F491560

General Info

Members Datasets Scaffolds Average Seq Length
1198 300 1198 133

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0047477|Ga0439460_0047477_847_1248
Length 125
Sequence LTERPAETGTADRSPVDVKDLHRIVLQSLDDDQAVDVVTIPLTGKSNIADHMVIASGRSTRQVASMAAKLKKNVRIEGLPAADWVLIDADDVIVHIFRPEVRSFYNLERMWAFGDDSGASATARG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
194 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
217 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
223 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
224 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
225 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
226 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
227 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
228 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
229 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
230 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
288 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
289 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
290 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
297 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 4.51
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007403 3300001904 Bacteria 1845
2 JGI24736J21556_1057634 3300001904 Bacteria 600
3 JGI24747J21853_1031043 3300001978 Bacteria 611
4 JGI24740J21852_10001189 3300001979 Bacteria 11731
5 JGI24740J21852_10014981 3300001979 Bacteria 2844
6 JGI24740J21852_10017781 3300001979 Bacteria 2535
7 JGI24740J21852_10017908 3300001979 Bacteria 2524
8 JGI24740J21852_10021633 3300001979 Bacteria 2226
9 JGI24739J22299_10017275 3300001989 Bacteria 2604
10 JGI24739J22299_10082795 3300001989 Bacteria 983
11 JGI24737J22298_10006423 3300001990 Bacteria 4016
12 JGI24737J22298_10013914 3300001990 Bacteria 2616
13 JGI24737J22298_10020665 3300001990 Bacteria 2101
14 JGI24737J22298_10033556 3300001990 Bacteria 1594
15 JGI24737J22298_10064233 3300001990 Bacteria 1101
16 JGI24735J21928_10005426 3300002067 Bacteria 4233
17 JGI24735J21928_10008880 3300002067 Bacteria 3242
18 JGI24735J21928_10025081 3300002067 Bacteria 1801
19 JGI24735J21928_10049235 3300002067 Bacteria 1218
20 JGI24750J21931_1006858 3300002070 Bacteria 1425
21 JGI24738J21930_10093971 3300002075 Bacteria 636
22 JGI24033J26618_1022039 3300002155 Bacteria 822
23 JGI24034J26672_10030534 3300002239 Bacteria 876
24 JGI24742J22300_10051672 3300002244 Bacteria 745
25 Ga0065712_10035350 3300005290 Bacteria 1073
26 Ga0065712_10100388 3300005290 Bacteria 2051
27 Ga0065712_10202517 3300005290 Bacteria 1103
28 Ga0065715_10034496 3300005293 Bacteria 1586
29 Ga0065715_10280007 3300005293 Bacteria 1083
30 Ga0065715_10334062 3300005293 Bacteria 978
31 Ga0065715_10539698 3300005293 Bacteria 749
32 Ga0065715_11033409 3300005293 Bacteria 536
33 Ga0070658_10000070 3300005327 Bacteria 98943
34 Ga0070658_10011090 3300005327 Bacteria 7225
35 Ga0070658_10028976 3300005327 Bacteria 4446
36 Ga0070658_10030513 3300005327 Bacteria 4331
37 Ga0070658_10042044 3300005327 Bacteria 3689
38 Ga0070658_10043618 3300005327 Bacteria 3622
39 Ga0070658_10075997 3300005327 Bacteria 2755
40 Ga0070658_10079178 3300005327 Bacteria 2698
41 Ga0070658_10091982 3300005327 Bacteria 2500
42 Ga0070658_10106531 3300005327 Bacteria 2319
43 Ga0070658_10130989 3300005327 Bacteria 2090
44 Ga0070658_10180644 3300005327 Bacteria 1775
45 Ga0070658_10221135 3300005327 Bacteria 1601
46 Ga0070658_10545216 3300005327 Bacteria 1004
47 Ga0070658_10557885 3300005327 Bacteria 991
48 Ga0070658_10996881 3300005327 Bacteria 729
49 Ga0070676_10001397 3300005328 Bacteria 12187
50 Ga0070676_10085555 3300005328 Bacteria 1922
51 Ga0070676_10096363 3300005328 Bacteria 1821
52 Ga0070676_10184426 3300005328 Bacteria 1359
53 Ga0070683_100057473 3300005329 Bacteria 3614
54 Ga0070683_100059590 3300005329 Bacteria 3547
55 Ga0070683_100286671 3300005329 Bacteria 1566
56 Ga0070683_100395016 3300005329 Bacteria 1319
57 Ga0070683_100397827 3300005329 Bacteria 1313
58 Ga0070683_101489299 3300005329 Bacteria 650
59 Ga0070690_100019106 3300005330 Bacteria 4153
60 Ga0070690_100142158 3300005330 Bacteria 1630
61 Ga0070670_100002414 3300005331 Bacteria 15403
62 Ga0070670_100103868 3300005331 Bacteria 2448
63 Ga0070670_100113799 3300005331 Bacteria 2333
64 Ga0070670_100263051 3300005331 Bacteria 1504
65 Ga0070677_10053665 3300005333 Bacteria 1640
66 Ga0070677_10387854 3300005333 Bacteria 733
67 Ga0068869_100352816 3300005334 Bacteria 1199
68 Ga0068869_100479455 3300005334 Bacteria 1035
69 Ga0070666_10000693 3300005335 Bacteria 20437
70 Ga0070666_10028217 3300005335 Bacteria 3681
71 Ga0070666_10032630 3300005335 Bacteria 3441
72 Ga0070666_10434440 3300005335 Bacteria 947
73 Ga0070666_10896149 3300005335 Bacteria 656
74 Ga0070680_100041996 3300005336 Bacteria 3709
75 Ga0070680_100054926 3300005336 Bacteria 3253
76 Ga0070680_100077373 3300005336 Bacteria 2740
77 Ga0070680_100095186 3300005336 Bacteria 2468
78 Ga0070680_100910731 3300005336 Bacteria 759
79 Ga0070682_100001991 3300005337 Bacteria 11391
80 Ga0070682_100064589 3300005337 Bacteria 2324
81 Ga0070682_100283451 3300005337 Bacteria 1209
82 Ga0068868_100001623 3300005338 Bacteria 15367
83 Ga0068868_100039816 3300005338 Bacteria 3654
84 Ga0068868_100174963 3300005338 Bacteria 1779
85 Ga0068868_100225233 3300005338 Bacteria 1571
86 Ga0068868_100707368 3300005338 Bacteria 902
87 Ga0068868_100752664 3300005338 Bacteria 876
88 Ga0068868_100873759 3300005338 Bacteria 815
89 Ga0070660_100012527 3300005339 Bacteria 6058
90 Ga0070660_100019076 3300005339 Bacteria 5020
91 Ga0070660_100024248 3300005339 Bacteria 4501
92 Ga0070660_100024658 3300005339 Bacteria 4463
93 Ga0070660_100026492 3300005339 Bacteria 4317
94 Ga0070660_100029093 3300005339 Bacteria 4138
95 Ga0070660_100051038 3300005339 Bacteria 3184
96 Ga0070660_100070548 3300005339 Bacteria 2727
97 Ga0070660_100070573 3300005339 Bacteria 2727
98 Ga0070660_100086557 3300005339 Bacteria 2465
99 Ga0070660_100095606 3300005339 Bacteria 2348
100 Ga0070660_100114786 3300005339 Bacteria 2146
101 Ga0070660_100155586 3300005339 Bacteria 1840
102 Ga0070660_100328742 3300005339 Bacteria 1257
103 Ga0070660_100639664 3300005339 Bacteria 890
104 Ga0070691_10012295 3300005341 Bacteria 3919
105 Ga0070691_10014238 3300005341 Bacteria 3647
106 Ga0070687_100279669 3300005343 Bacteria 1050
107 Ga0070661_100003112 3300005344 Bacteria 11415
108 Ga0070661_100003585 3300005344 Bacteria 10686
109 Ga0070661_100007620 3300005344 Bacteria 7467
110 Ga0070661_100007914 3300005344 Bacteria 7341
111 Ga0070661_100022414 3300005344 Bacteria 4522
112 Ga0070661_100058342 3300005344 Bacteria 2828
113 Ga0070661_100076964 3300005344 Bacteria 2459
114 Ga0070661_100161078 3300005344 Bacteria 1699
115 Ga0070661_100177450 3300005344 Bacteria 1620
116 Ga0070661_100209151 3300005344 Bacteria 1493
117 Ga0070661_100224283 3300005344 Bacteria 1442
118 Ga0070661_100977056 3300005344 Bacteria 702
119 Ga0070661_100984546 3300005344 Bacteria 699
120 Ga0070692_10079536 3300005345 Bacteria 1763
121 Ga0070692_10086083 3300005345 Bacteria 1701
122 Ga0070668_100000324 3300005347 Bacteria 31403
123 Ga0070668_100092066 3300005347 Bacteria 2391
124 Ga0070668_100159761 3300005347 Bacteria 1828
125 Ga0070668_100230126 3300005347 Bacteria 1532
126 Ga0070668_100359875 3300005347 Bacteria 1233
127 Ga0070668_100615240 3300005347 Bacteria 952
128 Ga0070669_100021655 3300005353 Bacteria 4594
129 Ga0070669_100117874 3300005353 Bacteria 2022
130 Ga0070669_100211355 3300005353 Bacteria 1530
131 Ga0070669_100240857 3300005353 Bacteria 1437
132 Ga0070669_100310661 3300005353 Bacteria 1271
133 Ga0070669_100533567 3300005353 Bacteria 977
134 Ga0070675_100022362 3300005354 Bacteria 5052
135 Ga0070675_100042120 3300005354 Bacteria 3730
136 Ga0070675_100049898 3300005354 Bacteria 3436
137 Ga0070675_100127092 3300005354 Bacteria 2170
138 Ga0070675_100168121 3300005354 Bacteria 1890
139 Ga0070671_100001903 3300005355 Bacteria 15966
140 Ga0070671_100004394 3300005355 Bacteria 11145
141 Ga0070671_100005300 3300005355 Bacteria 10284
142 Ga0070671_100009611 3300005355 Bacteria 7770
143 Ga0070671_100024734 3300005355 Bacteria 4919
144 Ga0070671_100244725 3300005355 Bacteria 1523
145 Ga0070671_100309916 3300005355 Bacteria 1344
146 Ga0070671_100573962 3300005355 Bacteria 974
147 Ga0070674_100026869 3300005356 Bacteria 3766
148 Ga0070674_100033351 3300005356 Bacteria 3427
149 Ga0070674_100037620 3300005356 Bacteria 3256
150 Ga0070674_100335702 3300005356 Bacteria 1216
151 Ga0070673_100012375 3300005364 Bacteria 5855
152 Ga0070673_100034179 3300005364 Bacteria 3844
153 Ga0070673_100043357 3300005364 Bacteria 3476
154 Ga0070673_100064668 3300005364 Bacteria 2915
155 Ga0070673_100135708 3300005364 Bacteria 2071
156 Ga0070673_100765009 3300005364 Bacteria 890
157 Ga0070673_101167613 3300005364 Bacteria 721
158 Ga0070659_100011503 3300005366 Bacteria 6546
159 Ga0070659_100018589 3300005366 Bacteria 5245
160 Ga0070659_100026025 3300005366 Bacteria 4500
161 Ga0070659_100035102 3300005366 Bacteria 3903
162 Ga0070659_100043855 3300005366 Bacteria 3500
163 Ga0070659_100096713 3300005366 Bacteria 2372
164 Ga0070659_100196190 3300005366 Bacteria 1661
165 Ga0070659_100301928 3300005366 Bacteria 1335
166 Ga0070659_100730615 3300005366 Bacteria 858
167 Ga0070667_100001793 3300005367 Bacteria 19116
168 Ga0070667_100002452 3300005367 Bacteria 16200
169 Ga0070667_100007452 3300005367 Bacteria 9084
170 Ga0070667_100011342 3300005367 Bacteria 7370
171 Ga0070667_100048291 3300005367 Bacteria 3582
172 Ga0070667_100187455 3300005367 Bacteria 1831
173 Ga0070667_101365322 3300005367 Bacteria 664
174 Ga0070714_100099690 3300005435 Bacteria 2557
175 Ga0070701_10299002 3300005438 Bacteria 989
176 Ga0070705_100256018 3300005440 Bacteria 1231
177 Ga0070694_100119188 3300005444 Bacteria 1891
178 Ga0070663_100003483 3300005455 Bacteria 9075
179 Ga0070663_100010497 3300005455 Bacteria 5772
180 Ga0070663_100019953 3300005455 Bacteria 4427
181 Ga0070663_100033054 3300005455 Bacteria 3570
182 Ga0070663_100077100 3300005455 Bacteria 2439
183 Ga0070663_100082846 3300005455 Bacteria 2361
184 Ga0070663_100124560 3300005455 Bacteria 1951
185 Ga0070663_100154549 3300005455 Bacteria 1762
186 Ga0070663_100328154 3300005455 Bacteria 1232
187 Ga0070663_100569772 3300005455 Bacteria 949
188 Ga0070663_100861019 3300005455 Bacteria 780
189 Ga0070678_100075465 3300005456 Bacteria 2536
190 Ga0070678_100387226 3300005456 Bacteria 1211
191 Ga0070678_101520837 3300005456 Bacteria 627
192 Ga0070662_100008030 3300005457 Bacteria 6867
193 Ga0070662_100009542 3300005457 Bacteria 6351
194 Ga0070662_100015942 3300005457 Bacteria 5041
195 Ga0070662_100095202 3300005457 Bacteria 2244
196 Ga0070662_100101866 3300005457 Bacteria 2174
197 Ga0070662_100103609 3300005457 Bacteria 2158
198 Ga0070662_100115852 3300005457 Bacteria 2047
199 Ga0070662_100143496 3300005457 Bacteria 1853
200 Ga0070662_100377191 3300005457 Bacteria 1167
201 Ga0070662_100620562 3300005457 Bacteria 910
202 Ga0070662_100795450 3300005457 Bacteria 804
203 Ga0070662_101094274 3300005457 Bacteria 684
204 Ga0070681_10057409 3300005458 Bacteria 3872
205 Ga0070681_10120953 3300005458 Bacteria 2553
206 Ga0070681_10205044 3300005458 Bacteria 1889
207 Ga0070681_10413986 3300005458 Bacteria 1260
208 Ga0070681_10664078 3300005458 Bacteria 957
209 Ga0068867_100001601 3300005459 Bacteria 15719
210 Ga0068867_100462907 3300005459 Bacteria 1083
211 Ga0070685_10786816 3300005466 Bacteria 700
212 Ga0070679_100014156 3300005530 Bacteria 7651
213 Ga0070679_100066933 3300005530 Bacteria 3582
214 Ga0070679_100109269 3300005530 Bacteria 2751
215 Ga0070679_100139583 3300005530 Bacteria 2404
216 Ga0070679_100702998 3300005530 Bacteria 954
217 Ga0070684_100002928 3300005535 Bacteria 12687
218 Ga0070684_100006344 3300005535 Bacteria 9137
219 Ga0070684_100261382 3300005535 Bacteria 1583
220 Ga0070684_100325272 3300005535 Bacteria 1413
221 Ga0070697_100588635 3300005536 Bacteria 977
222 Ga0068853_100020292 3300005539 Bacteria 5526
223 Ga0068853_100024862 3300005539 Bacteria 5024
224 Ga0068853_100070372 3300005539 Bacteria 3045
225 Ga0068853_100099446 3300005539 Bacteria 2570
226 Ga0068853_100132295 3300005539 Bacteria 2234
227 Ga0068853_100174844 3300005539 Bacteria 1944
228 Ga0068853_100374545 3300005539 Bacteria 1329
229 Ga0068853_100399186 3300005539 Bacteria 1287
230 Ga0068853_100489864 3300005539 Bacteria 1160
231 Ga0068853_101310202 3300005539 Bacteria 700
232 Ga0068853_101612455 3300005539 Bacteria 629
233 Ga0070672_100002633 3300005543 Bacteria 11476
234 Ga0070672_100060757 3300005543 Bacteria 2977
235 Ga0070672_100070955 3300005543 Bacteria 2769
236 Ga0070672_100071824 3300005543 Bacteria 2754
237 Ga0070672_100182832 3300005543 Bacteria 1748
238 Ga0070672_100259697 3300005543 Bacteria 1464
239 Ga0070672_100426951 3300005543 Bacteria 1139
240 Ga0070686_100177064 3300005544 Bacteria 1513
241 Ga0070695_100429638 3300005545 Bacteria 1007
242 Ga0070696_100004810 3300005546 Bacteria 9025
243 Ga0070696_100005700 3300005546 Bacteria 8319
244 Ga0070693_100010518 3300005547 Bacteria 4639
245 Ga0070693_100072940 3300005547 Bacteria 2026
246 Ga0070693_100088119 3300005547 Bacteria 1865
247 Ga0070665_100036695 3300005548 Bacteria 4928
248 Ga0070665_100074781 3300005548 Bacteria 3394
249 Ga0070665_101823723 3300005548 Bacteria 615
250 Ga0070704_100182335 3300005549 Bacteria 1680
251 Ga0068855_100025338 3300005563 Bacteria 7098
252 Ga0068855_100066914 3300005563 Bacteria 4188
253 Ga0068855_100113287 3300005563 Bacteria 3111
254 Ga0068855_100198405 3300005563 Bacteria 2260
255 Ga0068855_100469858 3300005563 Bacteria 1370
256 Ga0068855_100660719 3300005563 Bacteria 1122
257 Ga0068855_101078536 3300005563 Bacteria 841
258 Ga0068855_101354802 3300005563 Bacteria 735
259 Ga0070664_100009841 3300005564 Bacteria 7747
260 Ga0070664_100014536 3300005564 Bacteria 6421
261 Ga0070664_100022999 3300005564 Bacteria 5142
262 Ga0070664_100078427 3300005564 Bacteria 2841
263 Ga0070664_100079559 3300005564 Bacteria 2822
264 Ga0070664_100089658 3300005564 Bacteria 2661
265 Ga0070664_100139301 3300005564 Bacteria 2135
266 Ga0070664_100193308 3300005564 Bacteria 1813
267 Ga0070664_100288733 3300005564 Bacteria 1480
268 Ga0070664_100307716 3300005564 Bacteria 1433
269 Ga0068857_100009896 3300005577 Bacteria 8279
270 Ga0068857_100061344 3300005577 Bacteria 3341
271 Ga0068857_100124584 3300005577 Bacteria 2322
272 Ga0068857_100127422 3300005577 Bacteria 2294
273 Ga0068857_100147994 3300005577 Bacteria 2126
274 Ga0068857_100177063 3300005577 Bacteria 1940
275 Ga0068854_100001932 3300005578 Bacteria 12640
276 Ga0068854_100008675 3300005578 Bacteria 6545
277 Ga0068854_100018213 3300005578 Bacteria 4712
278 Ga0068854_100021848 3300005578 Bacteria 4349
279 Ga0068854_100031971 3300005578 Bacteria 3659
280 Ga0068854_100041707 3300005578 Bacteria 3244
281 Ga0068854_100044661 3300005578 Bacteria 3147
282 Ga0068854_100088238 3300005578 Bacteria 2303
283 Ga0068854_100217210 3300005578 Bacteria 1511
284 Ga0068854_100366374 3300005578 Bacteria 1183
285 Ga0068854_100736807 3300005578 Bacteria 854
286 Ga0068856_100020782 3300005614 Bacteria 6380
287 Ga0068856_100029066 3300005614 Bacteria 5401
288 Ga0068856_100244805 3300005614 Bacteria 1808
289 Ga0068856_100244916 3300005614 Bacteria 1808
290 Ga0068856_100294565 3300005614 Bacteria 1640
291 Ga0068856_100658618 3300005614 Bacteria 1068
292 Ga0068856_100723425 3300005614 Bacteria 1016
293 Ga0070702_100257187 3300005615 Bacteria 1187
294 Ga0068852_100001650 3300005616 Bacteria 15231
295 Ga0068852_100007134 3300005616 Bacteria 8142
296 Ga0068852_100018018 3300005616 Bacteria 5554
297 Ga0068852_100138067 3300005616 Bacteria 2253
298 Ga0068852_100173429 3300005616 Bacteria 2023
299 Ga0068852_100319507 3300005616 Bacteria 1507
300 Ga0068852_100375083 3300005616 Bacteria 1394
301 Ga0068852_100492407 3300005616 Bacteria 1220
302 Ga0068852_100608620 3300005616 Bacteria 1097
303 Ga0068852_101571818 3300005616 Bacteria 680
304 Ga0068859_100000088 3300005617 Bacteria 84390
305 Ga0068859_100011079 3300005617 Bacteria 9073
306 Ga0068859_100016383 3300005617 Bacteria 7445
307 Ga0068859_100308281 3300005617 Bacteria 1676
308 Ga0068864_100000136 3300005618 Bacteria 70797
309 Ga0068864_100002002 3300005618 Bacteria 16780
310 Ga0068864_100017849 3300005618 Bacteria 5918
311 Ga0068864_100115032 3300005618 Bacteria 2399
312 Ga0068864_100142198 3300005618 Bacteria 2165
313 Ga0068864_100611221 3300005618 Bacteria 1059
314 Ga0068866_10051327 3300005718 Bacteria 2099
315 Ga0068866_10340172 3300005718 Bacteria 950
