005503 | Ga0068867_10000550310 | 292 |
| 792 | 3300005459 | Ga0068867_100248865 | Ga0068867_1002488652 | 292 |
| 793 | 3300005466 | Ga0070685_10001961 | Ga0070685_100019618 | 292 |
| 794 | 3300005468 | Ga0070707_100153018 | Ga0070707_1001530182 | 292 |
| 795 | 3300005530 | Ga0070679_100000394 | Ga0070679_10000039441 | 292 |
| 796 | 3300005530 | Ga0070679_100126071 | Ga0070679_1001260713 | 292 |
| 797 | 3300005535 | Ga0070684_100001138 | Ga0070684_1000011387 | 292 |
| 798 | 3300005535 | Ga0070684_100049727 | Ga0070684_1000497274 | 292 |
| 799 | 3300005539 | Ga0068853_100002891 | Ga0068853_1000028912 | 292 |
| 800 | 3300005539 | Ga0068853_100554357 | Ga0068853_1005543571 | 292 |
| 801 | 3300005543 | Ga0070672_100000088 | Ga0070672_10000008833 | 292 |
| 802 | 3300005544 | Ga0070686_100000873 | Ga0070686_10000087320 | 292 |
| 803 | 3300005545 | Ga0070695_100000586 | Ga0070695_1000005867 | 292 |
| 804 | 3300005545 | Ga0070695_100003316 | Ga0070695_1000033169 | 292 |
| 805 | 3300005546 | Ga0070696_100000921 | Ga0070696_1000009217 | 292 |
| 806 | 3300005546 | Ga0070696_100210986 | Ga0070696_1002109862 | 292 |
| 807 | 3300005547 | Ga0070693_100000134 | Ga0070693_10000013428 | 292 |
| 808 | 3300005547 | Ga0070693_100059816 | Ga0070693_1000598161 | 292 |
| 809 | 3300005548 | Ga0070665_100094881 | Ga0070665_1000948813 | 292 |
| 810 | 3300005549 | Ga0070704_100000026 | Ga0070704_10000002614 | 292 |
| 811 | 3300005549 | Ga0070704_100016922 | Ga0070704_1000169222 | 292 |
| 812 | 3300005563 | Ga0068855_100118380 | Ga0068855_1001183802 | 292 |
| 813 | 3300005564 | Ga0070664_100001420 | Ga0070664_10000142019 | 292 |
| 814 | 3300005577 | Ga0068857_100001388 | Ga0068857_1000013887 | 292 |
| 815 | 3300005578 | Ga0068854_100000546 | Ga0068854_10000054616 | 292 |
| 816 | 3300005578 | Ga0068854_100157970 | Ga0068854_1001579702 | 292 |
| 817 | 3300005614 | Ga0068856_100002000 | Ga0068856_1000020002 | 292 |
| 818 | 3300005615 | Ga0070702_100000245 | Ga0070702_10000024512 | 292 |
| 819 | 3300005616 | Ga0068852_100002320 | Ga0068852_1000023207 | 292 |
| 820 | 3300005616 | Ga0068852_100453023 | Ga0068852_1004530232 | 292 |
| 821 | 3300005617 | Ga0068859_100061264 | Ga0068859_1000612644 | 292 |
| 822 | 3300005618 | Ga0068864_100000890 | Ga0068864_10000089014 | 292 |
| 823 | 3300005718 | Ga0068866_10000221 | Ga0068866_1000022114 | 292 |
| 824 | 3300005719 | Ga0068861_100000783 | Ga0068861_1000007837 | 292 |
| 825 | 3300005719 | Ga0068861_100027077 | Ga0068861_1000270772 | 292 |
| 826 | 3300005834 | Ga0068851_10164066 | Ga0068851_101640662 | 292 |
| 827 | 3300005840 | Ga0068870_10000090 | Ga0068870_1000009032 | 292 |
| 828 | 3300005841 | Ga0068863_100009502 | Ga0068863_1000095022 | 292 |
| 829 | 3300005841 | Ga0068863_100348865 | Ga0068863_1003488652 | 292 |
| 830 | 3300005842 | Ga0068858_100000295 | Ga0068858_10000029543 | 292 |
| 831 | 3300005843 | Ga0068860_100001285 | Ga0068860_10000128511 | 292 |
| 832 | 3300005843 | Ga0068860_100069499 | Ga0068860_1000694994 | 292 |
| 833 | 3300005844 | Ga0068862_100003658 | Ga0068862_1000036587 | 292 |
| 834 | 3300005844 | Ga0068862_100018135 | Ga0068862_1000181355 | 292 |
| 835 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007232 | 292 |
| 836 | 3300005983 | Ga0081540_1016438 | Ga0081540_10164385 | 292 |
| 837 | 3300006048 | Ga0075363_100234053 | Ga0075363_1002340532 | 292 |
| 838 | 3300006163 | Ga0070715_10033433 | Ga0070715_100334332 | 292 |
| 839 | 3300006175 | Ga0070712_100210003 | Ga0070712_1002100032 | 292 |
| 840 | 3300006175 | Ga0070712_100319090 | Ga0070712_1003190902 | 292 |
| 841 | 3300006178 | Ga0075367_10032971 | Ga0075367_100329714 | 292 |
| 842 | 3300006194 | Ga0075427_10000021 | Ga0075427_100000213 | 292 |
| 843 | 3300006237 | Ga0097621_100000040 | Ga0097621_10000004048 | 292 |
| 844 | 3300006358 | Ga0068871_100000252 | Ga0068871_10000025241 | 292 |
| 845 | 3300006844 | Ga0075428_100012162 | Ga0075428_1000121628 | 292 |
| 846 | 3300006846 | Ga0075430_100018573 | Ga0075430_1000185736 | 292 |
| 847 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000716 | 292 |