316 Ga0068861_100624367 3300005719 Bacteria 992
317 Ga0068861_101470636 3300005719 Bacteria 668
318 Ga0068851_10002427 3300005834 Bacteria 8184
319 Ga0068851_10040820 3300005834 Bacteria 2333
320 Ga0068851_10063269 3300005834 Bacteria 1900
321 Ga0068851_10258017 3300005834 Bacteria 991
322 Ga0068870_10084054 3300005840 Bacteria 1766
323 Ga0068863_100001560 3300005841 Bacteria 22637
324 Ga0068863_100009138 3300005841 Bacteria 9678
325 Ga0068863_100392419 3300005841 Bacteria 1356
326 Ga0068863_100457735 3300005841 Bacteria 1253
327 Ga0068863_101115893 3300005841 Bacteria 793
328 Ga0068863_101347940 3300005841 Bacteria 721
329 Ga0068858_100000063 3300005842 Bacteria 111811
330 Ga0068858_100000855 3300005842 Bacteria 31513
331 Ga0068858_100130303 3300005842 Bacteria 2358
332 Ga0068860_100050559 3300005843 Bacteria 3956
333 Ga0068860_100063347 3300005843 Bacteria 3512
334 Ga0068860_100111035 3300005843 Bacteria 2621
335 Ga0068860_100296765 3300005843 Bacteria 1582
336 Ga0068862_100002790 3300005844 Bacteria 15308
337 Ga0068862_100024321 3300005844 Bacteria 5082
338 Ga0068862_100059853 3300005844 Bacteria 3271
339 Ga0068862_100087072 3300005844 Bacteria 2717
340 Ga0068862_100215388 3300005844 Bacteria 1737
341 Ga0068862_100409012 3300005844 Bacteria 1271
342 Ga0068862_101048017 3300005844 Bacteria 808
343 Ga0081539_10012171 3300005985 Bacteria 6676
344 Ga0081539_10042924 3300005985 Bacteria 2627
345 Ga0097621_100075669 3300006237 Bacteria 2791
346 Ga0097621_100158892 3300006237 Bacteria 1942
347 Ga0068871_100030119 3300006358 Bacteria 4271
348 Ga0068871_100340841 3300006358 Bacteria 1324
349 Ga0068871_100983653 3300006358 Bacteria 785
350 Ga0068871_101731137 3300006358 Bacteria 593
351 Ga0075428_100205562 3300006844 Bacteria 2128
352 Ga0075428_100281751 3300006844 Bacteria 1788
353 Ga0075431_100605547 3300006847 Bacteria 1079
354 Ga0075433_10052624 3300006852 Bacteria 3548
355 Ga0075434_100772121 3300006871 Bacteria 978
356 Ga0075429_100179883 3300006880 Bacteria 1853
357 Ga0068865_100236900 3300006881 Bacteria 1434
358 Ga0068865_100258838 3300006881 Bacteria 1377
359 Ga0068865_100479868 3300006881 Bacteria 1033
360 Ga0075436_100171737 3300006914 Bacteria 1531
361 Ga0097620_100000088 3300006931 Bacteria 84390
362 Ga0097620_100011079 3300006931 Bacteria 9073
363 Ga0097620_100016383 3300006931 Bacteria 7445
364 Ga0097620_100308284 3300006931 Bacteria 1676
365 Ga0075435_100460778 3300007076 Bacteria 1097
366 Ga0105251_10266959 3300009011 Bacteria 773
367 Ga0105250_10008858 3300009092 Bacteria 4259
368 Ga0105240_10231152 3300009093 Bacteria 2149
369 Ga0105240_10412549 3300009093 Bacteria 1519
370 Ga0105240_10541683 3300009093 Bacteria 1289
371 Ga0105240_10623729 3300009093 Bacteria 1185
372 Ga0105240_11426915 3300009093 Bacteria 727
373 Ga0111539_10037205 3300009094 Bacteria 5879
374 Ga0105245_10031755 3300009098 Bacteria 4675
375 Ga0105245_10368754 3300009098 Bacteria 1427
376 Ga0105243_10049422 3300009148 Bacteria 3318
377 Ga0105243_10525817 3300009148 Bacteria 1126
378 Ga0105241_10228627 3300009174 Bacteria 1567
379 Ga0105241_10385229 3300009174 Bacteria 1226
380 Ga0105241_10408449 3300009174 Bacteria 1193
381 Ga0105241_10477369 3300009174 Bacteria 1108
382 Ga0105242_10310599 3300009176 Bacteria 1442
383 Ga0105242_10345519 3300009176 Bacteria 1372
384 Ga0105248_10000169 3300009177 Bacteria 75948
385 Ga0105248_10001030 3300009177 Bacteria 30868
386 Ga0105248_10020997 3300009177 Bacteria 7236
387 Ga0105248_10023443 3300009177 Bacteria 6856
388 Ga0105248_10024200 3300009177 Bacteria 6750
389 Ga0105248_10079105 3300009177 Bacteria 3695
390 Ga0105248_10396947 3300009177 Bacteria 1553
391 Ga0105237_10099028 3300009545 Bacteria 2907
392 Ga0105238_10037891 3300009551 Bacteria 4899
393 Ga0105238_10039950 3300009551 Bacteria 4755
394 Ga0105238_10087162 3300009551 Bacteria 3109
395 Ga0105238_10223115 3300009551 Bacteria 1861
396 Ga0105249_10338548 3300009553 Bacteria 1520
397 Ga0105249_10503523 3300009553 Bacteria 1256
398 Ga0105249_10548846 3300009553 Bacteria 1206
399 Ga0105239_10109133 3300010375 Bacteria 3066
400 Ga0105239_10966741 3300010375 Bacteria 979
401 Ga0105246_10048303 3300011119 Bacteria 2909
402 Ga0157373_10010857 3300013100 Bacteria 6703
403 Ga0157373_10012015 3300013100 Bacteria 6365
404 Ga0157373_10020523 3300013100 Bacteria 4801
405 Ga0157373_10076520 3300013100 Bacteria 2361
406 Ga0157373_10190063 3300013100 Bacteria 1447
407 Ga0157373_10201275 3300013100 Bacteria 1404
408 Ga0157373_10324888 3300013100 Bacteria 1095
409 Ga0157371_10041479 3300013102 Bacteria 3283
410 Ga0157371_10044453 3300013102 Bacteria 3162
411 Ga0157371_10063501 3300013102 Bacteria 2617
412 Ga0157371_10068288 3300013102 Bacteria 2516
413 Ga0157371_10095739 3300013102 Bacteria 2104
414 Ga0157371_10102510 3300013102 Bacteria 2030
415 Ga0157371_10136517 3300013102 Bacteria 1747
416 Ga0157371_10300916 3300013102 Bacteria 1161
417 Ga0157371_10546246 3300013102 Bacteria 859
418 Ga0157371_10722862 3300013102 Bacteria 746
419 Ga0157370_10071468 3300013104 Bacteria 3274
420 Ga0157370_10081100 3300013104 Bacteria 3054
421 Ga0157370_10092018 3300013104 Bacteria 2847
422 Ga0157370_10099257 3300013104 Bacteria 2729
423 Ga0157370_10183781 3300013104 Bacteria 1942
424 Ga0157370_10371706 3300013104 Bacteria 1317
425 Ga0157370_10438122 3300013104 Bacteria 1202
426 Ga0157370_10796395 3300013104 Bacteria 860
427 Ga0157370_11555284 3300013104 Bacteria 594
428 Ga0157369_10003544 3300013105 Bacteria 18538
429 Ga0157369_10073070 3300013105 Bacteria 3680
430 Ga0157369_10165984 3300013105 Bacteria 2328
431 Ga0157369_10177416 3300013105 Bacteria 2243
432 Ga0157369_10283278 3300013105 Bacteria 1726
433 Ga0157369_10550483 3300013105 Bacteria 1193
434 Ga0157374_10073128 3300013296 Bacteria 3236
435 Ga0157374_10237893 3300013296 Bacteria 1790
436 Ga0157378_10669868 3300013297 Bacteria 1055
437 Ga0157378_10732665 3300013297 Bacteria 1010
438 Ga0157378_10744794 3300013297 Bacteria 1002
439 Ga0163162_10544602 3300013306 Bacteria 1289
440 Ga0163162_10768460 3300013306 Bacteria 1082
441 Ga0163162_11934043 3300013306 Bacteria 675
442 Ga0163162_12464617 3300013306 Bacteria 598
443 Ga0157372_10046487 3300013307 Bacteria 4819
444 Ga0157372_10076912 3300013307 Bacteria 3769
445 Ga0157372_10136055 3300013307 Bacteria 2830
446 Ga0157372_10227966 3300013307 Bacteria 2160
447 Ga0157372_10229737 3300013307 Bacteria 2151
448 Ga0157375_10039482 3300013308 Bacteria 4544
449 Ga0157375_10057944 3300013308 Bacteria 3831
450 Ga0157375_10087808 3300013308 Bacteria 3163
451 Ga0157375_10385289 3300013308 Bacteria 1568
452 Ga0157375_11013368 3300013308 Bacteria 970
453 Ga0163163_10001969 3300014325 Bacteria 17361
454 Ga0163163_10260688 3300014325 Bacteria 1784
455 Ga0163163_11539318 3300014325 Bacteria 726
456 Ga0157377_10014277 3300014745 Bacteria 4039
457 Ga0157379_10003175 3300014968 Bacteria 13917
458 Ga0157379_10068515 3300014968 Bacteria 3172
459 Ga0157379_10169445 3300014968 Bacteria 1971
460 Ga0157379_10202382 3300014968 Bacteria 1796
461 Ga0157376_11103383 3300014969 Bacteria 819
462 Ga0163161_10221905 3300017792 Bacteria 1464
463 Ga0163161_10223498 3300017792 Bacteria 1459
464 Ga0163161_10316991 3300017792 Bacteria 1232
465 Ga0213873_10000007 3300021358 Bacteria 309961
466 Ga0213874_10084580 3300021377 Bacteria 1033
467 Ga0213876_10000005 3300021384 Bacteria 727326
468 Ga0207697_10048304 3300025315 Bacteria 1755
469 Ga0207656_10011657 3300025321 Bacteria 3326
470 Ga0207656_10012456 3300025321 Bacteria 3233
471 Ga0207656_10019287 3300025321 Bacteria 2697
472 Ga0207656_10053189 3300025321 Bacteria 1756
473 Ga0207696_1010575 3300025711 Bacteria 3375
474 Ga0207682_10093923 3300025893 Bacteria 1304
475 Ga0207682_10295621 3300025893 Bacteria 759
476 Ga0207642_10213154 3300025899 Bacteria 1074
477 Ga0207642_10331495 3300025899 Bacteria 892
478 Ga0207642_10564200 3300025899 Bacteria 704
479 Ga0207688_10034073 3300025901 Bacteria 2818
480 Ga0207688_10097261 3300025901 Bacteria 1696
481 Ga0207688_10124172 3300025901 Bacteria 1508
482 Ga0207680_10001868 3300025903 Bacteria 9878
483 Ga0207680_10024768 3300025903 Bacteria 3299
484 Ga0207680_10280307 3300025903 Bacteria 1158
485 Ga0207680_10503758 3300025903 Bacteria 862
486 Ga0207647_10000304 3300025904 Bacteria 40516
487 Ga0207647_10001001 3300025904 Bacteria 21921
488 Ga0207647_10003254 3300025904 Bacteria 12193
489 Ga0207647_10084437 3300025904 Bacteria 1900
490 Ga0207647_10570832 3300025904 Bacteria 626
491 Ga0207645_10002989 3300025907 Bacteria 13069
492 Ga0207645_10007529 3300025907 Bacteria 7683
493 Ga0207645_10089083 3300025907 Bacteria 1984
494 Ga0207645_10094460 3300025907 Bacteria 1924
495 Ga0207645_10199735 3300025907 Bacteria 1315
496 Ga0207643_10105869 3300025908 Bacteria 1653
497 Ga0207705_10000002 3300025909 Bacteria 2046852
498 Ga0207705_10002578 3300025909 Bacteria 13924
499 Ga0207705_10007626 3300025909 Bacteria 7958
500 Ga0207705_10011516 3300025909 Bacteria 6397
501 Ga0207705_10011668 3300025909 Bacteria 6348
502 Ga0207705_10015546 3300025909 Bacteria 5461
503 Ga0207705_10023169 3300025909 Bacteria 4429
504 Ga0207705_10025804 3300025909 Bacteria 4193
505 Ga0207705_10034116 3300025909 Bacteria 3638
506 Ga0207705_10050714 3300025909 Bacteria 2987
507 Ga0207705_10064533 3300025909 Bacteria 2646
508 Ga0207705_10148127 3300025909 Bacteria 1757
509 Ga0207705_10149321 3300025909 Bacteria 1750
510 Ga0207705_10186208 3300025909 Bacteria 1568
511 Ga0207705_10259559 3300025909 Bacteria 1326
512 Ga0207705_10280714 3300025909 Bacteria 1275
513 Ga0207705_11097719 3300025909 Bacteria 613
514 Ga0207654_10059987 3300025911 Bacteria 2221
515 Ga0207654_10232260 3300025911 Bacteria 1229
516 Ga0207654_10252388 3300025911 Bacteria 1183
517 Ga0207654_10409031 3300025911 Bacteria 945
518 Ga0207707_10004641 3300025912 Bacteria 12067
519 Ga0207707_10060221 3300025912 Bacteria 3303
520 Ga0207707_10384233 3300025912 Bacteria 1207
521 Ga0207707_10390826 3300025912 Bacteria 1195
522 Ga0207707_10703741 3300025912 Bacteria 848
523 Ga0207707_11570504 3300025912 Bacteria 519
524 Ga0207695_10012183 3300025913 Bacteria 10335
525 Ga0207695_10079126 3300025913 Bacteria 3333
526 Ga0207695_10151392 3300025913 Bacteria 2259
527 Ga0207695_10543537 3300025913 Bacteria 1043
528 Ga0207695_10781966 3300025913 Bacteria 835
529 Ga0207671_10067696 3300025914 Bacteria 2660
530 Ga0207660_10014425 3300025917 Bacteria 5198
531 Ga0207660_10091849 3300025917 Bacteria 2252
532 Ga0207660_11604649 3300025917 Bacteria 524
533 Ga0207662_10647168 3300025918 Bacteria 738
534 Ga0207657_10000594 3300025919 Bacteria 38336
535 Ga0207657_10002671 3300025919 Bacteria 19229
536 Ga0207657_10003798 3300025919 Bacteria 16059
537 Ga0207657_10008965 3300025919 Bacteria 10108
538 Ga0207657_10011912 3300025919 Bacteria 8606
539 Ga0207657_10013132 3300025919 Bacteria 8134
540 Ga0207657_10022038 3300025919 Bacteria 5981
541 Ga0207657_10045431 3300025919 Bacteria 3855
542 Ga0207657_10110616 3300025919 Bacteria 2269
543 Ga0207657_10118001 3300025919 Bacteria 2185
544 Ga0207657_10140669 3300025919 Bacteria 1972
545 Ga0207657_10141804 3300025919 Bacteria 1963
546 Ga0207657_10153885 3300025919 Bacteria 1871
547 Ga0207657_10168317 3300025919 Bacteria 1777
548 Ga0207657_10173402 3300025919 Bacteria 1746
549 Ga0207657_10529652 3300025919 Bacteria 922
550 Ga0207657_10709828 3300025919 Bacteria 781
551 Ga0207649_10004210 3300025920 Bacteria 7836
552 Ga0207649_10006256 3300025920 Bacteria 6468
553 Ga0207649_10016582 3300025920 Bacteria 4158
554 Ga0207649_10017140 3300025920 Bacteria 4102
555 Ga0207649_10035583 3300025920 Bacteria 2993
556 Ga0207649_10052867 3300025920 Bacteria 2522
557 Ga0207649_10054550 3300025920 Bacteria 2488
558 Ga0207649_10077582 3300025920 Bacteria 2141
559 Ga0207649_10346410 3300025920 Bacteria 1098
560 Ga0207649_10892857 3300025920 Bacteria 697
561 Ga0207652_10006156 3300025921 Bacteria 9700
562 Ga0207652_10043565 3300025921 Bacteria 3821
563 Ga0207652_10051991 3300025921 Bacteria 3515
564 Ga0207652_10067087 3300025921 Bacteria 3110
565 Ga0207652_10140927 3300025921 Bacteria 2156
566 Ga0207652_10296569 3300025921 Bacteria 1459
567 Ga0207652_10434739 3300025921 Bacteria 1183
568 Ga0207652_10934135 3300025921 Bacteria 765
569 Ga0207681_10025242 3300025923 Bacteria 3821
570 Ga0207681_10080381 3300025923 Bacteria 2299
571 Ga0207681_10228371 3300025923 Bacteria 1443
572 Ga0207681_10231833 3300025923 Bacteria 1433
573 Ga0207681_10667647 3300025923 Bacteria 862
574 Ga0207694_10000665 3300025924 Bacteria 30841
575 Ga0207694_10007832 3300025924 Bacteria 8090
576 Ga0207694_10170863 3300025924 Bacteria 1760
577 Ga0207650_10001178 3300025925 Bacteria 19210
578 Ga0207650_10139529 3300025925 Bacteria 1905
579 Ga0207650_10173037 3300025925 Bacteria 1717
580 Ga0207650_10406796 3300025925 Bacteria 1127
581 Ga0207650_10797520 3300025925 Bacteria 800
582 Ga0207659_10036608 3300025926 Bacteria 3401
583 Ga0207659_10040511 3300025926 Bacteria 3257
584 Ga0207659_10196940 3300025926 Bacteria 1606
585 Ga0207659_10378072 3300025926 Bacteria 1181
586 Ga0207659_10516214 3300025926 Bacteria 1013
587 Ga0207659_11289454 3300025926 Bacteria 627
588 Ga0207687_10030308 3300025927 Bacteria 3647
589 Ga0207664_10329500 3300025929 Bacteria 1348
590 Ga0207644_10011767 3300025931 Bacteria 5792
591 Ga0207644_10011879 3300025931 Bacteria 5772
592 Ga0207644_10049748 3300025931 Bacteria 3002
593 Ga0207644_10127016 3300025931 Bacteria 1947
594 Ga0207644_10564971 3300025931 Bacteria 942
595 Ga0207644_10609363 3300025931 Bacteria 907
596 Ga0207644_10666310 3300025931 Bacteria 866
597 Ga0207644_10677209 3300025931 Bacteria 859
598 Ga0207644_10876095 3300025931 Bacteria 752
599 Ga0207690_10003898 3300025932 Bacteria 8821
600 Ga0207690_10005603 3300025932 Bacteria 7421
601 Ga0207690_10005693 3300025932 Bacteria 7360
602 Ga0207690_10013151 3300025932 Bacteria 4967
603 Ga0207690_10018574 3300025932 Bacteria 4265
604 Ga0207690_10046289 3300025932 Bacteria 2880
605 Ga0207690_10064115 3300025932 Bacteria 2508
606 Ga0207690_10114421 3300025932 Bacteria 1948
607 Ga0207690_10116540 3300025932 Bacteria 1932
608 Ga0207690_10124171 3300025932 Bacteria 1880
609 Ga0207690_10126093 3300025932 Bacteria 1867
610 Ga0207690_10298648 3300025932 Bacteria 1260
611 Ga0207690_10444108 3300025932 Bacteria 1041
612 Ga0207690_10618351 3300025932 Bacteria 885
613 Ga0207690_10659682 3300025932 Bacteria 858
614 Ga0207690_10722520 3300025932 Bacteria 820
615 Ga0207690_10941879 3300025932 Bacteria 717
616 Ga0207706_10001396 3300025933 Bacteria 24136
617 Ga0207706_10012892 3300025933 Bacteria 7608
618 Ga0207706_10013013 3300025933 Bacteria 7572
619 Ga0207706_10017823 3300025933 Bacteria 6396
620 Ga0207706_10024600 3300025933 Bacteria 5399
621 Ga0207706_10037929 3300025933 Bacteria 4276
622 Ga0207706_10041370 3300025933 Bacteria 4085
623 Ga0207706_10090981 3300025933 Bacteria 2683
624 Ga0207706_10097907 3300025933 Bacteria 2580
625 Ga0207706_10148206 3300025933 Bacteria 2064
626 Ga0207706_10176159 3300025933 Bacteria 1879
627 Ga0207706_10318073 3300025933 Bacteria 1355
628 Ga0207706_10402133 3300025933 Bacteria 1187
629 Ga0207686_10165661 3300025934 Bacteria 1554
630 Ga0207709_10061929 3300025935 Bacteria 2340
631 Ga0207669_10006996 3300025937 Bacteria 5189
632 Ga0207669_10026312 3300025937 Bacteria 3162
633 Ga0207669_10099971 3300025937 Bacteria 1915
634 Ga0207704_10444042 3300025938 Bacteria 1034
635 Ga0207691_10002368 3300025940 Bacteria 18465
636 Ga0207691_10013203 3300025940 Bacteria 7910
637 Ga0207691_10037001 3300025940 Bacteria 4521
638 Ga0207691_10291631 3300025940 Bacteria 1403
639 Ga0207691_10345437 3300025940 Bacteria 1273
640 Ga0207691_10440466 3300025940 Bacteria 1109
641 Ga0207691_10862082 3300025940 Bacteria 759
642 Ga0207711_10000107 3300025941 Bacteria 87146
643 Ga0207711_10000543 3300025941 Bacteria 38517
644 Ga0207711_10001496 3300025941 Bacteria 21764
645 Ga0207711_10003726 3300025941 Bacteria 13140
646 Ga0207711_10004444 3300025941 Bacteria 11952
647 Ga0207711_10067638 3300025941 Bacteria 3093
648 Ga0207711_10192850 3300025941 Bacteria 1857
649 Ga0207689_10003262 3300025942 Bacteria 14871
650 Ga0207689_10386751 3300025942 Bacteria 1165
651 Ga0207689_10753696 3300025942 Bacteria 822
652 Ga0207661_10002460 3300025944 Bacteria 12728
653 Ga0207661_10039512 3300025944 Bacteria 3703
654 Ga0207661_10121926 3300025944 Bacteria 2220
655 Ga0207679_10018791 3300025945 Bacteria 4637
656 Ga0207679_10020147 3300025945 Bacteria 4497
657 Ga0207679_10044121 3300025945 Bacteria 3215
658 Ga0207679_10046901 3300025945 Bacteria 3135
659 Ga0207679_10144404 3300025945 Bacteria 1928
660 Ga0207679_10161575 3300025945 Bacteria 1834
661 Ga0207679_10175109 3300025945 Bacteria 1770
662 Ga0207679_10176475 3300025945 Bacteria 1764
663 Ga0207679_10194347 3300025945 Bacteria 1690
664 Ga0207679_10325885 3300025945 Bacteria 1331
665 Ga0207679_10373972 3300025945 Bacteria 1248
666 Ga0207679_10416192 3300025945 Bacteria 1185
667 Ga0207667_10052229 3300025949 Bacteria 4306
668 Ga0207667_10076813 3300025949 Bacteria 3465
669 Ga0207667_10087122 3300025949 Bacteria 3230
670 Ga0207667_10149722 3300025949 Bacteria 2402
671 Ga0207667_10174767 3300025949 Bacteria 2207
672 Ga0207667_10206461 3300025949 Bacteria 2014
673 Ga0207667_11209855 3300025949 Bacteria 735
674 Ga0207651_10026105 3300025960 Bacteria 3643
675 Ga0207651_10046067 3300025960 Bacteria 2929
676 Ga0207651_10374960 3300025960 Bacteria 1204
677 Ga0207651_10723566 3300025960 Bacteria 878
678 Ga0207712_10000195 3300025961 Bacteria 62560
679 Ga0207712_10218705 3300025961 Bacteria 1522
680 Ga0207712_11086017 3300025961 Bacteria 712
681 Ga0207668_10000176 3300025972 Bacteria 43587
682 Ga0207668_10079916 3300025972 Bacteria 2367
683 Ga0207668_10196428 3300025972 Bacteria 1603
684 Ga0207668_10261769 3300025972 Bacteria 1410
685 Ga0207668_10557554 3300025972 Bacteria 993
686 Ga0207640_10008423 3300025981 Bacteria 5729
687 Ga0207640_10011803 3300025981 Bacteria 4958
688 Ga0207640_10013090 3300025981 Bacteria 4745
689 Ga0207640_10019760 3300025981 Bacteria 3986
690 Ga0207640_10124489 3300025981 Bacteria 1853
691 Ga0207640_10135423 3300025981 Bacteria 1787
692 Ga0207640_10160375 3300025981 Bacteria 1663
693 Ga0207640_10160830 3300025981 Bacteria 1661
694 Ga0207640_10211381 3300025981 Bacteria 1478
695 Ga0207640_10266802 3300025981 Bacteria 1337
696 Ga0207640_10555229 3300025981 Bacteria 965
697 Ga0207658_10004177 3300025986 Bacteria 10062
698 Ga0207658_10005694 3300025986 Bacteria 8521
699 Ga0207658_10009770 3300025986 Bacteria 6515
700 Ga0207658_10012484 3300025986 Bacteria 5804
701 Ga0207658_10053329 3300025986 Bacteria 2987
702 Ga0207658_10193044 3300025986 Bacteria 1694
703 Ga0207658_10505013 3300025986 Bacteria 1077
704 Ga0207658_10723845 3300025986 Bacteria 900
705 Ga0207658_10768409 3300025986 Bacteria 873
706 Ga0207658_10812120 3300025986 Bacteria 849
707 Ga0207658_11291178 3300025986 Bacteria 667
708 Ga0207677_10002392 3300026023 Bacteria 9830
709 Ga0207677_10098925 3300026023 Bacteria 2141
710 Ga0207677_10849862 3300026023 Bacteria 820
711 Ga0207677_11380876 3300026023 Bacteria 648
712 Ga0207703_10001701 3300026035 Bacteria 19778
713 Ga0207703_10015295 3300026035 Bacteria 5985
714 Ga0207703_10319305 3300026035 Bacteria 1422
715 Ga0207639_10000162 3300026041 Bacteria 51395
716 Ga0207639_10021466 3300026041 Bacteria 4639
717 Ga0207639_10022710 3300026041 Bacteria 4521
718 Ga0207639_10026235 3300026041 Bacteria 4233
719 Ga0207639_10026556 3300026041 Bacteria 4208
720 Ga0207639_10029438 3300026041 Bacteria 4020
721 Ga0207639_10075954 3300026041 Bacteria 2644
722 Ga0207639_10266809 3300026041 Bacteria 1500
723 Ga0207639_10347822 3300026041 Bacteria 1323
724 Ga0207639_11301561 3300026041 Bacteria 682
725 Ga0207678_10002193 3300026067 Bacteria 17637
726 Ga0207678_10004258 3300026067 Bacteria 12830
727 Ga0207678_10005341 3300026067 Bacteria 11504
728 Ga0207678_10031647 3300026067 Bacteria 4614
729 Ga0207678_10050123 3300026067 Bacteria 3607
730 Ga0207678_10167245 3300026067 Bacteria 1878
731 Ga0207678_10192250 3300026067 Bacteria 1744
732 Ga0207678_10302282 3300026067 Bacteria 1375
733 Ga0207678_10842646 3300026067 Bacteria 810
734 Ga0207702_10003777 3300026078 Bacteria 13675
735 Ga0207702_10006018 3300026078 Bacteria 10527
736 Ga0207702_10017313 3300026078 Bacteria 5962
737 Ga0207702_10097149 3300026078 Bacteria 2592
738 Ga0207702_10398845 3300026078 Bacteria 1326
739 Ga0207702_10430340 3300026078 Bacteria 1277
740 Ga0207702_10442130 3300026078 Bacteria 1260
741 Ga0207702_10533287 3300026078 Bacteria 1147
742 Ga0207641_10000138 3300026088 Bacteria 106531
743 Ga0207641_10104357 3300026088 Bacteria 2502
744 Ga0207641_10110460 3300026088 Bacteria 2436
745 Ga0207641_10200230 3300026088 Bacteria 1840
746 Ga0207641_10287669 3300026088 Bacteria 1548
747 Ga0207641_10329795 3300026088 Bacteria 1449
748 Ga0207648_10002364 3300026089 Bacteria 20360
749 Ga0207648_10144505 3300026089 Bacteria 2098
750 Ga0207648_10252238 3300026089 Bacteria 1573
751 Ga0207676_10000245 3300026095 Bacteria 47297
752 Ga0207676_10112014 3300026095 Bacteria 2285
753 Ga0207676_10167159 3300026095 Bacteria 1912
754 Ga0207676_10469991 3300026095 Bacteria 1189
755 Ga0207674_10004380 3300026116 Bacteria 17015
756 Ga0207674_10004467 3300026116 Bacteria 16817
757 Ga0207674_10009547 3300026116 Bacteria 11069
758 Ga0207674_10025071 3300026116 Bacteria 6364
759 Ga0207674_10035223 3300026116 Bacteria 5226
760 Ga0207674_10057996 3300026116 Bacteria 3924
761 Ga0207674_10065368 3300026116 Bacteria 3666
762 Ga0207674_10071823 3300026116 Bacteria 3477
763 Ga0207674_10099350 3300026116 Bacteria 2893
764 Ga0207675_100235673 3300026118 Bacteria 1767
765 Ga0207675_102267757 3300026118 Bacteria 557
766 Ga0207683_10032732 3300026121 Bacteria 4516
767 Ga0207683_10116759 3300026121 Bacteria 2393
768 Ga0207683_10237591 3300026121 Bacteria 1662
769 Ga0207683_10355416 3300026121 Bacteria 1345
770 Ga0207698_10007116 3300026142 Bacteria 7007
771 Ga0207698_10039262 3300026142 Bacteria 3505
772 Ga0207698_10056843 3300026142 Bacteria 3023
773 Ga0207698_10098106 3300026142 Bacteria 2420
774 Ga0207698_10282463 3300026142 Bacteria 1536
775 Ga0207698_10348256 3300026142 Bacteria 1398
776 Ga0207698_10438683 3300026142 Bacteria 1258
777 Ga0207698_10655100 3300026142 Bacteria 1041
778 Ga0207698_10893729 3300026142 Bacteria 895
779 Ga0268266_10022337 3300028379 Bacteria 5393
780 Ga0268266_10283172 3300028379 Bacteria 1542
781 Ga0268266_10540552 3300028379 Bacteria 1115
782 Ga0268266_10677734 3300028379 Bacteria 993
783 Ga0268266_10870202 3300028379 Bacteria 871
784 Ga0268265_10002345 3300028380 Bacteria 14358
785 Ga0268265_10003839 3300028380 Bacteria 10635
786 Ga0268265_10020542 3300028380 Bacteria 4609
787 Ga0268265_10062605 3300028380 Bacteria 2859
788 Ga0268265_10120128 3300028380 Bacteria 2163
789 Ga0268265_10250175 3300028380 Bacteria 1569
790 Ga0268265_10305144 3300028380 Bacteria 1435
791 Ga0268265_10770016 3300028380 Bacteria 936
792 Ga0268265_11699887 3300028380 Bacteria 637
793 Ga0268265_11801574 3300028380 Bacteria 618
794 Ga0268264_10000644 3300028381 Bacteria 41159
795 Ga0268264_10001156 3300028381 Bacteria 25715
796 Ga0268264_10016134 3300028381 Bacteria 6119
797 Ga0268264_10047635 3300028381 Bacteria 3563
798 Ga0307515_10319954 3300028794 Bacteria 1219
799 Ga0316177_1065777 3300030731 Bacteria 2419
800 Ga0307513_10227254 3300031456 Bacteria 1681
801 Ga0307408_100004585 3300031548 Bacteria 9352
802 Ga0307408_100014186 3300031548 Bacteria 5295
803 Ga0307408_100030091 3300031548 Bacteria 3768
804 Ga0307408_100118320 3300031548 Bacteria 2048
805 Ga0307408_100119242 3300031548 Bacteria 2041
806 Ga0307408_100358520 3300031548 Bacteria 1239
807 Ga0307408_100657627 3300031548 Bacteria 938
808 Ga0307408_102181656 3300031548 Bacteria 535
809 Ga0307405_10058144 3300031731 Bacteria 2432
810 Ga0307405_10108424 3300031731 Bacteria 1876
811 Ga0307405_10115165 3300031731 Bacteria 1828
812 Ga0307405_10238163 3300031731 Bacteria 1346
813 Ga0307405_10274185 3300031731 Bacteria 1266
814 Ga0307405_10439343 3300031731 Bacteria 1031
815 Ga0307405_10469056 3300031731 Bacteria 1002
816 Ga0307405_10480648 3300031731 Bacteria 991
817 Ga0307405_10871980 3300031731 Bacteria 759
818 Ga0307405_10939464 3300031731 Bacteria 734
819 Ga0307405_11224286 3300031731 Bacteria 650
820 Ga0307413_10003721 3300031824 Bacteria 6488
821 Ga0307413_10063312 3300031824 Bacteria 2292
822 Ga0307413_10116342 3300031824 Bacteria 1801
823 Ga0307413_10142213 3300031824 Bacteria 1659
824 Ga0307413_10148645 3300031824 Bacteria 1629
825 Ga0307413_10199636 3300031824 Bacteria 1443
826 Ga0307413_10849090 3300031824 Bacteria 771
827 Ga0307413_11945875 3300031824 Bacteria 529
828 Ga0307413_12158101 3300031824 Bacteria 504
829 Ga0307410_10000196 3300031852 Bacteria 22538
830 Ga0307410_10000537 3300031852 Bacteria 15549
831 Ga0307410_10012782 3300031852 Bacteria 4870
832 Ga0307410_10014803 3300031852 Bacteria 4605
833 Ga0307410_10015712 3300031852 Bacteria 4498
834 Ga0307410_10024837 3300031852 Bacteria 3749
835 Ga0307410_10070856 3300031852 Bacteria 2416
836 Ga0307410_10083310 3300031852 Bacteria 2252
837 Ga0307410_10110842 3300031852 Bacteria 1985
838 Ga0307410_10110863 3300031852 Bacteria 1985
839 Ga0307410_10166900 3300031852 Bacteria 1655
840 Ga0307410_10187252 3300031852 Bacteria 1571
841 Ga0307410_10257082 3300031852 Bacteria 1360
842 Ga0307410_10461108 3300031852 Bacteria 1038
843 Ga0307410_10576251 3300031852 Bacteria 936
844 Ga0307406_10064744 3300031901 Bacteria 2374
845 Ga0307406_10065150 3300031901 Bacteria 2367
846 Ga0307406_10176898 3300031901 Bacteria 1550
847 Ga0307406_10826815 3300031901 Bacteria 783
848 Ga0307406_10912542 3300031901 Bacteria 748
849 Ga0307407_10010121 3300031903 Bacteria 4432
850 Ga0307407_10010569 3300031903 Bacteria 4360
851 Ga0307407_10139115 3300031903 Bacteria 1564
852 Ga0307407_10139492 3300031903 Bacteria 1562
853 Ga0307407_10176345 3300031903 Bacteria 1412
854 Ga0307407_10230251 3300031903 Bacteria 1258
855 Ga0307407_10298515 3300031903 Bacteria 1122
856 Ga0307407_10399988 3300031903 Bacteria 985
857 Ga0307407_10528681 3300031903 Bacteria 868
858 Ga0307407_11226815 3300031903 Bacteria 586
859 Ga0307412_10004852 3300031911 Bacteria 7506
860 Ga0307412_10085069 3300031911 Bacteria 2197
861 Ga0307412_10247043 3300031911 Bacteria 1383
862 Ga0307412_10371800 3300031911 Bacteria 1154
863 Ga0307412_10405312 3300031911 Bacteria 1111
864 Ga0307412_10751487 3300031911 Bacteria 842
865 Ga0307412_10828221 3300031911 Bacteria 805
866 Ga0307409_100004899 3300031995 Bacteria 7614
867 Ga0307409_100018555 3300031995 Bacteria 4681
868 Ga0307409_100052852 3300031995 Bacteria 3117
869 Ga0307409_100100155 3300031995 Bacteria 2401
870 Ga0307409_100110128 3300031995 Bacteria 2307
871 Ga0307409_100127426 3300031995 Bacteria 2168
872 Ga0307409_100127836 3300031995 Bacteria 2165
873 Ga0307409_100132739 3300031995 Bacteria 2131
874 Ga0307409_100169612 3300031995 Bacteria 1919
875 Ga0307409_100280581 3300031995 Bacteria 1539
876 Ga0307409_100446209 3300031995 Bacteria 1247
877 Ga0307409_100838664 3300031995 Bacteria 929
878 Ga0307409_100925788 3300031995 Bacteria 886
879 Ga0307409_100969351 3300031995 Bacteria 867
880 Ga0307409_101404508 3300031995 Bacteria 724
881 Ga0307416_100012684 3300032002 Bacteria 5690
882 Ga0307416_100083287 3300032002 Bacteria 2713
883 Ga0307416_100618806 3300032002 Bacteria 1164
884 Ga0307416_101005372 3300032002 Bacteria 937
885 Ga0307416_101318167 3300032002 Bacteria 828
886 Ga0307416_101493176 3300032002 Bacteria 781
887 Ga0307416_102231677 3300032002 Bacteria 648
888 Ga0307414_10017124 3300032004 Bacteria 4427
889 Ga0307414_10043049 3300032004 Bacteria 3073
890 Ga0307414_10073038 3300032004 Bacteria 2480
891 Ga0307414_10076664 3300032004 Bacteria 2430
892 Ga0307414_10090857 3300032004 Bacteria 2267
893 Ga0307414_10100103 3300032004 Bacteria 2179
894 Ga0307414_10295608 3300032004 Bacteria 1367
895 Ga0307414_10362565 3300032004 Bacteria 1247
896 Ga0307414_10428118 3300032004 Bacteria 1155
897 Ga0307414_10758533 3300032004 Bacteria 882
898 Ga0307414_11112839 3300032004 Bacteria 729
899 Ga0307414_11825505 3300032004 Bacteria 567
900 Ga0307411_10000314 3300032005 Bacteria 16195
901 Ga0307411_10000577 3300032005 Bacteria 13099
902 Ga0307411_10001878 3300032005 Bacteria 8950
903 Ga0307411_10005111 3300032005 Bacteria 6403
904 Ga0307411_10005963 3300032005 Bacteria 6054
905 Ga0307411_10012502 3300032005 Bacteria 4635
906 Ga0307411_10023318 3300032005 Bacteria 3663
907 Ga0307411_10042622 3300032005 Bacteria 2897
908 Ga0307411_10080630 3300032005 Bacteria 2238
909 Ga0307411_10165027 3300032005 Bacteria 1664
910 Ga0307411_10201065 3300032005 Bacteria 1530
911 Ga0307411_10220654 3300032005 Bacteria 1470
912 Ga0307411_10222583 3300032005 Bacteria 1465
913 Ga0307411_10261159 3300032005 Bacteria 1367
914 Ga0307411_10751016 3300032005 Bacteria 854
915 Ga0307411_10980524 3300032005 Bacteria 756
916 Ga0307411_11049104 3300032005 Bacteria 732
917 Ga0307415_100005774 3300032126 Bacteria 6604
918 Ga0307415_100009570 3300032126 Bacteria 5442
919 Ga0307415_100011457 3300032126 Bacteria 5076
920 Ga0307415_100093324 3300032126 Bacteria 2185
921 Ga0307415_100141637 3300032126 Bacteria 1837
922 Ga0307415_100277330 3300032126 Bacteria 1377
923 Ga0307415_100617434 3300032126 Bacteria 967
924 Ga0307415_101840457 3300032126 Bacteria 586
925 Ga0373930_0082584 3300034816 Bacteria 745
926 Ga0373948_0085822 3300034817 Bacteria 724
927 Ga0373926_0055354 3300035083 Bacteria 1438
928 Ga0373940_0120575 3300035088 Bacteria 813
929 Ga0373949_0069765 3300035090 Bacteria 919
930 Ga0373941_0317080 3300035115 Bacteria 626
931 Ga0373943_0144477 3300035170 Bacteria 1284
932 Ga0373946_0025294 3300035171 Bacteria 2334
933 Ga0373961_0292165 3300035241 Bacteria 601
934 Ga0373962_0130888 3300035242 Bacteria 808
935 Ga0373931_0112306 3300035691 Bacteria 1548
936 Ga0373925_0004938 3300037068 Bacteria 10027
937 Ga0395899_0003120 3300037312 Bacteria 13202
938 Ga0395899_0025846 3300037312 Bacteria 4432
939 Ga0395899_0037734 3300037312 Bacteria 3621
940 Ga0395899_0048805 3300037312 Bacteria 3148
941 Ga0395899_0061005 3300037312 Bacteria 2777
942 Ga0395899_0076159 3300037312 Bacteria 2449
943 Ga0395899_0084612 3300037312 Bacteria 2305
944 Ga0395899_0147401 3300037312 Bacteria 1670
945 Ga0395899_0227407 3300037312 Bacteria 1289
946 Ga0395899_0414054 3300037312 Bacteria 889
947 Ga0395899_0435420 3300037312 Bacteria 861
948 Ga0395899_0496770 3300037312 Bacteria 792
949 Ga0395900_0035574 3300037418 Bacteria 5130
950 Ga0395900_0065774 3300037418 Bacteria 3724
951 Ga0395900_0079426 3300037418 Bacteria 3371
952 Ga0395900_0110341 3300037418 Bacteria 2826
953 Ga0395900_0117132 3300037418 Bacteria 2733
954 Ga0395900_0130243 3300037418 Bacteria 2578
955 Ga0395900_0170148 3300037418 Bacteria 2218
956 Ga0395900_0173404 3300037418 Bacteria 2194
957 Ga0395900_0188358 3300037418 Bacteria 2093
958 Ga0395900_0226160 3300037418 Bacteria 1884
959 Ga0395900_0336364 3300037418 Bacteria 1486
960 Ga0395900_0424664 3300037418 Bacteria 1289
961 Ga0395900_1322166 3300037418 Bacteria 634
962 Ga0395900_1524306 3300037418 Bacteria 580
963 Ga0395898_0048366 3300037466 Bacteria 4171
964 Ga0395898_0064526 3300037466 Bacteria 3552
965 Ga0395898_0085484 3300037466 Bacteria 3040
966 Ga0395898_0087215 3300037466 Bacteria 3007
967 Ga0395898_0100792 3300037466 Bacteria 2773
968 Ga0395898_0101770 3300037466 Bacteria 2758
969 Ga0395898_0197113 3300037466 Bacteria 1923
970 Ga0395898_0229856 3300037466 Bacteria 1769
971 Ga0395898_0686579 3300037466 Bacteria 966
972 Ga0395898_0755620 3300037466 Bacteria 913
973 Ga0395905_0000886 3300037471 Bacteria 39025
974 Ga0395905_0000958 3300037471 Bacteria 37063
975 Ga0395905_0008116 3300037471 Bacteria 10374
976 Ga0395905_0010495 3300037471 Bacteria 9008
977 Ga0395905_0029756 3300037471 Bacteria 5147
978 Ga0395905_0031344 3300037471 Bacteria 5005
979 Ga0395905_0032826 3300037471 Bacteria 4880
980 Ga0395905_0061148 3300037471 Bacteria 3522
981 Ga0395905_0068333 3300037471 Bacteria 3328
982 Ga0395905_0072295 3300037471 Bacteria 3233
983 Ga0395905_0076035 3300037471 Bacteria 3146
984 Ga0395905_0154657 3300037471 Bacteria 2157
985 Ga0395905_0172184 3300037471 Bacteria 2033
986 Ga0395905_0195383 3300037471 Bacteria 1897
987 Ga0395905_0264312 3300037471 Bacteria 1606
988 Ga0395905_0277683 3300037471 Bacteria 1561
989 Ga0395905_0406121 3300037471 Bacteria 1257
990 Ga0395905_0844888 3300037471 Bacteria 818
991 Ga0395905_0906466 3300037471 Bacteria 784
992 Ga0395905_1011479 3300037471 Bacteria 734
993 Ga0395905_1638648 3300037471 Bacteria 548
994 Ga0395905_1757901 3300037471 Bacteria 525
995 Ga0395901_0006716 3300038443 Bacteria 11626
996 Ga0395901_0007822 3300038443 Bacteria 10787
997 Ga0395901_0025354 3300038443 Bacteria 6087
998 Ga0395901_0088258 3300038443 Bacteria 3243
999 Ga0395901_0552724 3300038443 Bacteria 1166
1000 Ga0395901_0589163 3300038443 Bacteria 1122
1001 Ga0395901_0720169 3300038443 Bacteria 993
1002 Ga0395901_0807451 3300038443 Bacteria 926
1003 Ga0395901_1385072 3300038443 Bacteria 662
1004 Ga0436365_0687780 3300039437 Bacteria 92990
1005 Ga0436365_1036392 3300039437 Bacteria 7696