| 848 | 3300006852 | Ga0075433_10031256 | Ga0075433_100312565 | 292 |
| 849 | 3300006852 | Ga0075433_10061152 | Ga0075433_100611524 | 292 |
| 850 | 3300006852 | Ga0075433_10062432 | Ga0075433_100624322 | 292 |
| 851 | 3300006871 | Ga0075434_100002477 | Ga0075434_10000247711 | 292 |
| 852 | 3300006871 | Ga0075434_100002531 | Ga0075434_1000025316 | 292 |
| 853 | 3300006880 | Ga0075429_100002081 | Ga0075429_1000020812 | 292 |
| 854 | 3300006881 | Ga0068865_100000275 | Ga0068865_10000027528 | 292 |
| 855 | 3300006881 | Ga0068865_100160059 | Ga0068865_1001600592 | 292 |
| 856 | 3300006931 | Ga0097620_100061259 | Ga0097620_1000612594 | 292 |
| 857 | 3300007076 | Ga0075435_100001384 | Ga0075435_10000138411 | 292 |
| 858 | 3300007076 | Ga0075435_100113723 | Ga0075435_1001137234 | 292 |
| 859 | 3300007076 | Ga0075435_100128394 | Ga0075435_1001283942 | 292 |
| 860 | 3300009094 | Ga0111539_10000394 | Ga0111539_1000039438 | 292 |
| 861 | 3300009094 | Ga0111539_10003483 | Ga0111539_1000348312 | 292 |
| 862 | 3300009094 | Ga0111539_10013521 | Ga0111539_100135219 | 292 |
| 863 | 3300009098 | Ga0105245_10000462 | Ga0105245_1000046225 | 292 |
| 864 | 3300009098 | Ga0105245_10350662 | Ga0105245_103506622 | 292 |
| 865 | 3300009098 | Ga0105245_10438237 | Ga0105245_104382372 | 292 |
| 866 | 3300009101 | Ga0105247_10000442 | Ga0105247_1000044216 | 292 |
| 867 | 3300009101 | Ga0105247_10007985 | Ga0105247_100079857 | 292 |
| 868 | 3300009147 | Ga0114129_10001111 | Ga0114129_1000111121 | 292 |
| 869 | 3300009147 | Ga0114129_10006627 | Ga0114129_100066274 | 292 |
| 870 | 3300009148 | Ga0105243_10000282 | Ga0105243_1000028242 | 292 |
| 871 | 3300009148 | Ga0105243_10063911 | Ga0105243_100639114 | 292 |
| 872 | 3300009174 | Ga0105241_10000652 | Ga0105241_1000065224 | 292 |
| 873 | 3300009176 | Ga0105242_10001726 | Ga0105242_1000172611 | 292 |
| 874 | 3300009176 | Ga0105242_10042656 | Ga0105242_100426562 | 292 |
| 875 | 3300009176 | Ga0105242_10195408 | Ga0105242_101954082 | 292 |
| 876 | 3300009177 | Ga0105248_10022138 | Ga0105248_100221387 | 292 |
| 877 | 3300009177 | Ga0105248_10044044 | Ga0105248_100440446 | 292 |
| 878 | 3300009177 | Ga0105248_10170963 | Ga0105248_101709633 | 292 |
| 879 | 3300009545 | Ga0105237_10176235 | Ga0105237_101762353 | 292 |
| 880 | 3300009553 | Ga0105249_10001210 | Ga0105249_100012105 | 292 |
| 881 | 3300009553 | Ga0105249_10032670 | Ga0105249_100326702 | 292 |
| 882 | 3300009553 | Ga0105249_10075335 | Ga0105249_100753353 | 292 |
| 883 | 3300010375 | Ga0105239_10006303 | Ga0105239_1000630314 | 292 |
| 884 | 3300010375 | Ga0105239_10013274 | Ga0105239_100132745 | 292 |
| 885 | 3300010375 | Ga0105239_10110219 | Ga0105239_101102192 | 292 |
| 886 | 3300010375 | Ga0105239_10421191 | Ga0105239_104211912 | 292 |
| 887 | 3300011119 | Ga0105246_10000312 | Ga0105246_1000031214 | 292 |
| 888 | 3300011119 | Ga0105246_10386820 | Ga0105246_103868202 | 292 |
| 889 | 3300012494 | Ga0157341_1002115 | Ga0157341_10021152 | 292 |
| 890 | 3300013100 | Ga0157373_10020437 | Ga0157373_100204372 | 292 |
| 891 | 3300013102 | Ga0157371_10398737 | Ga0157371_103987372 | 292 |
| 892 | 3300013296 | Ga0157374_10001123 | Ga0157374_1000112312 | 292 |
| 893 | 3300013297 | Ga0157378_10000270 | Ga0157378_1000027021 | 292 |
| 894 | 3300013297 | Ga0157378_10278159 | Ga0157378_102781592 | 292 |
| 895 | 3300013306 | Ga0163162_10000145 | Ga0163162_1000014523 | 292 |
| 896 | 3300013306 | Ga0163162_10028483 | Ga0163162_100284832 | 292 |
| 897 | 3300013307 | Ga0157372_10004025 | Ga0157372_1000402514 | 292 |
| 898 | 3300013308 | Ga0157375_10000332 | Ga0157375_1000033220 | 292 |
| 899 | 3300013308 | Ga0157375_10044592 | Ga0157375_100445925 | 292 |
| 900 | 3300013308 | Ga0157375_10289840 | Ga0157375_102898402 | 292 |
| 901 | 3300014325 | Ga0163163_10000865 | Ga0163163_1000086526 | 292 |
| 902 | 3300014325 | Ga0163163_10010305 | Ga0163163_100103057 | 292 |
| 903 | 3300014326 | Ga0157380_10001523 | Ga0157380_100015232 | 292 |
| 904 | 3300014745 | Ga0157377_10000137 | Ga0157377_1000013724 | 292 |
| 905 | 3300014968 | Ga0157379_10002484 | Ga0157379_100024842 | 292 |