1006 Ga0436363_0911474 3300039450 Bacteria 905
1007 Ga0436363_1424897 3300039450 Bacteria 2061
1008 Ga0436362_0451893 3300039453 Bacteria 163419
1009 Ga0439465_0078831 3300041413 Bacteria 1114
1010 Ga0439465_0128885 3300041413 Bacteria 892
1011 Ga0439465_0174005 3300041413 Bacteria 777
1012 Ga0451807_1360495 3300041486 Bacteria 722
1013 Ga0451853_0435493 3300041512 Bacteria 594
1014 Ga0439441_067785 3300042001 Bacteria 761
1015 Ga0439442_141366 3300042002 Bacteria 533
1016 Ga0439432_020678 3300042006 Bacteria 2185
1017 Ga0439432_026099 3300042006 Bacteria 1913
1018 Ga0439449_0026915 3300042007 Bacteria 2146
1019 Ga0439449_0122536 3300042007 Bacteria 965
1020 Ga0439449_0245029 3300042007 Bacteria 673
1021 Ga0439449_0266804 3300042007 Bacteria 644
1022 Ga0439452_037517 3300042010 Bacteria 1155
1023 Ga0439457_046915 3300042014 Bacteria 967
1024 Ga0450912_000503 3300042116 Bacteria 1960
1025 Ga0450914_031266 3300042118 Bacteria 642
1026 Ga0450920_017792 3300042122 Bacteria 1360
1027 Ga0450890_003850 3300042127 Bacteria 1977
1028 Ga0450890_005093 3300042127 Bacteria 1697
1029 Ga0450905_043990 3300042142 Bacteria 715
1030 Ga0450889_000018 3300042144 Bacteria 14192
1031 Ga0450906_052204 3300042145 Bacteria 723
1032 Ga0439458_0004321 3300042157 Bacteria 3268
1033 Ga0439458_0215993 3300042157 Bacteria 527
1034 Ga0439459_0143698 3300042438 Bacteria 619
1035 Ga0439464_0018202 3300042439 Bacteria 1910
1036 Ga0439464_0270121 3300042439 Bacteria 552
1037 Ga0439460_0047477 3300042461 Bacteria 1278
1038 Ga0450918_017630 3300042531 Bacteria 1243
1039 Ga0466972_0051722 3300044658 Bacteria 1981
1040 Ga0466965_0220865 3300044683 Bacteria 1010
1041 Ga0466965_0222779 3300044683 Bacteria 1006
1042 Ga0466966_0052884 3300044684 Bacteria 2578
1043 Ga0466966_0074094 3300044684 Bacteria 2128
1044 Ga0466966_0074683 3300044684 Bacteria 2118
1045 Ga0466961_0032406 3300044693 Bacteria 3358
1046 Ga0466961_0034226 3300044693 Bacteria 3262
1047 Ga0466961_0188402 3300044693 Bacteria 1279
1048 Ga0466963_0022136 3300044694 Bacteria 4022
1049 Ga0466963_0022222 3300044694 Bacteria 4015
1050 Ga0466963_0047759 3300044694 Bacteria 2826
1051 Ga0466963_0054130 3300044694 Bacteria 2666
1052 Ga0466963_0130499 3300044694 Bacteria 1736
1053 Ga0466963_0185564 3300044694 Bacteria 1453
1054 Ga0466963_0390317 3300044694 Bacteria 981
1055 Ga0466963_0597278 3300044694 Bacteria 779
1056 Ga0466964_0041256 3300044706 Bacteria 1866
1057 Ga0466964_0051973 3300044706 Bacteria 1683
1058 Ga0466964_0124981 3300044706 Bacteria 1164
1059 Ga0466971_0005504 3300044719 Bacteria 5500
1060 Ga0466971_0057856 3300044719 Bacteria 1749
1061 Ga0466968_0009699 3300044735 Bacteria 3710
1062 Ga0466968_0082069 3300044735 Bacteria 1418
1063 Ga0466970_0164455 3300044765 Bacteria 1228
1064 Ga0466970_0528775 3300044765 Bacteria 680
1065 Ga0466957_0005960 3300044842 Bacteria 6872
1066 Ga0466957_0029193 3300044842 Bacteria 3287
1067 Ga0466957_0034421 3300044842 Bacteria 3039
1068 Ga0466957_0283502 3300044842 Bacteria 1109
1069 Ga0466957_0388364 3300044842 Bacteria 953
1070 Ga0466957_1383768 3300044842 Bacteria 512
1071 Ga0466960_0641412 3300044901 Bacteria 633
1072 Ga0466959_0003226 3300045049 Bacteria 10610
1073 Ga0466959_0061525 3300045049 Bacteria 2729
1074 Ga0466959_0205389 3300045049 Bacteria 1370
1075 Ga0466958_0005124 3300045836 Bacteria 7005
1076 Ga0466958_0102917 3300045836 Bacteria 1777
1077 Ga0466958_0107193 3300045836 Bacteria 1742
1078 Ga0466958_0619654 3300045836 Bacteria 704
1079 Ga0466967_0012914 3300045976 Bacteria 6422
1080 Ga0466967_0015359 3300045976 Bacteria 5998
1081 Ga0466967_0031961 3300045976 Bacteria 4439
1082 Ga0466967_0038506 3300045976 Bacteria 4101
1083 Ga0466967_0045161 3300045976 Bacteria 3826
1084 Ga0466967_0046655 3300045976 Bacteria 3773
1085 Ga0466967_0208416 3300045976 Bacteria 1853
1086 Ga0466967_0215768 3300045976 Bacteria 1821
1087 Ga0466967_0218290 3300045976 Bacteria 1811
1088 Ga0466967_0522331 3300045976 Bacteria 1167
1089 Ga0466967_0909258 3300045976 Bacteria 875
1090 Ga0466967_1404111 3300045976 Bacteria 695
1091 Ga0466967_1526632 3300045976 Bacteria 665
1092 Ga0495629_0876299 3300046459 Bacteria 589
1093 Ga0495585_0146786 3300046492 Bacteria 1232
1094 Ga0495620_0148859 3300046515 Bacteria 913
1095 Ga0495631_0112089 3300046518 Bacteria 1173
1096 Ga0495643_0210690 3300046522 Bacteria 928
1097 Ga0495663_0027296 3300046525 Bacteria 1675
1098 Ga0495663_0047505 3300046525 Bacteria 1322
1099 Ga0495642_0011152 3300046528 Bacteria 3447
1100 Ga0495598_0020092 3300046537 Bacteria 1759
1101 Ga0495621_0000081 3300046539 Bacteria 19404
1102 Ga0495597_0352313 3300046542 Bacteria 565
1103 Ga0495633_0003855 3300046558 Bacteria 9803
1104 Ga0495668_0010487 3300046616 Bacteria 5605
1105 Ga0495668_0321680 3300046616 Bacteria 848
1106 Ga0495625_0116565 3300046660 Bacteria 1822
1107 Ga0495659_0083164 3300046664 Bacteria 1218
1108 Ga0495661_0017672 3300046665 Bacteria 4706
1109 Ga0495669_0003400 3300046684 Bacteria 6545
1110 Ga0495669_0004827 3300046684 Bacteria 5594
1111 Ga0495669_0005572 3300046684 Bacteria 5254
1112 Ga0495669_0006251 3300046684 Bacteria 4972
1113 Ga0495669_0015497 3300046684 Bacteria 3265
1114 Ga0495669_0054586 3300046684 Bacteria 1799
1115 Ga0495669_0144873 3300046684 Bacteria 1122
1116 Ga0495669_0159863 3300046684 Bacteria 1069
1117 Ga0495669_0416503 3300046684 Bacteria 651
1118 Ga0495670_0400278 3300046691 Bacteria 742
1119 Ga0495683_0238526 3300047323 Bacteria 803
1120 Ga0495677_0004198 3300047445 Bacteria 5556
1121 Ga0495677_0165241 3300047445 Bacteria 855
1122 Ga0495677_0330876 3300047445 Bacteria 600
1123 Ga0495685_280814 3300047447 Bacteria 525
1124 Ga0495615_0034472 3300048090 Bacteria 1232
1125 Ga0496100_0159940 3300048903 Bacteria 1614
1126 Ga0496100_0727384 3300048903 Bacteria 775
1127 Ga0496100_0734295 3300048903 Bacteria 772
1128 Ga0496101_0006012 3300048904 Bacteria 7783
1129 Ga0496101_0124306 3300048904 Bacteria 1954
1130 Ga0496101_0194402 3300048904 Bacteria 1567
1131 Ga0496102_0082149 3300048905 Bacteria 2972
1132 Ga0496102_0650254 3300048905 Bacteria 977
1133 Ga0496102_1880529 3300048905 Bacteria 515
1134 Ga0496103_0332485 3300048906 Bacteria 977
1135 Ga0496103_0759577 3300048906 Bacteria 613
1136 Ga0496103_0867432 3300048906 Bacteria 567
1137 Ga0496106_0275505 3300048909 Bacteria 1347
1138 Ga0496106_0629773 3300048909 Bacteria 858
1139 Ga0496106_0690312 3300048909 Bacteria 814
1140 Ga0496107_0006889 3300048910 Bacteria 7828
1141 Ga0496107_0020379 3300048910 Bacteria 4683
1142 Ga0496107_0146746 3300048910 Bacteria 1745
1143 Ga0496107_0337318 3300048910 Bacteria 1122
1144 Ga0496107_0661841 3300048910 Bacteria 769
1145 Ga0496107_0675706 3300048910 Bacteria 760
1146 Ga0496107_0705802 3300048910 Bacteria 742
1147 Ga0496108_0003253 3300048911 Bacteria 13057
1148 Ga0496108_0025768 3300048911 Bacteria 4849
1149 Ga0496108_0292035 3300048911 Bacteria 1419
1150 Ga0496108_0309604 3300048911 Bacteria 1376
1151 Ga0496109_0014987 3300048912 Bacteria 6747
1152 Ga0496109_0090286 3300048912 Bacteria 2833
1153 Ga0496109_0152044 3300048912 Bacteria 2167
1154 Ga0496109_0899987 3300048912 Bacteria 823
1155 Ga0496110_0001109 3300048913 Bacteria 19003
1156 Ga0496110_0013403 3300048913 Bacteria 6776
1157 Ga0496110_0174149 3300048913 Bacteria 1953
1158 Ga0496110_0175802 3300048913 Bacteria 1943
1159 Ga0496110_0188603 3300048913 Bacteria 1872
1160 Ga0496110_0196733 3300048913 Bacteria 1831
1161 Ga0496110_0299701 3300048913 Bacteria 1464
1162 Ga0496110_1156388 3300048913 Bacteria 682
1163 Ga0496111_0014436 3300048914 Bacteria 5395
1164 Ga0496111_0030469 3300048914 Bacteria 3836
1165 Ga0496111_0160997 3300048914 Bacteria 1666
1166 Ga0496111_0583987 3300048914 Bacteria 819
1167 Ga0496111_0816280 3300048914 Bacteria 674
1168 Ga0496112_0004475 3300048915 Bacteria 11855
1169 Ga0496112_0053681 3300048915 Bacteria 3959
1170 Ga0496112_0062662 3300048915 Bacteria 3668
1171 Ga0496112_0314863 3300048915 Bacteria 1510
1172 Ga0496113_0112425 3300048916 Bacteria 2121
1173 Ga0496113_0208707 3300048916 Bacteria 1554
1174 Ga0496113_0360175 3300048916 Bacteria 1167
1175 Ga0496114_0000006 3300048917 Bacteria 472921
1176 Ga0496114_0016874 3300048917 Bacteria 5888
1177 Ga0496115_0001032 3300048918 Bacteria 20227
1178 Ga0501302_023192 3300049525 Bacteria 549
1179 Ga0501067_0018792 3300049583 Bacteria 3826
1180 Ga0501067_0141059 3300049583 Bacteria 1342
1181 Ga0501070_0072897 3300049586 Bacteria 2842
1182 Ga0501071_0096155 3300049587 Bacteria 2180
1183 Ga0501202_053479 3300049652 Bacteria 899
1184 Ga0501216_020536 3300049660 Bacteria 1155
1185 Ga0501263_006203 3300049760 Bacteria 1375
1186 Ga0501268_006244 3300049765 Bacteria 1742
1187 nmdc:mga08y16_253769_c1 3300050511 Bacteria 1817
1188 nmdc:mga0n895_300490_c1 3300050512 Bacteria 1627
1189 nmdc:mga0rr50_737514_c1 3300050513 Bacteria 841
1190 Ga0500658_0000022 3300053134 Bacteria 129341
1191 Ga0590071_074186 3300059421 Bacteria 841
1192 Ga0590075_108133 3300059424 Bacteria 725
1193 Ga0587083_0103165 3300059505 Bacteria 713
1194 Ga0587088_066021 3300059508 Bacteria 744
1195 Ga0587071_051230 3300060344 Bacteria 854
1196 Ga0466962_0025584 3300061719 Bacteria 2833
1197 Ga0466962_0042964 3300061719 Bacteria 2163
1198 Ga0466962_0162026 3300061719 Bacteria 1087

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10001397 Ga0070676_100013979 125
2 3300025901 Ga0207688_10124172 Ga0207688_101241722 125
3 3300037471 Ga0395905_0195383 Ga0395905_0195383_129_506 125
4 3300042439 Ga0439464_0018202 Ga0439464_0018202_550_951 125
5 3300042461 Ga0439460_0047477 Ga0439460_0047477_847_1248 125
6 3300001978 JGI24747J21853_1031043 JGI24747J21853_10310431 126
7 3300002244 JGI24742J22300_10051672 JGI24742J22300_100516721 126
8 3300005334 Ga0068869_100352816 Ga0068869_1003528161 126
9 3300005335 Ga0070666_10434440 Ga0070666_104344402 126
10 3300005338 Ga0068868_100174963 Ga0068868_1001749631 126
11 3300005347 Ga0070668_100000324 Ga0070668_10000032413 126
12 3300005353 Ga0070669_100021655 Ga0070669_1000216555 126
13 3300005355 Ga0070671_100573962 Ga0070671_1005739622 126
14 3300005356 Ga0070674_100026869 Ga0070674_1000268692 126
15 3300005364 Ga0070673_100064668 Ga0070673_1000646683 126
16 3300005455 Ga0070663_100569772 Ga0070663_1005697722 126
17 3300005459 Ga0068867_100001601 Ga0068867_10000160112 126
18 3300005539 Ga0068853_100489864 Ga0068853_1004898642 126
19 3300005543 Ga0070672_100070955 Ga0070672_1000709553 126
20 3300005615 Ga0070702_100257187 Ga0070702_1002571872 126
21 3300005617 Ga0068859_100308281 Ga0068859_1003082812 126
22 3300005718 Ga0068866_10340172 Ga0068866_103401721 126
23 3300005719 Ga0068861_100624367 Ga0068861_1006243672 126
24 3300005840 Ga0068870_10084054 Ga0068870_100840542 126
25 3300005843 Ga0068860_100050559 Ga0068860_1000505595 126
26 3300006237 Ga0097621_100075669 Ga0097621_1000756694 126
27 3300006881 Ga0068865_100236900 Ga0068865_1002369001 126
28 3300006931 Ga0097620_100308284 Ga0097620_1003082842 126
29 3300009148 Ga0105243_10525817 Ga0105243_105258172 126
30 3300013297 Ga0157378_10732665 Ga0157378_107326652 126
31 3300013306 Ga0163162_11934043 Ga0163162_119340432 126
32 3300025315 Ga0207697_10048304 Ga0207697_100483041 126
33 3300025899 Ga0207642_10564200 Ga0207642_105642002 126
34 3300025903 Ga0207680_10503758 Ga0207680_105037582 126
35 3300025907 Ga0207645_10002989 Ga0207645_100029897 126
36 3300025908 Ga0207643_10105869 Ga0207643_101058692 126
37 3300025923 Ga0207681_10228371 Ga0207681_102283712 126
38 3300025931 Ga0207644_10876095 Ga0207644_108760951 126
39 3300025933 Ga0207706_10318073 Ga0207706_103180732 126
40 3300025937 Ga0207669_10026312 Ga0207669_100263122 126
41 3300025940 Ga0207691_10013203 Ga0207691_100132039 126
42 3300025942 Ga0207689_10386751 Ga0207689_103867512 126
43 3300025972 Ga0207668_10000176 Ga0207668_1000017610 126
44 3300026089 Ga0207648_10002364 Ga0207648_1000236417 126
45 3300026118 Ga0207675_100235673 Ga0207675_1002356731 126
46 3300026121 Ga0207683_10032732 Ga0207683_100327323 126
47 3300028380 Ga0268265_10003839 Ga0268265_100038395 126
48 3300028381 Ga0268264_10016134 Ga0268264_100161343 126
49 3300021358 Ga0213873_10000007 Ga0213873_10000007113 127
50 3300021384 Ga0213876_10000005 Ga0213876_10000005149 127
51 3300039437 Ga0436365_0687780 Ga0436365_0687780_74388_74777 127
52 3300039453 Ga0436362_0451893 Ga0436362_0451893_111946_112335 127
53 3300005327 Ga0070658_10000070 Ga0070658_1000007028 128
54 3300013308 Ga0157375_11013368 Ga0157375_110133682 128
55 3300025909 Ga0207705_10000002 Ga0207705_10000002977 128
56 3300025919 Ga0207657_10709828 Ga0207657_107098281 128
57 3300025926 Ga0207659_10378072 Ga0207659_103780721 128
58 3300026142 Ga0207698_10438683 Ga0207698_104386832 128
59 3300005331 Ga0070670_100263051 Ga0070670_1002630512 129
60 3300005338 Ga0068868_100707368 Ga0068868_1007073682 129
61 3300005353 Ga0070669_100117874 Ga0070669_1001178743 129
62 3300005355 Ga0070671_100024734 Ga0070671_1000247346 129
63 3300005364 Ga0070673_100043357 Ga0070673_1000433572 129
64 3300005366 Ga0070659_100011503 Ga0070659_1000115034 129
65 3300005367 Ga0070667_101365322 Ga0070667_1013653221 129
66 3300005455 Ga0070663_100082846 Ga0070663_1000828462 129
67 3300005456 Ga0070678_100387226 Ga0070678_1003872262 129
68 3300005466 Ga0070685_10786816 Ga0070685_107868162 129
69 3300005539 Ga0068853_101310202 Ga0068853_1013102022 129
70 3300005539 Ga0068853_101612455 Ga0068853_1016124551 129
71 3300005543 Ga0070672_100426951 Ga0070672_1004269511 129
72 3300005617 Ga0068859_100000088 Ga0068859_10000008836 129
73 3300005618 Ga0068864_100000136 Ga0068864_10000013665 129
74 3300005841 Ga0068863_100001560 Ga0068863_10000156019 129
75 3300005842 Ga0068858_100000063 Ga0068858_10000006322 129
76 3300005843 Ga0068860_100296765 Ga0068860_1002967652 129
77 3300005844 Ga0068862_100024321 Ga0068862_1000243217 129
78 3300005844 Ga0068862_101048017 Ga0068862_1010480172 129
79 3300006931 Ga0097620_100000088 Ga0097620_10000008836 129
80 3300009011 Ga0105251_10266959 Ga0105251_102669591 129
81 3300009092 Ga0105250_10008858 Ga0105250_100088583 129
82 3300009177 Ga0105248_10000169 Ga0105248_1000016928 129
83 3300009553 Ga0105249_10548846 Ga0105249_105488461 129
84 3300013100 Ga0157373_10012015 Ga0157373_100120155 129
85 3300013297 Ga0157378_10669868 Ga0157378_106698682 129
86 3300013306 Ga0163162_12464617 Ga0163162_124646171 129
87 3300013308 Ga0157375_10385289 Ga0157375_103852892 129
88 3300014325 Ga0163163_10001969 Ga0163163_1000196910 129
89 3300014968 Ga0157379_10003175 Ga0157379_100031757 129
90 3300025711 Ga0207696_1010575 Ga0207696_10105755 129
91 3300025918 Ga0207662_10647168 Ga0207662_106471682 129
92 3300025931 Ga0207644_10049748 Ga0207644_100497482 129
93 3300025932 Ga0207690_10003898 Ga0207690_1000389811 129
94 3300025940 Ga0207691_10345437 Ga0207691_103454372 129
95 3300025941 Ga0207711_10000543 Ga0207711_1000054340 129
96 3300025942 Ga0207689_10753696 Ga0207689_107536961 129
97 3300025960 Ga0207651_10374960 Ga0207651_103749602 129
98 3300025986 Ga0207658_10004177 Ga0207658_100041775 129
99 3300025986 Ga0207658_10005694 Ga0207658_100056944 129
100 3300026023 Ga0207677_11380876 Ga0207677_113808762 129
101 3300026067 Ga0207678_10302282 Ga0207678_103022822 129
102 3300026088 Ga0207641_10000138 Ga0207641_1000013884 129
103 3300026095 Ga0207676_10000245 Ga0207676_1000024519 129
104 3300026118 Ga0207675_102267757 Ga0207675_1022677572 129
105 3300026121 Ga0207683_10237591 Ga0207683_102375911 129
106 3300026121 Ga0207683_10355416 Ga0207683_103554161 129
107 3300028379 Ga0268266_10870202 Ga0268266_108702021 129
108 3300028380 Ga0268265_10020542 Ga0268265_100205421 129
109 3300028380 Ga0268265_10062605 Ga0268265_100626052 129
110 3300028380 Ga0268265_11801574 Ga0268265_118015741 129
111 3300028381 Ga0268264_10000644 Ga0268264_1000064428 129
112 3300028794 Ga0307515_10319954 Ga0307515_103199541 129
113 3300030731 Ga0316177_1065777 Ga0316177_10657773 129
114 3300031456 Ga0307513_10227254 Ga0307513_102272541 129
115 3300031548 Ga0307408_100004585 Ga0307408_1000045859 129
116 3300031731 Ga0307405_10115165 Ga0307405_101151652 129
117 3300031824 Ga0307413_10199636 Ga0307413_101996362 129
118 3300031824 Ga0307413_12158101 Ga0307413_121581011 129
119 3300031852 Ga0307410_10024837 Ga0307410_100248373 129
120 3300031852 Ga0307410_10110863 Ga0307410_101108632 129
121 3300031901 Ga0307406_10912542 Ga0307406_109125422 129
122 3300031903 Ga0307407_10528681 Ga0307407_105286811 129
123 3300031903 Ga0307407_11226815 Ga0307407_112268152 129
124 3300031911 Ga0307412_10004852 Ga0307412_100048522 129
125 3300031995 Ga0307409_100169612 Ga0307409_1001696123 129
126 3300031995 Ga0307409_100280581 Ga0307409_1002805812 129
127 3300032002 Ga0307416_100618806 Ga0307416_1006188061 129
128 3300032004 Ga0307414_10428118 Ga0307414_104281182 129
129 3300032005 Ga0307411_10220654 Ga0307411_102206542 129
130 3300032126 Ga0307415_101840457 Ga0307415_1018404571 129
131 3300039450 Ga0436363_0911474 Ga0436363_0911474_11_406 129
132 3300042001 Ga0439441_067785 Ga0439441_067785_49_438 129
133 3300042145 Ga0450906_052204 Ga0450906_052204_220_609 129
134 3300046616 Ga0495668_0010487 Ga0495668_0010487_1954_2343 129
135 3300046660 Ga0495625_0116565 Ga0495625_0116565_183_572 129
136 3300046684 Ga0495669_0005572 Ga0495669_0005572_3948_4337 129
137 3300046684 Ga0495669_0416503 Ga0495669_0416503_198_587 129
138 3300046691 Ga0495670_0400278 Ga0495670_0400278_267_656 129
139 3300047323 Ga0495683_0238526 Ga0495683_0238526_57_446 129
140 3300048906 Ga0496103_0759577 Ga0496103_0759577_187_576 129
141 3300049525 Ga0501302_023192 Ga0501302_023192_144_533 129
142 3300049760 Ga0501263_006203 Ga0501263_006203_160_549 129
143 3300053134 Ga0500658_0000022 Ga0500658_0000022_88295_88684 129
144 3300005327 Ga0070658_10996881 Ga0070658_109968812 130
145 3300013104 Ga0157370_10796395 Ga0157370_107963952 130
146 3300025909 Ga0207705_11097719 Ga0207705_110977191 130
147 3300025921 Ga0207652_10934135 Ga0207652_109341352 130
148 3300042439 Ga0439464_0270121 Ga0439464_0270121_146_541 130
149 3300060344 Ga0587071_051230 Ga0587071_051230_204_605 130
150 3300005353 Ga0070669_100240857 Ga0070669_1002408573 131
151 3300005548 Ga0070665_100036695 Ga0070665_1000366954 131
152 3300025923 Ga0207681_10231833 Ga0207681_102318332 131
153 3300028379 Ga0268266_10022337 Ga0268266_100223375 131
154 3300028380 Ga0268265_10770016 Ga0268265_107700161 131
155 3300031731 Ga0307405_10939464 Ga0307405_109394642 131
156 3300031901 Ga0307406_10065150 Ga0307406_100651503 131
157 3300032002 Ga0307416_101005372 Ga0307416_1010053722 131
158 3300032002 Ga0307416_101318167 Ga0307416_1013181671 131
159 3300032005 Ga0307411_10165027 Ga0307411_101650273 131
160 3300032005 Ga0307411_11049104 Ga0307411_110491041 131
161 3300037312 Ga0395899_0076159 Ga0395899_0076159_33_428 131
162 3300037418 Ga0395900_0079426 Ga0395900_0079426_2394_2789 131
163 3300037471 Ga0395905_0068333 Ga0395905_0068333_728_1123 131
164 3300044683 Ga0466965_0220865 Ga0466965_0220865_294_689 131
165 3300045976 Ga0466967_0218290 Ga0466967_0218290_1058_1453 131
166 3300049765 Ga0501268_006244 Ga0501268_006244_635_1030 131
167 3300001979 JGI24740J21852_10017781 JGI24740J21852_100177813 132
168 3300001989 JGI24739J22299_10017275 JGI24739J22299_100172753 132
169 3300001990 JGI24737J22298_10064233 JGI24737J22298_100642332 132
170 3300002067 JGI24735J21928_10025081 JGI24735J21928_100250813 132
171 3300002075 JGI24738J21930_10093971 JGI24738J21930_100939711 132
172 3300002155 JGI24033J26618_1022039 JGI24033J26618_10220391 132
173 3300002239 JGI24034J26672_10030534 JGI24034J26672_100305342 132
174 3300005290 Ga0065712_10035350 Ga0065712_100353502 132
175 3300005290 Ga0065712_10100388 Ga0065712_101003881 132
176 3300005293 Ga0065715_10334062 Ga0065715_103340622 132
177 3300005327 Ga0070658_10042044 Ga0070658_100420442 132
178 3300005327 Ga0070658_10130989 Ga0070658_101309892 132
179 3300005327 Ga0070658_10545216 Ga0070658_105452162 132
180 3300005328 Ga0070676_10096363 Ga0070676_100963632 132
181 3300005328 Ga0070676_10184426 Ga0070676_101844262 132
182 3300005329 Ga0070683_101489299 Ga0070683_1014892991 132
183 3300005331 Ga0070670_100002414 Ga0070670_10000241411 132
184 3300005333 Ga0070677_10053665 Ga0070677_100536653 132
185 3300005335 Ga0070666_10032630 Ga0070666_100326302 132
186 3300005336 Ga0070680_100077373 Ga0070680_1000773733 132
187 3300005337 Ga0070682_100001991 Ga0070682_1000019915 132
188 3300005339 Ga0070660_100070573 Ga0070660_1000705734 132
189 3300005339 Ga0070660_100639664 Ga0070660_1006396641 132
190 3300005343 Ga0070687_100279669 Ga0070687_1002796691 132
191 3300005344 Ga0070661_100007620 Ga0070661_1000076206 132
192 3300005344 Ga0070661_100022414 Ga0070661_1000224142 132
193 3300005344 Ga0070661_100984546 Ga0070661_1009845461 132
194 3300005345 Ga0070692_10086083 Ga0070692_100860832 132
195 3300005347 Ga0070668_100092066 Ga0070668_1000920663 132
196 3300005347 Ga0070668_100359875 Ga0070668_1003598752 132
197 3300005353 Ga0070669_100310661 Ga0070669_1003106612 132
198 3300005353 Ga0070669_100533567 Ga0070669_1005335672 132
199 3300005354 Ga0070675_100022362 Ga0070675_1000223624 132
200 3300005354 Ga0070675_100042120 Ga0070675_1000421204 132
201 3300005354 Ga0070675_100127092 Ga0070675_1001270922 132
202 3300005355 Ga0070671_100009611 Ga0070671_1000096117 132
203 3300005356 Ga0070674_100037620 Ga0070674_1000376205 132
204 3300005364 Ga0070673_100012375 Ga0070673_1000123754 132
205 3300005364 Ga0070673_100765009 Ga0070673_1007650092 132
206 3300005366 Ga0070659_100026025 Ga0070659_1000260255 132
207 3300005366 Ga0070659_100035102 Ga0070659_1000351025 132
208 3300005366 Ga0070659_100301928 Ga0070659_1003019283 132
209 3300005367 Ga0070667_100002452 Ga0070667_1000024525 132
210 3300005455 Ga0070663_100033054 Ga0070663_1000330541 132
211 3300005455 Ga0070663_100077100 Ga0070663_1000771002 132
212 3300005456 Ga0070678_100075465 Ga0070678_1000754653 132
213 3300005457 Ga0070662_100008030 Ga0070662_1000080305 132
214 3300005457 Ga0070662_100015942 Ga0070662_1000159423 132
215 3300005457 Ga0070662_100101866 Ga0070662_1001018663 132
216 3300005457 Ga0070662_100143496 Ga0070662_1001434962 132
217 3300005459 Ga0068867_100462907 Ga0068867_1004629071 132
218 3300005535 Ga0070684_100325272 Ga0070684_1003252723 132
219 3300005539 Ga0068853_100132295 Ga0068853_1001322953 132
220 3300005543 Ga0070672_100002633 Ga0070672_10000263310 132
221 3300005548 Ga0070665_100074781 Ga0070665_1000747815 132
222 3300005563 Ga0068855_100198405 Ga0068855_1001984052 132
223 3300005564 Ga0070664_100009841 Ga0070664_1000098418 132
224 3300005564 Ga0070664_100079559 Ga0070664_1000795592 132
225 3300005564 Ga0070664_100193308 Ga0070664_1001933082 132
226 3300005577 Ga0068857_100147994 Ga0068857_1001479942 132
227 3300005577 Ga0068857_100177063 Ga0068857_1001770632 132
228 3300005578 Ga0068854_100018213 Ga0068854_1000182135 132
229 3300005578 Ga0068854_100736807 Ga0068854_1007368071 132
230 3300005614 Ga0068856_100244916 Ga0068856_1002449163 132
231 3300005616 Ga0068852_100138067 Ga0068852_1001380673 132
232 3300005616 Ga0068852_101571818 Ga0068852_1015718182 132
233 3300005618 Ga0068864_100017849 Ga0068864_1000178495 132
234 3300005618 Ga0068864_100115032 Ga0068864_1001150322 132
235 3300005618 Ga0068864_100611221 Ga0068864_1006112212 132
236 3300005841 Ga0068863_100457735 Ga0068863_1004577352 132
237 3300005841 Ga0068863_101115893 Ga0068863_1011158932 132
238 3300005844 Ga0068862_100087072 Ga0068862_1000870722 132
239 3300006881 Ga0068865_100479868 Ga0068865_1004798681 132
240 3300009148 Ga0105243_10049422 Ga0105243_100494224 132
241 3300009177 Ga0105248_10020997 Ga0105248_100209975 132
242 3300013100 Ga0157373_10020523 Ga0157373_100205235 132
243 3300013100 Ga0157373_10324888 Ga0157373_103248882 132
244 3300013102 Ga0157371_10095739 Ga0157371_100957393 132
245 3300013102 Ga0157371_10136517 Ga0157371_101365172 132
246 3300013102 Ga0157371_10300916 Ga0157371_103009161 132
247 3300013102 Ga0157371_10546246 Ga0157371_105462462 132
248 3300013104 Ga0157370_11555284 Ga0157370_115552841 132
249 3300013307 Ga0157372_10076912 Ga0157372_100769122 132
250 3300013308 Ga0157375_10087808 Ga0157375_100878083 132
251 3300014325 Ga0163163_10260688 Ga0163163_102606882 132
252 3300017792 Ga0163161_10221905 Ga0163161_102219052 132
253 3300017792 Ga0163161_10223498 Ga0163161_102234981 132
254 3300025893 Ga0207682_10093923 Ga0207682_100939232 132
255 3300025901 Ga0207688_10097261 Ga0207688_100972612 132
256 3300025903 Ga0207680_10024768 Ga0207680_100247683 132
257 3300025903 Ga0207680_10280307 Ga0207680_102803072 132
258 3300025907 Ga0207645_10199735 Ga0207645_101997352 132
259 3300025909 Ga0207705_10023169 Ga0207705_100231695 132
260 3300025909 Ga0207705_10025804 Ga0207705_100258042 132
261 3300025912 Ga0207707_10004641 Ga0207707_100046415 132
262 3300025912 Ga0207707_11570504 Ga0207707_115705041 132
263 3300025917 Ga0207660_10014425 Ga0207660_100144254 132
264 3300025919 Ga0207657_10008965 Ga0207657_100089652 132
265 3300025919 Ga0207657_10141804 Ga0207657_101418042 132
266 3300025919 Ga0207657_10153885 Ga0207657_101538853 132
267 3300025920 Ga0207649_10004210 Ga0207649_100042107 132
268 3300025920 Ga0207649_10016582 Ga0207649_100165825 132
269 3300025920 Ga0207649_10077582 Ga0207649_100775823 132
270 3300025920 Ga0207649_10892857 Ga0207649_108928571 132
271 3300025921 Ga0207652_10006156 Ga0207652_100061563 132
272 3300025923 Ga0207681_10025242 Ga0207681_100252425 132
273 3300025923 Ga0207681_10080381 Ga0207681_100803811 132
274 3300025923 Ga0207681_10667647 Ga0207681_106676472 132
275 3300025925 Ga0207650_10001178 Ga0207650_1000117815 132
276 3300025925 Ga0207650_10797520 Ga0207650_107975202 132
277 3300025926 Ga0207659_10040511 Ga0207659_100405114 132
278 3300025926 Ga0207659_10196940 Ga0207659_101969402 132
279 3300025926 Ga0207659_11289454 Ga0207659_112894541 132
280 3300025931 Ga0207644_10011767 Ga0207644_100117674 132
281 3300025932 Ga0207690_10005693 Ga0207690_100056933 132
282 3300025932 Ga0207690_10013151 Ga0207690_100131513 132
283 3300025932 Ga0207690_10046289 Ga0207690_100462892 132
284 3300025932 Ga0207690_10126093 Ga0207690_101260932 132
285 3300025932 Ga0207690_10659682 Ga0207690_106596822 132
286 3300025933 Ga0207706_10001396 Ga0207706_1000139612 132
287 3300025933 Ga0207706_10012892 Ga0207706_100128926 132
288 3300025933 Ga0207706_10013013 Ga0207706_100130135 132
289 3300025933 Ga0207706_10176159 Ga0207706_101761593 132
290 3300025937 Ga0207669_10006996 Ga0207669_100069965 132
291 3300025938 Ga0207704_10444042 Ga0207704_104440422 132
292 3300025940 Ga0207691_10002368 Ga0207691_100023685 132
293 3300025941 Ga0207711_10003726 Ga0207711_100037264 132
294 3300025944 Ga0207661_10121926 Ga0207661_101219264 132
295 3300025945 Ga0207679_10044121 Ga0207679_100441214 132
296 3300025945 Ga0207679_10175109 Ga0207679_101751093 132
297 3300025945 Ga0207679_10176475 Ga0207679_101764753 132
298 3300025945 Ga0207679_10325885 Ga0207679_103258852 132
299 3300025949 Ga0207667_10174767 Ga0207667_101747672 132
300 3300025960 Ga0207651_10026105 Ga0207651_100261055 132
301 3300025960 Ga0207651_10723566 Ga0207651_107235662 132
302 3300025972 Ga0207668_10557554 Ga0207668_105575542 132
303 3300025981 Ga0207640_10019760 Ga0207640_100197602 132
304 3300025981 Ga0207640_10555229 Ga0207640_105552292 132
305 3300025986 Ga0207658_10012484 Ga0207658_100124844 132
306 3300025986 Ga0207658_10723845 Ga0207658_107238452 132
307 3300026041 Ga0207639_10022710 Ga0207639_100227105 132
308 3300026041 Ga0207639_11301561 Ga0207639_113015611 132
309 3300026067 Ga0207678_10002193 Ga0207678_100021935 132
310 3300026067 Ga0207678_10167245 Ga0207678_101672452 132
311 3300026078 Ga0207702_10442130 Ga0207702_104421302 132
312 3300026088 Ga0207641_10110460 Ga0207641_101104603 132
313 3300026088 Ga0207641_10329795 Ga0207641_103297952 132
314 3300026089 Ga0207648_10144505 Ga0207648_101445052 132
315 3300026095 Ga0207676_10112014 Ga0207676_101120141 132
316 3300026095 Ga0207676_10469991 Ga0207676_104699912 132
317 3300026116 Ga0207674_10004467 Ga0207674_100044675 132
318 3300026116 Ga0207674_10099350 Ga0207674_100993503 132
319 3300026121 Ga0207683_10116759 Ga0207683_101167592 132
320 3300028379 Ga0268266_10540552 Ga0268266_105405522 132
321 3300028379 Ga0268266_10677734 Ga0268266_106777342 132
322 3300028380 Ga0268265_11699887 Ga0268265_116998871 132
323 3300031548 Ga0307408_100014186 Ga0307408_1000141862 132
324 3300031548 Ga0307408_100119242 Ga0307408_1001192422 132
325 3300031548 Ga0307408_100358520 Ga0307408_1003585202 132
326 3300031731 Ga0307405_10058144 Ga0307405_100581442 132
327 3300031731 Ga0307405_10439343 Ga0307405_104393432 132
328 3300031731 Ga0307405_10469056 Ga0307405_104690562 132
329 3300031731 Ga0307405_10480648 Ga0307405_104806482 132
330 3300031731 Ga0307405_10871980 Ga0307405_108719802 132
331 3300031731 Ga0307405_11224286 Ga0307405_112242861 132
332 3300031824 Ga0307413_10003721 Ga0307413_100037215 132
333 3300031824 Ga0307413_10063312 Ga0307413_100633124 132
334 3300031824 Ga0307413_10116342 Ga0307413_101163422 132
335 3300031824 Ga0307413_10142213 Ga0307413_101422132 132
336 3300031852 Ga0307410_10000196 Ga0307410_100001968 132
337 3300031852 Ga0307410_10000537 Ga0307410_100005378 132
338 3300031852 Ga0307410_10012782 Ga0307410_100127825 132
339 3300031852 Ga0307410_10110842 Ga0307410_101108422 132
340 3300031852 Ga0307410_10166900 Ga0307410_101669002 132
341 3300031852 Ga0307410_10461108 Ga0307410_104611082 132
342 3300031901 Ga0307406_10176898 Ga0307406_101768982 132
343 3300031901 Ga0307406_10826815 Ga0307406_108268152 132
344 3300031903 Ga0307407_10010121 Ga0307407_100101215 132
345 3300031903 Ga0307407_10010569 Ga0307407_100105692 132
346 3300031903 Ga0307407_10176345 Ga0307407_101763452 132
347 3300031903 Ga0307407_10399988 Ga0307407_103999881 132
348 3300031911 Ga0307412_10247043 Ga0307412_102470433 132
349 3300031911 Ga0307412_10828221 Ga0307412_108282212 132
350 3300031995 Ga0307409_100004899 Ga0307409_1000048994 132
351 3300031995 Ga0307409_100052852 Ga0307409_1000528522 132
352 3300031995 Ga0307409_100110128 Ga0307409_1001101282 132
353 3300031995 Ga0307409_100127426 Ga0307409_1001274264 132
354 3300031995 Ga0307409_100127836 Ga0307409_1001278362 132
355 3300031995 Ga0307409_100446209 Ga0307409_1004462092 132
356 3300031995 Ga0307409_101404508 Ga0307409_1014045082 132
357 3300032002 Ga0307416_100012684 Ga0307416_1000126842 132
358 3300032002 Ga0307416_100083287 Ga0307416_1000832871 132
359 3300032002 Ga0307416_101493176 Ga0307416_1014931762 132
360 3300032004 Ga0307414_10017124 Ga0307414_100171245 132
361 3300032004 Ga0307414_10073038 Ga0307414_100730384 132
362 3300032004 Ga0307414_10076664 Ga0307414_100766642 132
363 3300032004 Ga0307414_10090857 Ga0307414_100908572 132
364 3300032004 Ga0307414_10100103 Ga0307414_101001031 132
365 3300032004 Ga0307414_10295608 Ga0307414_102956082 132
366 3300032004 Ga0307414_11112839 Ga0307414_111128392 132
367 3300032005 Ga0307411_10000314 Ga0307411_100003145 132
368 3300032005 Ga0307411_10000577 Ga0307411_100005775 132
369 3300032005 Ga0307411_10005963 Ga0307411_100059633 132
370 3300032005 Ga0307411_10012502 Ga0307411_100125022 132
371 3300032005 Ga0307411_10042622 Ga0307411_100426223 132
372 3300032005 Ga0307411_10261159 Ga0307411_102611591 132
373 3300032005 Ga0307411_10980524 Ga0307411_109805242 132
374 3300032126 Ga0307415_100005774 Ga0307415_1000057741 132
375 3300032126 Ga0307415_100011457 Ga0307415_1000114574 132
376 3300032126 Ga0307415_100093324 Ga0307415_1000933242 132
377 3300032126 Ga0307415_100141637 Ga0307415_1001416372 132
378 3300032126 Ga0307415_100617434 Ga0307415_1006174342 132
379 3300034816 Ga0373930_0082584 Ga0373930_0082584_251_649 132
380 3300037418 Ga0395900_0035574 Ga0395900_0035574_3291_3689 132
381 3300037418 Ga0395900_1524306 Ga0395900_1524306_19_420 132
382 3300037466 Ga0395898_0064526 Ga0395898_0064526_304_702 132
383 3300037471 Ga0395905_0000886 Ga0395905_0000886_20338_20736 132
384 3300037471 Ga0395905_0172184 Ga0395905_0172184_1317_1718 132
385 3300037471 Ga0395905_0264312 Ga0395905_0264312_327_725 132
386 3300038443 Ga0395901_0025354 Ga0395901_0025354_5426_5827 132
387 3300041413 Ga0439465_0128885 Ga0439465_0128885_250_648 132
388 3300041413 Ga0439465_0174005 Ga0439465_0174005_21_419 132
389 3300041486 Ga0451807_1360495 Ga0451807_1360495_92_490 132
390 3300042002 Ga0439442_141366 Ga0439442_141366_66_464 132
391 3300042006 Ga0439432_020678 Ga0439432_020678_1456_1854 132
392 3300042006 Ga0439432_026099 Ga0439432_026099_1350_1748 132
393 3300042007 Ga0439449_0026915 Ga0439449_0026915_25_423 132
394 3300042007 Ga0439449_0122536 Ga0439449_0122536_65_463 132
395 3300042007 Ga0439449_0266804 Ga0439449_0266804_13_411 132
396 3300042116 Ga0450912_000503 Ga0450912_000503_273_671 132
397 3300042118 Ga0450914_031266 Ga0450914_031266_35_433 132
398 3300042127 Ga0450890_005093 Ga0450890_005093_193_591 132
399 3300042142 Ga0450905_043990 Ga0450905_043990_116_514 132
400 3300042438 Ga0439459_0143698 Ga0439459_0143698_77_475 132
401 3300044706 Ga0466964_0041256 Ga0466964_0041256_131_529 132
402 3300044842 Ga0466957_0034421 Ga0466957_0034421_697_1095 132
403 3300044842 Ga0466957_0388364 Ga0466957_0388364_94_495 132