| 906 | 3300014968 | Ga0157379_10077370 | Ga0157379_100773702 | 292 |
| 907 | 3300014969 | Ga0157376_10000088 | Ga0157376_1000008842 | 292 |
| 908 | 3300017792 | Ga0163161_10000144 | Ga0163161_1000014429 | 292 |
| 909 | 3300025271 | Ga0207666_1000048 | Ga0207666_10000487 | 292 |
| 910 | 3300025271 | Ga0207666_1005457 | Ga0207666_10054572 | 292 |
| 911 | 3300025290 | Ga0207673_1001170 | Ga0207673_10011702 | 292 |
| 912 | 3300025315 | Ga0207697_10000136 | Ga0207697_1000013614 | 292 |
| 913 | 3300025315 | Ga0207697_10055625 | Ga0207697_100556252 | 292 |
| 914 | 3300025885 | Ga0207653_10011159 | Ga0207653_100111591 | 292 |
| 915 | 3300025885 | Ga0207653_10084406 | Ga0207653_100844062 | 292 |
| 916 | 3300025893 | Ga0207682_10000006 | Ga0207682_1000000613 | 292 |
| 917 | 3300025899 | Ga0207642_10000628 | Ga0207642_100006285 | 292 |
| 918 | 3300025900 | Ga0207710_10035283 | Ga0207710_100352832 | 292 |
| 919 | 3300025901 | Ga0207688_10000027 | Ga0207688_1000002742 | 292 |
| 920 | 3300025901 | Ga0207688_10003913 | Ga0207688_100039137 | 292 |
| 921 | 3300025903 | Ga0207680_10010727 | Ga0207680_100107272 | 292 |
| 922 | 3300025904 | Ga0207647_10005974 | Ga0207647_100059744 | 292 |
| 923 | 3300025904 | Ga0207647_10033429 | Ga0207647_100334294 | 292 |
| 924 | 3300025907 | Ga0207645_10000100 | Ga0207645_1000010042 | 292 |
| 925 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007153 | 292 |
| 926 | 3300025911 | Ga0207654_10000314 | Ga0207654_1000031427 | 292 |
| 927 | 3300025912 | Ga0207707_10003553 | Ga0207707_100035533 | 292 |
| 928 | 3300025912 | Ga0207707_10079478 | Ga0207707_100794782 | 292 |
| 929 | 3300025914 | Ga0207671_10294766 | Ga0207671_102947662 | 292 |
| 930 | 3300025915 | Ga0207693_10100221 | Ga0207693_101002212 | 292 |
| 931 | 3300025917 | Ga0207660_10000041 | Ga0207660_1000004130 | 292 |
| 932 | 3300025917 | Ga0207660_10174387 | Ga0207660_101743872 | 292 |
| 933 | 3300025917 | Ga0207660_10523123 | Ga0207660_105231231 | 292 |
| 934 | 3300025918 | Ga0207662_10000282 | Ga0207662_100002827 | 292 |
| 935 | 3300025918 | Ga0207662_10032258 | Ga0207662_100322582 | 292 |
| 936 | 3300025919 | Ga0207657_10003933 | Ga0207657_100039337 | 292 |
| 937 | 3300025919 | Ga0207657_10018028 | Ga0207657_100180282 | 292 |
| 938 | 3300025920 | Ga0207649_10000451 | Ga0207649_100004512 | 292 |
| 939 | 3300025921 | Ga0207652_10002586 | Ga0207652_1000258617 | 292 |
| 940 | 3300025923 | Ga0207681_10000100 | Ga0207681_1000010073 | 292 |
| 941 | 3300025926 | Ga0207659_10000044 | Ga0207659_1000004488 | 292 |
| 942 | 3300025926 | Ga0207659_10288669 | Ga0207659_102886692 | 292 |
| 943 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007244 | 292 |
| 944 | 3300025927 | Ga0207687_10182279 | Ga0207687_101822792 | 292 |
| 945 | 3300025928 | Ga0207700_10026082 | Ga0207700_100260825 | 292 |
| 946 | 3300025931 | Ga0207644_10013238 | Ga0207644_100132387 | 292 |
| 947 | 3300025932 | Ga0207690_10000140 | Ga0207690_1000014047 | 292 |
| 948 | 3300025932 | Ga0207690_10214907 | Ga0207690_102149072 | 292 |
| 949 | 3300025933 | Ga0207706_10001913 | Ga0207706_1000191320 | 292 |
| 950 | 3300025933 | Ga0207706_10003180 | Ga0207706_1000318014 | 292 |
| 951 | 3300025933 | Ga0207706_10036749 | Ga0207706_100367492 | 292 |
| 952 | 3300025934 | Ga0207686_10000448 | Ga0207686_1000044826 | 292 |
| 953 | 3300025935 | Ga0207709_10000154 | Ga0207709_1000015491 | 292 |
| 954 | 3300025935 | Ga0207709_10511446 | Ga0207709_105114461 | 292 |
| 955 | 3300025936 | Ga0207670_10000444 | Ga0207670_1000044416 | 292 |
| 956 | 3300025936 | Ga0207670_10249020 | Ga0207670_102490202 | 292 |
| 957 | 3300025937 | Ga0207669_10000176 | Ga0207669_100001762 | 292 |
| 958 | 3300025938 | Ga0207704_10000086 | Ga0207704_1000008621 | 292 |
| 959 | 3300025938 | Ga0207704_10118160 | Ga0207704_101181602 | 292 |
| 960 | 3300025939 | Ga0207665_10071245 | Ga0207665_100712452 | 292 |
| 961 | 3300025940 | Ga0207691_10000214 | Ga0207691_1000021442 | 292 |
| 962 | 3300025941 | Ga0207711_10001773 | Ga0207711_1000177314 | 292 |
| 963 | 3300025941 | Ga0207711_10044737 | Ga0207711_100447374 | 292 |