404 3300045976 Ga0466967_0038506 Ga0466967_0038506_2146_2544 132
405 3300046492 Ga0495585_0146786 Ga0495585_0146786_16_414 132
406 3300046515 Ga0495620_0148859 Ga0495620_0148859_431_829 132
407 3300046518 Ga0495631_0112089 Ga0495631_0112089_557_955 132
408 3300046537 Ga0495598_0020092 Ga0495598_0020092_531_929 132
409 3300046539 Ga0495621_0000081 Ga0495621_0000081_6201_6599 132
410 3300046542 Ga0495597_0352313 Ga0495597_0352313_11_409 132
411 3300046558 Ga0495633_0003855 Ga0495633_0003855_4260_4658 132
412 3300046665 Ga0495661_0017672 Ga0495661_0017672_891_1289 132
413 3300046684 Ga0495669_0003400 Ga0495669_0003400_4323_4721 132
414 3300046684 Ga0495669_0006251 Ga0495669_0006251_1602_2000 132
415 3300046684 Ga0495669_0159863 Ga0495669_0159863_333_731 132
416 3300047445 Ga0495677_0004198 Ga0495677_0004198_790_1188 132
417 3300047447 Ga0495685_280814 Ga0495685_280814_53_451 132
418 3300048090 Ga0495615_0034472 Ga0495615_0034472_559_957 132
419 3300048905 Ga0496102_0650254 Ga0496102_0650254_396_794 132
420 3300048906 Ga0496103_0332485 Ga0496103_0332485_359_757 132
421 3300048910 Ga0496107_0337318 Ga0496107_0337318_431_829 132
422 3300048910 Ga0496107_0675706 Ga0496107_0675706_125_523 132
423 3300048911 Ga0496108_0309604 Ga0496108_0309604_808_1206 132
424 3300048912 Ga0496109_0090286 Ga0496109_0090286_1361_1759 132
425 3300048912 Ga0496109_0152044 Ga0496109_0152044_1263_1661 132
426 3300048913 Ga0496110_0001109 Ga0496110_0001109_4219_4617 132
427 3300048913 Ga0496110_0188603 Ga0496110_0188603_796_1194 132
428 3300048913 Ga0496110_0196733 Ga0496110_0196733_1226_1624 132
429 3300048914 Ga0496111_0014436 Ga0496111_0014436_535_933 132
430 3300048914 Ga0496111_0816280 Ga0496111_0816280_58_456 132
431 3300049583 Ga0501067_0141059 Ga0501067_0141059_375_776 132
432 3300049586 Ga0501070_0072897 Ga0501070_0072897_885_1283 132
433 3300049587 Ga0501071_0096155 Ga0501071_0096155_1572_1970 132
434 3300059421 Ga0590071_074186 Ga0590071_074186_131_529 132
435 3300059424 Ga0590075_108133 Ga0590075_108133_112_510 132
436 3300061719 Ga0466962_0162026 Ga0466962_0162026_639_1037 132
437 3300001904 JGI24736J21556_1057634 JGI24736J21556_10576341 133
438 3300001979 JGI24740J21852_10014981 JGI24740J21852_100149813 133
439 3300001990 JGI24737J22298_10006423 JGI24737J22298_100064232 133
440 3300001990 JGI24737J22298_10013914 JGI24737J22298_100139144 133
441 3300001990 JGI24737J22298_10020665 JGI24737J22298_100206652 133
442 3300002067 JGI24735J21928_10005426 JGI24735J21928_100054265 133
443 3300002067 JGI24735J21928_10049235 JGI24735J21928_100492351 133
444 3300005293 Ga0065715_10280007 Ga0065715_102800072 133
445 3300005293 Ga0065715_11033409 Ga0065715_110334091 133
446 3300005327 Ga0070658_10091982 Ga0070658_100919823 133
447 3300005328 Ga0070676_10085555 Ga0070676_100855551 133
448 3300005329 Ga0070683_100059590 Ga0070683_1000595902 133
449 3300005329 Ga0070683_100395016 Ga0070683_1003950162 133
450 3300005331 Ga0070670_100113799 Ga0070670_1001137994 133
451 3300005334 Ga0068869_100479455 Ga0068869_1004794551 133
452 3300005335 Ga0070666_10028217 Ga0070666_100282171 133
453 3300005338 Ga0068868_100873759 Ga0068868_1008737592 133
454 3300005339 Ga0070660_100019076 Ga0070660_1000190762 133
455 3300005339 Ga0070660_100026492 Ga0070660_1000264926 133
456 3300005339 Ga0070660_100051038 Ga0070660_1000510383 133
457 3300005339 Ga0070660_100114786 Ga0070660_1001147862 133
458 3300005341 Ga0070691_10012295 Ga0070691_100122953 133
459 3300005344 Ga0070661_100007914 Ga0070661_1000079142 133
460 3300005344 Ga0070661_100076964 Ga0070661_1000769641 133
461 3300005344 Ga0070661_100177450 Ga0070661_1001774503 133
462 3300005347 Ga0070668_100159761 Ga0070668_1001597612 133
463 3300005347 Ga0070668_100230126 Ga0070668_1002301263 133
464 3300005353 Ga0070669_100211355 Ga0070669_1002113552 133
465 3300005354 Ga0070675_100168121 Ga0070675_1001681212 133
466 3300005355 Ga0070671_100001903 Ga0070671_1000019039 133
467 3300005364 Ga0070673_100034179 Ga0070673_1000341794 133
468 3300005366 Ga0070659_100730615 Ga0070659_1007306152 133
469 3300005438 Ga0070701_10299002 Ga0070701_102990021 133
470 3300005440 Ga0070705_100256018 Ga0070705_1002560182 133
471 3300005444 Ga0070694_100119188 Ga0070694_1001191882 133
472 3300005457 Ga0070662_100103609 Ga0070662_1001036093 133
473 3300005457 Ga0070662_100620562 Ga0070662_1006205621 133
474 3300005458 Ga0070681_10057409 Ga0070681_100574092 133
475 3300005458 Ga0070681_10120953 Ga0070681_101209533 133
476 3300005458 Ga0070681_10205044 Ga0070681_102050442 133
477 3300005530 Ga0070679_100066933 Ga0070679_1000669336 133
478 3300005530 Ga0070679_100139583 Ga0070679_1001395832 133
479 3300005536 Ga0070697_100588635 Ga0070697_1005886352 133
480 3300005539 Ga0068853_100020292 Ga0068853_1000202925 133
481 3300005539 Ga0068853_100070372 Ga0068853_1000703725 133
482 3300005539 Ga0068853_100374545 Ga0068853_1003745451 133
483 3300005539 Ga0068853_100399186 Ga0068853_1003991862 133
484 3300005543 Ga0070672_100071824 Ga0070672_1000718243 133
485 3300005543 Ga0070672_100182832 Ga0070672_1001828322 133
486 3300005545 Ga0070695_100429638 Ga0070695_1004296381 133
487 3300005546 Ga0070696_100004810 Ga0070696_1000048102 133
488 3300005546 Ga0070696_100005700 Ga0070696_1000057001 133
489 3300005547 Ga0070693_100010518 Ga0070693_1000105186 133
490 3300005547 Ga0070693_100088119 Ga0070693_1000881193 133
491 3300005549 Ga0070704_100182335 Ga0070704_1001823352 133
492 3300005563 Ga0068855_100025338 Ga0068855_1000253381 133
493 3300005563 Ga0068855_100066914 Ga0068855_1000669145 133
494 3300005563 Ga0068855_100113287 Ga0068855_1001132874 133
495 3300005563 Ga0068855_100660719 Ga0068855_1006607192 133
496 3300005563 Ga0068855_101354802 Ga0068855_1013548021 133
497 3300005564 Ga0070664_100089658 Ga0070664_1000896583 133
498 3300005564 Ga0070664_100288733 Ga0070664_1002887332 133
499 3300005577 Ga0068857_100061344 Ga0068857_1000613441 133
500 3300005577 Ga0068857_100127422 Ga0068857_1001274223 133
501 3300005578 Ga0068854_100021848 Ga0068854_1000218483 133
502 3300005578 Ga0068854_100366374 Ga0068854_1003663742 133
503 3300005614 Ga0068856_100020782 Ga0068856_1000207825 133
504 3300005614 Ga0068856_100658618 Ga0068856_1006586182 133
505 3300005616 Ga0068852_100007134 Ga0068852_1000071345 133
506 3300005616 Ga0068852_100018018 Ga0068852_1000180184 133
507 3300005617 Ga0068859_100011079 Ga0068859_10001107910 133
508 3300005618 Ga0068864_100002002 Ga0068864_1000020029 133
509 3300005618 Ga0068864_100142198 Ga0068864_1001421983 133
510 3300005718 Ga0068866_10051327 Ga0068866_100513273 133
511 3300005719 Ga0068861_101470636 Ga0068861_1014706361 133
512 3300005834 Ga0068851_10063269 Ga0068851_100632693 133
513 3300005841 Ga0068863_100392419 Ga0068863_1003924192 133
514 3300005844 Ga0068862_100002790 Ga0068862_1000027909 133
515 3300005844 Ga0068862_100059853 Ga0068862_1000598535 133
516 3300006237 Ga0097621_100158892 Ga0097621_1001588921 133
517 3300006358 Ga0068871_100030119 Ga0068871_1000301192 133
518 3300006358 Ga0068871_100983653 Ga0068871_1009836532 133
519 3300006844 Ga0075428_100205562 Ga0075428_1002055622 133
520 3300006844 Ga0075428_100281751 Ga0075428_1002817512 133
521 3300006847 Ga0075431_100605547 Ga0075431_1006055472 133
522 3300006852 Ga0075433_10052624 Ga0075433_100526241 133
523 3300006871 Ga0075434_100772121 Ga0075434_1007721212 133
524 3300006880 Ga0075429_100179883 Ga0075429_1001798833 133
525 3300006881 Ga0068865_100258838 Ga0068865_1002588382 133
526 3300006914 Ga0075436_100171737 Ga0075436_1001717372 133
527 3300006931 Ga0097620_100011079 Ga0097620_10001107910 133
528 3300007076 Ga0075435_100460778 Ga0075435_1004607781 133
529 3300009093 Ga0105240_10231152 Ga0105240_102311522 133
530 3300009093 Ga0105240_10623729 Ga0105240_106237292 133
531 3300009093 Ga0105240_11426915 Ga0105240_114269152 133
532 3300009094 Ga0111539_10037205 Ga0111539_100372057 133
533 3300009098 Ga0105245_10031755 Ga0105245_100317551 133
534 3300009174 Ga0105241_10228627 Ga0105241_102286272 133
535 3300009174 Ga0105241_10385229 Ga0105241_103852291 133
536 3300009174 Ga0105241_10477369 Ga0105241_104773691 133
537 3300009176 Ga0105242_10310599 Ga0105242_103105992 133
538 3300009176 Ga0105242_10345519 Ga0105242_103455193 133
539 3300009177 Ga0105248_10024200 Ga0105248_100242008 133
540 3300009545 Ga0105237_10099028 Ga0105237_100990283 133
541 3300009551 Ga0105238_10039950 Ga0105238_100399505 133
542 3300009551 Ga0105238_10087162 Ga0105238_100871624 133
543 3300009553 Ga0105249_10503523 Ga0105249_105035231 133
544 3300010375 Ga0105239_10109133 Ga0105239_101091334 133
545 3300010375 Ga0105239_10966741 Ga0105239_109667411 133
546 3300011119 Ga0105246_10048303 Ga0105246_100483033 133
547 3300013100 Ga0157373_10010857 Ga0157373_100108576 133
548 3300013100 Ga0157373_10076520 Ga0157373_100765202 133
549 3300013100 Ga0157373_10190063 Ga0157373_101900632 133
550 3300013102 Ga0157371_10041479 Ga0157371_100414795 133
551 3300013102 Ga0157371_10722862 Ga0157371_107228622 133
552 3300013104 Ga0157370_10071468 Ga0157370_100714682 133
553 3300013104 Ga0157370_10092018 Ga0157370_100920185 133
554 3300013104 Ga0157370_10099257 Ga0157370_100992573 133
555 3300013105 Ga0157369_10177416 Ga0157369_101774163 133
556 3300013105 Ga0157369_10283278 Ga0157369_102832782 133
557 3300013297 Ga0157378_10744794 Ga0157378_107447941 133
558 3300013306 Ga0163162_10544602 Ga0163162_105446022 133
559 3300013307 Ga0157372_10046487 Ga0157372_100464875 133
560 3300013307 Ga0157372_10229737 Ga0157372_102297372 133
561 3300014745 Ga0157377_10014277 Ga0157377_100142773 133
562 3300014968 Ga0157379_10169445 Ga0157379_101694451 133
563 3300025321 Ga0207656_10011657 Ga0207656_100116574 133
564 3300025899 Ga0207642_10213154 Ga0207642_102131542 133
565 3300025904 Ga0207647_10000304 Ga0207647_100003041 133
566 3300025904 Ga0207647_10003254 Ga0207647_1000325413 133
567 3300025907 Ga0207645_10089083 Ga0207645_100890834 133
568 3300025909 Ga0207705_10015546 Ga0207705_100155465 133
569 3300025909 Ga0207705_10034116 Ga0207705_100341163 133
570 3300025909 Ga0207705_10280714 Ga0207705_102807142 133
571 3300025911 Ga0207654_10059987 Ga0207654_100599873 133
572 3300025911 Ga0207654_10252388 Ga0207654_102523881 133
573 3300025911 Ga0207654_10409031 Ga0207654_104090312 133
574 3300025912 Ga0207707_10060221 Ga0207707_100602215 133
575 3300025912 Ga0207707_10390826 Ga0207707_103908262 133
576 3300025913 Ga0207695_10079126 Ga0207695_100791262 133
577 3300025913 Ga0207695_10543537 Ga0207695_105435371 133
578 3300025913 Ga0207695_10781966 Ga0207695_107819662 133
579 3300025914 Ga0207671_10067696 Ga0207671_100676963 133
580 3300025919 Ga0207657_10013132 Ga0207657_100131326 133
581 3300025919 Ga0207657_10022038 Ga0207657_100220385 133
582 3300025919 Ga0207657_10118001 Ga0207657_101180012 133
583 3300025919 Ga0207657_10140669 Ga0207657_101406693 133
584 3300025920 Ga0207649_10054550 Ga0207649_100545504 133
585 3300025921 Ga0207652_10051991 Ga0207652_100519914 133
586 3300025921 Ga0207652_10067087 Ga0207652_100670872 133
587 3300025924 Ga0207694_10000665 Ga0207694_1000066530 133
588 3300025926 Ga0207659_10516214 Ga0207659_105162142 133
589 3300025927 Ga0207687_10030308 Ga0207687_100303084 133
590 3300025931 Ga0207644_10127016 Ga0207644_101270162 133
591 3300025932 Ga0207690_10064115 Ga0207690_100641152 133
592 3300025932 Ga0207690_10618351 Ga0207690_106183511 133
593 3300025932 Ga0207690_10722520 Ga0207690_107225201 133
594 3300025932 Ga0207690_10941879 Ga0207690_109418791 133
595 3300025933 Ga0207706_10041370 Ga0207706_100413703 133
596 3300025933 Ga0207706_10090981 Ga0207706_100909814 133
597 3300025933 Ga0207706_10402133 Ga0207706_104021331 133
598 3300025934 Ga0207686_10165661 Ga0207686_101656612 133
599 3300025935 Ga0207709_10061929 Ga0207709_100619293 133
600 3300025940 Ga0207691_10037001 Ga0207691_100370013 133
601 3300025940 Ga0207691_10440466 Ga0207691_104404662 133
602 3300025941 Ga0207711_10067638 Ga0207711_100676382 133
603 3300025942 Ga0207689_10003262 Ga0207689_100032626 133
604 3300025945 Ga0207679_10020147 Ga0207679_100201474 133
605 3300025945 Ga0207679_10194347 Ga0207679_101943472 133
606 3300025945 Ga0207679_10373972 Ga0207679_103739722 133
607 3300025949 Ga0207667_10052229 Ga0207667_100522293 133
608 3300025949 Ga0207667_10087122 Ga0207667_100871223 133
609 3300025949 Ga0207667_10149722 Ga0207667_101497224 133
610 3300025949 Ga0207667_11209855 Ga0207667_112098552 133
611 3300025961 Ga0207712_10000195 Ga0207712_1000019520 133
612 3300025961 Ga0207712_11086017 Ga0207712_110860171 133
613 3300025972 Ga0207668_10079916 Ga0207668_100799164 133
614 3300025972 Ga0207668_10261769 Ga0207668_102617693 133
615 3300025981 Ga0207640_10008423 Ga0207640_100084236 133
616 3300025981 Ga0207640_10124489 Ga0207640_101244892 133
617 3300025986 Ga0207658_10505013 Ga0207658_105050131 133
618 3300026035 Ga0207703_10015295 Ga0207703_100152954 133
619 3300026041 Ga0207639_10000162 Ga0207639_1000016238 133
620 3300026041 Ga0207639_10021466 Ga0207639_100214662 133
621 3300026041 Ga0207639_10026235 Ga0207639_100262352 133
622 3300026041 Ga0207639_10075954 Ga0207639_100759544 133
623 3300026078 Ga0207702_10003777 Ga0207702_100037776 133
624 3300026078 Ga0207702_10097149 Ga0207702_100971494 133
625 3300026078 Ga0207702_10398845 Ga0207702_103988452 133
626 3300026088 Ga0207641_10104357 Ga0207641_101043573 133
627 3300026095 Ga0207676_10167159 Ga0207676_101671593 133
628 3300026116 Ga0207674_10025071 Ga0207674_100250715 133
629 3300026116 Ga0207674_10057996 Ga0207674_100579964 133
630 3300026116 Ga0207674_10071823 Ga0207674_100718235 133
631 3300026142 Ga0207698_10007116 Ga0207698_100071165 133
632 3300026142 Ga0207698_10056843 Ga0207698_100568434 133
633 3300028380 Ga0268265_10002345 Ga0268265_100023459 133
634 3300028380 Ga0268265_10120128 Ga0268265_101201283 133
635 3300028381 Ga0268264_10001156 Ga0268264_100011565 133
636 3300031548 Ga0307408_100030091 Ga0307408_1000300913 133
637 3300031548 Ga0307408_100118320 Ga0307408_1001183201 133
638 3300031548 Ga0307408_100657627 Ga0307408_1006576272 133
639 3300031548 Ga0307408_102181656 Ga0307408_1021816561 133
640 3300031731 Ga0307405_10108424 Ga0307405_101084243 133
641 3300031731 Ga0307405_10238163 Ga0307405_102381632 133
642 3300031731 Ga0307405_10274185 Ga0307405_102741852 133
643 3300031824 Ga0307413_10148645 Ga0307413_101486452 133
644 3300031852 Ga0307410_10014803 Ga0307410_100148034 133
645 3300031852 Ga0307410_10083310 Ga0307410_100833103 133
646 3300031852 Ga0307410_10187252 Ga0307410_101872521 133
647 3300031852 Ga0307410_10257082 Ga0307410_102570823 133
648 3300031901 Ga0307406_10064744 Ga0307406_100647444 133
649 3300031903 Ga0307407_10139115 Ga0307407_101391152 133
650 3300031903 Ga0307407_10139492 Ga0307407_101394921 133
651 3300031903 Ga0307407_10298515 Ga0307407_102985152 133
652 3300031911 Ga0307412_10085069 Ga0307412_100850693 133
653 3300031911 Ga0307412_10371800 Ga0307412_103718001 133
654 3300031911 Ga0307412_10405312 Ga0307412_104053122 133
655 3300031995 Ga0307409_100100155 Ga0307409_1001001553 133
656 3300031995 Ga0307409_100132739 Ga0307409_1001327391 133
657 3300031995 Ga0307409_100838664 Ga0307409_1008386642 133
658 3300031995 Ga0307409_100925788 Ga0307409_1009257882 133
659 3300031995 Ga0307409_100969351 Ga0307409_1009693512 133
660 3300032002 Ga0307416_102231677 Ga0307416_1022316771 133
661 3300032004 Ga0307414_10362565 Ga0307414_103625652 133
662 3300032004 Ga0307414_10758533 Ga0307414_107585332 133
663 3300032004 Ga0307414_11825505 Ga0307414_118255051 133
664 3300032005 Ga0307411_10005111 Ga0307411_100051115 133
665 3300032005 Ga0307411_10080630 Ga0307411_100806303 133
666 3300032005 Ga0307411_10201065 Ga0307411_102010652 133
667 3300032005 Ga0307411_10751016 Ga0307411_107510162 133
668 3300032126 Ga0307415_100277330 Ga0307415_1002773302 133
669 3300035115 Ga0373941_0317080 Ga0373941_0317080_152_553 133
670 3300035241 Ga0373961_0292165 Ga0373961_0292165_92_493 133
671 3300037312 Ga0395899_0025846 Ga0395899_0025846_355_756 133
672 3300037312 Ga0395899_0435420 Ga0395899_0435420_299_700 133
673 3300037418 Ga0395900_0173404 Ga0395900_0173404_667_1068 133
674 3300037418 Ga0395900_1322166 Ga0395900_1322166_170_571 133
675 3300037466 Ga0395898_0686579 Ga0395898_0686579_555_956 133
676 3300037471 Ga0395905_0406121 Ga0395905_0406121_554_955 133
677 3300037471 Ga0395905_1757901 Ga0395905_1757901_57_458 133
678 3300038443 Ga0395901_0589163 Ga0395901_0589163_16_417 133
679 3300042014 Ga0439457_046915 Ga0439457_046915_541_942 133
680 3300042122 Ga0450920_017792 Ga0450920_017792_657_1058 133