| 964 | 3300025941 | Ga0207711_10182982 | Ga0207711_101829822 | 292 |
| 965 | 3300025942 | Ga0207689_10000366 | Ga0207689_1000036644 | 292 |
| 966 | 3300025942 | Ga0207689_10196951 | Ga0207689_101969512 | 292 |
| 967 | 3300025944 | Ga0207661_10000087 | Ga0207661_1000008729 | 292 |
| 968 | 3300025944 | Ga0207661_10278218 | Ga0207661_102782182 | 292 |
| 969 | 3300025945 | Ga0207679_10000029 | Ga0207679_1000002944 | 292 |
| 970 | 3300025949 | Ga0207667_10315441 | Ga0207667_103154412 | 292 |
| 971 | 3300025960 | Ga0207651_10000264 | Ga0207651_100002645 | 292 |
| 972 | 3300025960 | Ga0207651_10213530 | Ga0207651_102135302 | 292 |
| 973 | 3300025960 | Ga0207651_10281218 | Ga0207651_102812182 | 292 |
| 974 | 3300025961 | Ga0207712_10000129 | Ga0207712_1000012979 | 292 |
| 975 | 3300025972 | Ga0207668_10000100 | Ga0207668_1000010057 | 292 |
| 976 | 3300025972 | Ga0207668_10088074 | Ga0207668_100880742 | 292 |
| 977 | 3300025981 | Ga0207640_10001280 | Ga0207640_100012804 | 292 |
| 978 | 3300025981 | Ga0207640_10174372 | Ga0207640_101743722 | 292 |
| 979 | 3300025986 | Ga0207658_10177304 | Ga0207658_101773041 | 292 |
| 980 | 3300026023 | Ga0207677_10005747 | Ga0207677_100057472 | 292 |
| 981 | 3300026023 | Ga0207677_10085907 | Ga0207677_100859072 | 292 |
| 982 | 3300026035 | Ga0207703_10004645 | Ga0207703_1000464513 | 292 |
| 983 | 3300026035 | Ga0207703_10167710 | Ga0207703_101677102 | 292 |
| 984 | 3300026041 | Ga0207639_10002204 | Ga0207639_1000220414 | 292 |
| 985 | 3300026067 | Ga0207678_10002814 | Ga0207678_1000281414 | 292 |
| 986 | 3300026067 | Ga0207678_10028585 | Ga0207678_100285854 | 292 |
| 987 | 3300026067 | Ga0207678_10038708 | Ga0207678_100387084 | 292 |
| 988 | 3300026075 | Ga0207708_10001802 | Ga0207708_100018027 | 292 |
| 989 | 3300026075 | Ga0207708_10002366 | Ga0207708_100023664 | 292 |
| 990 | 3300026078 | Ga0207702_10001819 | Ga0207702_1000181917 | 292 |
| 991 | 3300026078 | Ga0207702_10213324 | Ga0207702_102133242 | 292 |
| 992 | 3300026088 | Ga0207641_10000476 | Ga0207641_1000047621 | 292 |
| 993 | 3300026088 | Ga0207641_10340140 | Ga0207641_103401402 | 292 |
| 994 | 3300026089 | Ga0207648_10000072 | Ga0207648_1000007221 | 292 |
| 995 | 3300026089 | Ga0207648_10264927 | Ga0207648_102649272 | 292 |
| 996 | 3300026095 | Ga0207676_10000512 | Ga0207676_1000051218 | 292 |
| 997 | 3300026116 | Ga0207674_10000697 | Ga0207674_1000069722 | 292 |
| 998 | 3300026118 | Ga0207675_100002384 | Ga0207675_10000238416 | 292 |
| 999 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002931 | 292 |
| 1000 | 3300026121 | Ga0207683_10019860 | Ga0207683_100198606 | 292 |
| 1001 | 3300026121 | Ga0207683_10316004 | Ga0207683_103160042 | 292 |
| 1002 | 3300026142 | Ga0207698_10000523 | Ga0207698_1000052324 | 292 |
| 1003 | 3300026142 | Ga0207698_10399221 | Ga0207698_103992212 | 292 |
| 1004 | 3300027617 | Ga0210002_1000410 | Ga0210002_10004104 | 292 |
| 1005 | 3300027665 | Ga0209983_1004567 | Ga0209983_10045673 | 292 |
| 1006 | 3300027717 | Ga0209998_10001837 | Ga0209998_100018375 | 292 |
| 1007 | 3300027717 | Ga0209998_10002670 | Ga0209998_100026704 | 292 |
| 1008 | 3300027876 | Ga0209974_10003891 | Ga0209974_100038914 | 292 |
| 1009 | 3300027907 | Ga0207428_10000100 | Ga0207428_10000100105 | 292 |
| 1010 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011566 | 292 |
| 1011 | 3300027907 | Ga0207428_10000228 | Ga0207428_1000022843 | 292 |
| 1012 | 3300028379 | Ga0268266_10040078 | Ga0268266_100400783 | 292 |
| 1013 | 3300028380 | Ga0268265_10000755 | Ga0268265_1000075538 | 292 |
| 1014 | 3300028380 | Ga0268265_10040639 | Ga0268265_100406394 | 292 |
| 1015 | 3300028381 | Ga0268264_10044476 | Ga0268264_100444763 | 292 |
| 1016 | 3300028381 | Ga0268264_10249122 | Ga0268264_102491222 | 292 |
| 1017 | 3300031344 | Ga0265316_10229111 | Ga0265316_102291112 | 292 |
| 1018 | 3300031711 | Ga0265314_10007859 | Ga0265314_100078594 | 292 |
| 1019 | 3300034816 | Ga0373930_0000771 | Ga0373930_0000771_449_1327 | 292 |
| 1020 | 3300034817 | Ga0373948_0022558 | Ga0373948_0022558_213_1091 | 292 |