681 3300042127 Ga0450890_003850 Ga0450890_003850_1503_1907 133
682 3300042144 Ga0450889_000018 Ga0450889_000018_7982_8386 133
683 3300042157 Ga0439458_0215993 Ga0439458_0215993_61_462 133
684 3300042531 Ga0450918_017630 Ga0450918_017630_424_825 133
685 3300044658 Ga0466972_0051722 Ga0466972_0051722_924_1325 133
686 3300044684 Ga0466966_0074094 Ga0466966_0074094_1001_1402 133
687 3300044693 Ga0466961_0032406 Ga0466961_0032406_2421_2822 133
688 3300044694 Ga0466963_0022222 Ga0466963_0022222_1805_2206 133
689 3300044694 Ga0466963_0047759 Ga0466963_0047759_1465_1866 133
690 3300044694 Ga0466963_0130499 Ga0466963_0130499_596_997 133
691 3300044694 Ga0466963_0390317 Ga0466963_0390317_495_896 133
692 3300044706 Ga0466964_0124981 Ga0466964_0124981_464_865 133
693 3300044735 Ga0466968_0082069 Ga0466968_0082069_797_1198 133
694 3300044842 Ga0466957_0283502 Ga0466957_0283502_434_835 133
695 3300044842 Ga0466957_1383768 Ga0466957_1383768_50_451 133
696 3300045049 Ga0466959_0003226 Ga0466959_0003226_8688_9089 133
697 3300045836 Ga0466958_0619654 Ga0466958_0619654_278_679 133
698 3300045976 Ga0466967_0012914 Ga0466967_0012914_4541_4942 133
699 3300045976 Ga0466967_0015359 Ga0466967_0015359_2023_2424 133
700 3300045976 Ga0466967_0031961 Ga0466967_0031961_2778_3179 133
701 3300045976 Ga0466967_0045161 Ga0466967_0045161_2774_3175 133
702 3300045976 Ga0466967_0046655 Ga0466967_0046655_200_601 133
703 3300045976 Ga0466967_0909258 Ga0466967_0909258_267_668 133
704 3300045976 Ga0466967_1404111 Ga0466967_1404111_42_476 133
705 3300046459 Ga0495629_0876299 Ga0495629_0876299_165_569 133
706 3300046528 Ga0495642_0011152 Ga0495642_0011152_1980_2381 133
707 3300046616 Ga0495668_0321680 Ga0495668_0321680_94_498 133
708 3300046664 Ga0495659_0083164 Ga0495659_0083164_428_829 133
709 3300047445 Ga0495677_0330876 Ga0495677_0330876_149_550 133
710 3300048903 Ga0496100_0727384 Ga0496100_0727384_363_764 133
711 3300048904 Ga0496101_0006012 Ga0496101_0006012_1889_2290 133
712 3300048904 Ga0496101_0124306 Ga0496101_0124306_1131_1532 133
713 3300048904 Ga0496101_0194402 Ga0496101_0194402_25_426 133
714 3300048905 Ga0496102_0082149 Ga0496102_0082149_2427_2828 133
715 3300048905 Ga0496102_1880529 Ga0496102_1880529_76_477 133
716 3300048906 Ga0496103_0867432 Ga0496103_0867432_114_515 133
717 3300048909 Ga0496106_0275505 Ga0496106_0275505_268_669 133
718 3300048910 Ga0496107_0006889 Ga0496107_0006889_3732_4133 133
719 3300048911 Ga0496108_0292035 Ga0496108_0292035_757_1158 133
720 3300048912 Ga0496109_0014987 Ga0496109_0014987_4210_4611 133
721 3300048913 Ga0496110_0013403 Ga0496110_0013403_3867_4268 133
722 3300048913 Ga0496110_0174149 Ga0496110_0174149_178_579 133
723 3300048913 Ga0496110_0299701 Ga0496110_0299701_493_894 133
724 3300048914 Ga0496111_0030469 Ga0496111_0030469_1370_1771 133
725 3300048914 Ga0496111_0160997 Ga0496111_0160997_389_790 133
726 3300048915 Ga0496112_0004475 Ga0496112_0004475_7842_8243 133
727 3300048915 Ga0496112_0053681 Ga0496112_0053681_1153_1554 133
728 3300048915 Ga0496112_0314863 Ga0496112_0314863_773_1177 133
729 3300048916 Ga0496113_0112425 Ga0496113_0112425_1358_1759 133
730 3300048916 Ga0496113_0208707 Ga0496113_0208707_1019_1420 133
731 3300050511 nmdc:mga08y16_253769_c1 nmdc:mga08y16_253769_c1_499_903 133
732 3300050512 nmdc:mga0n895_300490_c1 nmdc:mga0n895_300490_c1_478_879 133
733 3300050513 nmdc:mga0rr50_737514_c1 nmdc:mga0rr50_737514_c1_219_620 133
734 3300059505 Ga0587083_0103165 Ga0587083_0103165_98_499 133
735 3300001979 JGI24740J21852_10021633 JGI24740J21852_100216333 134
736 3300001989 JGI24739J22299_10082795 JGI24739J22299_100827952 134
737 3300001990 JGI24737J22298_10033556 JGI24737J22298_100335562 134
738 3300002067 JGI24735J21928_10008880 JGI24735J21928_100088803 134
739 3300002070 JGI24750J21931_1006858 JGI24750J21931_10068582 134
740 3300005290 Ga0065712_10202517 Ga0065712_102025172 134
741 3300005293 Ga0065715_10034496 Ga0065715_100344962 134
742 3300005293 Ga0065715_10539698 Ga0065715_105396981 134
743 3300005327 Ga0070658_10028976 Ga0070658_100289762 134
744 3300005327 Ga0070658_10043618 Ga0070658_100436184 134
745 3300005327 Ga0070658_10180644 Ga0070658_101806442 134
746 3300005327 Ga0070658_10557885 Ga0070658_105578852 134
747 3300005329 Ga0070683_100397827 Ga0070683_1003978272 134
748 3300005330 Ga0070690_100019106 Ga0070690_1000191065 134
749 3300005330 Ga0070690_100142158 Ga0070690_1001421582 134
750 3300005333 Ga0070677_10387854 Ga0070677_103878541 134
751 3300005335 Ga0070666_10000693 Ga0070666_100006931 134
752 3300005336 Ga0070680_100041996 Ga0070680_1000419962 134
753 3300005336 Ga0070680_100910731 Ga0070680_1009107311 134
754 3300005337 Ga0070682_100064589 Ga0070682_1000645894 134
755 3300005338 Ga0068868_100001623 Ga0068868_1000016235 134
756 3300005338 Ga0068868_100039816 Ga0068868_1000398163 134
757 3300005338 Ga0068868_100225233 Ga0068868_1002252333 134
758 3300005338 Ga0068868_100752664 Ga0068868_1007526642 134
759 3300005339 Ga0070660_100012527 Ga0070660_1000125274 134
760 3300005339 Ga0070660_100024248 Ga0070660_1000242484 134
761 3300005339 Ga0070660_100070548 Ga0070660_1000705484 134
762 3300005339 Ga0070660_100086557 Ga0070660_1000865573 134
763 3300005339 Ga0070660_100155586 Ga0070660_1001555863 134
764 3300005339 Ga0070660_100328742 Ga0070660_1003287422 134
765 3300005344 Ga0070661_100003112 Ga0070661_10000311211 134
766 3300005344 Ga0070661_100209151 Ga0070661_1002091512 134
767 3300005345 Ga0070692_10079536 Ga0070692_100795363 134
768 3300005347 Ga0070668_100615240 Ga0070668_1006152402 134
769 3300005354 Ga0070675_100049898 Ga0070675_1000498983 134
770 3300005355 Ga0070671_100004394 Ga0070671_10000439414 134
771 3300005355 Ga0070671_100005300 Ga0070671_1000053009 134
772 3300005355 Ga0070671_100244725 Ga0070671_1002447252 134
773 3300005356 Ga0070674_100033351 Ga0070674_1000333512 134
774 3300005356 Ga0070674_100335702 Ga0070674_1003357022 134
775 3300005364 Ga0070673_100135708 Ga0070673_1001357082 134
776 3300005366 Ga0070659_100018589 Ga0070659_1000185897 134
777 3300005366 Ga0070659_100043855 Ga0070659_1000438554 134
778 3300005366 Ga0070659_100096713 Ga0070659_1000967132 134
779 3300005366 Ga0070659_100196190 Ga0070659_1001961902 134
780 3300005367 Ga0070667_100001793 Ga0070667_1000017931 134
781 3300005367 Ga0070667_100007452 Ga0070667_1000074526 134
782 3300005367 Ga0070667_100011342 Ga0070667_1000113426 134
783 3300005367 Ga0070667_100048291 Ga0070667_1000482911 134
784 3300005367 Ga0070667_100187455 Ga0070667_1001874551 134
785 3300005455 Ga0070663_100003483 Ga0070663_1000034833 134
786 3300005455 Ga0070663_100010497 Ga0070663_1000104974 134
787 3300005455 Ga0070663_100154549 Ga0070663_1001545493 134
788 3300005455 Ga0070663_100328154 Ga0070663_1003281542 134
789 3300005456 Ga0070678_101520837 Ga0070678_1015208372 134
790 3300005457 Ga0070662_100009542 Ga0070662_1000095426 134
791 3300005457 Ga0070662_100095202 Ga0070662_1000952024 134
792 3300005457 Ga0070662_100115852 Ga0070662_1001158524 134
793 3300005457 Ga0070662_100377191 Ga0070662_1003771912 134
794 3300005457 Ga0070662_100795450 Ga0070662_1007954501 134
795 3300005458 Ga0070681_10664078 Ga0070681_106640781 134
796 3300005530 Ga0070679_100109269 Ga0070679_1001092694 134
797 3300005535 Ga0070684_100261382 Ga0070684_1002613821 134
798 3300005539 Ga0068853_100024862 Ga0068853_1000248625 134
799 3300005539 Ga0068853_100099446 Ga0068853_1000994464 134
800 3300005539 Ga0068853_100174844 Ga0068853_1001748443 134
801 3300005543 Ga0070672_100060757 Ga0070672_1000607571 134
802 3300005543 Ga0070672_100259697 Ga0070672_1002596972 134
803 3300005544 Ga0070686_100177064 Ga0070686_1001770642 134
804 3300005547 Ga0070693_100072940 Ga0070693_1000729403 134
805 3300005548 Ga0070665_101823723 Ga0070665_1018237232 134
806 3300005563 Ga0068855_100469858 Ga0068855_1004698582 134
807 3300005563 Ga0068855_101078536 Ga0068855_1010785362 134
808 3300005564 Ga0070664_100014536 Ga0070664_1000145366 134
809 3300005564 Ga0070664_100078427 Ga0070664_1000784271 134
810 3300005564 Ga0070664_100139301 Ga0070664_1001393013 134
811 3300005564 Ga0070664_100307716 Ga0070664_1003077162 134
812 3300005578 Ga0068854_100008675 Ga0068854_1000086754 134
813 3300005578 Ga0068854_100044661 Ga0068854_1000446614 134
814 3300005616 Ga0068852_100001650 Ga0068852_1000016504 134
815 3300005616 Ga0068852_100173429 Ga0068852_1001734292 134
816 3300005616 Ga0068852_100492407 Ga0068852_1004924072 134
817 3300005616 Ga0068852_100608620 Ga0068852_1006086202 134
818 3300005617 Ga0068859_100016383 Ga0068859_1000163835 134
819 3300005834 Ga0068851_10002427 Ga0068851_100024272 134
820 3300005834 Ga0068851_10040820 Ga0068851_100408202 134
821 3300005841 Ga0068863_100009138 Ga0068863_1000091387 134
822 3300005841 Ga0068863_101347940 Ga0068863_1013479402 134
823 3300005842 Ga0068858_100000855 Ga0068858_10000085533 134
824 3300005842 Ga0068858_100130303 Ga0068858_1001303034 134
825 3300005843 Ga0068860_100063347 Ga0068860_1000633472 134
826 3300005843 Ga0068860_100111035 Ga0068860_1001110354 134
827 3300005844 Ga0068862_100215388 Ga0068862_1002153882 134
828 3300005844 Ga0068862_100409012 Ga0068862_1004090122 134
829 3300006358 Ga0068871_100340841 Ga0068871_1003408412 134
830 3300006358 Ga0068871_101731137 Ga0068871_1017311371 134
831 3300006931 Ga0097620_100016383 Ga0097620_1000163835 134
832 3300009098 Ga0105245_10368754 Ga0105245_103687541 134
833 3300009177 Ga0105248_10001030 Ga0105248_100010305 134
834 3300009177 Ga0105248_10023443 Ga0105248_100234436 134
835 3300009177 Ga0105248_10396947 Ga0105248_103969472 134
836 3300009551 Ga0105238_10037891 Ga0105238_100378914 134
837 3300009551 Ga0105238_10223115 Ga0105238_102231152 134
838 3300009553 Ga0105249_10338548 Ga0105249_103385483 134
839 3300013102 Ga0157371_10102510 Ga0157371_101025102 134
840 3300013104 Ga0157370_10081100 Ga0157370_100811002 134
841 3300013105 Ga0157369_10003544 Ga0157369_100035446 134
842 3300013296 Ga0157374_10073128 Ga0157374_100731283 134
843 3300013296 Ga0157374_10237893 Ga0157374_102378932 134
844 3300013306 Ga0163162_10768460 Ga0163162_107684601 134
845 3300013307 Ga0157372_10227966 Ga0157372_102279661 134
846 3300013308 Ga0157375_10039482 Ga0157375_100394824 134
847 3300013308 Ga0157375_10057944 Ga0157375_100579443 134
848 3300014968 Ga0157379_10068515 Ga0157379_100685155 134
849 3300014968 Ga0157379_10202382 Ga0157379_102023823 134
850 3300014969 Ga0157376_11103383 Ga0157376_111033831 134
851 3300017792 Ga0163161_10316991 Ga0163161_103169912 134
852 3300021377 Ga0213874_10084580 Ga0213874_100845801 134
853 3300025321 Ga0207656_10019287 Ga0207656_100192872 134
854 3300025321 Ga0207656_10053189 Ga0207656_100531893 134
855 3300025893 Ga0207682_10295621 Ga0207682_102956211 134
856 3300025899 Ga0207642_10331495 Ga0207642_103314952 134
857 3300025901 Ga0207688_10034073 Ga0207688_100340734 134
858 3300025903 Ga0207680_10001868 Ga0207680_100018686 134
859 3300025904 Ga0207647_10084437 Ga0207647_100844372 134
860 3300025907 Ga0207645_10007529 Ga0207645_100075297 134
861 3300025907 Ga0207645_10094460 Ga0207645_100944603 134
862 3300025909 Ga0207705_10002578 Ga0207705_100025783 134
863 3300025909 Ga0207705_10011516 Ga0207705_100115164 134
864 3300025909 Ga0207705_10064533 Ga0207705_100645334 134
865 3300025909 Ga0207705_10148127 Ga0207705_101481273 134
866 3300025909 Ga0207705_10149321 Ga0207705_101493212 134
867 3300025909 Ga0207705_10259559 Ga0207705_102595592 134
868 3300025912 Ga0207707_10384233 Ga0207707_103842332 134
869 3300025919 Ga0207657_10002671 Ga0207657_1000267115 134
870 3300025919 Ga0207657_10045431 Ga0207657_100454314 134
871 3300025919 Ga0207657_10110616 Ga0207657_101106162 134
872 3300025919 Ga0207657_10173402 Ga0207657_101734023 134
873 3300025919 Ga0207657_10529652 Ga0207657_105296522 134
874 3300025920 Ga0207649_10035583 Ga0207649_100355833 134
875 3300025920 Ga0207649_10052867 Ga0207649_100528673 134
876 3300025921 Ga0207652_10296569 Ga0207652_102965692 134
877 3300025921 Ga0207652_10434739 Ga0207652_104347392 134
878 3300025924 Ga0207694_10170863 Ga0207694_101708632 134
879 3300025925 Ga0207650_10139529 Ga0207650_101395293 134
880 3300025926 Ga0207659_10036608 Ga0207659_100366083 134
881 3300025931 Ga0207644_10011879 Ga0207644_100118795 134
882 3300025931 Ga0207644_10609363 Ga0207644_106093632 134
883 3300025931 Ga0207644_10666310 Ga0207644_106663102 134
884 3300025931 Ga0207644_10677209 Ga0207644_106772092 134
885 3300025932 Ga0207690_10005603 Ga0207690_100056036 134
886 3300025932 Ga0207690_10018574 Ga0207690_100185742 134
887 3300025932 Ga0207690_10124171 Ga0207690_101241713 134
888 3300025932 Ga0207690_10298648 Ga0207690_102986482 134
889 3300025932 Ga0207690_10444108 Ga0207690_104441082 134
890 3300025933 Ga0207706_10017823 Ga0207706_100178235 134
891 3300025933 Ga0207706_10024600 Ga0207706_100246004 134
892 3300025933 Ga0207706_10037929 Ga0207706_100379294 134
893 3300025933 Ga0207706_10148206 Ga0207706_101482062 134
894 3300025937 Ga0207669_10099971 Ga0207669_100999712 134
895 3300025940 Ga0207691_10291631 Ga0207691_102916312 134
896 3300025940 Ga0207691_10862082 Ga0207691_108620822 134
897 3300025941 Ga0207711_10000107 Ga0207711_1000010739 134
898 3300025941 Ga0207711_10001496 Ga0207711_1000149611 134
899 3300025941 Ga0207711_10004444 Ga0207711_1000444413 134
900 3300025945 Ga0207679_10018791 Ga0207679_100187912 134
901 3300025945 Ga0207679_10161575 Ga0207679_101615752 134
902 3300025945 Ga0207679_10416192 Ga0207679_104161921 134
903 3300025960 Ga0207651_10046067 Ga0207651_100460672 134
904 3300025961 Ga0207712_10218705 Ga0207712_102187053 134
905 3300025972 Ga0207668_10196428 Ga0207668_101964283 134
906 3300025981 Ga0207640_10011803 Ga0207640_100118033 134
907 3300025981 Ga0207640_10160375 Ga0207640_101603752 134
908 3300025981 Ga0207640_10211381 Ga0207640_102113812 134
909 3300025986 Ga0207658_10009770 Ga0207658_100097705 134
910 3300025986 Ga0207658_10053329 Ga0207658_100533293 134
911 3300025986 Ga0207658_10193044 Ga0207658_101930443 134
912 3300025986 Ga0207658_10768409 Ga0207658_107684092 134
913 3300025986 Ga0207658_10812120 Ga0207658_108121202 134
914 3300025986 Ga0207658_11291178 Ga0207658_112911782 134
915 3300026023 Ga0207677_10002392 Ga0207677_1000239210 134
916 3300026023 Ga0207677_10098925 Ga0207677_100989253 134
917 3300026023 Ga0207677_10849862 Ga0207677_108498622 134
918 3300026035 Ga0207703_10001701 Ga0207703_1000170115 134
919 3300026035 Ga0207703_10319305 Ga0207703_103193052 134
920 3300026041 Ga0207639_10266809 Ga0207639_102668092 134
921 3300026041 Ga0207639_10347822 Ga0207639_103478221 134
922 3300026067 Ga0207678_10004258 Ga0207678_100042583 134
923 3300026067 Ga0207678_10005341 Ga0207678_100053414 134
924 3300026067 Ga0207678_10050123 Ga0207678_100501235 134
925 3300026078 Ga0207702_10533287 Ga0207702_105332871 134
926 3300026088 Ga0207641_10200230 Ga0207641_102002303 134
927 3300026088 Ga0207641_10287669 Ga0207641_102876693 134
928 3300026089 Ga0207648_10252238 Ga0207648_102522383 134
929 3300026116 Ga0207674_10035223 Ga0207674_100352235 134
930 3300026116 Ga0207674_10065368 Ga0207674_100653682 134
931 3300026142 Ga0207698_10098106 Ga0207698_100981062 134
932 3300026142 Ga0207698_10282463 Ga0207698_102824632 134
933 3300026142 Ga0207698_10655100 Ga0207698_106551002 134
934 3300028379 Ga0268266_10283172 Ga0268266_102831722 134
935 3300028380 Ga0268265_10250175 Ga0268265_102501753 134
936 3300028380 Ga0268265_10305144 Ga0268265_103051442 134
937 3300028381 Ga0268264_10047635 Ga0268264_100476353 134
938 3300031824 Ga0307413_11945875 Ga0307413_119458751 134
939 3300031852 Ga0307410_10015712 Ga0307410_100157123 134
940 3300032005 Ga0307411_10001878 Ga0307411_100018785 134
941 3300032126 Ga0307415_100009570 Ga0307415_1000095705 134
942 3300035088 Ga0373940_0120575 Ga0373940_0120575_156_560 134
943 3300035090 Ga0373949_0069765 Ga0373949_0069765_402_806 134
944 3300035242 Ga0373962_0130888 Ga0373962_0130888_221_625 134
945 3300035691 Ga0373931_0112306 Ga0373931_0112306_594_998 134
946 3300037312 Ga0395899_0061005 Ga0395899_0061005_203_607 134
947 3300037312 Ga0395899_0147401 Ga0395899_0147401_1151_1555 134
948 3300037312 Ga0395899_0496770 Ga0395899_0496770_337_741 134
949 3300037418 Ga0395900_0226160 Ga0395900_0226160_56_460 134
950 3300037418 Ga0395900_0336364 Ga0395900_0336364_361_765 134
951 3300037466 Ga0395898_0087215 Ga0395898_0087215_2058_2462 134
952 3300037466 Ga0395898_0229856 Ga0395898_0229856_120_524 134
953 3300037471 Ga0395905_0010495 Ga0395905_0010495_4389_4793 134
954 3300037471 Ga0395905_0154657 Ga0395905_0154657_27_431 134
955 3300037471 Ga0395905_0906466 Ga0395905_0906466_70_474 134