| 1021 | 3300034818 | Ga0373950_0000996 | Ga0373950_0000996_94_972 | 292 |
| 1022 | 3300034818 | Ga0373950_0005396 | Ga0373950_0005396_846_1724 | 292 |
| 1023 | 3300034819 | Ga0373958_0000704 | Ga0373958_0000704_1926_2804 | 292 |
| 1024 | 3300034820 | Ga0373959_0000679 | Ga0373959_0000679_1147_2025 | 292 |
| 1025 | 3300034957 | Ga0373938_0000025 | Ga0373938_0000025_931_1809 | 292 |
| 1026 | 3300034957 | Ga0373938_0000565 | Ga0373938_0000565_2131_3009 | 292 |
| 1027 | 3300035084 | Ga0373928_0000893 | Ga0373928_0000893_3821_4699 | 292 |
| 1028 | 3300035084 | Ga0373928_0004298 | Ga0373928_0004298_1306_2184 | 292 |
| 1029 | 3300035085 | Ga0373929_0003783 | Ga0373929_0003783_276_1154 | 292 |
| 1030 | 3300035085 | Ga0373929_0009824 | Ga0373929_0009824_266_1144 | 292 |
| 1031 | 3300035086 | Ga0373934_0012658 | Ga0373934_0012658_1724_2614 | 292 |
| 1032 | 3300035086 | Ga0373934_0072880 | Ga0373934_0072880_36_926 | 292 |
| 1033 | 3300035088 | Ga0373940_0001432 | Ga0373940_0001432_2204_3082 | 292 |
| 1034 | 3300035088 | Ga0373940_0002052 | Ga0373940_0002052_2565_3443 | 292 |
| 1035 | 3300035089 | Ga0373944_0014889 | Ga0373944_0014889_19_909 | 292 |
| 1036 | 3300035090 | Ga0373949_0000284 | Ga0373949_0000284_14023_14901 | 292 |
| 1037 | 3300035090 | Ga0373949_0001993 | Ga0373949_0001993_2803_3681 | 292 |
| 1038 | 3300035091 | Ga0373951_0001866 | Ga0373951_0001866_2827_3705 | 292 |
| 1039 | 3300035091 | Ga0373951_0002968 | Ga0373951_0002968_2395_3273 | 292 |
| 1040 | 3300035092 | Ga0373952_0001907 | Ga0373952_0001907_171_1049 | 292 |
| 1041 | 3300035092 | Ga0373952_0015456 | Ga0373952_0015456_617_1495 | 292 |
| 1042 | 3300035111 | Ga0373923_0028795 | Ga0373923_0028795_833_1723 | 292 |
| 1043 | 3300035112 | Ga0373932_0000745 | Ga0373932_0000745_8792_9670 | 292 |
| 1044 | 3300035112 | Ga0373932_0002517 | Ga0373932_0002517_1032_1910 | 292 |
| 1045 | 3300035112 | Ga0373932_0028565 | Ga0373932_0028565_622_1512 | 292 |
| 1046 | 3300035113 | Ga0373936_0020559 | Ga0373936_0020559_25_915 | 292 |
| 1047 | 3300035114 | Ga0373939_0000640 | Ga0373939_0000640_447_1325 | 292 |
| 1048 | 3300035114 | Ga0373939_0002988 | Ga0373939_0002988_575_1453 | 292 |
| 1049 | 3300035115 | Ga0373941_0001556 | Ga0373941_0001556_1835_2713 | 292 |
| 1050 | 3300035115 | Ga0373941_0003272 | Ga0373941_0003272_931_1809 | 292 |
| 1051 | 3300035116 | Ga0373945_0006315 | Ga0373945_0006315_2146_3036 | 292 |
| 1052 | 3300035117 | Ga0373953_0015536 | Ga0373953_0015536_177_1067 | 292 |
| 1053 | 3300035118 | Ga0373954_0010677 | Ga0373954_0010677_2002_2886 | 292 |
| 1054 | 3300035118 | Ga0373954_0026696 | Ga0373954_0026696_553_1443 | 292 |
| 1055 | 3300035119 | Ga0373956_0005293 | Ga0373956_0005293_3876_4760 | 292 |
| 1056 | 3300035119 | Ga0373956_0017397 | Ga0373956_0017397_357_1247 | 292 |
| 1057 | 3300035119 | Ga0373956_0031450 | Ga0373956_0031450_404_1294 | 292 |
| 1058 | 3300035120 | Ga0373957_0002619 | Ga0373957_0002619_2361_3251 | 292 |
| 1059 | 3300035120 | Ga0373957_0022059 | Ga0373957_0022059_1205_2089 | 292 |
| 1060 | 3300035120 | Ga0373957_0124333 | Ga0373957_0124333_114_1019 | 292 |
| 1061 | 3300035121 | Ga0373960_0004701 | Ga0373960_0004701_1185_2063 | 292 |
| 1062 | 3300035172 | Ga0373955_0002863 | Ga0373955_0002863_4659_5564 | 292 |
| 1063 | 3300035172 | Ga0373955_0019914 | Ga0373955_0019914_913_1797 | 292 |
| 1064 | 3300035172 | Ga0373955_0034707 | Ga0373955_0034707_1213_2103 | 292 |
| 1065 | 3300035172 | Ga0373955_0116083 | Ga0373955_0116083_218_1102 | 292 |
| 1066 | 3300035207 | Ga0373942_0000722 | Ga0373942_0000722_1059_1937 | 292 |
| 1067 | 3300035207 | Ga0373942_0002912 | Ga0373942_0002912_1112_1990 | 292 |
| 1068 | 3300035241 | Ga0373961_0000791 | Ga0373961_0000791_47_925 | 292 |
| 1069 | 3300035242 | Ga0373962_0000151 | Ga0373962_0000151_2335_3213 | 292 |
| 1070 | 3300035410 | Ga0373924_0012363 | Ga0373924_0012363_407_1297 | 292 |
| 1071 | 3300035691 | Ga0373931_0000381 | Ga0373931_0000381_565_1443 | 292 |
| 1072 | 3300035691 | Ga0373931_0079061 | Ga0373931_0079061_771_1649 | 292 |
| 1073 | 3300035691 | Ga0373931_0143846 | Ga0373931_0143846_367_1257 | 292 |
| 1074 | 3300035724 | Ga0373933_0004299 | Ga0373933_0004299_3118_4008 | 292 |
| 1075 | 3300035724 | Ga0373933_0008712 | Ga0373933_0008712_4219_5124 | 292 |
| 1076 | 3300035724 | Ga0373933_0042497 | Ga0373933_0042497_1459_2343 | 292 |
| 1077 | 3300035724 | Ga0373933_0107869 | Ga0373933_0107869_599_1489 | 292 |
| 1078 | 3300035725 | Ga0373947_0068838 | Ga0373947_0068838_1048_1938 | 292 |
| 1079 | 3300036401 | Ga0373937_0012115 | Ga0373937_0012115_5240_6130 | 292 |
| 1080 | 3300036401 | Ga0373937_0023630 | Ga0373937_0023630_1805_2710 | 292 |
| 1081 | 3300036401 | Ga0373937_0023983 | Ga0373937_0023983_2408_3298 | 292 |
| 1082 | 3300036401 | Ga0373937_0033945 | Ga0373937_0033945_1313_2197 | 292 |
| 1083 | 3300036401 | Ga0373937_0043327 | Ga0373937_0043327_433_1338 | 292 |
| 1084 | 3300036401 | Ga0373937_0211287 | Ga0373937_0211287_902_1801 | 292 |
| 1085 | 3300042876 | Ga0451577_0296704 | Ga0451577_0296704_106_984 | 292 |
| 1086 | 3300045051 | Ga0451576_0042133 | Ga0451576_0042133_651_1529 | 292 |
| 1087 | 3300046454 | Ga0495592_0006061 | Ga0495592_0006061_6389_7294 | 292 |
| 1088 | 3300046454 | Ga0495592_0163023 | Ga0495592_0163023_143_1048 | 292 |
| 1089 | 3300046462 | Ga0495651_0102658 | Ga0495651_0102658_46_930 | 292 |
| 1090 | 3300046462 | Ga0495651_0122042 | Ga0495651_0122042_581_1465 | 292 |
| 1091 | 3300046477 | Ga0495664_0008599 | Ga0495664_0008599_2635_3525 | 292 |
| 1092 | 3300046477 | Ga0495664_0026579 | Ga0495664_0026579_2250_3155 | 292 |
| 1093 | 3300046477 | Ga0495664_0044351 | Ga0495664_0044351_375_1265 | 292 |
| 1094 | 3300046477 | Ga0495664_0045474 | Ga0495664_0045474_1136_2041 | 292 |
| 1095 | 3300046514 | Ga0495618_0015542 | Ga0495618_0015542_2949_3839 | 292 |
| 1096 | 3300046516 | Ga0495628_0003390 | Ga0495628_0003390_10262_11167 | 292 |
| 1097 | 3300046517 | Ga0495630_0120146 | Ga0495630_0120146_116_1006 | 292 |
| 1098 | 3300046517 | Ga0495630_0464014 | Ga0495630_0464014_20_910 | 292 |
| 1099 | 3300046533 | Ga0495640_0030306 | Ga0495640_0030306_1492_2397 | 292 |
| 1100 | 3300046533 | Ga0495640_0123766 | Ga0495640_0123766_548_1438 | 292 |
| 1101 | 3300046536 | Ga0495587_0002521 | Ga0495587_0002521_2772_3662 | 292 |
| 1102 | 3300046536 | Ga0495587_0015010 | Ga0495587_0015010_872_1756 | 292 |
| 1103 | 3300046536 | Ga0495587_0107890 | Ga0495587_0107890_586_1491 | 292 |
| 1104 | 3300046543 | Ga0495645_0002657 | Ga0495645_0002657_3731_4621 | 292 |
| 1105 | 3300046543 | Ga0495645_0031265 | Ga0495645_0031265_197_1102 | 292 |
| 1106 | 3300046543 | Ga0495645_0203422 | Ga0495645_0203422_152_1042 | 292 |
| 1107 | 3300046559 | Ga0495667_0002603 | Ga0495667_0002603_3584_4474 | 292 |
| 1108 | 3300046559 | Ga0495667_0012554 | Ga0495667_0012554_588_1472 | 292 |
| 1109 | 3300046663 | Ga0495635_0012601 | Ga0495635_0012601_4761_5651 | 292 |
| 1110 | 3300046663 | Ga0495635_0038244 | Ga0495635_0038244_2002_2892 | 292 |
| 1111 | 3300046663 | Ga0495635_0053072 | Ga0495635_0053072_1872_2777 | 292 |
| 1112 | 3300046664 | Ga0495659_0038928 | Ga0495659_0038928_654_1544 | 292 |
| 1113 | 3300046675 | Ga0495657_0003205 | Ga0495657_0003205_12063_12953 | 292 |
| 1114 | 3300046675 | Ga0495657_0107953 | Ga0495657_0107953_64_948 | 292 |
| 1115 | 3300046679 | Ga0495623_0002818 | Ga0495623_0002818_9721_10611 | 292 |
| 1116 | 3300046680 | Ga0495646_0006855 | Ga0495646_0006855_3255_4145 | 292 |
| 1117 | 3300046680 | Ga0495646_0162082 | Ga0495646_0162082_50_955 | 292 |
| 1118 | 3300046683 | Ga0495658_0035323 | Ga0495658_0035323_260_1165 | 292 |
| 1119 | 3300046809 | Ga0495600_0052214 | Ga0495600_0052214_1249_2139 | 292 |
| 1120 | 3300047317 | Ga0495604_0009051 | Ga0495604_0009051_3468_4352 | 292 |
| 1121 | 3300047317 | Ga0495604_0011548 | Ga0495604_0011548_2009_2914 | 292 |
| 1122 | 3300047317 | Ga0495604_0011991 | Ga0495604_0011991_2746_3636 | 292 |
| 1123 | 3300047317 | Ga0495604_0046824 | Ga0495604_0046824_2305_3210 | 292 |
| 1124 | 3300047322 | Ga0495680_0006209 | Ga0495680_0006209_5395_6285 | 292 |
| 1125 | 3300047322 | Ga0495680_0023741 | Ga0495680_0023741_956_1861 | 292 |