956 3300037471 Ga0395905_1011479 Ga0395905_1011479_273_677 134
957 3300037471 Ga0395905_1638648 Ga0395905_1638648_117_521 134
958 3300038443 Ga0395901_0007822 Ga0395901_0007822_197_601 134
959 3300038443 Ga0395901_1385072 Ga0395901_1385072_221_625 134
960 3300039437 Ga0436365_1036392 Ga0436365_1036392_5972_6376 134
961 3300039450 Ga0436363_1424897 Ga0436363_1424897_1458_1862 134
962 3300041512 Ga0451853_0435493 Ga0451853_0435493_132_536 134
963 3300044684 Ga0466966_0052884 Ga0466966_0052884_1548_1952 134
964 3300044693 Ga0466961_0034226 Ga0466961_0034226_182_586 134
965 3300044693 Ga0466961_0188402 Ga0466961_0188402_600_1004 134
966 3300044694 Ga0466963_0022136 Ga0466963_0022136_1636_2040 134
967 3300044694 Ga0466963_0185564 Ga0466963_0185564_894_1298 134
968 3300044719 Ga0466971_0005504 Ga0466971_0005504_3722_4126 134
969 3300044842 Ga0466957_0005960 Ga0466957_0005960_5243_5647 134
970 3300044901 Ga0466960_0641412 Ga0466960_0641412_23_427 134
971 3300045049 Ga0466959_0205389 Ga0466959_0205389_410_814 134
972 3300045836 Ga0466958_0005124 Ga0466958_0005124_5288_5692 134
973 3300045976 Ga0466967_0215768 Ga0466967_0215768_571_975 134
974 3300046522 Ga0495643_0210690 Ga0495643_0210690_513_917 134
975 3300046684 Ga0495669_0054586 Ga0495669_0054586_1143_1547 134
976 3300046684 Ga0495669_0144873 Ga0495669_0144873_349_753 134
977 3300048903 Ga0496100_0159940 Ga0496100_0159940_767_1171 134
978 3300048909 Ga0496106_0629773 Ga0496106_0629773_124_534 134
979 3300048909 Ga0496106_0690312 Ga0496106_0690312_19_423 134
980 3300048910 Ga0496107_0020379 Ga0496107_0020379_1617_2021 134
981 3300048910 Ga0496107_0146746 Ga0496107_0146746_559_963 134
982 3300048910 Ga0496107_0661841 Ga0496107_0661841_325_729 134
983 3300048910 Ga0496107_0705802 Ga0496107_0705802_215_625 134
984 3300048911 Ga0496108_0025768 Ga0496108_0025768_807_1211 134
985 3300048913 Ga0496110_0175802 Ga0496110_0175802_1211_1615 134
986 3300048913 Ga0496110_1156388 Ga0496110_1156388_238_642 134
987 3300048914 Ga0496111_0583987 Ga0496111_0583987_65_469 134
988 3300048917 Ga0496114_0000006 Ga0496114_0000006_349886_350290 134
989 3300048917 Ga0496114_0016874 Ga0496114_0016874_3610_4014 134
990 3300048918 Ga0496115_0001032 Ga0496115_0001032_12203_12607 134
991 3300049652 Ga0501202_053479 Ga0501202_053479_276_680 134
992 3300061719 Ga0466962_0042964 Ga0466962_0042964_1576_1980 134
993 3300001904 JGI24736J21556_1007403 JGI24736J21556_10074031 135
994 3300001979 JGI24740J21852_10001189 JGI24740J21852_100011893 135
995 3300001979 JGI24740J21852_10017908 JGI24740J21852_100179083 135
996 3300005327 Ga0070658_10011090 Ga0070658_100110902 135
997 3300005327 Ga0070658_10030513 Ga0070658_100305132 135
998 3300005327 Ga0070658_10075997 Ga0070658_100759972 135
999 3300005327 Ga0070658_10079178 Ga0070658_100791783 135
1000 3300005327 Ga0070658_10106531 Ga0070658_101065312 135
1001 3300005327 Ga0070658_10221135 Ga0070658_102211351 135
1002 3300005329 Ga0070683_100057473 Ga0070683_1000574732 135
1003 3300005329 Ga0070683_100286671 Ga0070683_1002866712 135
1004 3300005331 Ga0070670_100103868 Ga0070670_1001038683 135
1005 3300005335 Ga0070666_10896149 Ga0070666_108961491 135
1006 3300005336 Ga0070680_100054926 Ga0070680_1000549263 135
1007 3300005336 Ga0070680_100095186 Ga0070680_1000951862 135
1008 3300005337 Ga0070682_100283451 Ga0070682_1002834512 135
1009 3300005339 Ga0070660_100024658 Ga0070660_1000246584 135
1010 3300005339 Ga0070660_100029093 Ga0070660_1000290933 135
1011 3300005339 Ga0070660_100095606 Ga0070660_1000956064 135
1012 3300005341 Ga0070691_10014238 Ga0070691_100142382 135
1013 3300005344 Ga0070661_100003585 Ga0070661_10000358510 135
1014 3300005344 Ga0070661_100058342 Ga0070661_1000583422 135
1015 3300005344 Ga0070661_100161078 Ga0070661_1001610782 135
1016 3300005344 Ga0070661_100224283 Ga0070661_1002242832 135
1017 3300005344 Ga0070661_100977056 Ga0070661_1009770562 135
1018 3300005355 Ga0070671_100309916 Ga0070671_1003099162 135
1019 3300005364 Ga0070673_101167613 Ga0070673_1011676131 135
1020 3300005435 Ga0070714_100099690 Ga0070714_1000996902 135
1021 3300005455 Ga0070663_100019953 Ga0070663_1000199534 135
1022 3300005455 Ga0070663_100124560 Ga0070663_1001245603 135
1023 3300005455 Ga0070663_100861019 Ga0070663_1008610191 135
1024 3300005457 Ga0070662_101094274 Ga0070662_1010942741 135
1025 3300005458 Ga0070681_10413986 Ga0070681_104139862 135
1026 3300005530 Ga0070679_100014156 Ga0070679_1000141565 135
1027 3300005530 Ga0070679_100702998 Ga0070679_1007029982 135
1028 3300005535 Ga0070684_100002928 Ga0070684_10000292813 135
1029 3300005535 Ga0070684_100006344 Ga0070684_1000063449 135
1030 3300005564 Ga0070664_100022999 Ga0070664_1000229993 135
1031 3300005577 Ga0068857_100009896 Ga0068857_1000098962 135
1032 3300005577 Ga0068857_100124584 Ga0068857_1001245842 135
1033 3300005578 Ga0068854_100001932 Ga0068854_1000019323 135
1034 3300005578 Ga0068854_100031971 Ga0068854_1000319714 135
1035 3300005578 Ga0068854_100041707 Ga0068854_1000417072 135
1036 3300005578 Ga0068854_100088238 Ga0068854_1000882382 135
1037 3300005578 Ga0068854_100217210 Ga0068854_1002172102 135
1038 3300005614 Ga0068856_100029066 Ga0068856_1000290665 135
1039 3300005614 Ga0068856_100244805 Ga0068856_1002448052 135
1040 3300005614 Ga0068856_100294565 Ga0068856_1002945651 135
1041 3300005614 Ga0068856_100723425 Ga0068856_1007234251 135
1042 3300005616 Ga0068852_100319507 Ga0068852_1003195072 135
1043 3300005616 Ga0068852_100375083 Ga0068852_1003750832 135
1044 3300005834 Ga0068851_10258017 Ga0068851_102580172 135
1045 3300005985 Ga0081539_10012171 Ga0081539_100121715 135
1046 3300005985 Ga0081539_10042924 Ga0081539_100429244 135
1047 3300009093 Ga0105240_10412549 Ga0105240_104125492 135
1048 3300009093 Ga0105240_10541683 Ga0105240_105416831 135
1049 3300009174 Ga0105241_10408449 Ga0105241_104084491 135
1050 3300009177 Ga0105248_10079105 Ga0105248_100791053 135
1051 3300013100 Ga0157373_10201275 Ga0157373_102012752 135
1052 3300013102 Ga0157371_10044453 Ga0157371_100444532 135
1053 3300013102 Ga0157371_10063501 Ga0157371_100635013 135
1054 3300013102 Ga0157371_10068288 Ga0157371_100682883 135
1055 3300013104 Ga0157370_10183781 Ga0157370_101837813 135
1056 3300013104 Ga0157370_10371706 Ga0157370_103717062 135
1057 3300013104 Ga0157370_10438122 Ga0157370_104381221 135
1058 3300013105 Ga0157369_10073070 Ga0157369_100730701 135
1059 3300013105 Ga0157369_10165984 Ga0157369_101659841 135
1060 3300013105 Ga0157369_10550483 Ga0157369_105504832 135
1061 3300013307 Ga0157372_10136055 Ga0157372_101360553 135
1062 3300014325 Ga0163163_11539318 Ga0163163_115393182 135
1063 3300025321 Ga0207656_10012456 Ga0207656_100124561 135
1064 3300025904 Ga0207647_10001001 Ga0207647_1000100110 135
1065 3300025904 Ga0207647_10570832 Ga0207647_105708321 135
1066 3300025909 Ga0207705_10007626 Ga0207705_100076267 135
1067 3300025909 Ga0207705_10011668 Ga0207705_100116682 135
1068 3300025909 Ga0207705_10050714 Ga0207705_100507143 135
1069 3300025909 Ga0207705_10186208 Ga0207705_101862082 135
1070 3300025911 Ga0207654_10232260 Ga0207654_102322602 135
1071 3300025912 Ga0207707_10703741 Ga0207707_107037412 135
1072 3300025913 Ga0207695_10012183 Ga0207695_1001218310 135
1073 3300025913 Ga0207695_10151392 Ga0207695_101513921 135
1074 3300025917 Ga0207660_10091849 Ga0207660_100918492 135
1075 3300025917 Ga0207660_11604649 Ga0207660_116046491 135
1076 3300025919 Ga0207657_10000594 Ga0207657_1000059426 135
1077 3300025919 Ga0207657_10003798 Ga0207657_100037985 135
1078 3300025919 Ga0207657_10011912 Ga0207657_100119125 135
1079 3300025919 Ga0207657_10168317 Ga0207657_101683173 135
1080 3300025920 Ga0207649_10006256 Ga0207649_100062567 135
1081 3300025920 Ga0207649_10017140 Ga0207649_100171404 135
1082 3300025920 Ga0207649_10346410 Ga0207649_103464102 135
1083 3300025921 Ga0207652_10043565 Ga0207652_100435652 135
1084 3300025921 Ga0207652_10140927 Ga0207652_101409273 135
1085 3300025924 Ga0207694_10007832 Ga0207694_100078328 135
1086 3300025925 Ga0207650_10173037 Ga0207650_101730372 135
1087 3300025925 Ga0207650_10406796 Ga0207650_104067962 135
1088 3300025929 Ga0207664_10329500 Ga0207664_103295001 135
1089 3300025931 Ga0207644_10564971 Ga0207644_105649712 135
1090 3300025932 Ga0207690_10114421 Ga0207690_101144212 135
1091 3300025932 Ga0207690_10116540 Ga0207690_101165403 135
1092 3300025933 Ga0207706_10097907 Ga0207706_100979074 135
1093 3300025941 Ga0207711_10192850 Ga0207711_101928503 135
1094 3300025944 Ga0207661_10002460 Ga0207661_100024603 135
1095 3300025944 Ga0207661_10039512 Ga0207661_100395123 135
1096 3300025945 Ga0207679_10046901 Ga0207679_100469013 135
1097 3300025945 Ga0207679_10144404 Ga0207679_101444042 135
1098 3300025949 Ga0207667_10076813 Ga0207667_100768134 135
1099 3300025949 Ga0207667_10206461 Ga0207667_102064613 135
1100 3300025981 Ga0207640_10013090 Ga0207640_100130904 135
1101 3300025981 Ga0207640_10135423 Ga0207640_101354233 135
1102 3300025981 Ga0207640_10160830 Ga0207640_101608302 135
1103 3300025981 Ga0207640_10266802 Ga0207640_102668022 135
1104 3300026041 Ga0207639_10026556 Ga0207639_100265563 135
1105 3300026041 Ga0207639_10029438 Ga0207639_100294382 135
1106 3300026067 Ga0207678_10031647 Ga0207678_100316474 135
1107 3300026067 Ga0207678_10192250 Ga0207678_101922503 135
1108 3300026067 Ga0207678_10842646 Ga0207678_108426461 135
1109 3300026078 Ga0207702_10006018 Ga0207702_1000601810 135
1110 3300026078 Ga0207702_10017313 Ga0207702_100173137 135
1111 3300026078 Ga0207702_10430340 Ga0207702_104303401 135
1112 3300026116 Ga0207674_10004380 Ga0207674_100043804 135
1113 3300026116 Ga0207674_10009547 Ga0207674_100095474 135
1114 3300026142 Ga0207698_10039262 Ga0207698_100392622 135
1115 3300026142 Ga0207698_10348256 Ga0207698_103482562 135
1116 3300026142 Ga0207698_10893729 Ga0207698_108937291 135
1117 3300031824 Ga0307413_10849090 Ga0307413_108490901 135
1118 3300031852 Ga0307410_10070856 Ga0307410_100708563 135
1119 3300031852 Ga0307410_10576251 Ga0307410_105762512 135
1120 3300031903 Ga0307407_10230251 Ga0307407_102302512 135
1121 3300031911 Ga0307412_10751487 Ga0307412_107514872 135
1122 3300031995 Ga0307409_100018555 Ga0307409_1000185555 135
1123 3300032004 Ga0307414_10043049 Ga0307414_100430494 135
1124 3300032005 Ga0307411_10023318 Ga0307411_100233184 135
1125 3300032005 Ga0307411_10222583 Ga0307411_102225831 135
1126 3300034817 Ga0373948_0085822 Ga0373948_0085822_119_526 135
1127 3300035083 Ga0373926_0055354 Ga0373926_0055354_408_815 135
1128 3300035170 Ga0373943_0144477 Ga0373943_0144477_320_727 135
1129 3300035171 Ga0373946_0025294 Ga0373946_0025294_1610_2017 135
1130 3300037068 Ga0373925_0004938 Ga0373925_0004938_2828_3235 135
1131 3300037312 Ga0395899_0003120 Ga0395899_0003120_7994_8401 135
1132 3300037312 Ga0395899_0037734 Ga0395899_0037734_986_1393 135
1133 3300037312 Ga0395899_0048805 Ga0395899_0048805_1084_1491 135
1134 3300037312 Ga0395899_0084612 Ga0395899_0084612_687_1094 135
1135 3300037312 Ga0395899_0227407 Ga0395899_0227407_605_1012 135
1136 3300037312 Ga0395899_0414054 Ga0395899_0414054_453_863 135
1137 3300037418 Ga0395900_0065774 Ga0395900_0065774_2869_3276 135
1138 3300037418 Ga0395900_0110341 Ga0395900_0110341_506_916 135
1139 3300037418 Ga0395900_0117132 Ga0395900_0117132_1232_1639 135
1140 3300037418 Ga0395900_0130243 Ga0395900_0130243_422_829 135
1141 3300037418 Ga0395900_0170148 Ga0395900_0170148_523_930 135
1142 3300037418 Ga0395900_0188358 Ga0395900_0188358_866_1273 135
1143 3300037418 Ga0395900_0424664 Ga0395900_0424664_278_685 135
1144 3300037466 Ga0395898_0048366 Ga0395898_0048366_1636_2043 135
1145 3300037466 Ga0395898_0085484 Ga0395898_0085484_523_930 135
1146 3300037466 Ga0395898_0100792 Ga0395898_0100792_1133_1540 135
1147 3300037466 Ga0395898_0101770 Ga0395898_0101770_1832_2239 135
1148 3300037466 Ga0395898_0197113 Ga0395898_0197113_1446_1853 135
1149 3300037466 Ga0395898_0755620 Ga0395898_0755620_147_554 135
1150 3300037471 Ga0395905_0000958 Ga0395905_0000958_24940_25350 135
1151 3300037471 Ga0395905_0008116 Ga0395905_0008116_4920_5327 135
1152 3300037471 Ga0395905_0029756 Ga0395905_0029756_2106_2516 135
1153 3300037471 Ga0395905_0031344 Ga0395905_0031344_2111_2518 135
1154 3300037471 Ga0395905_0032826 Ga0395905_0032826_3096_3503 135
1155 3300037471 Ga0395905_0061148 Ga0395905_0061148_620_1027 135
1156 3300037471 Ga0395905_0072295 Ga0395905_0072295_1185_1592 135
1157 3300037471 Ga0395905_0076035 Ga0395905_0076035_1004_1411 135
1158 3300037471 Ga0395905_0277683 Ga0395905_0277683_1067_1474 135
1159 3300037471 Ga0395905_0844888 Ga0395905_0844888_179_586 135
1160 3300038443 Ga0395901_0006716 Ga0395901_0006716_3351_3761 135
1161 3300038443 Ga0395901_0088258 Ga0395901_0088258_2388_2795 135
1162 3300038443 Ga0395901_0552724 Ga0395901_0552724_689_1096 135
1163 3300038443 Ga0395901_0720169 Ga0395901_0720169_515_925 135
1164 3300038443 Ga0395901_0807451 Ga0395901_0807451_278_685 135
1165 3300041413 Ga0439465_0078831 Ga0439465_0078831_683_1090 135
1166 3300042007 Ga0439449_0245029 Ga0439449_0245029_213_620 135
1167 3300042010 Ga0439452_037517 Ga0439452_037517_543_950 135
1168 3300042157 Ga0439458_0004321 Ga0439458_0004321_2098_2508 135
1169 3300044683 Ga0466965_0222779 Ga0466965_0222779_443_850 135
1170 3300044684 Ga0466966_0074683 Ga0466966_0074683_511_918 135
1171 3300044694 Ga0466963_0054130 Ga0466963_0054130_143_550 135
1172 3300044694 Ga0466963_0597278 Ga0466963_0597278_111_518 135
1173 3300044706 Ga0466964_0051973 Ga0466964_0051973_1144_1551 135
1174 3300044719 Ga0466971_0057856 Ga0466971_0057856_1032_1439 135
1175 3300044735 Ga0466968_0009699 Ga0466968_0009699_2513_2920 135
1176 3300044765 Ga0466970_0164455 Ga0466970_0164455_518_925 135
1177 3300044765 Ga0466970_0528775 Ga0466970_0528775_21_428 135
1178 3300044842 Ga0466957_0029193 Ga0466957_0029193_1228_1635 135
1179 3300045049 Ga0466959_0061525 Ga0466959_0061525_1475_1882 135
1180 3300045836 Ga0466958_0102917 Ga0466958_0102917_173_580 135
1181 3300045836 Ga0466958_0107193 Ga0466958_0107193_617_1024 135
1182 3300045976 Ga0466967_0208416 Ga0466967_0208416_1421_1828 135
1183 3300045976 Ga0466967_0522331 Ga0466967_0522331_689_1096 135
1184 3300045976 Ga0466967_1526632 Ga0466967_1526632_121_528 135
1185 3300046525 Ga0495663_0027296 Ga0495663_0027296_588_995 135
1186 3300046525 Ga0495663_0047505 Ga0495663_0047505_728_1138 135
1187 3300046684 Ga0495669_0004827 Ga0495669_0004827_2994_3404 135
1188 3300046684 Ga0495669_0015497 Ga0495669_0015497_377_787 135
1189 3300047445 Ga0495677_0165241 Ga0495677_0165241_377_784 135
1190 3300048903 Ga0496100_0734295 Ga0496100_0734295_172_579 135
1191 3300048911 Ga0496108_0003253 Ga0496108_0003253_6726_7139 135
1192 3300048912 Ga0496109_0899987 Ga0496109_0899987_222_629 135
1193 3300048915 Ga0496112_0062662 Ga0496112_0062662_692_1099 135
1194 3300048916 Ga0496113_0360175 Ga0496113_0360175_435_842 135
1195 3300049583 Ga0501067_0018792 Ga0501067_0018792_3115_3522 135
1196 3300049660 Ga0501216_020536 Ga0501216_020536_668_1075 135
1197 3300059508 Ga0587088_066021 Ga0587088_066021_240_650 135
1198 3300061719 Ga0466962_0025584 Ga0466962_0025584_1775_2182 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

23

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.8669 18 121
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.8659 21 119
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.8603 21 121
3ups-assembly1.cif.gz_A-2 crystal structure of iojap-like protein from zymomonas mobilis 0.8535 19 125
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.846 15 121
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8957 21 122 3.30.460.10
af_E7F2E7_80_194_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8894 24 122 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8833 19 121 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.878 21 121 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8719 21 122 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A0F3RAS5-F1-model_v4 Oligomerization domain protein 0.9637 20 110 GO:0017148
GO:0043023
GO:0090071
AF-A0A3C0C7S9-F1-model_v4 Ribosomal silencing factor RsfS 0.9401 19 121 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A533IB22-F1-model_v4 Ribosomal silencing factor RsfS 0.9363 20 122 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A349GQH3-F1-model_v4 Ribosome silencing factor 0.9341 21 107 GO:0017148
GO:0043023
GO:0090071
AF-A0A1G9E6V3-F1-model_v4 Ribosomal silencing factor RsfS 0.9298 23 121 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Feature Viewer

pLDDT pTM Quality
77.99 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map