| 1126 | 3300047322 | Ga0495680_0025295 | Ga0495680_0025295_2426_3310 | 292 |
| 1127 | 3300047444 | Ga0495675_0005683 | Ga0495675_0005683_4908_5798 | 292 |
| 1128 | 3300047444 | Ga0495675_0055898 | Ga0495675_0055898_322_1227 | 292 |
| 1129 | 3300047471 | Ga0495684_0032210 | Ga0495684_0032210_1339_2244 | 292 |
| 1130 | 3300047471 | Ga0495684_0134838 | Ga0495684_0134838_383_1288 | 292 |
| 1131 | 3300048088 | Ga0495602_0004518 | Ga0495602_0004518_569_1474 | 292 |
| 1132 | 3300048088 | Ga0495602_0007000 | Ga0495602_0007000_3096_3986 | 292 |
| 1133 | 3300048088 | Ga0495602_0123396 | Ga0495602_0123396_896_1780 | 292 |
| 1134 | 3300048903 | Ga0496100_0000530 | Ga0496100_0000530_17102_17980 | 292 |
| 1135 | 3300048903 | Ga0496100_0042520 | Ga0496100_0042520_1097_1987 | 292 |
| 1136 | 3300048904 | Ga0496101_0000189 | Ga0496101_0000189_26032_26910 | 292 |
| 1137 | 3300048904 | Ga0496101_0026690 | Ga0496101_0026690_1088_1978 | 292 |
| 1138 | 3300048905 | Ga0496102_0007437 | Ga0496102_0007437_934_1824 | 292 |
| 1139 | 3300048905 | Ga0496102_0228045 | Ga0496102_0228045_494_1384 | 292 |
| 1140 | 3300048906 | Ga0496103_0082569 | Ga0496103_0082569_338_1216 | 292 |
| 1141 | 3300048906 | Ga0496103_0126318 | Ga0496103_0126318_563_1453 | 292 |
| 1142 | 3300048907 | Ga0496104_0073768 | Ga0496104_0073768_2243_3121 | 292 |
| 1143 | 3300048907 | Ga0496104_0094987 | Ga0496104_0094987_1420_2310 | 292 |
| 1144 | 3300048908 | Ga0496105_0173093 | Ga0496105_0173093_256_1134 | 292 |
| 1145 | 3300048908 | Ga0496105_0230454 | Ga0496105_0230454_461_1351 | 292 |
| 1146 | 3300048909 | Ga0496106_0100557 | Ga0496106_0100557_792_1682 | 292 |
| 1147 | 3300048909 | Ga0496106_0217356 | Ga0496106_0217356_260_1150 | 292 |
| 1148 | 3300048910 | Ga0496107_0018052 | Ga0496107_0018052_595_1473 | 292 |
| 1149 | 3300048910 | Ga0496107_0059427 | Ga0496107_0059427_1191_2081 | 292 |
| 1150 | 3300048910 | Ga0496107_0072869 | Ga0496107_0072869_541_1431 | 292 |
| 1151 | 3300048910 | Ga0496107_0083486 | Ga0496107_0083486_1114_1992 | 292 |
| 1152 | 3300048910 | Ga0496107_0145235 | Ga0496107_0145235_82_960 | 292 |
| 1153 | 3300048911 | Ga0496108_0004455 | Ga0496108_0004455_6484_7362 | 292 |
| 1154 | 3300048911 | Ga0496108_0018809 | Ga0496108_0018809_3703_4593 | 292 |
| 1155 | 3300048911 | Ga0496108_0021834 | Ga0496108_0021834_626_1504 | 292 |
| 1156 | 3300048911 | Ga0496108_0611468 | Ga0496108_0611468_31_909 | 292 |
| 1157 | 3300048912 | Ga0496109_0000488 | Ga0496109_0000488_7423_8301 | 292 |
| 1158 | 3300048912 | Ga0496109_0001318 | Ga0496109_0001318_17879_18757 | 292 |
| 1159 | 3300048912 | Ga0496109_0104177 | Ga0496109_0104177_1566_2456 | 292 |
| 1160 | 3300048913 | Ga0496110_0021488 | Ga0496110_0021488_3332_4210 | 292 |
| 1161 | 3300048913 | Ga0496110_0031059 | Ga0496110_0031059_363_1241 | 292 |
| 1162 | 3300048913 | Ga0496110_0232955 | Ga0496110_0232955_770_1660 | 292 |
| 1163 | 3300048914 | Ga0496111_0021342 | Ga0496111_0021342_1091_1969 | 292 |
| 1164 | 3300048914 | Ga0496111_0038419 | Ga0496111_0038419_1956_2834 | 292 |
| 1165 | 3300048915 | Ga0496112_0103864 | Ga0496112_0103864_1354_2232 | 292 |
| 1166 | 3300048916 | Ga0496113_0002209 | Ga0496113_0002209_6918_7796 | 292 |
| 1167 | 3300048916 | Ga0496113_0117820 | Ga0496113_0117820_763_1641 | 292 |
| 1168 | 3300048917 | Ga0496114_0001960 | Ga0496114_0001960_11462_12340 | 292 |
| 1169 | 3300048917 | Ga0496114_0112540 | Ga0496114_0112540_594_1484 | 292 |
| 1170 | 3300048918 | Ga0496115_0002442 | Ga0496115_0002442_3081_3959 | 292 |
| 1171 | 3300048918 | Ga0496115_0206305 | Ga0496115_0206305_272_1162 | 292 |
| 1172 | 3300049592 | Ga0501076_0089633 | Ga0501076_0089633_895_1773 | 292 |
| 1173 | 3300049593 | Ga0501077_0029799 | Ga0501077_0029799_2001_2879 | 292 |
| 1174 | 3300050490 | nmdc:mga03n38_186316_c1 | nmdc:mga03n38_186316_c1_43_921 | 292 |
| 1175 | 3300050494 | nmdc:mga06z11_90716_c1 | nmdc:mga06z11_90716_c1_692_1570 | 292 |
| 1176 | 3300050507 | nmdc:mga05p37_505_c1 | nmdc:mga05p37_505_c1_13260_14180 | 292 |
| 1177 | 3300050508 | nmdc:mga09592_3702_c1 | nmdc:mga09592_3702_c1_2122_3042 | 292 |
| 1178 | 3300050509 | nmdc:mga0qj67_859_c1 | nmdc:mga0qj67_859_c1_15288_16208 | 292 |
| 1179 | 3300050510 | nmdc:mga06r32_20013_c1 | nmdc:mga06r32_20013_c1_1793_2713 | 292 |
| 1180 | 3300050511 | nmdc:mga08y16_11105_c1 | nmdc:mga08y16_11105_c1_175_1053 | 292 |
| 1181 | 3300050511 | nmdc:mga08y16_33421_c1 | nmdc:mga08y16_33421_c1_397_1275 | 292 |
| 1182 | 3300050511 | nmdc:mga08y16_7641_c1 | nmdc:mga08y16_7641_c1_1665_2585 | 292 |
| 1183 | 3300050512 | nmdc:mga0n895_2584_c1 | nmdc:mga0n895_2584_c1_7945_8823 | 292 |
| 1184 | 3300050512 | nmdc:mga0n895_3537_c1 | nmdc:mga0n895_3537_c1_5692_6612 | 292 |
| 1185 | 3300050513 | nmdc:mga0rr50_1087_c1 | nmdc:mga0rr50_1087_c1_10873_11793 | 292 |
| 1186 | 3300050513 | nmdc:mga0rr50_116638_c1 | nmdc:mga0rr50_116638_c1_1025_1903 | 292 |
| 1187 | 3300050513 | nmdc:mga0rr50_486212_c1 | nmdc:mga0rr50_486212_c1_53_979 | 292 |
| 1188 | 3300050515 | nmdc:mga0a205_108_c1 | nmdc:mga0a205_108_c1_44771_45691 | 292 |
| 1189 | 3300050515 | nmdc:mga0a205_1492_c1 | nmdc:mga0a205_1492_c1_3425_4303 | 292 |
| 1190 | 3300050515 | nmdc:mga0a205_397110_c1 | nmdc:mga0a205_397110_c1_92_970 | 292 |
| 1191 | 3300050515 | nmdc:mga0a205_9612_c2 | nmdc:mga0a205_9612_c2_1806_2732 | 292 |
| 1192 | 3300053077 | Ga0495601_0000958 | Ga0495601_0000958_14516_15421 | 292 |
| 1193 | 3300053077 | Ga0495601_0002291 | Ga0495601_0002291_3979_4869 | 292 |
| 1194 | 3300053077 | Ga0495601_0004285 | Ga0495601_0004285_4143_5033 | 292 |
| 1195 | 3300053078 | Ga0495612_0000276 | Ga0495612_0000276_12221_13126 | 292 |
| 1196 | 3300053078 | Ga0495612_0003620 | Ga0495612_0003620_2181_3071 | 292 |
| 1197 | 3300053078 | Ga0495612_0014054 | Ga0495612_0014054_202_1092 | 292 |
| 1198 | 3300053084 | Ga0495595_0000596 | Ga0495595_0000596_9953_10858 | 292 |
| 1199 | 3300053084 | Ga0495595_0009479 | Ga0495595_0009479_903_1808 | 292 |
| 1200 | 3300053085 | Ga0495619_0000108 | Ga0495619_0000108_11366_12271 | 292 |
| 1201 | 3300053085 | Ga0495619_0000763 | Ga0495619_0000763_6324_7229 | 292 |
| 1202 | 3300053085 | Ga0495619_0005840 | Ga0495619_0005840_3267_4157 | 292 |
| 1203 | 3300053117 | Ga0500593_018155 | Ga0500593_018155_1517_2404 | 292 |
| 1204 | 3300060353 | Ga0501082_0217372 | Ga0501082_0217372_124_1002 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
189
309
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zcd-assembly3.cif.gz_B | renalase in complex with nad+ | 0.9667 | 4 | 32 |
| 7d6x-assembly1.cif.gz_A | mycobacterium smegmatis sdh1 complex in the apo form | 0.9612 | 4 | 31 |
| 4zcc-assembly2.cif.gz_C | renalase in complex with nadh | 0.9611 | 4 | 32 |
| 3doj-assembly1.cif.gz_A | structure of glyoxylate reductase 1 from arabidopsis (atglyr1) | 0.9592 | 4 | 287 |
| 1vpd-assembly1.cif.gz_A | x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] | 0.9565 | 4 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6E7M3_47_537_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9817 | 5 | 32 | 3.50.50.60 |
| af_A0A1D6NCX6_182_311_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9804 | 166 | 288 | 1.10.1040.10 |
| af_P77161_159_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9749 | 162 | 288 | 1.10.1040.10 |
| af_F4IAP5_485_617_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9711 | 166 | 290 | 1.10.1040.10 |
| af_Q4DFE2_166_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9704 | 166 | 288 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A395WE70-F1-model_v4 | HAD family hydrolase | 0.9735 | 3 | 285 |
GO:0016054
GO:0016787 GO:0050661 GO:0051287 |
| AF-A0A3N5PJN0-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) | 0.9734 | 192 | 288 |
GO:0008679
GO:0051287 |
| AF-A0A094E1N2-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein | 0.9728 | 160 | 284 |
GO:0051287
|
| AF-A0A2M8J2P9-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9727 | 3 | 292 |
GO:0016054
GO:0016491 GO:0050661 GO:0051287 |
| AF-A0A7S1LNM2-F1-model_v4 | 3-hydroxyisobutyrate dehydrogenase-like NAD-binding domain-containing protein | 0.9719 | 89 | 287 |
GO:0050661
GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar