F491493

General Info

Members Datasets Scaffolds Average Seq Length
1194 358 1194 130

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_102120411|Ga0068868_1021204111
Length 142
Sequence MASTPFPCEVLTPDGEVFNDEVVQISTKTTIGSIGILAKHQPLLAMLDPTELRLYKSESDVVRMIQGEGYLQVQPDGRVLILVDEAGDPSSIDQSEWEDRLRRAEEELSSADEGSHQAEVAARDKRRAEAFLEVLRSGAGAS

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
219 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
223 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
224 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
225 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
226 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
227 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
228 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
229 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
230 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
231 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 5.95
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10026030 3300001991 Bacteria 1136
2 JGI24745J21846_1000633 3300002073 Bacteria 3156
3 JGI24744J21845_10015481 3300002077 Bacteria 1524
4 JGI25406J46586_10008130 3300003203 Bacteria 4762
5 JGI25406J46586_10034801 3300003203 Bacteria 1844
6 JGI25406J46586_10109597 3300003203 Bacteria 818
7 JGI25406J46586_10110030 3300003203 Bacteria 816
8 JGI25407J50210_10000141 3300003373 Bacteria 10945
9 JGI25407J50210_10004242 3300003373 Bacteria 3487
10 JGI25407J50210_10080461 3300003373 Bacteria 810
11 JGI25407J50210_10150474 3300003373 Bacteria 573
12 Ga0032354_1043383 3300003693 Bacteria 719
13 Ga0070658_10033242 3300005327 Bacteria 4148
14 Ga0070658_10658330 3300005327 Bacteria 909
15 Ga0070658_10795240 3300005327 Bacteria 822
16 Ga0070676_10034541 3300005328 Bacteria 2904
17 Ga0070676_10125201 3300005328 Bacteria 1618
18 Ga0070676_10898135 3300005328 Bacteria 660
19 Ga0070683_100001769 3300005329 Bacteria 16823
20 Ga0070683_100005389 3300005329 Bacteria 10673
21 Ga0070683_100065158 3300005329 Bacteria 3392
22 Ga0070683_100126015 3300005329 Bacteria 2421
23 Ga0070683_100411099 3300005329 Bacteria 1290
24 Ga0070683_100619776 3300005329 Bacteria 1036
25 Ga0070683_100871629 3300005329 Bacteria 863
26 Ga0070683_101080965 3300005329 Bacteria 770
27 Ga0068869_100110975 3300005334 Bacteria 2086
28 Ga0068869_100213862 3300005334 Bacteria 1525
29 Ga0070666_10386536 3300005335 Bacteria 1005
30 Ga0070666_11270535 3300005335 Bacteria 549
31 Ga0070680_100002392 3300005336 Bacteria 13887
32 Ga0070680_100826054 3300005336 Bacteria 799
33 Ga0070682_100019701 3300005337 Bacteria 3962
34 Ga0070682_100927241 3300005337 Bacteria 718
35 Ga0068868_100007906 3300005338 Bacteria 7597
36 Ga0068868_100061487 3300005338 Bacteria 2975
37 Ga0068868_100668394 3300005338 Bacteria 926
38 Ga0068868_101143322 3300005338 Bacteria 718
39 Ga0068868_102120411 3300005338 Unclassified 535
40 Ga0070660_100415363 3300005339 Bacteria 1114
41 Ga0070660_100488225 3300005339 Bacteria 1024
42 Ga0070660_100814688 3300005339 Bacteria 785
43 Ga0070660_100930012 3300005339 Bacteria 734
44 Ga0070660_101854589 3300005339 Unclassified 514
45 Ga0070689_100302110 3300005340 Bacteria 1332
46 Ga0070691_10036620 3300005341 Bacteria 2313
47 Ga0070687_100018335 3300005343 Bacteria 3236
48 Ga0070687_100110688 3300005343 Bacteria 1554
49 Ga0070687_100699722 3300005343 Bacteria 708
50 Ga0070661_100235238 3300005344 Bacteria 1409
51 Ga0070661_100429907 3300005344 Bacteria 1048
52 Ga0070661_100462513 3300005344 Bacteria 1011
53 Ga0070661_101300627 3300005344 Bacteria 610
54 Ga0070692_10000136 3300005345 Bacteria 17586
55 Ga0070692_10023589 3300005345 Bacteria 3016
56 Ga0070692_10048536 3300005345 Bacteria 2200
57 Ga0070692_10097313 3300005345 Bacteria 1608
58 Ga0070692_10157652 3300005345 Bacteria 1298
59 Ga0070692_10246880 3300005345 Bacteria 1066
60 Ga0070668_100266310 3300005347 Bacteria 1427
61 Ga0070669_100001051 3300005353 Bacteria 20194
62 Ga0070669_100486770 3300005353 Bacteria 1022
63 Ga0070669_100875568 3300005353 Bacteria 766
64 Ga0070675_100451019 3300005354 Bacteria 1153
65 Ga0070675_100741965 3300005354 Bacteria 896
66 Ga0070674_100123102 3300005356 Bacteria 1923
67 Ga0070674_100133932 3300005356 Bacteria 1851
68 Ga0070674_100324440 3300005356 Bacteria 1235
69 Ga0070674_100576315 3300005356 Bacteria 948
70 Ga0070673_100142138 3300005364 Bacteria 2025
71 Ga0070673_100708770 3300005364 Bacteria 925
72 Ga0070673_101872463 3300005364 Bacteria 569
73 Ga0070688_100197424 3300005365 Bacteria 1406
74 Ga0070688_100967303 3300005365 Bacteria 675
75 Ga0070659_100001163 3300005366 Bacteria 19237
76 Ga0070659_100002782 3300005366 Bacteria 12449
77 Ga0070659_100051525 3300005366 Bacteria 3237
78 Ga0070659_100386477 3300005366 Bacteria 1179
79 Ga0070659_100546853 3300005366 Bacteria 991
80 Ga0070659_100575851 3300005366 Bacteria 966
81 Ga0070659_100778873 3300005366 Bacteria 831
82 Ga0070709_10408443 3300005434 Bacteria 1015
83 Ga0070714_100090477 3300005435 Bacteria 2680
84 Ga0070714_100306176 3300005435 Bacteria 1482
85 Ga0070714_100378371 3300005435 Bacteria 1334
86 Ga0070714_100436645 3300005435 Bacteria 1242
87 Ga0070714_100764017 3300005435 Bacteria 935
88 Ga0070714_100878691 3300005435 Bacteria 870
89 Ga0070714_100971882 3300005435 Bacteria 826
90 Ga0070714_101112441 3300005435 Bacteria 770
91 Ga0070713_100532487 3300005436 Bacteria 1111
92 Ga0070710_10000002 3300005437 Bacteria 290371
93 Ga0070701_10040526 3300005438 Bacteria 2368
94 Ga0070701_10461014 3300005438 Bacteria 818
95 Ga0070701_10714341 3300005438 Bacteria 675
96 Ga0070711_100105216 3300005439 Bacteria 2061
97 Ga0070711_101109969 3300005439 Bacteria 682
98 Ga0070711_101175037 3300005439 Bacteria 663
99 Ga0070705_100034145 3300005440 Bacteria 2841
100 Ga0070705_100218328 3300005440 Bacteria 1319
101 Ga0070700_100009444 3300005441 Bacteria 5354
102 Ga0070700_100010007 3300005441 Bacteria 5221
103 Ga0070700_100011166 3300005441 Bacteria 4971
104 Ga0070700_100319365 3300005441 Bacteria 1140
105 Ga0070700_100669391 3300005441 Bacteria 821
106 Ga0070700_100729392 3300005441 Bacteria 791
107 Ga0070700_100796643 3300005441 Bacteria 760
108 Ga0070700_100833136 3300005441 Unclassified 746
109 Ga0070694_100262805 3300005444 Bacteria 1310
110 Ga0070663_100038538 3300005455 Bacteria 3335
111 Ga0070663_100138320 3300005455 Bacteria 1856
112 Ga0070663_100237422 3300005455 Bacteria 1438
113 Ga0070663_100381704 3300005455 Bacteria 1148
114 Ga0070663_100466917 3300005455 Bacteria 1043
115 Ga0070663_101295603 3300005455 Bacteria 643
116 Ga0070678_100019340 3300005456 Bacteria 4437
117 Ga0070678_100130878 3300005456 Bacteria 1993
118 Ga0070678_100774225 3300005456 Bacteria 869
119 Ga0070678_101079125 3300005456 Bacteria 741
120 Ga0070662_100344678 3300005457 Bacteria 1219
121 Ga0070662_100455036 3300005457 Bacteria 1063
122 Ga0070662_101132212 3300005457 Bacteria 672
123 Ga0070681_10019241 3300005458 Bacteria 6832
124 Ga0070681_10506360 3300005458 Bacteria 1121
125 Ga0070681_10590631 3300005458 Bacteria 1025
126 Ga0070681_10757392 3300005458 Bacteria 888
127 Ga0068867_100463368 3300005459 Bacteria 1082
128 Ga0068867_100692022 3300005459 Bacteria 899
129 Ga0068867_100965437 3300005459 Bacteria 771
130 Ga0068867_101394675 3300005459 Bacteria 650
131 Ga0070685_10200574 3300005466 Bacteria 1296
132 Ga0070685_10220321 3300005466 Bacteria 1243
133 Ga0070706_101092595 3300005467 Bacteria 734
134 Ga0070707_101202543 3300005468 Bacteria 724
135 Ga0070679_100366618 3300005530 Bacteria 1388
136 Ga0070684_100013185 3300005535 Bacteria 6654
137 Ga0070684_100020346 3300005535 Bacteria 5506
138 Ga0070684_100079063 3300005535 Bacteria 2907
139 Ga0070684_100289138 3300005535 Bacteria 1502
140 Ga0070684_100362082 3300005535 Bacteria 1335
141 Ga0070684_100472890 3300005535 Bacteria 1159
142 Ga0070684_100563425 3300005535 Bacteria 1058
143 Ga0070684_100720283 3300005535 Bacteria 931
144 Ga0070684_100828381 3300005535 Bacteria 866
145 Ga0068853_100339934 3300005539 Bacteria 1394
146 Ga0068853_100833657 3300005539 Bacteria 884
147 Ga0070672_100264294 3300005543 Bacteria 1452
148 Ga0070672_100362378 3300005543 Bacteria 1237
149 Ga0070672_100694682 3300005543 Bacteria 891
150 Ga0070686_100174306 3300005544 Bacteria 1524
151 Ga0070686_100335374 3300005544 Bacteria 1132
152 Ga0070686_101403892 3300005544 Bacteria 586
153 Ga0070693_100202519 3300005547 Bacteria 1290
154 Ga0070665_100005346 3300005548 Bacteria 13262
155 Ga0070665_100087378 3300005548 Bacteria 3123
156 Ga0070665_100879752 3300005548 Bacteria 909
157 Ga0070665_101444532 3300005548 Bacteria 697
158 Ga0070665_101612682 3300005548 Bacteria 657
159 Ga0070704_100150892 3300005549 Bacteria 1827
160 Ga0070704_101138210 3300005549 Bacteria 710
161 Ga0070664_100121454 3300005564 Bacteria 2288
162 Ga0070664_100310130 3300005564 Bacteria 1428
163 Ga0070664_100355896 3300005564 Bacteria 1333
164 Ga0070664_100499092 3300005564 Bacteria 1121
165 Ga0070664_100959933 3300005564 Bacteria 803
166 Ga0070664_101220671 3300005564 Bacteria 709
167 Ga0068857_100350155 3300005577 Bacteria 1368
168 Ga0068857_100797347 3300005577 Bacteria 902
169 Ga0068854_100068091 3300005578 Bacteria 2595
170 Ga0068854_100314747 3300005578 Bacteria 1270
171 Ga0068854_100323242 3300005578 Bacteria 1255
172 Ga0068856_100012413 3300005614 Bacteria 8248
173 Ga0068856_100048650 3300005614 Bacteria 4179
174 Ga0068856_100730323 3300005614 Bacteria 1010
175 Ga0068856_101028605 3300005614 Bacteria 842
176 Ga0068856_101457445 3300005614 Bacteria 699
177 Ga0070702_100011498 3300005615 Bacteria 4404
178 Ga0070702_100024221 3300005615 Bacteria 3235
179 Ga0070702_100114588 3300005615 Bacteria 1677
180 Ga0070702_100133431 3300005615 Bacteria 1572
181 Ga0070702_100611406 3300005615 Bacteria 818
182 Ga0070702_100715628 3300005615 Bacteria 765
183 Ga0070702_101081414 3300005615 Bacteria 640
184 Ga0068852_100003014 3300005616 Bacteria 11715
185 Ga0068852_100058926 3300005616 Bacteria 3328
186 Ga0068852_100645458 3300005616 Bacteria 1065
187 Ga0068852_100720225 3300005616 Bacteria 1009
188 Ga0068852_100851039 3300005616 Bacteria 928
189 Ga0068852_100977584 3300005616 Bacteria 865
190 Ga0068852_101254344 3300005616 Bacteria 763
191 Ga0068852_102560864 3300005616 Unclassified 530
192 Ga0068859_100084528 3300005617 Bacteria 3218
193 Ga0068859_100114585 3300005617 Bacteria 2760
194 Ga0068859_100140060 3300005617 Bacteria 2493
195 Ga0068859_101131567 3300005617 Bacteria 861
196 Ga0068864_100013258 3300005618 Bacteria 6828
197 Ga0068864_100149644 3300005618 Bacteria 2113
198 Ga0068864_100425402 3300005618 Bacteria 1266
199 Ga0068864_101034308 3300005618 Bacteria 815
200 Ga0068864_101678903 3300005618 Bacteria 640
201 Ga0068866_10081583 3300005718 Bacteria 1738
202 Ga0068866_10142086 3300005718 Bacteria 1379
203 Ga0068861_100150964 3300005719 Bacteria 1906
204 Ga0068861_100543011 3300005719 Bacteria 1058
205 Ga0068870_10226328 3300005840 Bacteria 1148
206 Ga0068870_10530435 3300005840 Bacteria 789
207 Ga0068863_101396973 3300005841 Bacteria 708
208 Ga0068863_101856089 3300005841 Bacteria 612
209 Ga0068858_100176523 3300005842 Bacteria 2016
210 Ga0068858_100430970 3300005842 Bacteria 1269
211 Ga0068860_100639161 3300005843 Bacteria 1072
212 Ga0068860_101197339 3300005843 Bacteria 780
213 Ga0068860_101641818 3300005843 Bacteria 665
214 Ga0068862_100675278 3300005844 Bacteria 999
215 Ga0081455_10045365 3300005937 Bacteria 3825
216 Ga0081455_10465749 3300005937 Bacteria 859
217 Ga0081538_10000011 3300005981 Bacteria 154554
218 Ga0081538_10000332 3300005981 Bacteria 53567
219 Ga0081538_10000575 3300005981 Bacteria 40813
220 Ga0081538_10000661 3300005981 Bacteria 38054
221 Ga0081538_10000784 3300005981 Bacteria 34665
222 Ga0081538_10005330 3300005981 Bacteria 11574
223 Ga0081538_10028761 3300005981 Bacteria 3813
224 Ga0081538_10046042 3300005981 Bacteria 2696
225 Ga0081538_10049537 3300005981 Bacteria 2547
226 Ga0081538_10053060 3300005981 Bacteria 2415
227 Ga0081538_10054845 3300005981 Bacteria 2352
228 Ga0081538_10056816 3300005981 Bacteria 2289
229 Ga0081538_10077619 3300005981 Bacteria 1788
230 Ga0081538_10148807 3300005981 Bacteria 1064
231 Ga0081538_10251991 3300005981 Bacteria 672
232 Ga0081540_1004390 3300005983 Bacteria 10778
233 Ga0081539_10001944 3300005985 Bacteria 31666
234 Ga0081539_10095149 3300005985 Bacteria 1531
235 Ga0081539_10179847 3300005985 Bacteria 993
236 Ga0081539_10419588 3300005985 Unclassified 555
237 Ga0070717_10000006 3300006028 Bacteria 353403
238 Ga0070717_10245645 3300006028 Bacteria 1580
239 Ga0070717_10443286 3300006028 Bacteria 1170
240 Ga0070717_11156375 3300006028 Unclassified 704
241 Ga0070717_11894904 3300006028 Bacteria 538
242 Ga0075363_100168419 3300006048 Bacteria 1243
243 Ga0075363_100292688 3300006048 Bacteria 944
244 Ga0075363_100697829 3300006048 Unclassified 613
245 Ga0075432_10006336 3300006058 Bacteria 4023
246 Ga0075432_10059584 3300006058 Bacteria 1357
247 Ga0075432_10163562 3300006058 Bacteria 862
248 Ga0070712_100000003 3300006175 Bacteria 253696
249 Ga0070712_100038037 3300006175 Bacteria 3285
250 Ga0070712_100325174 3300006175 Bacteria 1251
251 Ga0070712_101206696 3300006175 Bacteria 658
252 Ga0068871_100378656 3300006358 Bacteria 1257
253 Ga0068871_100639110 3300006358 Bacteria 971
254 Ga0068871_101495379 3300006358 Bacteria 638
255 Ga0068871_101921042 3300006358 Bacteria 563
256 Ga0075428_100077918 3300006844 Bacteria 3618
257 Ga0075428_100084021 3300006844 Bacteria 3474
258 Ga0075428_100134842 3300006844 Bacteria 2685
259 Ga0075428_100167725 3300006844 Bacteria 2381
260 Ga0075428_100541517 3300006844 Bacteria 1244
261 Ga0075428_100755407 3300006844 Bacteria 1034
262 Ga0075428_100930275 3300006844 Bacteria 922
263 Ga0075428_101094822 3300006844 Bacteria 842
264 Ga0075428_101618997 3300006844 Bacteria 677
265 Ga0075430_100002129 3300006846 Bacteria 16386
266 Ga0075430_100007231 3300006846 Bacteria 9373
267 Ga0075430_100092307 3300006846 Bacteria 2531
268 Ga0075430_100556924 3300006846 Bacteria 946
269 Ga0075430_100705854 3300006846 Bacteria 831
270 Ga0075430_101432881 3300006846 Bacteria 568
271 Ga0075431_100096458 3300006847 Bacteria 3052
272 Ga0075431_100103687 3300006847 Bacteria 2935
273 Ga0075431_100117445 3300006847 Bacteria 2745
274 Ga0075431_100322143 3300006847 Bacteria 1558
275 Ga0075431_101429874 3300006847 Bacteria 651
276 Ga0075431_101810035 3300006847 Bacteria 567
277 Ga0075433_10894261 3300006852 Bacteria 775
278 Ga0075434_100077536 3300006871 Bacteria 3318
279 Ga0075434_100550722 3300006871 Bacteria 1173
280 Ga0075434_101355076 3300006871 Bacteria 722
281 Ga0075429_100050567 3300006880 Bacteria 3616
282 Ga0075429_101380091 3300006880 Bacteria 614
283 Ga0068865_100045446 3300006881 Bacteria 3011
284 Ga0068865_100166543 3300006881 Bacteria 1686
285 Ga0068865_100246228 3300006881 Bacteria 1409
286 Ga0068865_100345012 3300006881 Bacteria 1204
287 Ga0068865_100526150 3300006881 Bacteria 989
288 Ga0068865_100587653 3300006881 Bacteria 939
289 Ga0068865_100682997 3300006881 Bacteria 876
290 Ga0068865_100747312 3300006881 Bacteria 840
291 Ga0068865_102184931 3300006881 Bacteria 504
292 Ga0075436_100642285 3300006914 Bacteria 784
293 Ga0097620_100084532 3300006931 Bacteria 3218
294 Ga0097620_100114589 3300006931 Bacteria 2760
295 Ga0097620_100140051 3300006931 Bacteria 2493
296 Ga0097620_101131521 3300006931 Bacteria 861
297 Ga0075435_100253741 3300007076 Bacteria 1497
298 Ga0075435_101378607 3300007076 Bacteria 618
299 Ga0105240_10016903 3300009093 Bacteria 9860
300 Ga0105240_12199090 3300009093 Bacteria 572
301 Ga0105240_12408405 3300009093 Bacteria 545
302 Ga0111539_10049531 3300009094 Bacteria 5009
303 Ga0111539_10071125 3300009094 Bacteria 4105
304 Ga0111539_10101161 3300009094 Bacteria 3384
305 Ga0111539_10108851 3300009094 Bacteria 3252
306 Ga0111539_11292360 3300009094 Bacteria 847
307 Ga0111539_12002550 3300009094 Bacteria 672
308 Ga0111539_12473750 3300009094 Archaea 602
309 Ga0111539_13423641 3300009094 Bacteria 510
310 Ga0105245_10010141 3300009098 Bacteria 8204
311 Ga0105245_10296953 3300009098 Bacteria 1584
312 Ga0105245_10491897 3300009098 Bacteria 1241
313 Ga0105245_10530787 3300009098 Bacteria 1197
314 Ga0105245_10581858 3300009098 Bacteria 1144
315 Ga0105245_10703888 3300009098 Bacteria 1044
316 Ga0105245_11175682 3300009098 Bacteria 815
317 Ga0105245_11333505 3300009098 Bacteria 767
318 Ga0114129_10056265 3300009147 Bacteria 5510
319 Ga0114129_10171458 3300009147 Bacteria 2958
320 Ga0114129_10661191 3300009147 Bacteria 1347
321 Ga0114129_10973170 3300009147 Bacteria 1070
322 Ga0114129_11489994 3300009147 Bacteria 832
323 Ga0114129_11577321 3300009147 Bacteria 804
324 Ga0114129_12205259 3300009147 Bacteria 663
325 Ga0114129_12222574 3300009147 Bacteria 660
326 Ga0114129_13503518 3300009147 Bacteria 502
327 Ga0105243_10139520 3300009148 Bacteria 2066
328 Ga0105243_10154812 3300009148 Bacteria 1970
329 Ga0105243_10477290 3300009148 Bacteria 1176
330 Ga0105243_10831664 3300009148 Bacteria 913
331 Ga0105243_11430247 3300009148 Unclassified 713
332 Ga0105243_11772142 3300009148 Bacteria 648
333 Ga0105243_12139034 3300009148 Bacteria 596
334 Ga0105243_12200548 3300009148 Unclassified 588
335 Ga0105241_12316456 3300009174 Bacteria 535
336 Ga0105242_10475303 3300009176 Bacteria 1183
337 Ga0105242_10744953 3300009176 Unclassified 964
338 Ga0105242_10783221 3300009176 Bacteria 942
339 Ga0105242_10969181 3300009176 Bacteria 856
340 Ga0105242_11213175 3300009176 Bacteria 774
341 Ga0105248_10454699 3300009177 Bacteria 1443
342 Ga0105248_10696823 3300009177 Bacteria 1146
343 Ga0105248_10999145 3300009177 Bacteria 945
344 Ga0105248_11352278 3300009177 Bacteria 806
345 Ga0105248_11948079 3300009177 Bacteria 667
346 Ga0105237_10553258 3300009545 Bacteria 1157
347 Ga0105238_10004565 3300009551 Bacteria 13702
348 Ga0105238_10314074 3300009551 Bacteria 1552
349 Ga0105238_10453916 3300009551 Bacteria 1279
350 Ga0105238_10525711 3300009551 Bacteria 1186
351 Ga0105238_10742089 3300009551 Bacteria 995
352 Ga0105238_10839387 3300009551 Bacteria 935
353 Ga0105238_11393500 3300009551 Bacteria 728
354 Ga0105238_11607482 3300009551 Bacteria 680
355 Ga0105238_12278149 3300009551 Bacteria 577
356 Ga0105238_12794391 3300009551 Unclassified 525
357 Ga0105249_10359370 3300009553 Bacteria 1477
358 Ga0105249_10420309 3300009553 Bacteria 1370
359 Ga0105249_11434939 3300009553 Bacteria 762
360 Ga0105249_12681104 3300009553 Bacteria 570
361 Ga0105239_10013083 3300010375 Bacteria 9221
362 Ga0105239_10147635 3300010375 Bacteria 2624
363 Ga0105239_10231529 3300010375 Bacteria 2073
364 Ga0105239_10524822 3300010375 Bacteria 1347
365 Ga0105239_11442808 3300010375 Bacteria 795
366 Ga0105246_10011127 3300011119 Bacteria 5575
367 Ga0105246_10943412 3300011119 Bacteria 777
368 Ga0105246_11464593 3300011119 Bacteria 640
369 Ga0105246_11520366 3300011119 Bacteria 629
370 Ga0105246_11593860 3300011119 Bacteria 617
371 Ga0157339_1052436 3300012505 Bacteria 544
372 Ga0157371_10320817 3300013102 Bacteria 1124
373 Ga0157371_10373423 3300013102 Bacteria 1040
374 Ga0157371_10393408 3300013102 Bacteria 1013
375 Ga0157370_10015527 3300013104 Bacteria 7744
376 Ga0157369_10015461 3300013105 Bacteria 8599
377 Ga0157369_10358099 3300013105 Bacteria 1515
378 Ga0157369_10413033 3300013105 Bacteria 1399
379 Ga0157369_10893498 3300013105 Bacteria 911
380 Ga0157374_10036527 3300013296 Bacteria 4501
381 Ga0157378_10147313 3300013297 Bacteria 2191
382 Ga0157378_12109726 3300013297 Unclassified 614
383 Ga0157378_12714263 3300013297 Unclassified 548
384 Ga0163162_10379293 3300013306 Bacteria 1547
385 Ga0157372_10030245 3300013307 Bacteria 5923
386 Ga0157372_10093470 3300013307 Bacteria 3422
387 Ga0157372_10847953 3300013307 Bacteria 1061
388 Ga0157372_11493704 3300013307 Bacteria 778
389 Ga0157375_10126151 3300013308 Bacteria 2674
390 Ga0157375_10727784 3300013308 Bacteria 1145
391 Ga0157375_10893758 3300013308 Bacteria 1033
392 Ga0157375_11015127 3300013308 Bacteria 969
393 Ga0157375_11141521 3300013308 Bacteria 913
394 Ga0157375_11906082 3300013308 Bacteria 705
395 Ga0157375_13011809 3300013308 Bacteria 562
396 Ga0163163_10051838 3300014325 Bacteria 4046
397 Ga0163163_10312817 3300014325 Bacteria 1624
398 Ga0163163_11384889 3300014325 Bacteria 765
399 Ga0163163_11409893 3300014325 Bacteria 758
400 Ga0163163_11475306 3300014325 Bacteria 742
401 Ga0163163_11496423 3300014325 Bacteria 736
402 Ga0163163_11583588 3300014325 Bacteria 716
403 Ga0163163_11593993 3300014325 Bacteria 714
404 Ga0157380_10190434 3300014326 Bacteria 1810
405 Ga0157380_10344823 3300014326 Bacteria 1391
406 Ga0157380_10364467 3300014326 Bacteria 1357
407 Ga0157380_11012868 3300014326 Bacteria 865
408 Ga0157380_11802528 3300014326 Bacteria 671
409 Ga0157380_12035945 3300014326 Bacteria 636
410 Ga0182008_10231321 3300014497 Bacteria 948
411 Ga0182008_10383146 3300014497 Bacteria 752
412 Ga0182008_10413741 3300014497 Unclassified 727
413 Ga0157377_10003737 3300014745 Bacteria 6905
414 Ga0157377_10330608 3300014745 Bacteria 1016
415 Ga0157377_10407594 3300014745 Bacteria 927
416 Ga0157377_10414002 3300014745 Bacteria 921
417 Ga0157379_10677516 3300014968 Bacteria 967
418 Ga0157379_10997880 3300014968 Bacteria 798
419 Ga0157376_10030022 3300014969 Bacteria 4335
420 Ga0157376_10368423 3300014969 Bacteria 1380
421 Ga0157376_11930549 3300014969 Bacteria 628
422 Ga0163161_10837883 3300017792 Bacteria 775
423 Ga0197907_10473012 3300020069 Bacteria 702
424 Ga0206354_10206908 3300020081 Bacteria 2211
425 Ga0206354_11117301 3300020081 Bacteria 515
426 Ga0206353_10452253 3300020082 Bacteria 1657
427 Ga0206353_11318428 3300020082 Bacteria 784
428 Ga0154015_1538802 3300020610 Bacteria 601
429 Ga0213873_10075029 3300021358 Bacteria 938
430 Ga0213874_10027729 3300021377 Bacteria 1613
431 Ga0213874_10038033 3300021377 Unclassified 1427
432 Ga0213874_10041644 3300021377 Bacteria 1376
433 Ga0213874_10383224 3300021377 Bacteria 544
434 Ga0213876_10011152 3300021384 Bacteria 4806
435 Ga0213876_10033411 3300021384 Bacteria 2713
436 Ga0213876_10038526 3300021384 Bacteria 2523
437 Ga0213876_10055739 3300021384 Bacteria 2087
438 Ga0213876_10071496 3300021384 Bacteria 1832
439 Ga0213876_10241891 3300021384 Bacteria 959
440 Ga0213876_10437910 3300021384 Unclassified 695
441 Ga0213875_10011062 3300021388 Bacteria 4503
442 Ga0213875_10090116 3300021388 Bacteria 1430
443 Ga0213875_10114793 3300021388 Bacteria 1258
444 Ga0213875_10313815 3300021388 Bacteria 743
445 Ga0213875_10395228 3300021388 Bacteria 659
446 Ga0213871_10015760 3300021441 Bacteria 1812
447 Ga0224712_10064589 3300022467 Bacteria 1468
448 Ga0224712_10282483 3300022467 Bacteria 773
449 Ga0224712_10319831 3300022467 Bacteria 729
450 Ga0207426_1040103 3300025302 Bacteria 1461
451 Ga0207692_10000005 3300025898 Bacteria 370169
452 Ga0207642_10127250 3300025899 Bacteria 1324
453 Ga0207642_10677234 3300025899 Bacteria 648
454 Ga0207688_10003829 3300025901 Bacteria 8210
455 Ga0207688_10046046 3300025901 Bacteria 2435
456 Ga0207688_10183522 3300025901 Bacteria 1249
457 Ga0207688_10667560 3300025901 Unclassified 657
458 Ga0207680_10183634 3300025903 Bacteria 1416
459 Ga0207680_10783513 3300025903 Bacteria 684
460 Ga0207647_10094864 3300025904 Bacteria 1777
461 Ga0207699_10057245 3300025906 Bacteria 2327
462 Ga0207645_10106839 3300025907 Bacteria 1810
463 Ga0207645_10794354 3300025907 Bacteria 643
464 Ga0207643_10030011 3300025908 Bacteria 3025
465 Ga0207643_10802099 3300025908 Bacteria 610
466 Ga0207705_10072299 3300025909 Bacteria 2501
467 Ga0207705_11380766 3300025909 Bacteria 536
468 Ga0207705_11391015 3300025909 Bacteria 534
469 Ga0207707_10025333 3300025912 Bacteria 5189
470 Ga0207707_10386936 3300025912 Bacteria 1202
471 Ga0207707_11043035 3300025912 Bacteria 669
472 Ga0207695_10023649 3300025913 Bacteria 6934
473 Ga0207695_10288200 3300025913 Bacteria 1534
474 Ga0207693_10000009 3300025915 Bacteria 168990
475 Ga0207693_10053117 3300025915 Bacteria 3179
476 Ga0207663_10298282 3300025916 Bacteria 1203
477 Ga0207660_10066549 3300025917 Bacteria 2607
478 Ga0207660_10422317 3300025917 Bacteria 1076
479 Ga0207660_11072817 3300025917 Bacteria 656
480 Ga0207662_10099955 3300025918 Bacteria 1796
481 Ga0207662_10130707 3300025918 Bacteria 1583
482 Ga0207662_10165826 3300025918 Bacteria 1414
483 Ga0207657_10004005 3300025919 Bacteria 15662
484 Ga0207657_10036782 3300025919 Bacteria 4380
485 Ga0207657_10054538 3300025919 Bacteria 3456
486 Ga0207657_10249886 3300025919 Bacteria 1414
487 Ga0207649_10157233 3300025920 Bacteria 1572
488 Ga0207649_10171862 3300025920 Bacteria 1510
489 Ga0207649_10342843 3300025920 Bacteria 1104
490 Ga0207649_10762350 3300025920 Bacteria 753
491 Ga0207652_10010707 3300025921 Bacteria 7383
492 Ga0207681_10000842 3300025923 Bacteria 20240
493 Ga0207681_10046791 3300025923 Bacteria 2911
494 Ga0207681_10745143 3300025923 Bacteria 816
495 Ga0207650_10519986 3300025925 Bacteria 996
496 Ga0207650_11376744 3300025925 Bacteria 600
497 Ga0207659_10584440 3300025926 Bacteria 951
498 Ga0207687_10014755 3300025927 Bacteria 5116
499 Ga0207687_10109261 3300025927 Bacteria 2049
500 Ga0207687_10421997 3300025927 Bacteria 1101
501 Ga0207687_10867903 3300025927 Bacteria 771
502 Ga0207687_11064065 3300025927 Bacteria 694
503 Ga0207700_10496315 3300025928 Bacteria 1080
504 Ga0207664_10000060 3300025929 Bacteria 116764
505 Ga0207664_10188242 3300025929 Bacteria 1776
506 Ga0207664_10278231 3300025929 Bacteria 1468
507 Ga0207664_10318717 3300025929 Bacteria 1371
508 Ga0207664_11047159 3300025929 Unclassified 730
509 Ga0207664_11817532 3300025929 Bacteria 532
510 Ga0207690_10000117 3300025932 Bacteria 65570
511 Ga0207690_10012040 3300025932 Bacteria 5172
512 Ga0207690_10049659 3300025932 Bacteria 2798
513 Ga0207690_10714702 3300025932 Bacteria 824
514 Ga0207690_10893670 3300025932 Bacteria 737
515 Ga0207690_11208100 3300025932 Bacteria 631
516 Ga0207706_10383659 3300025933 Bacteria 1219
517 Ga0207706_10440371 3300025933 Bacteria 1128
518 Ga0207686_10575558 3300025934 Bacteria 883
519 Ga0207709_10029323 3300025935 Bacteria 3190
520 Ga0207709_10232649 3300025935 Bacteria 1336
521 Ga0207709_10622508 3300025935 Bacteria 857
522 Ga0207709_10703700 3300025935 Bacteria 809
523 Ga0207709_11111094 3300025935 Bacteria 649
524 Ga0207669_10041575 3300025937 Bacteria 2677
525 Ga0207669_10266074 3300025937 Bacteria 1285
526 Ga0207669_10308807 3300025937 Bacteria 1205
527 Ga0207669_10383489 3300025937 Bacteria 1096
528 Ga0207704_10660470 3300025938 Bacteria 862
529 Ga0207704_10739519 3300025938 Bacteria 817
530 Ga0207704_10780262 3300025938 Bacteria 797
531 Ga0207665_10428987 3300025939 Bacteria 1011
532 Ga0207665_10684908 3300025939 Bacteria 805
533 Ga0207691_10178584 3300025940 Bacteria 1856
534 Ga0207691_10181032 3300025940 Bacteria 1842
535 Ga0207691_10225485 3300025940 Bacteria 1624
536 Ga0207691_10446998 3300025940 Bacteria 1100
537 Ga0207711_10790725 3300025941 Bacteria 884
538 Ga0207711_11319469 3300025941 Bacteria 664
539 Ga0207711_11371111 3300025941 Bacteria 649
540 Ga0207661_10006238 3300025944 Bacteria 8434
541 Ga0207661_10047165 3300025944 Bacteria 3419
542 Ga0207661_10058321 3300025944 Bacteria 3106
543 Ga0207661_10117253 3300025944 Bacteria 2261
544 Ga0207661_10152479 3300025944 Bacteria 1998
545 Ga0207661_10177782 3300025944 Bacteria 1857
546 Ga0207661_10242892 3300025944 Bacteria 1598
547 Ga0207661_10465448 3300025944 Bacteria 1153
548 Ga0207661_10560975 3300025944 Bacteria 1047
549 Ga0207661_10854601 3300025944 Bacteria 838
550 Ga0207679_10220257 3300025945 Bacteria 1596
551 Ga0207679_10260623 3300025945 Bacteria 1478
552 Ga0207679_10338246 3300025945 Bacteria 1308
553 Ga0207679_11674998 3300025945 Unclassified 582
554 Ga0207651_10044941 3300025960 Bacteria 2960
555 Ga0207712_10429568 3300025961 Bacteria 1116
556 Ga0207712_10456486 3300025961 Bacteria 1085
557 Ga0207712_10460000 3300025961 Bacteria 1081
558 Ga0207712_10706015 3300025961 Bacteria 881
559 Ga0207712_11284097 3300025961 Bacteria 654
560 Ga0207668_10383025 3300025972 Bacteria 1184
561 Ga0207640_10034311 3300025981 Bacteria 3166
562 Ga0207640_10150101 3300025981 Bacteria 1711
563 Ga0207640_10217518 3300025981 Bacteria 1460
564 Ga0207640_10286387 3300025981 Bacteria 1297
565 Ga0207640_10729298 3300025981 Bacteria 852
566 Ga0207677_10018542 3300026023 Bacteria 4179
567 Ga0207677_10227348 3300026023 Bacteria 1500
568 Ga0207677_10293776 3300026023 Bacteria 1340
569 Ga0207677_10590949 3300026023 Bacteria 973
570 Ga0207677_10858574 3300026023 Bacteria 816
571 Ga0207677_11442733 3300026023 Bacteria 635
572 Ga0207703_10341495 3300026035 Bacteria 1376
573 Ga0207703_10713016 3300026035 Bacteria 954
574 Ga0207639_10253122 3300026041 Bacteria 1537
575 Ga0207678_10058339 3300026067 Bacteria 3321
576 Ga0207678_10083252 3300026067 Bacteria 2736
577 Ga0207678_10240467 3300026067 Bacteria 1551
578 Ga0207678_10646927 3300026067 Bacteria 929
579 Ga0207678_10928031 3300026067 Unclassified 770
580 Ga0207708_10000504 3300026075 Bacteria 30056
581 Ga0207708_10015048 3300026075 Bacteria 5798
582 Ga0207708_10354722 3300026075 Bacteria 1204
583 Ga0207708_10372294 3300026075 Bacteria 1176
584 Ga0207708_10649074 3300026075 Bacteria 898
585 Ga0207708_11071709 3300026075 Bacteria 702
586 Ga0207708_11171772 3300026075 Bacteria 671
587 Ga0207702_10038108 3300026078 Bacteria 4026
588 Ga0207702_10188237 3300026078 Bacteria 1905
589 Ga0207702_10753456 3300026078 Bacteria 961
590 Ga0207702_11489325 3300026078 Bacteria 670
591 Ga0207641_11014696 3300026088 Unclassified 827
592 Ga0207648_10030285 3300026089 Bacteria 4793
593 Ga0207648_10288256 3300026089 Bacteria 1469
594 Ga0207648_10514494 3300026089 Bacteria 1096
595 Ga0207648_11133347 3300026089 Bacteria 734
596 Ga0207648_12235654 3300026089 Bacteria 507
597 Ga0207676_10249333 3300026095 Bacteria 1597
598 Ga0207676_10283590 3300026095 Bacteria 1505
599 Ga0207676_10595342 3300026095 Bacteria 1061
600 Ga0207676_10828493 3300026095 Bacteria 904
601 Ga0207674_10052366 3300026116 Bacteria 4163
602 Ga0207674_10258267 3300026116 Bacteria 1689
603 Ga0207674_10580589 3300026116 Bacteria 1083
604 Ga0207674_10937258 3300026116 Bacteria 834
605 Ga0207675_100129854 3300026118 Bacteria 2389
606 Ga0207675_100170004 3300026118 Bacteria 2083
607 Ga0207675_100261448 3300026118 Bacteria 1677
608 Ga0207683_10017272 3300026121 Bacteria 6147
609 Ga0207698_10012232 3300026142 Bacteria 5606
610 Ga0207698_10049753 3300026142 Bacteria 3192
611 Ga0207698_10128352 3300026142 Bacteria 2162
612 Ga0207698_10543047 3300026142 Bacteria 1138
613 Ga0207698_10640027 3300026142 Bacteria 1052
614 Ga0207698_10686197 3300026142 Bacteria 1018
615 Ga0207698_10953744 3300026142 Bacteria 867
616 Ga0207698_11387147 3300026142 Bacteria 718
617 Ga0207698_11455637 3300026142 Unclassified 700
618 Ga0207698_11513329 3300026142 Bacteria 686
619 Ga0207428_10116975 3300027907 Bacteria 2047
620 Ga0207428_10200568 3300027907 Bacteria 1501
621 Ga0207428_10313673 3300027907 Bacteria 1159
622 Ga0268266_10002835 3300028379 Bacteria 18066
623 Ga0268266_10069326 3300028379 Bacteria 3055
624 Ga0268266_10441037 3300028379 Bacteria 1237
625 Ga0268266_10568841 3300028379 Bacteria 1087
626 Ga0268265_11503773 3300028380 Bacteria 677
627 Ga0268264_10675963 3300028381 Bacteria 1024
628 Ga0268264_10949626 3300028381 Bacteria 865
629 Ga0268264_12693824 3300028381 Bacteria 501
630 Ga0265326_10000024 3300028558 Bacteria 112928
631 Ga0265319_1002433 3300028563 Bacteria 10178
632 Ga0265334_10000078 3300028573 Bacteria 70145
633 Ga0265338_10011681 3300028800 Bacteria 10112
634 Ga0265324_10009205 3300029957 Bacteria 3868
635 Ga0265320_10046594 3300031240 Bacteria 2124
636 Ga0307408_100100351 3300031548 Bacteria 2204
637 Ga0307408_100538147 3300031548 Bacteria 1029
638 Ga0307408_100553966 3300031548 Bacteria 1015
639 Ga0307408_100941048 3300031548 Unclassified 793
640 Ga0307405_10015925 3300031731 Bacteria 4086
641 Ga0307405_10143255 3300031731 Bacteria 1670
642 Ga0307405_10199864 3300031731 Bacteria 1451
643 Ga0307405_10381189 3300031731 Bacteria 1098
644 Ga0307405_10431197 3300031731 Bacteria 1040
645 Ga0307405_11052807 3300031731 Bacteria 697
646 Ga0307405_11172605 3300031731 Bacteria 663
647 Ga0307413_10095978 3300031824 Bacteria 1945
648 Ga0307413_10168367 3300031824 Bacteria 1548
649 Ga0307413_10198257 3300031824 Bacteria 1447
650 Ga0307413_10428271 3300031824 Bacteria 1044
651 Ga0307413_10685547 3300031824 Bacteria 849
652 Ga0307413_10896153 3300031824 Bacteria 753
653 Ga0307413_11049246 3300031824 Bacteria 701
654 Ga0307413_12016803 3300031824 Bacteria 520
655 Ga0307410_10074870 3300031852 Bacteria 2359
656 Ga0307410_10088184 3300031852 Bacteria 2196
657 Ga0307410_10112356 3300031852 Bacteria 1973
658 Ga0307410_10142476 3300031852 Bacteria 1775
659 Ga0307410_10227872 3300031852 Bacteria 1437
660 Ga0307410_10258862 3300031852 Bacteria 1356
661 Ga0307410_10292669 3300031852 Bacteria 1282
662 Ga0307410_10366678 3300031852 Bacteria 1155
663 Ga0307410_10465748 3300031852 Bacteria 1034
664 Ga0307410_10512716 3300031852 Bacteria 988
665 Ga0307410_11361494 3300031852 Bacteria 622
666 Ga0307406_10115157 3300031901 Bacteria 1858
667 Ga0307406_10156301 3300031901 Bacteria 1633
668 Ga0307406_10161430 3300031901 Bacteria 1611
669 Ga0307406_10169877 3300031901 Bacteria 1577
670 Ga0307406_10237411 3300031901 Bacteria 1365
671 Ga0307406_10648832 3300031901 Bacteria 876
672 Ga0307406_10722333 3300031901 Bacteria 834
673 Ga0307406_10797158 3300031901 Bacteria 797
674 Ga0307406_10880445 3300031901 Bacteria 761
675 Ga0307407_10019780 3300031903 Bacteria 3435
676 Ga0307407_10068488 3300031903 Bacteria 2102
677 Ga0307407_10252382 3300031903 Bacteria 1209
678 Ga0307407_10252738 3300031903 Bacteria 1208
679 Ga0307407_10609078 3300031903 Bacteria 814
680 Ga0307407_10756182 3300031903 Unclassified 736
681 Ga0307407_10773788 3300031903 Bacteria 728
682 Ga0307407_11022688 3300031903 Bacteria 639
683 Ga0307407_11339083 3300031903 Bacteria 563
684 Ga0307412_10050572 3300031911 Bacteria 2743
685 Ga0307412_10625447 3300031911 Bacteria 915
686 Ga0307412_10725396 3300031911 Bacteria 856
687 Ga0307412_11022557 3300031911 Bacteria 731
688 Ga0307409_100008537 3300031995 Bacteria 6227
689 Ga0307409_100054314 3300031995 Bacteria 3084
690 Ga0307409_100066590 3300031995 Bacteria 2841
691 Ga0307409_100071536 3300031995 Bacteria 2758
692 Ga0307409_100081803 3300031995 Bacteria 2612
693 Ga0307409_100116530 3300031995 Bacteria 2252
694 Ga0307409_100326935 3300031995 Bacteria 1437
695 Ga0307409_100759273 3300031995 Bacteria 974
696 Ga0307409_100825580 3300031995 Bacteria 936
697 Ga0307409_100887525 3300031995 Bacteria 904
698 Ga0307409_101250191 3300031995 Bacteria 767
699 Ga0307409_101507459 3300031995 Bacteria 700
700 Ga0307409_102556182 3300031995 Bacteria 539
701 Ga0307416_100010493 3300032002 Bacteria 6121
702 Ga0307416_100015350 3300032002 Bacteria 5288
703 Ga0307416_100021545 3300032002 Bacteria 4630
704 Ga0307416_100038659 3300032002 Bacteria 3684
705 Ga0307416_100090239 3300032002 Bacteria 2627
706 Ga0307416_100093265 3300032002 Bacteria 2593
707 Ga0307416_100178288 3300032002 Bacteria 1988
708 Ga0307416_100222554 3300032002 Bacteria 1811
709 Ga0307416_100294345 3300032002 Unclassified 1609
710 Ga0307416_100405553 3300032002 Bacteria 1402
711 Ga0307416_100527577 3300032002 Bacteria 1250
712 Ga0307416_100690199 3300032002 Bacteria 1109
713 Ga0307416_100732474 3300032002 Bacteria 1080
714 Ga0307416_101462869 3300032002 Bacteria 789
715 Ga0307416_101612534 3300032002 Bacteria 754
716 Ga0307416_102206737 3300032002 Bacteria 652
717 Ga0307416_102749736 3300032002 Bacteria 588
718 Ga0307414_10285492 3300032004 Bacteria 1389
719 Ga0307414_10288656 3300032004 Bacteria 1382
720 Ga0307414_11020275 3300032004 Bacteria 762
721 Ga0307414_11051822 3300032004 Bacteria 750
722 Ga0307414_11181730 3300032004 Bacteria 708
723 Ga0307411_10049870 3300032005 Bacteria 2723
724 Ga0307411_10544216 3300032005 Bacteria 989
725 Ga0307411_11272551 3300032005 Bacteria 669
726 Ga0307411_11522553 3300032005 Bacteria 615
727 Ga0307415_100000270 3300032126 Bacteria 22363
728 Ga0307415_100010952 3300032126 Bacteria 5162
729 Ga0307415_100043520 3300032126 Bacteria 2996
730 Ga0307415_100355350 3300032126 Unclassified 1235
731 Ga0307415_100427039 3300032126 Bacteria 1139
732 Ga0307415_100558181 3300032126 Bacteria 1012
733 Ga0307415_100591469 3300032126 Bacteria 986
734 Ga0307415_100719769 3300032126 Bacteria 903
735 Ga0307415_100928294 3300032126 Bacteria 804
736 Ga0307415_101074890 3300032126 Bacteria 752
737 Ga0307415_101455759 3300032126 Bacteria 654
738 Ga0373939_0240489 3300035114 Bacteria 701
739 Ga0373956_0402941 3300035119 Bacteria 653
740 Ga0373931_0185599 3300035691 Bacteria 1234
741 Ga0395900_0056497 3300037418 Bacteria 4040
742 Ga0395900_0215606 3300037418 Bacteria 1937
743 Ga0395900_0398612 3300037418 Bacteria 1341
744 Ga0395900_0522055 3300037418 Bacteria 1135
745 Ga0395900_0723636 3300037418 Bacteria 927
746 Ga0395900_0847330 3300037418 Bacteria 840
747 Ga0395900_0849176 3300037418 Bacteria 839
748 Ga0395900_1762725 3300037418 Bacteria 530
749 Ga0395900_1844523 3300037418 Bacteria 515
750 Ga0395898_0013113 3300037466 Bacteria 8546
751 Ga0395898_0060062 3300037466 Bacteria 3696
752 Ga0395898_0270651 3300037466 Bacteria 1620
753 Ga0395898_0314086 3300037466 Bacteria 1495
754 Ga0395898_0319916 3300037466 Bacteria 1480
755 Ga0395898_0536122 3300037466 Bacteria 1112
756 Ga0395898_0540769 3300037466 Bacteria 1107
757 Ga0395898_0641143 3300037466 Bacteria 1005
758 Ga0395898_0904171 3300037466 Bacteria 821
759 Ga0395898_1021125 3300037466 Bacteria 762
760 Ga0395898_1044852 3300037466 Bacteria 752
761 Ga0395898_1581135 3300037466 Bacteria 580
762 Ga0395905_0254745 3300037471 Bacteria 1639
763 Ga0395905_0360877 3300037471 Bacteria 1346
764 Ga0395905_0401469 3300037471 Bacteria 1266
765 Ga0395905_1093901 3300037471 Bacteria 700
766 Ga0395905_1593983 3300037471 Bacteria 558
767 Ga0436364_0004833 3300037853 Bacteria 1212
768 Ga0436364_0034912 3300037853 Bacteria 9009
769 Ga0436364_0176805 3300037853 Bacteria 8838
770 Ga0436364_0362965 3300037853 Bacteria 3897
771 Ga0436364_0618250 3300037853 Bacteria 3769
772 Ga0436364_0623278 3300037853 Unclassified 534
773 Ga0436364_0770501 3300037853 Bacteria 1932
774 Ga0436364_0858177 3300037853 Bacteria 1453
775 Ga0436364_0874633 3300037853 Bacteria 1345
776 Ga0436364_1096338 3300037853 Unclassified 791
777 Ga0436364_1105959 3300037853 Bacteria 5672
778 Ga0436364_1277692 3300037853 Bacteria 504
779 Ga0436364_1551956 3300037853 Bacteria 880
780 Ga0436364_1562180 3300037853 Bacteria 2161
781 Ga0395901_0000710 3300038443 Bacteria 38071
782 Ga0395901_0047839 3300038443 Bacteria 4441
783 Ga0395901_0306132 3300038443 Bacteria 1647
784 Ga0395901_0312434 3300038443 Bacteria 1627
785 Ga0395901_0330672 3300038443 Bacteria 1575
786 Ga0395901_0516599 3300038443 Bacteria 1214
787 Ga0436365_0107102 3300039437 Bacteria 11577
788 Ga0436365_0156161 3300039437 Bacteria 5478
789 Ga0436365_0202207 3300039437 Bacteria 8785
790 Ga0436365_0746115 3300039437 Bacteria 1351
791 Ga0436365_0818994 3300039437 Bacteria 7213
792 Ga0436365_0971428 3300039437 Bacteria 3434
793 Ga0436365_0978996 3300039437 Bacteria 2261
794 Ga0436365_1351567 3300039437 Bacteria 2034
795 Ga0436365_1541488 3300039437 Bacteria 2985
796 Ga0436365_1887722 3300039437 Bacteria 991
797 Ga0436360_0215321 3300039438 Unclassified 630
798 Ga0436360_0607721 3300039438 Bacteria 3448
799 Ga0436360_1130529 3300039438 Bacteria 1263
800 Ga0436363_0138138 3300039450 Bacteria 531
801 Ga0436363_0247128 3300039450 Bacteria 1497
802 Ga0436363_0390027 3300039450 Bacteria 1888
803 Ga0436363_0494613 3300039450 Unclassified 635
804 Ga0436363_0605155 3300039450 Bacteria 4976
805 Ga0436363_0675171 3300039450 Bacteria 25439
806 Ga0436363_0715098 3300039450 Bacteria 1681
807 Ga0436363_0720254 3300039450 Bacteria 1743
808 Ga0436363_0795428 3300039450 Bacteria 1763
809 Ga0436363_0951790 3300039450 Bacteria 1320
810 Ga0436363_1040091 3300039450 Unclassified 554
811 Ga0436363_1154196 3300039450 Bacteria 6116
812 Ga0436363_1303994 3300039450 Bacteria 568
813 Ga0436363_1339470 3300039450 Bacteria 1369
814 Ga0436363_1441094 3300039450 Bacteria 1122
815 Ga0436363_1720810 3300039450 Bacteria 2695
816 Ga0436362_0112120 3300039453 Bacteria 3157
817 Ga0436362_0322118 3300039453 Bacteria 649
818 Ga0436362_0511003 3300039453 Bacteria 1852
819 Ga0436362_0736330 3300039453 Unclassified 776
820 Ga0436362_0992033 3300039453 Bacteria 2814
821 Ga0451791_0546527 3300041451 Bacteria 1369
822 Ga0451793_0050141 3300041452 Bacteria 952
823 Ga0451797_1414214 3300041453 Bacteria 1401
824 Ga0451804_0879486 3300041463 Unclassified 738
825 Ga0451807_1208132 3300041486 Bacteria 1012
826 Ga0451807_1766298 3300041486 Bacteria 537
827 Ga0451837_0425334 3300041494 Bacteria 838
828 Ga0451841_0077213 3300041498 Bacteria 687
829 Ga0451855_1358094 3300041511 Bacteria 518
830 Ga0451853_2611373 3300041512 Bacteria 1304
831 Ga0439443_056886 3300042003 Bacteria 694
832 Ga0439450_027123 3300042008 Bacteria 1267
833 Ga0439463_018553 3300042016 Bacteria 1732
834 Ga0439463_085975 3300042016 Bacteria 809
835 Ga0450914_026122 3300042118 Bacteria 680
836 Ga0450888_037860 3300042126 Bacteria 664
837 Ga0450902_068813 3300042137 Bacteria 616
838 Ga0450905_004208 3300042142 Bacteria 1900
839 Ga0439435_0097423 3300042436 Bacteria 900
840 Ga0439444_0019074 3300042437 Bacteria 1193
841 Ga0439444_0080024 3300042437 Bacteria 714
842 Ga0439459_0005987 3300042438 Bacteria 2016
843 Ga0439464_0026297 3300042439 Bacteria 1614
844 Ga0466969_0116667 3300044656 Bacteria 1245
845 Ga0466972_0306560 3300044658 Bacteria 742
846 Ga0466972_0378525 3300044658 Bacteria 663
847 Ga0466965_0040897 3300044683 Bacteria 2283
848 Ga0466965_0172548 3300044683 Bacteria 1138
849 Ga0466965_0405284 3300044683 Bacteria 754
850 Ga0466966_0040682 3300044684 Bacteria 2991
851 Ga0466966_0316202 3300044684 Bacteria 938
852 Ga0466966_0742985 3300044684 Bacteria 591
853 Ga0466961_0046180 3300044693 Bacteria 2786
854 Ga0466961_0257037 3300044693 Bacteria 1072
855 Ga0466963_0000719 3300044694 Bacteria 16195
856 Ga0466963_0002732 3300044694 Bacteria 9958
857 Ga0466963_0004857 3300044694 Bacteria 7830
858 Ga0466963_0021568 3300044694 Bacteria 4066
859 Ga0466963_0042028 3300044694 Bacteria 3000
860 Ga0466963_0084764 3300044694 Bacteria 2150
861 Ga0466963_0116630 3300044694 Bacteria 1835
862 Ga0466963_0132117 3300044694 Bacteria 1725
863 Ga0466963_1160138 3300044694 Bacteria 543
864 Ga0466964_0696204 3300044706 Bacteria 566
865 Ga0466971_0044510 3300044719 Bacteria 1993
866 Ga0466971_0116326 3300044719 Bacteria 1236
867 Ga0466971_0657965 3300044719 Bacteria 525
868 Ga0466968_0007527 3300044735 Bacteria 4145
869 Ga0466968_0046987 3300044735 Bacteria 1835
870 Ga0466968_0092655 3300044735 Bacteria 1341
871 Ga0466968_0103172 3300044735 Unclassified 1275
872 Ga0466968_0116729 3300044735 Bacteria 1205
873 Ga0466968_0175033 3300044735 Bacteria 996
874 Ga0466968_0200147 3300044735 Bacteria 935
875 Ga0466968_0283751 3300044735 Bacteria 793
876 Ga0466968_0630579 3300044735 Bacteria 543
877 Ga0466970_0059077 3300044765 Bacteria 2054
878 Ga0466970_0102444 3300044765 Bacteria 1560
879 Ga0466970_0253573 3300044765 Bacteria 986
880 Ga0466970_0285154 3300044765 Bacteria 929
881 Ga0466970_0680925 3300044765 Bacteria 599
882 Ga0466957_0019541 3300044842 Bacteria 3984
883 Ga0466957_0100081 3300044842 Bacteria 1826
884 Ga0466957_0120226 3300044842 Bacteria 1674
885 Ga0466957_0294371 3300044842 Bacteria 1089
886 Ga0466957_0393551 3300044842 Unclassified 947
887 Ga0466960_0000213 3300044901 Bacteria 19969
888 Ga0466960_0145077 3300044901 Bacteria 1264
889 Ga0466960_0285535 3300044901 Bacteria 926
890 Ga0466960_0505971 3300044901 Bacteria 708
891 Ga0466960_0617000 3300044901 Unclassified 645
892 Ga0466960_0721045 3300044901 Bacteria 599
893 Ga0466960_0820468 3300044901 Bacteria 564
894 Ga0466960_0928918 3300044901 Bacteria 532
895 Ga0466959_0011769 3300045049 Bacteria 6298
896 Ga0466959_0111552 3300045049 Bacteria 1951
897 Ga0466959_0133337 3300045049 Bacteria 1759
898 Ga0466959_0253925 3300045049 Bacteria 1212
899 Ga0466959_0257734 3300045049 Bacteria 1201
900 Ga0466959_0275738 3300045049 Bacteria 1155
901 Ga0466959_0291655 3300045049 Bacteria 1118
902 Ga0466959_0693210 3300045049 Bacteria 683
903 Ga0466958_0000670 3300045836 Bacteria 14818
904 Ga0466958_0009159 3300045836 Bacteria 5504
905 Ga0466958_0047094 3300045836 Bacteria 2603
906 Ga0466958_0093935 3300045836 Bacteria 1858
907 Ga0466958_0107606 3300045836 Bacteria 1739
908 Ga0466958_0204335 3300045836 Bacteria 1257
909 Ga0466958_0204513 3300045836 Bacteria 1257
910 Ga0466958_0260538 3300045836 Bacteria 1110
911 Ga0466958_0337781 3300045836 Bacteria 969
912 Ga0466958_0730907 3300045836 Unclassified 645
913 Ga0466958_0791623 3300045836 Bacteria 618
914 Ga0466967_0006662 3300045976 Bacteria 8213
915 Ga0466967_0021890 3300045976 Bacteria 5203
916 Ga0466967_0035716 3300045976 Bacteria 4234
917 Ga0466967_0077437 3300045976 Bacteria 2994
918 Ga0466967_0109780 3300045976 Bacteria 2533
919 Ga0466967_0211276 3300045976 Bacteria 1840
920 Ga0466967_0415651 3300045976 Bacteria 1310
921 Ga0466967_0418622 3300045976 Bacteria 1305
922 Ga0466967_0558642 3300045976 Bacteria 1127
923 Ga0466967_0561062 3300045976 Bacteria 1124
924 Ga0466967_0714330 3300045976 Unclassified 993
925 Ga0466967_0734792 3300045976 Bacteria 978
926 Ga0466967_0945261 3300045976 Bacteria 858
927 Ga0466967_0954268 3300045976 Bacteria 853
928 Ga0466967_1089489 3300045976 Bacteria 796
929 Ga0466967_1223594 3300045976 Unclassified 748
930 Ga0466967_1317283 3300045976 Unclassified 719
931 Ga0466967_1449726 3300045976 Bacteria 684
932 Ga0466967_1588489 3300045976 Bacteria 651
933 Ga0466967_1829685 3300045976 Bacteria 604
934 Ga0495603_0770853 3300046455 Bacteria 549
935 Ga0495629_0733573 3300046459 Bacteria 655
936 Ga0495651_0818943 3300046462 Archaea 573
937 Ga0495650_0000055 3300046471 Bacteria 308438
938 Ga0495582_0237778 3300046473 Bacteria 1044
939 Ga0495582_0877234 3300046473 Unclassified 519
940 Ga0495639_0269178 3300046475 Bacteria 845
941 Ga0495664_0221690 3300046477 Bacteria 1145
942 Ga0495584_0236490 3300046491 Bacteria 929
943 Ga0495584_0482943 3300046491 Bacteria 631
944 Ga0495585_0249685 3300046492 Bacteria 886
945 Ga0495596_0093661 3300046500 Bacteria 1166
946 Ga0495608_0178117 3300046511 Bacteria 1346
947 Ga0495616_0254248 3300046513 Unclassified 754
948 Ga0495616_0322874 3300046513 Bacteria 648
949 Ga0495620_0398247 3300046515 Unclassified 521
950 Ga0495643_0327705 3300046522 Unclassified 691
951 Ga0495643_0358840 3300046522 Bacteria 651
952 Ga0495644_0179083 3300046523 Bacteria 815
953 Ga0495663_0066282 3300046525 Bacteria 1143
954 Ga0495663_0212488 3300046525 Bacteria 678
955 Ga0495652_0569606 3300046529 Bacteria 776
956 Ga0495586_0178729 3300046535 Bacteria 1200
957 Ga0495667_0332587 3300046559 Bacteria 961
958 Ga0495656_0660619 3300046615 Bacteria 561
959 Ga0495611_0059448 3300046648 Bacteria 1735
960 Ga0495611_0473746 3300046648 Unclassified 570
961 Ga0495661_0146940 3300046665 Bacteria 1277
962 Ga0495661_0517269 3300046665 Bacteria 568
963 Ga0495657_0054434 3300046675 Bacteria 2673
964 Ga0495657_0436274 3300046675 Bacteria 768
965 Ga0495623_0549572 3300046679 Bacteria 605
966 Ga0495646_0581624 3300046680 Bacteria 570
967 Ga0495613_0319774 3300046689 Bacteria 1071
968 Ga0495589_0356467 3300046794 Bacteria 673
969 Ga0495600_0004959 3300046809 Bacteria 7993
970 Ga0495604_0407448 3300047317 Bacteria 894
971 Ga0495672_0004233 3300047320 Bacteria 11852
972 Ga0495672_0320297 3300047320 Bacteria 728
973 Ga0495680_0810587 3300047322 Bacteria 611
974 Ga0495677_0382129 3300047445 Unclassified 557
975 Ga0495684_0214701 3300047471 Bacteria 1413
976 Ga0495684_1090262 3300047471 Bacteria 501
977 Ga0495593_0420058 3300047673 Bacteria 669
978 Ga0495602_0584238 3300048088 Bacteria 770
979 Ga0496100_0064551 3300048903 Bacteria 2423
980 Ga0496100_0277635 3300048903 Bacteria 1248
981 Ga0496101_0023275 3300048904 Bacteria 4278
982 Ga0496101_0224586 3300048904 Bacteria 1458
983 Ga0496101_0297534 3300048904 Bacteria 1264
984 Ga0496101_1126087 3300048904 Bacteria 616
985 Ga0496102_0006596 3300048905 Bacteria 9914
986 Ga0496102_0068133 3300048905 Bacteria 3265
987 Ga0496102_0385772 3300048905 Unclassified 1318
988 Ga0496103_0262702 3300048906 Bacteria 1111
989 Ga0496104_0004544 3300048907 Bacteria 12087
990 Ga0496104_0073904 3300048907 Bacteria 3244
991 Ga0496104_0541251 3300048907 Bacteria 1075
992 Ga0496104_1132390 3300048907 Bacteria 686
993 Ga0496105_0001407 3300048908 Bacteria 16892
994 Ga0496105_0278512 3300048908 Bacteria 1349
995 Ga0496105_0466659 3300048908 Bacteria 995
996 Ga0496105_0873748 3300048908 Bacteria 679
997 Ga0496106_0015850 3300048909 Bacteria 5574
998 Ga0496106_0112396 3300048909 Bacteria 2122
999 Ga0496107_0095717 3300048910 Bacteria 2172
1000 Ga0496108_0032003 3300048911 Bacteria 4366
1001 Ga0496108_0082647 3300048911 Bacteria 2724
1002 Ga0496108_0112393 3300048911 Bacteria 2330
1003 Ga0496108_0420752 3300048911 Bacteria 1167
1004 Ga0496108_0783126 3300048911 Bacteria 823
1005 Ga0496108_1399272 3300048911 Bacteria 585
1006 Ga0496109_0005281 3300048912 Bacteria 10793
1007 Ga0496109_0022582 3300048912 Bacteria 5574
1008 Ga0496109_0173243 3300048912 Bacteria 2025
1009 Ga0496109_0245480 3300048912 Unclassified 1686
1010 Ga0496109_0328026 3300048912 Bacteria 1445
1011 Ga0496109_0445024 3300048912 Bacteria 1224
1012 Ga0496109_0742477 3300048912 Bacteria 919
1013 Ga0496109_0767304 3300048912 Bacteria 902
1014 Ga0496109_0895694 3300048912 Bacteria 825
1015 Ga0496110_0046036 3300048913 Bacteria 3815
1016 Ga0496110_0360550 3300048913 Bacteria 1324
1017 Ga0496110_0427034 3300048913 Bacteria 1208
1018 Ga0496110_0579542 3300048913 Bacteria 1019
1019 Ga0496110_0608401 3300048913 Bacteria 991
1020 Ga0496110_1177224 3300048913 Unclassified 675
1021 Ga0496111_0019707 3300048914 Bacteria 4690
1022 Ga0496111_0070896 3300048914 Bacteria 2536
1023 Ga0496111_0159698 3300048914 Bacteria 1673
1024 Ga0496111_0322857 3300048914 Bacteria 1143
1025 Ga0496111_0370385 3300048914 Bacteria 1060
1026 Ga0496111_0405586 3300048914 Unclassified 1007
1027 Ga0496111_0939698 3300048914 Bacteria 621
1028 Ga0496112_0000411 3300048915 Bacteria 28176
1029 Ga0496112_0016212 3300048915 Bacteria 6971
1030 Ga0496112_0162688 3300048915 Bacteria 2198
1031 Ga0496112_0784677 3300048915 Bacteria 878
1032 Ga0496112_0938568 3300048915 Bacteria 786
1033 Ga0496113_0037504 3300048916 Bacteria 3557
1034 Ga0496113_0430564 3300048916 Bacteria 1060
1035 Ga0496113_0490623 3300048916 Bacteria 986
1036 Ga0496113_0663631 3300048916 Bacteria 833
1037 Ga0496113_0790171 3300048916 Bacteria 754
1038 Ga0496113_0833394 3300048916 Bacteria 732
1039 Ga0496113_0860817 3300048916 Unclassified 718
1040 Ga0496114_0128052 3300048917 Bacteria 2190
1041 Ga0496114_0460034 3300048917 Bacteria 1126
1042 Ga0496115_0154470 3300048918 Bacteria 1895
1043 Ga0496115_0692406 3300048918 Bacteria 802
1044 Ga0496126_0515789 3300048929 Bacteria 953
1045 Ga0501306_059166 3300049127 Bacteria 629
1046 Ga0501310_055308 3300049130 Bacteria 582
1047 Ga0501305_065271 3300049161 Bacteria 633
1048 Ga0501312_066044 3300049528 Bacteria 634
1049 Ga0501317_034662 3300049533 Bacteria 748
1050 Ga0501318_059975 3300049534 Bacteria 582
1051 Ga0501323_040575 3300049539 Bacteria 681
1052 Ga0501324_039427 3300049540 Unclassified 536
1053 Ga0501031_0074946 3300049568 Bacteria 2203
1054 Ga0501032_0236057 3300049569 Bacteria 1188
1055 Ga0501032_0807481 3300049569 Bacteria 592
1056 Ga0501032_0900160 3300049569 Bacteria 557
1057 Ga0501033_0503460 3300049570 Bacteria 838
1058 Ga0501034_0059629 3300049571 Bacteria 3833
1059 Ga0501034_0826968 3300049571 Bacteria 817
1060 Ga0501034_1075038 3300049571 Bacteria 686
1061 Ga0501034_1161417 3300049571 Bacteria 652
1062 Ga0501036_0099767 3300049572 Bacteria 2456
1063 Ga0501036_0256667 3300049572 Bacteria 1464
1064 Ga0501036_0281968 3300049572 Bacteria 1390
1065 Ga0501037_0028680 3300049573 Bacteria 4111
1066 Ga0501038_0028807 3300049574 Bacteria 4929
1067 Ga0501038_0211572 3300049574 Bacteria 1551
1068 Ga0501038_0215540 3300049574 Bacteria 1534
1069 Ga0501039_0034479 3300049575 Bacteria 3905
1070 Ga0501039_0267196 3300049575 Bacteria 1344
1071 Ga0501039_0576475 3300049575 Bacteria 882
1072 Ga0501040_0042133 3300049576 Bacteria 3109
1073 Ga0501040_0236299 3300049576 Bacteria 1302
1074 Ga0501040_0311694 3300049576 Bacteria 1125
1075 Ga0501040_0387883 3300049576 Bacteria 1002
1076 Ga0501040_0481302 3300049576 Bacteria 894
1077 Ga0501040_0942599 3300049576 Bacteria 626
1078 Ga0501040_1381930 3300049576 Bacteria 511
1079 Ga0501041_0135642 3300049577 Bacteria 1533
1080 Ga0501041_0191422 3300049577 Bacteria 1281
1081 Ga0501042_0021613 3300049578 Bacteria 4488
1082 Ga0501042_0040279 3300049578 Bacteria 3322
1083 Ga0501042_0205985 3300049578 Bacteria 1418
1084 Ga0501042_1131911 3300049578 Bacteria 571
1085 Ga0501042_1318229 3300049578 Bacteria 526
1086 Ga0501043_0092731 3300049579 Bacteria 2374
1087 Ga0501046_0203022 3300049580 Bacteria 1474
1088 Ga0501047_0092793 3300049581 Bacteria 2898
1089 Ga0501047_1259067 3300049581 Bacteria 553
1090 Ga0501048_0027387 3300049582 Bacteria 4142
1091 Ga0501048_0074714 3300049582 Bacteria 2391
1092 Ga0501048_0080369 3300049582 Bacteria 2300
1093 Ga0501048_0568178 3300049582 Bacteria 814
1094 Ga0501048_0836919 3300049582 Bacteria 661
1095 Ga0501067_0169944 3300049583 Bacteria 1214
1096 Ga0501068_0012280 3300049584 Bacteria 4848
1097 Ga0501068_0515389 3300049584 Bacteria 776
1098 Ga0501069_0006139 3300049585 Bacteria 6275
1099 Ga0501069_0997723 3300049585 Bacteria 511
1100 Ga0501070_0037404 3300049586 Bacteria 4051
1101 Ga0501071_0064707 3300049587 Bacteria 2653
1102 Ga0501071_0232695 3300049587 Bacteria 1388
1103 Ga0501071_0313949 3300049587 Bacteria 1189
1104 Ga0501071_0393860 3300049587 Bacteria 1057
1105 Ga0501071_0798232 3300049587 Bacteria 728
1106 Ga0501072_0025453 3300049588 Bacteria 4610
1107 Ga0501072_0046952 3300049588 Bacteria 3400
1108 Ga0501072_0192048 3300049588 Bacteria 1628
1109 Ga0501072_0688579 3300049588 Bacteria 804
1110 Ga0501074_0015338 3300049590 Bacteria 5569
1111 Ga0501074_0203190 3300049590 Bacteria 1412
1112 Ga0501074_0377180 3300049590 Bacteria 1006
1113 Ga0501075_0071037 3300049591 Bacteria 2631
1114 Ga0501075_0195358 3300049591 Bacteria 1543
1115 Ga0501076_0036204 3300049592 Bacteria 3866
1116 Ga0501076_0041329 3300049592 Bacteria 3627
1117 Ga0501076_0041764 3300049592 Bacteria 3609
1118 Ga0501076_0221161 3300049592 Bacteria 1548
1119 Ga0501077_0212812 3300049593 Bacteria 1228
1120 Ga0501077_0296893 3300049593 Unclassified 1029
1121 Ga0501079_0178887 3300049741 Bacteria 1655
1122 Ga0501079_0183393 3300049741 Bacteria 1634
1123 Ga0501079_0214103 3300049741 Bacteria 1505
1124 Ga0501079_0351061 3300049741 Bacteria 1156
1125 Ga0501081_0112648 3300049743 Bacteria 1931
1126 Ga0501081_0320317 3300049743 Bacteria 1139
1127 Ga0501035_0078436 3300049822 Bacteria 2917
1128 Ga0501035_0330060 3300049822 Bacteria 1280
1129 Ga0501044_0316300 3300049823 Bacteria 1487
1130 Ga0501044_0854454 3300049823 Bacteria 787
1131 Ga0501045_0264112 3300049824 Bacteria 1281
1132 nmdc:mga03n38_825230_c1 3300050490 Bacteria 541
1133 nmdc:mga0yw44_897668_c1 3300050492 Bacteria 601
1134 nmdc:mga05p37_1017081_c1 3300050507 Bacteria 878
1135 nmdc:mga05p37_188749_c1 3300050507 Bacteria 2504
1136 nmdc:mga09592_1318712_c1 3300050508 Bacteria 593
1137 nmdc:mga09592_2788_c1 3300050508 Bacteria 6364
1138 nmdc:mga09592_358210_c1 3300050508 Bacteria 1262
1139 nmdc:mga09592_923849_c1 3300050508 Bacteria 732
1140 nmdc:mga0qj67_3118_c1 3300050509 Bacteria 11928
1141 nmdc:mga0qj67_3507_c1 3300050509 Bacteria 11316
1142 nmdc:mga0qj67_366733_c1 3300050509 Bacteria 1163
1143 nmdc:mga0qj67_750298_c1 3300050509 Bacteria 774
1144 nmdc:mga0qj67_963363_c1 3300050509 Bacteria 670
1145 nmdc:mga06r32_1308909_c1 3300050510 Bacteria 668
1146 nmdc:mga06r32_15328_c1 3300050510 Bacteria 6963
1147 nmdc:mga06r32_260169_c1 3300050510 Bacteria 1723
1148 nmdc:mga06r32_833171_c1 3300050510 Bacteria 882
1149 nmdc:mga06r32_97728_c1 3300050510 Bacteria 2878
1150 nmdc:mga08y16_1034919_c1 3300050511 Bacteria 799
1151 nmdc:mga08y16_37249_c1 3300050511 Bacteria 5109
1152 nmdc:mga08y16_377180_c1 3300050511 Bacteria 1454
1153 nmdc:mga08y16_39120_c1 3300050511 Bacteria 4977
1154 nmdc:mga08y16_402796_c1 3300050511 Bacteria 1400
1155 nmdc:mga08y16_778072_c1 3300050511 Bacteria 951
1156 nmdc:mga08y16_79996_c1 3300050511 Bacteria 3407
1157 nmdc:mga0n895_1178757_c1 3300050512 Bacteria 741
1158 nmdc:mga0n895_7725_c1 3300050512 Bacteria 9256
1159 nmdc:mga0rr50_206084_c1 3300050513 Bacteria 1618
1160 nmdc:mga0rr50_494288_c1 3300050513 Bacteria 1040
1161 nmdc:mga08x19_728106_c1 3300050514 Bacteria 704
1162 nmdc:mga08x19_8490_c1 3300050514 Bacteria 6119
1163 nmdc:mga0a205_12690_c1 3300050515 Bacteria 7806
1164 nmdc:mga0a205_238380_c1 3300050515 Bacteria 1700
1165 Ga0495601_0282114 3300053077 Bacteria 1083
1166 Ga0495655_0003884 3300053083 Bacteria 2508
1167 Ga0495655_0010843 3300053083 Bacteria 1813
1168 Ga0495655_0022041 3300053083 Bacteria 1450
1169 Ga0495655_0050399 3300053083 Bacteria 1100
1170 Ga0495595_0450718 3300053084 Bacteria 654
1171 Ga0495619_0571145 3300053085 Bacteria 775
1172 Ga0495619_1191044 3300053085 Bacteria 505
1173 Ga0500556_0000185 3300053104 Bacteria 50733
1174 Ga0500616_0004192 3300053153 Bacteria 10393
1175 Ga0500616_0120701 3300053153 Bacteria 1253
1176 Ga0501084_0036418 3300054114 Bacteria 4110
1177 Ga0501084_0123090 3300054114 Bacteria 2181
1178 Ga0501084_0194679 3300054114 Bacteria 1710
1179 Ga0501084_0653261 3300054114 Bacteria 888
1180 Ga0501084_1457850 3300054114 Bacteria 573
1181 Ga0501084_1722399 3300054114 Bacteria 524
1182 Ga0501082_0007046 3300060353 Bacteria 9702
1183 Ga0501082_0030710 3300060353 Bacteria 4631
1184 Ga0501082_0152246 3300060353 Bacteria 2009
1185 Ga0501082_1661794 3300060353 Bacteria 557
1186 Ga0466962_0007109 3300061719 Bacteria 5363
1187 Ga0466962_0009079 3300061719 Bacteria 4762
1188 Ga0466962_0011598 3300061719 Bacteria 4245
1189 Ga0466962_0030703 3300061719 Bacteria 2573
1190 Ga0466962_0054703 3300061719 Bacteria 1907
1191 Ga0466962_0329315 3300061719 Bacteria 758
1192 Ga0530510_0008772 3300061734 Bacteria 7072
1193 Ga0530510_0286779 3300061734 Bacteria 1230
1194 Ga0530510_1532031 3300061734 Bacteria 512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0818943 Ga0495651_0818943_217_558 105
2 3300049587 Ga0501071_0798232 Ga0501071_0798232_321_662 105
3 3300005329 Ga0070683_100126015 Ga0070683_1001260153 106
4 3300005337 Ga0070682_100927241 Ga0070682_1009272412 106
5 3300005345 Ga0070692_10246880 Ga0070692_102468801 106
6 3300005354 Ga0070675_100451019 Ga0070675_1004510192 106
7 3300005356 Ga0070674_100123102 Ga0070674_1001231022 106
8 3300005366 Ga0070659_100575851 Ga0070659_1005758512 106
9 3300005455 Ga0070663_100138320 Ga0070663_1001383202 106
10 3300005459 Ga0068867_101394675 Ga0068867_1013946752 106
11 3300005466 Ga0070685_10200574 Ga0070685_102005742 106
12 3300005548 Ga0070665_101612682 Ga0070665_1016126822 106
13 3300005617 Ga0068859_101131567 Ga0068859_1011315672 106
14 3300006881 Ga0068865_100526150 Ga0068865_1005261502 106
15 3300006931 Ga0097620_101131521 Ga0097620_1011315212 106
16 3300009098 Ga0105245_10703888 Ga0105245_107038882 106
17 3300009148 Ga0105243_10139520 Ga0105243_101395203 106
18 3300009177 Ga0105248_10454699 Ga0105248_104546992 106
19 3300013102 Ga0157371_10320817 Ga0157371_103208172 106
20 3300014745 Ga0157377_10330608 Ga0157377_103306082 106
21 3300025899 Ga0207642_10677234 Ga0207642_106772341 106
22 3300025917 Ga0207660_11072817 Ga0207660_110728172 106
23 3300025920 Ga0207649_10157233 Ga0207649_101572332 106
24 3300025932 Ga0207690_10012040 Ga0207690_100120402 106
25 3300025935 Ga0207709_10232649 Ga0207709_102326492 106
26 3300025937 Ga0207669_10308807 Ga0207669_103088072 106
27 3300025941 Ga0207711_11371111 Ga0207711_113711112 106
28 3300025944 Ga0207661_10047165 Ga0207661_100471653 106
29 3300026023 Ga0207677_10590949 Ga0207677_105909492 106
30 3300026035 Ga0207703_10713016 Ga0207703_107130162 106
31 3300026067 Ga0207678_10240467 Ga0207678_102404672 106
32 3300028379 Ga0268266_10441037 Ga0268266_104410372 106
33 3300039450 Ga0436363_0138138 Ga0436363_0138138_172_519 106
34 3300048911 Ga0496108_0032003 Ga0496108_0032003_1385_1735 108
35 3300005616 Ga0068852_101254344 Ga0068852_1012543442 109
36 3300031731 Ga0307405_11172605 Ga0307405_111726052 109
37 3300031824 Ga0307413_11049246 Ga0307413_110492461 109
38 3300031852 Ga0307410_10366678 Ga0307410_103666782 109
39 3300031995 Ga0307409_100759273 Ga0307409_1007592732 109
40 3300005441 Ga0070700_100796643 Ga0070700_1007966432 110
41 3300009094 Ga0111539_13423641 Ga0111539_134236411 110
42 3300009551 Ga0105238_12794391 Ga0105238_127943911 110
43 3300025901 Ga0207688_10667560 Ga0207688_106675602 110
44 3300009098 Ga0105245_10581858 Ga0105245_105818582 111
45 3300003373 JGI25407J50210_10150474 JGI25407J50210_101504741 112
46 3300005328 Ga0070676_10898135 Ga0070676_108981352 112
47 3300005329 Ga0070683_100619776 Ga0070683_1006197761 112
48 3300005338 Ga0068868_100061487 Ga0068868_1000614872 112
49 3300005343 Ga0070687_100018335 Ga0070687_1000183351 112
50 3300005345 Ga0070692_10023589 Ga0070692_100235893 112
51 3300005364 Ga0070673_100708770 Ga0070673_1007087702 112
52 3300005438 Ga0070701_10040526 Ga0070701_100405262 112
53 3300005441 Ga0070700_100010007 Ga0070700_1000100071 112
54 3300005459 Ga0068867_100692022 Ga0068867_1006920222 112
55 3300005466 Ga0070685_10220321 Ga0070685_102203212 112
56 3300005535 Ga0070684_100362082 Ga0070684_1003620822 112
57 3300005535 Ga0070684_100472890 Ga0070684_1004728902 112
58 3300005544 Ga0070686_101403892 Ga0070686_1014038921 112
59 3300005549 Ga0070704_100150892 Ga0070704_1001508922 112
60 3300005564 Ga0070664_100310130 Ga0070664_1003101303 112
61 3300005577 Ga0068857_100797347 Ga0068857_1007973472 112
62 3300005614 Ga0068856_101028605 Ga0068856_1010286052 112
63 3300005615 Ga0070702_100024221 Ga0070702_1000242213 112
64 3300005615 Ga0070702_100114588 Ga0070702_1001145882 112
65 3300005616 Ga0068852_102560864 Ga0068852_1025608642 112
66 3300005617 Ga0068859_100084528 Ga0068859_1000845281 112
67 3300005618 Ga0068864_100149644 Ga0068864_1001496442 112
68 3300005618 Ga0068864_100425402 Ga0068864_1004254022 112
69 3300005841 Ga0068863_101396973 Ga0068863_1013969732 112
70 3300005842 Ga0068858_100430970 Ga0068858_1004309702 112
71 3300005843 Ga0068860_101197339 Ga0068860_1011973392 112
72 3300005981 Ga0081538_10028761 Ga0081538_100287612 112
73 3300005981 Ga0081538_10056816 Ga0081538_100568162 112
74 3300005981 Ga0081538_10148807 Ga0081538_101488071 112
75 3300006175 Ga0070712_101206696 Ga0070712_1012066962 112
76 3300006358 Ga0068871_100378656 Ga0068871_1003786562 112
77 3300006881 Ga0068865_100166543 Ga0068865_1001665432 112
78 3300006881 Ga0068865_100345012 Ga0068865_1003450122 112
79 3300006931 Ga0097620_100084532 Ga0097620_1000845323 112
80 3300009094 Ga0111539_12002550 Ga0111539_120025501 112
81 3300009098 Ga0105245_10296953 Ga0105245_102969532 112
82 3300009098 Ga0105245_10530787 Ga0105245_105307872 112
83 3300009148 Ga0105243_12200548 Ga0105243_122005481 112
84 3300009177 Ga0105248_11352278 Ga0105248_113522782 112
85 3300009551 Ga0105238_10839387 Ga0105238_108393872 112
86 3300010375 Ga0105239_11442808 Ga0105239_114428082 112
87 3300011119 Ga0105246_10943412 Ga0105246_109434121 112
88 3300011119 Ga0105246_11593860 Ga0105246_115938601 112
89 3300013102 Ga0157371_10393408 Ga0157371_103934082 112
90 3300013105 Ga0157369_10413033 Ga0157369_104130332 112
91 3300013307 Ga0157372_11493704 Ga0157372_114937042 112
92 3300013308 Ga0157375_10126151 Ga0157375_101261513 112
93 3300013308 Ga0157375_13011809 Ga0157375_130118091 112
94 3300014325 Ga0163163_11475306 Ga0163163_114753062 112
95 3300014497 Ga0182008_10383146 Ga0182008_103831461 112
96 3300014745 Ga0157377_10407594 Ga0157377_104075942 112
97 3300014968 Ga0157379_10677516 Ga0157379_106775162 112
98 3300014969 Ga0157376_11930549 Ga0157376_119305491 112
99 3300025901 Ga0207688_10046046 Ga0207688_100460462 112
100 3300025907 Ga0207645_10794354 Ga0207645_107943542 112
101 3300025908 Ga0207643_10802099 Ga0207643_108020991 112
102 3300025918 Ga0207662_10130707 Ga0207662_101307072 112
103 3300025927 Ga0207687_10109261 Ga0207687_101092612 112
104 3300025927 Ga0207687_10421997 Ga0207687_104219972 112
105 3300025932 Ga0207690_10714702 Ga0207690_107147022 112
106 3300025932 Ga0207690_10893670 Ga0207690_108936701 112
107 3300025935 Ga0207709_10029323 Ga0207709_100293231 112
108 3300025938 Ga0207704_10739519 Ga0207704_107395191 112
109 3300025941 Ga0207711_10790725 Ga0207711_107907252 112
110 3300025944 Ga0207661_10177782 Ga0207661_101777821 112
111 3300025944 Ga0207661_10242892 Ga0207661_102428921 112
112 3300025945 Ga0207679_10220257 Ga0207679_102202572 112
113 3300025961 Ga0207712_10706015 Ga0207712_107060152 112
114 3300026023 Ga0207677_10227348 Ga0207677_102273482 112
115 3300026035 Ga0207703_10341495 Ga0207703_103414952 112
116 3300026075 Ga0207708_10015048 Ga0207708_100150485 112
117 3300026089 Ga0207648_10030285 Ga0207648_100302851 112
118 3300026095 Ga0207676_10283590 Ga0207676_102835902 112
119 3300026095 Ga0207676_10595342 Ga0207676_105953421 112
120 3300026142 Ga0207698_10686197 Ga0207698_106861972 112
121 3300028381 Ga0268264_10949626 Ga0268264_109496262 112
122 3300031903 Ga0307407_11022688 Ga0307407_110226881 112
123 3300031903 Ga0307407_11339083 Ga0307407_113390831 112
124 3300032002 Ga0307416_100010493 Ga0307416_1000104935 112
125 3300032002 Ga0307416_102206737 Ga0307416_1022067372 112
126 3300032004 Ga0307414_11020275 Ga0307414_110202752 112
127 3300032005 Ga0307411_10544216 Ga0307411_105442162 112
128 3300032126 Ga0307415_100000270 Ga0307415_10000027013 112
129 3300035691 Ga0373931_0185599 Ga0373931_0185599_613_1026 112
130 3300037466 Ga0395898_1581135 Ga0395898_1581135_74_481 112
131 3300044706 Ga0466964_0696204 Ga0466964_0696204_70_492 112
132 3300044901 Ga0466960_0820468 Ga0466960_0820468_124_537 112
133 3300048904 Ga0496101_0297534 Ga0496101_0297534_244_657 112
134 3300048905 Ga0496102_0068133 Ga0496102_0068133_1431_1844 112
135 3300048909 Ga0496106_0112396 Ga0496106_0112396_1354_1767 112
136 3300048911 Ga0496108_0082647 Ga0496108_0082647_137_550 112
137 3300048912 Ga0496109_0742477 Ga0496109_0742477_91_504 112
138 3300048913 Ga0496110_0427034 Ga0496110_0427034_638_1051 112
139 3300003373 JGI25407J50210_10000141 JGI25407J50210_1000014112 113
140 3300005455 Ga0070663_100237422 Ga0070663_1002374222 113
141 3300005614 Ga0068856_101457445 Ga0068856_1014574452 113
142 3300011119 Ga0105246_11520366 Ga0105246_115203661 113
143 3300014497 Ga0182008_10231321 Ga0182008_102313212 113
144 3300020610 Ga0154015_1538802 Ga0154015_15388022 113
145 3300037466 Ga0395898_0314086 Ga0395898_0314086_690_1106 113
146 3300053083 Ga0495655_0003884 Ga0495655_0003884_1290_1706 113
147 3300005344 Ga0070661_100462513 Ga0070661_1004625132 114
148 3300005548 Ga0070665_100005346 Ga0070665_1000053464 114
149 3300005564 Ga0070664_100959933 Ga0070664_1009599332 114
150 3300013105 Ga0157369_10358099 Ga0157369_103580992 114
151 3300017792 Ga0163161_10837883 Ga0163161_108378832 114
152 3300026023 Ga0207677_11442733 Ga0207677_114427332 114
153 3300026067 Ga0207678_10928031 Ga0207678_109280312 114
154 3300026142 Ga0207698_10953744 Ga0207698_109537442 114
155 3300028379 Ga0268266_10002835 Ga0268266_1000283514 114
156 3300046522 Ga0495643_0358840 Ga0495643_0358840_176_589 114
157 3300003203 JGI25406J46586_10034801 JGI25406J46586_100348011 115
158 3300003203 JGI25406J46586_10110030 JGI25406J46586_101100301 115
159 3300005339 Ga0070660_100814688 Ga0070660_1008146881 115
160 3300005354 Ga0070675_100741965 Ga0070675_1007419652 115
161 3300005455 Ga0070663_101295603 Ga0070663_1012956031 115
162 3300005456 Ga0070678_100130878 Ga0070678_1001308782 115
163 3300005535 Ga0070684_100079063 Ga0070684_1000790632 115
164 3300005535 Ga0070684_100720283 Ga0070684_1007202832 115
165 3300005614 Ga0068856_100730323 Ga0068856_1007303232 115
166 3300005981 Ga0081538_10049537 Ga0081538_100495373 115
167 3300006048 Ga0075363_100697829 Ga0075363_1006978292 115
168 3300006358 Ga0068871_100639110 Ga0068871_1006391102 115
169 3300009177 Ga0105248_10999145 Ga0105248_109991452 115
170 3300014325 Ga0163163_11593993 Ga0163163_115939932 115
171 3300014969 Ga0157376_10368423 Ga0157376_103684231 115
172 3300025903 Ga0207680_10183634 Ga0207680_101836342 115
173 3300025917 Ga0207660_10422317 Ga0207660_104223172 115
174 3300025920 Ga0207649_10762350 Ga0207649_107623501 115
175 3300026116 Ga0207674_10258267 Ga0207674_102582672 115
176 3300026116 Ga0207674_10937258 Ga0207674_109372581 115
177 3300031731 Ga0307405_10015925 Ga0307405_100159255 115
178 3300031824 Ga0307413_10198257 Ga0307413_101982572 115
179 3300031824 Ga0307413_12016803 Ga0307413_120168031 115
180 3300031852 Ga0307410_10512716 Ga0307410_105127162 115
181 3300031901 Ga0307406_10115157 Ga0307406_101151572 115
182 3300031901 Ga0307406_10161430 Ga0307406_101614302 115
183 3300031901 Ga0307406_10797158 Ga0307406_107971582 115
184 3300031903 Ga0307407_10252738 Ga0307407_102527382 115
185 3300031911 Ga0307412_10050572 Ga0307412_100505722 115
186 3300031911 Ga0307412_10625447 Ga0307412_106254472 115
187 3300031995 Ga0307409_100008537 Ga0307409_1000085376 115
188 3300031995 Ga0307409_100887525 Ga0307409_1008875252 115
189 3300032002 Ga0307416_100015350 Ga0307416_1000153502 115
190 3300032002 Ga0307416_100527577 Ga0307416_1005275772 115
191 3300032004 Ga0307414_11051822 Ga0307414_110518222 115
192 3300032005 Ga0307411_10049870 Ga0307411_100498702 115
193 3300032126 Ga0307415_100010952 Ga0307415_1000109523 115
194 3300037418 Ga0395900_0849176 Ga0395900_0849176_235_645 115
195 3300046473 Ga0495582_0237778 Ga0495582_0237778_273_683 115
196 3300046473 Ga0495582_0877234 Ga0495582_0877234_85_498 115
197 3300047445 Ga0495677_0382129 Ga0495677_0382129_77_490 115
198 3300047673 Ga0495593_0420058 Ga0495593_0420058_172_582 115
199 3300048908 Ga0496105_0278512 Ga0496105_0278512_541_960 115
200 3300048912 Ga0496109_0173243 Ga0496109_0173243_589_1002 115
201 3300048913 Ga0496110_1177224 Ga0496110_1177224_154_567 115
202 3300048914 Ga0496111_0405586 Ga0496111_0405586_506_919 115
203 3300049576 Ga0501040_0311694 Ga0501040_0311694_480_893 115
204 3300049578 Ga0501042_1318229 Ga0501042_1318229_23_436 115
205 3300049582 Ga0501048_0568178 Ga0501048_0568178_192_605 115
206 3300053085 Ga0495619_1191044 Ga0495619_1191044_60_470 115
207 3300003693 Ga0032354_1043383 Ga0032354_10433832 116
208 3300005339 Ga0070660_100930012 Ga0070660_1009300122 116
209 3300005543 Ga0070672_100694682 Ga0070672_1006946822 116
210 3300025901 Ga0207688_10183522 Ga0207688_101835221 116
211 3300025940 Ga0207691_10181032 Ga0207691_101810322 116
212 3300025945 Ga0207679_10260623 Ga0207679_102606232 116
213 3300048907 Ga0496104_0541251 Ga0496104_0541251_292_708 116
214 3300048912 Ga0496109_0895694 Ga0496109_0895694_162_572 116
215 3300005328 Ga0070676_10125201 Ga0070676_101252011 117
216 3300005334 Ga0068869_100213862 Ga0068869_1002138622 117
217 3300005344 Ga0070661_100235238 Ga0070661_1002352382 117
218 3300005441 Ga0070700_100833136 Ga0070700_1008331362 117
219 3300005455 Ga0070663_100381704 Ga0070663_1003817042 117
220 3300005615 Ga0070702_100133431 Ga0070702_1001334311 117
221 3300005718 Ga0068866_10081583 Ga0068866_100815833 117
222 3300009148 Ga0105243_11430247 Ga0105243_114302471 117
223 3300009176 Ga0105242_10744953 Ga0105242_107449532 117
224 3300014325 Ga0163163_11409893 Ga0163163_114098932 117
225 3300025899 Ga0207642_10127250 Ga0207642_101272503 117
226 3300025920 Ga0207649_10171862 Ga0207649_101718622 117
227 3300025938 Ga0207704_10660470 Ga0207704_106604701 117
228 3300026067 Ga0207678_10058339 Ga0207678_100583393 117
229 3300026075 Ga0207708_10354722 Ga0207708_103547222 117
230 3300027907 Ga0207428_10313673 Ga0207428_103136732 117
231 3300037471 Ga0395905_1593983 Ga0395905_1593983_13_429 117
232 3300049540 Ga0501324_039427 Ga0501324_039427_20_445 117
233 3300050511 nmdc:mga08y16_778072_c1 nmdc:mga08y16_778072_c1_190_603 117
234 3300005455 Ga0070663_100466917 Ga0070663_1004669172 118
235 3300005457 Ga0070662_101132212 Ga0070662_1011322122 118
236 3300005467 Ga0070706_101092595 Ga0070706_1010925952 118
237 3300005981 Ga0081538_10000784 Ga0081538_1000078416 118
238 3300009147 Ga0114129_13503518 Ga0114129_135035181 118
239 3300032126 Ga0307415_100719769 Ga0307415_1007197692 118
240 3300037418 Ga0395900_1762725 Ga0395900_1762725_28_441 118
241 3300037466 Ga0395898_0013113 Ga0395898_0013113_1455_1868 118
242 3300005344 Ga0070661_101300627 Ga0070661_1013006271 119
243 3300005618 Ga0068864_101678903 Ga0068864_1016789032 119
244 3300005840 Ga0068870_10226328 Ga0068870_102263282 119
245 3300006048 Ga0075363_100168419 Ga0075363_1001684192 119
246 3300009176 Ga0105242_10969181 Ga0105242_109691812 119
247 3300014325 Ga0163163_11583588 Ga0163163_115835882 119
248 3300014326 Ga0157380_11802528 Ga0157380_118025281 119
249 3300032002 Ga0307416_101462869 Ga0307416_1014628692 119
250 3300035114 Ga0373939_0240489 Ga0373939_0240489_224_637 119
251 3300037471 Ga0395905_0254745 Ga0395905_0254745_190_603 119
252 3300038443 Ga0395901_0000710 Ga0395901_0000710_30881_31294 119
253 3300041486 Ga0451807_1208132 Ga0451807_1208132_145_558 119
254 3300041498 Ga0451841_0077213 Ga0451841_0077213_119_532 119
255 3300044694 Ga0466963_0116630 Ga0466963_0116630_224_640 119
256 3300044901 Ga0466960_0145077 Ga0466960_0145077_104_517 119
257 3300045976 Ga0466967_1317283 Ga0466967_1317283_154_570 119
258 3300046513 Ga0495616_0254248 Ga0495616_0254248_95_508 119
259 3300046648 Ga0495611_0473746 Ga0495611_0473746_33_446 119
260 3300048911 Ga0496108_0420752 Ga0496108_0420752_128_544 119
261 3300048912 Ga0496109_0022582 Ga0496109_0022582_3652_4068 119
262 3300048916 Ga0496113_0490623 Ga0496113_0490623_420_836 119
263 3300054114 Ga0501084_1722399 Ga0501084_1722399_89_505 119
264 3300003373 JGI25407J50210_10080461 JGI25407J50210_100804611 120
265 3300005329 Ga0070683_100871629 Ga0070683_1008716292 120
266 3300005456 Ga0070678_101079125 Ga0070678_1010791252 120
267 3300005564 Ga0070664_100355896 Ga0070664_1003558962 120
268 3300005616 Ga0068852_100645458 Ga0068852_1006454582 120
269 3300005981 Ga0081538_10054845 Ga0081538_100548453 120
270 3300007076 Ga0075435_101378607 Ga0075435_1013786071 120
271 3300009098 Ga0105245_10491897 Ga0105245_104918972 120
272 3300025909 Ga0207705_11391015 Ga0207705_113910152 120
273 3300025933 Ga0207706_10383659 Ga0207706_103836592 120
274 3300025935 Ga0207709_11111094 Ga0207709_111110941 120
275 3300025937 Ga0207669_10383489 Ga0207669_103834892 120
276 3300025944 Ga0207661_10560975 Ga0207661_105609752 120
277 3300026023 Ga0207677_10858574 Ga0207677_108585742 120
278 3300026142 Ga0207698_10640027 Ga0207698_106400272 120
279 3300031548 Ga0307408_100553966 Ga0307408_1005539662 120
280 3300031901 Ga0307406_10722333 Ga0307406_107223332 120
281 3300037418 Ga0395900_0522055 Ga0395900_0522055_32_424 120
282 3300037466 Ga0395898_0641143 Ga0395898_0641143_429_839 120
283 3300048914 Ga0496111_0070896 Ga0496111_0070896_1025_1441 120
284 3300005535 Ga0070684_100563425 Ga0070684_1005634251 121
285 3300014325 Ga0163163_10312817 Ga0163163_103128172 121
286 3300022467 Ga0224712_10282483 Ga0224712_102824831 121
287 3300031548 Ga0307408_100100351 Ga0307408_1001003514 121
288 3300031824 Ga0307413_10428271 Ga0307413_104282712 121
289 3300031852 Ga0307410_10074870 Ga0307410_100748702 121
290 3300031852 Ga0307410_10112356 Ga0307410_101123562 121
291 3300031901 Ga0307406_10156301 Ga0307406_101563012 121
292 3300031901 Ga0307406_10880445 Ga0307406_108804451 121
293 3300031903 Ga0307407_10068488 Ga0307407_100684883 121
294 3300032002 Ga0307416_100021545 Ga0307416_1000215457 121
295 3300032004 Ga0307414_10288656 Ga0307414_102886563 121
296 3300032126 Ga0307415_101074890 Ga0307415_1010748902 121
297 3300044842 Ga0466957_0120226 Ga0466957_0120226_194_607 121
298 3300048907 Ga0496104_1132390 Ga0496104_1132390_197_610 121
299 3300048914 Ga0496111_0939698 Ga0496111_0939698_180_593 121
300 3300053153 Ga0500616_0004192 Ga0500616_0004192_321_746 121
301 3300005327 Ga0070658_10658330 Ga0070658_106583302 122
302 3300005458 Ga0070681_10757392 Ga0070681_107573921 122
303 3300006058 Ga0075432_10163562 Ga0075432_101635622 122
304 3300006844 Ga0075428_100134842 Ga0075428_1001348423 122
305 3300006846 Ga0075430_100092307 Ga0075430_1000923072 122
306 3300006847 Ga0075431_100096458 Ga0075431_1000964582 122
307 3300009147 Ga0114129_10171458 Ga0114129_101714585 122
308 3300009551 Ga0105238_10453916 Ga0105238_104539163 122
309 3300013297 Ga0157378_12109726 Ga0157378_121097262 122
310 3300013308 Ga0157375_11906082 Ga0157375_119060822 122
311 3300025934 Ga0207686_10575558 Ga0207686_105755582 122
312 3300025944 Ga0207661_10152479 Ga0207661_101524792 122
313 3300025945 Ga0207679_11674998 Ga0207679_116749982 122
314 3300026088 Ga0207641_11014696 Ga0207641_110146962 122
315 3300031731 Ga0307405_10143255 Ga0307405_101432552 122
316 3300031911 Ga0307412_10725396 Ga0307412_107253962 122
317 3300031995 Ga0307409_100071536 Ga0307409_1000715362 122
318 3300031995 Ga0307409_102556182 Ga0307409_1025561822 122
319 3300032002 Ga0307416_100222554 Ga0307416_1002225542 122
320 3300041486 Ga0451807_1766298 Ga0451807_1766298_60_473 122
321 3300044735 Ga0466968_0092655 Ga0466968_0092655_570_977 122
322 3300046522 Ga0495643_0327705 Ga0495643_0327705_198_611 122
323 3300046665 Ga0495661_0517269 Ga0495661_0517269_47_460 122
324 3300048916 Ga0496113_0860817 Ga0496113_0860817_92_505 122
325 3300049581 Ga0501047_0092793 Ga0501047_0092793_1571_1963 122
326 3300050510 nmdc:mga06r32_260169_c1 nmdc:mga06r32_260169_c1_690_1100 122
327 3300005327 Ga0070658_10033242 Ga0070658_100332422 123
328 3300025909 Ga0207705_10072299 Ga0207705_100722992 123
329 3300031995 Ga0307409_101250191 Ga0307409_1012501912 123
330 3300032002 Ga0307416_101612534 Ga0307416_1016125341 123
331 3300049582 Ga0501048_0836919 Ga0501048_0836919_14_427 123
332 3300005985 Ga0081539_10419588 Ga0081539_104195882 124
333 3300031995 Ga0307409_101507459 Ga0307409_1015074591 124
334 3300032126 Ga0307415_100558181 Ga0307415_1005581812 124
335 3300037471 Ga0395905_0401469 Ga0395905_0401469_425_838 124
336 3300044901 Ga0466960_0285535 Ga0466960_0285535_411_833 124
337 3300049576 Ga0501040_0387883 Ga0501040_0387883_481_891 124
338 3300049582 Ga0501048_0027387 Ga0501048_0027387_3202_3612 124
339 3300049588 Ga0501072_0192048 Ga0501072_0192048_636_1046 124
340 3300049590 Ga0501074_0377180 Ga0501074_0377180_124_534 124
341 3300049591 Ga0501075_0195358 Ga0501075_0195358_844_1254 124
342 3300049592 Ga0501076_0041329 Ga0501076_0041329_1846_2256 124
343 3300049593 Ga0501077_0296893 Ga0501077_0296893_511_921 124
344 3300049741 Ga0501079_0214103 Ga0501079_0214103_1045_1455 124
345 3300049822 Ga0501035_0330060 Ga0501035_0330060_40_450 124
346 3300060353 Ga0501082_0152246 Ga0501082_0152246_413_823 124
347 3300061734 Ga0530510_0008772 Ga0530510_0008772_6037_6447 124
348 3300005615 Ga0070702_100715628 Ga0070702_1007156282 125
349 3300021377 Ga0213874_10041644 Ga0213874_100416442 125
350 3300031903 Ga0307407_10773788 Ga0307407_107737882 125
351 3300037418 Ga0395900_0215606 Ga0395900_0215606_1494_1907 125
352 3300037466 Ga0395898_0540769 Ga0395898_0540769_33_446 125
353 3300037471 Ga0395905_1093901 Ga0395905_1093901_220_633 125
354 3300039450 Ga0436363_0390027 Ga0436363_0390027_1268_1681 125
355 3300039450 Ga0436363_1040091 Ga0436363_1040091_62_478 125
356 3300041452 Ga0451793_0050141 Ga0451793_0050141_201_614 125
357 3300048912 Ga0496109_0445024 Ga0496109_0445024_499_900 125
358 3300049161 Ga0501305_065271 Ga0501305_065271_21_434 125
359 3300044901 Ga0466960_0505971 Ga0466960_0505971_61_465 126
360 3300046809 Ga0495600_0004959 Ga0495600_0004959_2136_2549 126
361 3300049569 Ga0501032_0900160 Ga0501032_0900160_101_514 126
362 3300049572 Ga0501036_0099767 Ga0501036_0099767_1295_1708 126
363 3300049576 Ga0501040_0481302 Ga0501040_0481302_143_556 126
364 3300049577 Ga0501041_0135642 Ga0501041_0135642_895_1308 126
365 3300049578 Ga0501042_0040279 Ga0501042_0040279_2529_2942 126
366 3300049587 Ga0501071_0064707 Ga0501071_0064707_343_756 126
367 3300049592 Ga0501076_0036204 Ga0501076_0036204_482_895 126
368 3300049743 Ga0501081_0320317 Ga0501081_0320317_11_424 126
369 3300054114 Ga0501084_0194679 Ga0501084_0194679_657_1070 126
370 3300060353 Ga0501082_1661794 Ga0501082_1661794_27_440 126
371 3300003203 JGI25406J46586_10109597 JGI25406J46586_101095971 127
372 3300005343 Ga0070687_100110688 Ga0070687_1001106882 127
373 3300005366 Ga0070659_100546853 Ga0070659_1005468532 127
374 3300005366 Ga0070659_100778873 Ga0070659_1007788732 127
375 3300005439 Ga0070711_101175037 Ga0070711_1011750371 127
376 3300005441 Ga0070700_100319365 Ga0070700_1003193652 127
377 3300005468 Ga0070707_101202543 Ga0070707_1012025431 127
378 3300005985 Ga0081539_10179847 Ga0081539_101798472 127
379 3300006028 Ga0070717_11894904 Ga0070717_118949041 127
380 3300006844 Ga0075428_100084021 Ga0075428_1000840214 127
381 3300006844 Ga0075428_100755407 Ga0075428_1007554072 127
382 3300006844 Ga0075428_101618997 Ga0075428_1016189972 127
383 3300006846 Ga0075430_100002129 Ga0075430_10000212921 127
384 3300006846 Ga0075430_101432881 Ga0075430_1014328811 127
385 3300006847 Ga0075431_100103687 Ga0075431_1001036872 127
386 3300006847 Ga0075431_101429874 Ga0075431_1014298742 127
387 3300006847 Ga0075431_101810035 Ga0075431_1018100351 127
388 3300009094 Ga0111539_11292360 Ga0111539_112923602 127
389 3300009147 Ga0114129_10056265 Ga0114129_100562653 127
390 3300009147 Ga0114129_10973170 Ga0114129_109731703 127
391 3300009147 Ga0114129_11577321 Ga0114129_115773212 127
392 3300009148 Ga0105243_10831664 Ga0105243_108316642 127
393 3300014326 Ga0157380_12035945 Ga0157380_120359452 127
394 3300021377 Ga0213874_10038033 Ga0213874_100380332 127
395 3300021384 Ga0213876_10071496 Ga0213876_100714963 127
396 3300021384 Ga0213876_10241891 Ga0213876_102418912 127
397 3300021388 Ga0213875_10395228 Ga0213875_103952281 127
398 3300025918 Ga0207662_10165826 Ga0207662_101658262 127
399 3300025929 Ga0207664_10278231 Ga0207664_102782312 127
400 3300026075 Ga0207708_10372294 Ga0207708_103722942 127
401 3300026075 Ga0207708_11071709 Ga0207708_110717091 127
402 3300026089 Ga0207648_12235654 Ga0207648_122356541 127
403 3300031548 Ga0307408_100941048 Ga0307408_1009410482 127
404 3300031824 Ga0307413_10168367 Ga0307413_101683672 127
405 3300031852 Ga0307410_10258862 Ga0307410_102588622 127
406 3300031903 Ga0307407_10756182 Ga0307407_107561822 127
407 3300031995 Ga0307409_100116530 Ga0307409_1001165302 127
408 3300032002 Ga0307416_100093265 Ga0307416_1000932652 127
409 3300032002 Ga0307416_100690199 Ga0307416_1006901992 127
410 3300032002 Ga0307416_102749736 Ga0307416_1027497362 127
411 3300032005 Ga0307411_11272551 Ga0307411_112725512 127
412 3300032126 Ga0307415_100928294 Ga0307415_1009282942 127
413 3300037418 Ga0395900_0398612 Ga0395900_0398612_343_750 127
414 3300037466 Ga0395898_0270651 Ga0395898_0270651_196_603 127
415 3300037471 Ga0395905_0360877 Ga0395905_0360877_64_471 127
416 3300037853 Ga0436364_0770501 Ga0436364_0770501_110_517 127
417 3300037853 Ga0436364_0874633 Ga0436364_0874633_429_836 127
418 3300038443 Ga0395901_0047839 Ga0395901_0047839_1886_2293 127
419 3300038443 Ga0395901_0516599 Ga0395901_0516599_530_937 127
420 3300039437 Ga0436365_0971428 Ga0436365_0971428_250_657 127
421 3300039437 Ga0436365_1541488 Ga0436365_1541488_453_860 127
422 3300039450 Ga0436363_0494613 Ga0436363_0494613_60_467 127
423 3300039450 Ga0436363_0720254 Ga0436363_0720254_696_1103 127
424 3300039453 Ga0436362_0322118 Ga0436362_0322118_95_502 127
425 3300039453 Ga0436362_0511003 Ga0436362_0511003_475_882 127
426 3300042437 Ga0439444_0019074 Ga0439444_0019074_129_536 127
427 3300044656 Ga0466969_0116667 Ga0466969_0116667_197_604 127
428 3300044683 Ga0466965_0172548 Ga0466965_0172548_429_836 127
429 3300044683 Ga0466965_0405284 Ga0466965_0405284_181_588 127
430 3300044694 Ga0466963_0000719 Ga0466963_0000719_4229_4636 127
431 3300044694 Ga0466963_0002732 Ga0466963_0002732_9240_9647 127
432 3300044694 Ga0466963_0004857 Ga0466963_0004857_22_429 127
433 3300044735 Ga0466968_0007527 Ga0466968_0007527_3228_3635 127
434 3300044735 Ga0466968_0200147 Ga0466968_0200147_399_806 127
435 3300044765 Ga0466970_0253573 Ga0466970_0253573_283_690 127
436 3300044842 Ga0466957_0100081 Ga0466957_0100081_185_592 127
437 3300044901 Ga0466960_0928918 Ga0466960_0928918_89_496 127
438 3300045049 Ga0466959_0111552 Ga0466959_0111552_1182_1589 127
439 3300045049 Ga0466959_0133337 Ga0466959_0133337_447_854 127
440 3300045836 Ga0466958_0000670 Ga0466958_0000670_6431_6838 127
441 3300045836 Ga0466958_0009159 Ga0466958_0009159_107_514 127
442 3300045976 Ga0466967_0734792 Ga0466967_0734792_362_769 127
443 3300046500 Ga0495596_0093661 Ga0495596_0093661_233_640 127
444 3300046525 Ga0495663_0066282 Ga0495663_0066282_384_791 127
445 3300046615 Ga0495656_0660619 Ga0495656_0660619_129_536 127
446 3300046794 Ga0495589_0356467 Ga0495589_0356467_174_581 127
447 3300048911 Ga0496108_1399272 Ga0496108_1399272_76_498 127
448 3300049576 Ga0501040_0236299 Ga0501040_0236299_621_1028 127
449 3300049741 Ga0501079_0351061 Ga0501079_0351061_511_918 127
450 3300049823 Ga0501044_0854454 Ga0501044_0854454_218_625 127
451 3300050507 nmdc:mga05p37_188749_c1 nmdc:mga05p37_188749_c1_1035_1442 127
452 3300050508 nmdc:mga09592_1318712_c1 nmdc:mga09592_1318712_c1_164_571 127
453 3300050509 nmdc:mga0qj67_3118_c1 nmdc:mga0qj67_3118_c1_902_1309 127
454 3300050510 nmdc:mga06r32_1308909_c1 nmdc:mga06r32_1308909_c1_36_443 127
455 3300050510 nmdc:mga06r32_15328_c1 nmdc:mga06r32_15328_c1_602_1009 127
456 3300050511 nmdc:mga08y16_1034919_c1 nmdc:mga08y16_1034919_c1_159_566 127
457 3300053083 Ga0495655_0022041 Ga0495655_0022041_910_1317 127
458 3300054114 Ga0501084_0653261 Ga0501084_0653261_172_579 127
459 3300061719 Ga0466962_0054703 Ga0466962_0054703_1235_1642 127
460 3300003203 JGI25406J46586_10008130 JGI25406J46586_100081301 128
461 3300003373 JGI25407J50210_10004242 JGI25407J50210_100042424 128
462 3300005329 Ga0070683_100411099 Ga0070683_1004110992 128
463 3300005335 Ga0070666_10386536 Ga0070666_103865362 128
464 3300005336 Ga0070680_100826054 Ga0070680_1008260542 128
465 3300005338 Ga0068868_100668394 Ga0068868_1006683942 128
466 3300005338 Ga0068868_101143322 Ga0068868_1011433222 128
467 3300005338 Ga0068868_102120411 Ga0068868_1021204111 128
468 3300005339 Ga0070660_101854589 Ga0070660_1018545891 128
469 3300005343 Ga0070687_100699722 Ga0070687_1006997221 128
470 3300005345 Ga0070692_10097313 Ga0070692_100973131 128
471 3300005353 Ga0070669_100486770 Ga0070669_1004867702 128
472 3300005356 Ga0070674_100133932 Ga0070674_1001339322 128
473 3300005364 Ga0070673_101872463 Ga0070673_1018724631 128
474 3300005365 Ga0070688_100967303 Ga0070688_1009673032 128
475 3300005366 Ga0070659_100386477 Ga0070659_1003864772 128
476 3300005438 Ga0070701_10461014 Ga0070701_104610142 128
477 3300005441 Ga0070700_100009444 Ga0070700_1000094444 128
478 3300005441 Ga0070700_100669391 Ga0070700_1006693912 128
479 3300005456 Ga0070678_100774225 Ga0070678_1007742252 128
480 3300005457 Ga0070662_100455036 Ga0070662_1004550362 128
481 3300005458 Ga0070681_10506360 Ga0070681_105063602 128
482 3300005458 Ga0070681_10590631 Ga0070681_105906312 128
483 3300005459 Ga0068867_100463368 Ga0068867_1004633682 128
484 3300005530 Ga0070679_100366618 Ga0070679_1003666182 128
485 3300005535 Ga0070684_100289138 Ga0070684_1002891382 128
486 3300005543 Ga0070672_100362378 Ga0070672_1003623782 128
487 3300005544 Ga0070686_100335374 Ga0070686_1003353742 128
488 3300005548 Ga0070665_100879752 Ga0070665_1008797522 128
489 3300005548 Ga0070665_101444532 Ga0070665_1014445322 128
490 3300005564 Ga0070664_101220671 Ga0070664_1012206712 128
491 3300005578 Ga0068854_100068091 Ga0068854_1000680913 128
492 3300005578 Ga0068854_100314747 Ga0068854_1003147472 128
493 3300005578 Ga0068854_100323242 Ga0068854_1003232422 128
494 3300005616 Ga0068852_100720225 Ga0068852_1007202252 128
495 3300005616 Ga0068852_100977584 Ga0068852_1009775841 128
496 3300005719 Ga0068861_100150964 Ga0068861_1001509642 128
497 3300005840 Ga0068870_10530435 Ga0068870_105304351 128
498 3300005843 Ga0068860_101641818 Ga0068860_1016418182 128
499 3300005844 Ga0068862_100675278 Ga0068862_1006752782 128
500 3300005937 Ga0081455_10045365 Ga0081455_100453654 128
501 3300005937 Ga0081455_10465749 Ga0081455_104657492 128
502 3300005981 Ga0081538_10000011 Ga0081538_1000001176 128
503 3300005981 Ga0081538_10046042 Ga0081538_100460423 128
504 3300005983 Ga0081540_1004390 Ga0081540_10043902 128
505 3300005985 Ga0081539_10001944 Ga0081539_1000194430 128
506 3300006358 Ga0068871_101495379 Ga0068871_1014953792 128
507 3300006844 Ga0075428_100077918 Ga0075428_1000779182 128
508 3300006844 Ga0075428_100541517 Ga0075428_1005415172 128
509 3300006844 Ga0075428_101094822 Ga0075428_1010948222 128
510 3300006846 Ga0075430_100556924 Ga0075430_1005569242 128
511 3300006880 Ga0075429_101380091 Ga0075429_1013800912 128
512 3300006881 Ga0068865_100246228 Ga0068865_1002462282 128
513 3300006881 Ga0068865_100587653 Ga0068865_1005876532 128
514 3300006881 Ga0068865_100747312 Ga0068865_1007473122 128
515 3300009093 Ga0105240_12199090 Ga0105240_121990901 128
516 3300009093 Ga0105240_12408405 Ga0105240_124084051 128
517 3300009094 Ga0111539_10049531 Ga0111539_100495314 128
518 3300009094 Ga0111539_10101161 Ga0111539_101011612 128
519 3300009098 Ga0105245_11333505 Ga0105245_113335052 128
520 3300009147 Ga0114129_11489994 Ga0114129_114899942 128
521 3300009174 Ga0105241_12316456 Ga0105241_123164562 128
522 3300009176 Ga0105242_10783221 Ga0105242_107832211 128
523 3300009177 Ga0105248_11948079 Ga0105248_119480792 128
524 3300009551 Ga0105238_11393500 Ga0105238_113935001 128
525 3300009551 Ga0105238_11607482 Ga0105238_116074821 128
526 3300009553 Ga0105249_11434939 Ga0105249_114349392 128
527 3300011119 Ga0105246_11464593 Ga0105246_114645932 128
528 3300012505 Ga0157339_1052436 Ga0157339_10524361 128
529 3300013297 Ga0157378_12714263 Ga0157378_127142632 128
530 3300013308 Ga0157375_11015127 Ga0157375_110151272 128
531 3300013308 Ga0157375_11141521 Ga0157375_111415211 128
532 3300014326 Ga0157380_10190434 Ga0157380_101904342 128
533 3300020081 Ga0206354_11117301 Ga0206354_111173011 128
534 3300021358 Ga0213873_10075029 Ga0213873_100750292 128
535 3300021377 Ga0213874_10027729 Ga0213874_100277292 128
536 3300021384 Ga0213876_10011152 Ga0213876_100111524 128
537 3300021384 Ga0213876_10038526 Ga0213876_100385262 128
538 3300021388 Ga0213875_10090116 Ga0213875_100901162 128
539 3300021441 Ga0213871_10015760 Ga0213871_100157602 128
540 3300025903 Ga0207680_10783513 Ga0207680_107835132 128
541 3300025908 Ga0207643_10030011 Ga0207643_100300113 128
542 3300025912 Ga0207707_10386936 Ga0207707_103869362 128
543 3300025918 Ga0207662_10099955 Ga0207662_100999553 128
544 3300025919 Ga0207657_10249886 Ga0207657_102498862 128
545 3300025923 Ga0207681_10046791 Ga0207681_100467912 128
546 3300025927 Ga0207687_10867903 Ga0207687_108679032 128
547 3300025937 Ga0207669_10041575 Ga0207669_100415752 128
548 3300025938 Ga0207704_10780262 Ga0207704_107802622 128
549 3300025940 Ga0207691_10446998 Ga0207691_104469982 128
550 3300025941 Ga0207711_11319469 Ga0207711_113194692 128
551 3300025944 Ga0207661_10465448 Ga0207661_104654482 128
552 3300025944 Ga0207661_10854601 Ga0207661_108546011 128
553 3300025961 Ga0207712_10460000 Ga0207712_104600002 128
554 3300025981 Ga0207640_10217518 Ga0207640_102175183 128
555 3300025981 Ga0207640_10286387 Ga0207640_102863872 128
556 3300025981 Ga0207640_10729298 Ga0207640_107292982 128
557 3300026023 Ga0207677_10293776 Ga0207677_102937762 128
558 3300026075 Ga0207708_10649074 Ga0207708_106490742 128
559 3300026075 Ga0207708_11171772 Ga0207708_111717721 128
560 3300026089 Ga0207648_10288256 Ga0207648_102882562 128
561 3300026118 Ga0207675_100129854 Ga0207675_1001298542 128
562 3300026142 Ga0207698_10128352 Ga0207698_101283521 128
563 3300026142 Ga0207698_10543047 Ga0207698_105430472 128
564 3300026142 Ga0207698_11513329 Ga0207698_115133292 128
565 3300027907 Ga0207428_10200568 Ga0207428_102005682 128
566 3300028379 Ga0268266_10568841 Ga0268266_105688411 128
567 3300028380 Ga0268265_11503773 Ga0268265_115037732 128
568 3300028381 Ga0268264_10675963 Ga0268264_106759632 128
569 3300031548 Ga0307408_100538147 Ga0307408_1005381472 128
570 3300031731 Ga0307405_10199864 Ga0307405_101998642 128
571 3300031731 Ga0307405_10431197 Ga0307405_104311972 128
572 3300031731 Ga0307405_11052807 Ga0307405_110528072 128
573 3300031824 Ga0307413_10095978 Ga0307413_100959782 128
574 3300031824 Ga0307413_10896153 Ga0307413_108961532 128
575 3300031852 Ga0307410_10088184 Ga0307410_100881843 128
576 3300031852 Ga0307410_10142476 Ga0307410_101424762 128
577 3300031852 Ga0307410_10227872 Ga0307410_102278722 128
578 3300031852 Ga0307410_10292669 Ga0307410_102926692 128
579 3300031852 Ga0307410_10465748 Ga0307410_104657482 128
580 3300031901 Ga0307406_10237411 Ga0307406_102374112 128
581 3300031901 Ga0307406_10648832 Ga0307406_106488322 128
582 3300031903 Ga0307407_10019780 Ga0307407_100197803 128
583 3300031903 Ga0307407_10252382 Ga0307407_102523822 128
584 3300031903 Ga0307407_10609078 Ga0307407_106090782 128
585 3300031911 Ga0307412_11022557 Ga0307412_110225572 128
586 3300031995 Ga0307409_100054314 Ga0307409_1000543144 128
587 3300031995 Ga0307409_100066590 Ga0307409_1000665902 128
588 3300031995 Ga0307409_100326935 Ga0307409_1003269352 128
589 3300031995 Ga0307409_100825580 Ga0307409_1008255802 128
590 3300032002 Ga0307416_100038659 Ga0307416_1000386592 128
591 3300032002 Ga0307416_100090239 Ga0307416_1000902392 128
592 3300032002 Ga0307416_100294345 Ga0307416_1002943452 128
593 3300032002 Ga0307416_100405553 Ga0307416_1004055532 128
594 3300032002 Ga0307416_100732474 Ga0307416_1007324742 128
595 3300032004 Ga0307414_10285492 Ga0307414_102854923 128
596 3300032004 Ga0307414_11181730 Ga0307414_111817302 128
597 3300032126 Ga0307415_100355350 Ga0307415_1003553502 128
598 3300032126 Ga0307415_100427039 Ga0307415_1004270392 128
599 3300032126 Ga0307415_100591469 Ga0307415_1005914691 128
600 3300032126 Ga0307415_101455759 Ga0307415_1014557592 128
601 3300037418 Ga0395900_0723636 Ga0395900_0723636_94_504 128
602 3300037466 Ga0395898_0904171 Ga0395898_0904171_32_457 128
603 3300037466 Ga0395898_1021125 Ga0395898_1021125_313_723 128
604 3300037466 Ga0395898_1044852 Ga0395898_1044852_322_732 128
605 3300037853 Ga0436364_0034912 Ga0436364_0034912_991_1401 128
606 3300037853 Ga0436364_1096338 Ga0436364_1096338_80_490 128
607 3300038443 Ga0395901_0312434 Ga0395901_0312434_218_643 128
608 3300039437 Ga0436365_0107102 Ga0436365_0107102_10296_10706 128
609 3300039437 Ga0436365_0202207 Ga0436365_0202207_6088_6498 128
610 3300039437 Ga0436365_0978996 Ga0436365_0978996_756_1166 128
611 3300039438 Ga0436360_0215321 Ga0436360_0215321_101_511 128
612 3300039438 Ga0436360_0607721 Ga0436360_0607721_1502_1912 128
613 3300039450 Ga0436363_0247128 Ga0436363_0247128_506_916 128
614 3300039450 Ga0436363_0605155 Ga0436363_0605155_1236_1646 128
615 3300039450 Ga0436363_0715098 Ga0436363_0715098_755_1165 128
616 3300039450 Ga0436363_1154196 Ga0436363_1154196_3156_3566 128
617 3300039450 Ga0436363_1441094 Ga0436363_1441094_551_961 128
618 3300039453 Ga0436362_0112120 Ga0436362_0112120_141_551 128
619 3300042003 Ga0439443_056886 Ga0439443_056886_113_523 128
620 3300042008 Ga0439450_027123 Ga0439450_027123_304_714 128
621 3300042016 Ga0439463_018553 Ga0439463_018553_394_804 128
622 3300042016 Ga0439463_085975 Ga0439463_085975_116_526 128
623 3300042118 Ga0450914_026122 Ga0450914_026122_228_638 128
624 3300042137 Ga0450902_068813 Ga0450902_068813_91_501 128
625 3300042142 Ga0450905_004208 Ga0450905_004208_1016_1426 128
626 3300042436 Ga0439435_0097423 Ga0439435_0097423_114_524 128
627 3300042437 Ga0439444_0080024 Ga0439444_0080024_195_605 128
628 3300042438 Ga0439459_0005987 Ga0439459_0005987_1081_1491 128
629 3300042439 Ga0439464_0026297 Ga0439464_0026297_602_1012 128
630 3300044658 Ga0466972_0306560 Ga0466972_0306560_294_704 128
631 3300044693 Ga0466961_0046180 Ga0466961_0046180_1617_2027 128
632 3300044694 Ga0466963_0042028 Ga0466963_0042028_263_673 128
633 3300044719 Ga0466971_0657965 Ga0466971_0657965_74_490 128
634 3300044735 Ga0466968_0046987 Ga0466968_0046987_1341_1751 128
635 3300044735 Ga0466968_0103172 Ga0466968_0103172_41_451 128
636 3300044765 Ga0466970_0285154 Ga0466970_0285154_160_585 128
637 3300044765 Ga0466970_0680925 Ga0466970_0680925_140_565 128
638 3300044901 Ga0466960_0721045 Ga0466960_0721045_114_536 128
639 3300045049 Ga0466959_0011769 Ga0466959_0011769_4860_5270 128
640 3300045836 Ga0466958_0093935 Ga0466958_0093935_499_909 128
641 3300045836 Ga0466958_0204513 Ga0466958_0204513_704_1114 128
642 3300045836 Ga0466958_0730907 Ga0466958_0730907_144_554 128
643 3300045976 Ga0466967_0035716 Ga0466967_0035716_3616_4026 128
644 3300045976 Ga0466967_0109780 Ga0466967_0109780_2105_2518 128
645 3300045976 Ga0466967_0211276 Ga0466967_0211276_361_771 128
646 3300045976 Ga0466967_0418622 Ga0466967_0418622_839_1264 128
647 3300045976 Ga0466967_0561062 Ga0466967_0561062_317_727 128
648 3300045976 Ga0466967_0945261 Ga0466967_0945261_70_480 128
649 3300046455 Ga0495603_0770853 Ga0495603_0770853_42_458 128
650 3300046475 Ga0495639_0269178 Ga0495639_0269178_25_435 128
651 3300046491 Ga0495584_0236490 Ga0495584_0236490_455_868 128
652 3300046491 Ga0495584_0482943 Ga0495584_0482943_192_602 128
653 3300046492 Ga0495585_0249685 Ga0495585_0249685_283_693 128
654 3300046513 Ga0495616_0322874 Ga0495616_0322874_182_592 128
655 3300046515 Ga0495620_0398247 Ga0495620_0398247_65_478 128
656 3300046523 Ga0495644_0179083 Ga0495644_0179083_117_527 128
657 3300046525 Ga0495663_0212488 Ga0495663_0212488_119_529 128
658 3300046559 Ga0495667_0332587 Ga0495667_0332587_128_541 128
659 3300046648 Ga0495611_0059448 Ga0495611_0059448_484_894 128
660 3300046665 Ga0495661_0146940 Ga0495661_0146940_189_599 128
661 3300046675 Ga0495657_0054434 Ga0495657_0054434_556_969 128
662 3300047322 Ga0495680_0810587 Ga0495680_0810587_128_541 128
663 3300047471 Ga0495684_0214701 Ga0495684_0214701_389_799 128
664 3300048912 Ga0496109_0328026 Ga0496109_0328026_296_706 128
665 3300048914 Ga0496111_0370385 Ga0496111_0370385_254_664 128
666 3300048915 Ga0496112_0938568 Ga0496112_0938568_268_678 128
667 3300048916 Ga0496113_0663631 Ga0496113_0663631_285_695 128
668 3300049533 Ga0501317_034662 Ga0501317_034662_271_681 128
669 3300049569 Ga0501032_0807481 Ga0501032_0807481_103_513 128
670 3300049570 Ga0501033_0503460 Ga0501033_0503460_29_439 128
671 3300049572 Ga0501036_0281968 Ga0501036_0281968_393_803 128
672 3300049575 Ga0501039_0034479 Ga0501039_0034479_666_1076 128
673 3300049587 Ga0501071_0313949 Ga0501071_0313949_21_431 128
674 3300049588 Ga0501072_0025453 Ga0501072_0025453_3002_3412 128
675 3300049741 Ga0501079_0183393 Ga0501079_0183393_138_548 128
676 3300050507 nmdc:mga05p37_1017081_c1 nmdc:mga05p37_1017081_c1_335_745 128
677 3300050508 nmdc:mga09592_358210_c1 nmdc:mga09592_358210_c1_242_652 128
678 3300050508 nmdc:mga09592_923849_c1 nmdc:mga09592_923849_c1_202_612 128
679 3300050509 nmdc:mga0qj67_366733_c1 nmdc:mga0qj67_366733_c1_432_842 128
680 3300050509 nmdc:mga0qj67_750298_c1 nmdc:mga0qj67_750298_c1_219_629 128
681 3300050511 nmdc:mga08y16_37249_c1 nmdc:mga08y16_37249_c1_3688_4098 128
682 3300050511 nmdc:mga08y16_377180_c1 nmdc:mga08y16_377180_c1_148_558 128
683 3300050511 nmdc:mga08y16_79996_c1 nmdc:mga08y16_79996_c1_82_492 128
684 3300053083 Ga0495655_0050399 Ga0495655_0050399_23_433 128
685 3300053084 Ga0495595_0450718 Ga0495595_0450718_166_579 128
686 3300054114 Ga0501084_1457850 Ga0501084_1457850_49_459 128
687 3300061719 Ga0466962_0329315 Ga0466962_0329315_162_572 128
688 3300061734 Ga0530510_1532031 Ga0530510_1532031_78_488 128
689 3300001991 JGI24743J22301_10026030 JGI24743J22301_100260301 129
690 3300002073 JGI24745J21846_1000633 JGI24745J21846_10006332 129
691 3300002077 JGI24744J21845_10015481 JGI24744J21845_100154812 129
692 3300005327 Ga0070658_10795240 Ga0070658_107952401 129
693 3300005328 Ga0070676_10034541 Ga0070676_100345413 129
694 3300005329 Ga0070683_100001769 Ga0070683_1000017692 129
695 3300005329 Ga0070683_100005389 Ga0070683_10000538912 129
696 3300005329 Ga0070683_100065158 Ga0070683_1000651582 129
697 3300005329 Ga0070683_101080965 Ga0070683_1010809651 129
698 3300005334 Ga0068869_100110975 Ga0068869_1001109752 129
699 3300005335 Ga0070666_11270535 Ga0070666_112705351 129
700 3300005336 Ga0070680_100002392 Ga0070680_10000239215 129
701 3300005337 Ga0070682_100019701 Ga0070682_1000197014 129
702 3300005338 Ga0068868_100007906 Ga0068868_1000079063 129
703 3300005339 Ga0070660_100415363 Ga0070660_1004153631 129
704 3300005339 Ga0070660_100488225 Ga0070660_1004882251 129
705 3300005340 Ga0070689_100302110 Ga0070689_1003021102 129
706 3300005341 Ga0070691_10036620 Ga0070691_100366202 129
707 3300005344 Ga0070661_100429907 Ga0070661_1004299072 129
708 3300005345 Ga0070692_10000136 Ga0070692_100001362 129
709 3300005345 Ga0070692_10048536 Ga0070692_100485362 129
710 3300005345 Ga0070692_10157652 Ga0070692_101576522 129
711 3300005347 Ga0070668_100266310 Ga0070668_1002663102 129
712 3300005353 Ga0070669_100001051 Ga0070669_10000105114 129
713 3300005353 Ga0070669_100875568 Ga0070669_1008755682 129
714 3300005356 Ga0070674_100324440 Ga0070674_1003244402 129
715 3300005356 Ga0070674_100576315 Ga0070674_1005763152 129
716 3300005364 Ga0070673_100142138 Ga0070673_1001421383 129
717 3300005365 Ga0070688_100197424 Ga0070688_1001974242 129
718 3300005366 Ga0070659_100001163 Ga0070659_10000116313 129
719 3300005366 Ga0070659_100002782 Ga0070659_10000278214 129
720 3300005366 Ga0070659_100051525 Ga0070659_1000515253 129
721 3300005434 Ga0070709_10408443 Ga0070709_104084432 129
722 3300005435 Ga0070714_100090477 Ga0070714_1000904772 129
723 3300005435 Ga0070714_100306176 Ga0070714_1003061762 129
724 3300005435 Ga0070714_100378371 Ga0070714_1003783712 129
725 3300005435 Ga0070714_100436645 Ga0070714_1004366452 129
726 3300005435 Ga0070714_100764017 Ga0070714_1007640172 129
727 3300005435 Ga0070714_100878691 Ga0070714_1008786911 129
728 3300005435 Ga0070714_100971882 Ga0070714_1009718822 129
729 3300005435 Ga0070714_101112441 Ga0070714_1011124412 129
730 3300005436 Ga0070713_100532487 Ga0070713_1005324872 129
731 3300005437 Ga0070710_10000002 Ga0070710_10000002228 129
732 3300005438 Ga0070701_10714341 Ga0070701_107143411 129
733 3300005439 Ga0070711_100105216 Ga0070711_1001052162 129
734 3300005439 Ga0070711_101109969 Ga0070711_1011099691 129
735 3300005440 Ga0070705_100034145 Ga0070705_1000341452 129
736 3300005440 Ga0070705_100218328 Ga0070705_1002183282 129
737 3300005441 Ga0070700_100011166 Ga0070700_1000111664 129
738 3300005441 Ga0070700_100729392 Ga0070700_1007293922 129
739 3300005444 Ga0070694_100262805 Ga0070694_1002628052 129
740 3300005455 Ga0070663_100038538 Ga0070663_1000385382 129
741 3300005456 Ga0070678_100019340 Ga0070678_1000193403 129
742 3300005457 Ga0070662_100344678 Ga0070662_1003446782 129
743 3300005458 Ga0070681_10019241 Ga0070681_100192417 129
744 3300005459 Ga0068867_100965437 Ga0068867_1009654371 129
745 3300005535 Ga0070684_100013185 Ga0070684_1000131854 129
746 3300005535 Ga0070684_100020346 Ga0070684_1000203464 129
747 3300005535 Ga0070684_100828381 Ga0070684_1008283812 129
748 3300005539 Ga0068853_100339934 Ga0068853_1003399342 129
749 3300005539 Ga0068853_100833657 Ga0068853_1008336572 129
750 3300005543 Ga0070672_100264294 Ga0070672_1002642942 129
751 3300005544 Ga0070686_100174306 Ga0070686_1001743062 129
752 3300005547 Ga0070693_100202519 Ga0070693_1002025192 129
753 3300005548 Ga0070665_100087378 Ga0070665_1000873784 129
754 3300005549 Ga0070704_101138210 Ga0070704_1011382101 129
755 3300005564 Ga0070664_100121454 Ga0070664_1001214542 129
756 3300005564 Ga0070664_100499092 Ga0070664_1004990921 129
757 3300005577 Ga0068857_100350155 Ga0068857_1003501552 129
758 3300005614 Ga0068856_100012413 Ga0068856_1000124132 129
759 3300005614 Ga0068856_100048650 Ga0068856_1000486504 129
760 3300005615 Ga0070702_100011498 Ga0070702_1000114984 129
761 3300005615 Ga0070702_100611406 Ga0070702_1006114062 129
762 3300005615 Ga0070702_101081414 Ga0070702_1010814141 129
763 3300005616 Ga0068852_100003014 Ga0068852_10000301415 129
764 3300005616 Ga0068852_100058926 Ga0068852_1000589263 129
765 3300005616 Ga0068852_100851039 Ga0068852_1008510392 129
766 3300005617 Ga0068859_100114585 Ga0068859_1001145852 129
767 3300005617 Ga0068859_100140060 Ga0068859_1001400603 129
768 3300005618 Ga0068864_100013258 Ga0068864_1000132588 129
769 3300005618 Ga0068864_101034308 Ga0068864_1010343081 129
770 3300005718 Ga0068866_10142086 Ga0068866_101420862 129
771 3300005719 Ga0068861_100543011 Ga0068861_1005430112 129
772 3300005841 Ga0068863_101856089 Ga0068863_1018560891 129
773 3300005842 Ga0068858_100176523 Ga0068858_1001765232 129
774 3300005843 Ga0068860_100639161 Ga0068860_1006391612 129
775 3300005981 Ga0081538_10000332 Ga0081538_1000033221 129
776 3300005981 Ga0081538_10000575 Ga0081538_1000057515 129
777 3300005981 Ga0081538_10000661 Ga0081538_1000066118 129
778 3300005981 Ga0081538_10005330 Ga0081538_100053303 129
779 3300005981 Ga0081538_10053060 Ga0081538_100530602 129
780 3300005981 Ga0081538_10077619 Ga0081538_100776192 129
781 3300005981 Ga0081538_10251991 Ga0081538_102519911 129
782 3300005985 Ga0081539_10095149 Ga0081539_100951491 129
783 3300006028 Ga0070717_10000006 Ga0070717_1000000634 129
784 3300006028 Ga0070717_10245645 Ga0070717_102456452 129
785 3300006028 Ga0070717_10443286 Ga0070717_104432862 129
786 3300006028 Ga0070717_11156375 Ga0070717_111563752 129
787 3300006048 Ga0075363_100292688 Ga0075363_1002926881 129
788 3300006058 Ga0075432_10006336 Ga0075432_100063364 129
789 3300006058 Ga0075432_10059584 Ga0075432_100595842 129
790 3300006175 Ga0070712_100000003 Ga0070712_100000003166 129
791 3300006175 Ga0070712_100038037 Ga0070712_1000380373 129
792 3300006175 Ga0070712_100325174 Ga0070712_1003251742 129
793 3300006358 Ga0068871_101921042 Ga0068871_1019210422 129
794 3300006844 Ga0075428_100167725 Ga0075428_1001677253 129
795 3300006844 Ga0075428_100930275 Ga0075428_1009302752 129
796 3300006846 Ga0075430_100007231 Ga0075430_10000723111 129
797 3300006846 Ga0075430_100705854 Ga0075430_1007058541 129
798 3300006847 Ga0075431_100117445 Ga0075431_1001174452 129
799 3300006847 Ga0075431_100322143 Ga0075431_1003221432 129
800 3300006852 Ga0075433_10894261 Ga0075433_108942612 129
801 3300006871 Ga0075434_100077536 Ga0075434_1000775362 129
802 3300006871 Ga0075434_100550722 Ga0075434_1005507222 129
803 3300006871 Ga0075434_101355076 Ga0075434_1013550762 129
804 3300006880 Ga0075429_100050567 Ga0075429_1000505673 129
805 3300006881 Ga0068865_100045446 Ga0068865_1000454463 129
806 3300006881 Ga0068865_100682997 Ga0068865_1006829972 129
807 3300006881 Ga0068865_102184931 Ga0068865_1021849311 129
808 3300006914 Ga0075436_100642285 Ga0075436_1006422852 129
809 3300006931 Ga0097620_100114589 Ga0097620_1001145892 129
810 3300006931 Ga0097620_100140051 Ga0097620_1001400512 129
811 3300007076 Ga0075435_100253741 Ga0075435_1002537412 129
812 3300009093 Ga0105240_10016903 Ga0105240_1001690314 129
813 3300009094 Ga0111539_10071125 Ga0111539_100711254 129
814 3300009094 Ga0111539_10108851 Ga0111539_101088514 129
815 3300009094 Ga0111539_12473750 Ga0111539_124737501 129
816 3300009098 Ga0105245_10010141 Ga0105245_100101414 129
817 3300009098 Ga0105245_11175682 Ga0105245_111756821 129
818 3300009147 Ga0114129_10661191 Ga0114129_106611911 129
819 3300009147 Ga0114129_12205259 Ga0114129_122052591 129
820 3300009147 Ga0114129_12222574 Ga0114129_122225742 129
821 3300009148 Ga0105243_10154812 Ga0105243_101548122 129
822 3300009148 Ga0105243_10477290 Ga0105243_104772902 129
823 3300009148 Ga0105243_11772142 Ga0105243_117721421 129
824 3300009148 Ga0105243_12139034 Ga0105243_121390342 129
825 3300009176 Ga0105242_10475303 Ga0105242_104753032 129
826 3300009176 Ga0105242_11213175 Ga0105242_112131751 129
827 3300009177 Ga0105248_10696823 Ga0105248_106968232 129
828 3300009545 Ga0105237_10553258 Ga0105237_105532582 129
829 3300009551 Ga0105238_10004565 Ga0105238_100045652 129
830 3300009551 Ga0105238_10314074 Ga0105238_103140742 129
831 3300009551 Ga0105238_10525711 Ga0105238_105257112 129
832 3300009551 Ga0105238_10742089 Ga0105238_107420892 129
833 3300009551 Ga0105238_12278149 Ga0105238_122781492 129
834 3300009553 Ga0105249_10359370 Ga0105249_103593702 129
835 3300009553 Ga0105249_10420309 Ga0105249_104203092 129
836 3300009553 Ga0105249_12681104 Ga0105249_126811041 129
837 3300010375 Ga0105239_10013083 Ga0105239_100130833 129
838 3300010375 Ga0105239_10147635 Ga0105239_101476352 129
839 3300010375 Ga0105239_10231529 Ga0105239_102315292 129
840 3300010375 Ga0105239_10524822 Ga0105239_105248221 129
841 3300011119 Ga0105246_10011127 Ga0105246_100111272 129
842 3300013102 Ga0157371_10373423 Ga0157371_103734232 129
843 3300013104 Ga0157370_10015527 Ga0157370_100155277 129
844 3300013105 Ga0157369_10015461 Ga0157369_100154617 129
845 3300013105 Ga0157369_10893498 Ga0157369_108934981 129
846 3300013296 Ga0157374_10036527 Ga0157374_100365274 129
847 3300013297 Ga0157378_10147313 Ga0157378_101473132 129
848 3300013306 Ga0163162_10379293 Ga0163162_103792932 129
849 3300013307 Ga0157372_10030245 Ga0157372_100302452 129
850 3300013307 Ga0157372_10093470 Ga0157372_100934702 129
851 3300013307 Ga0157372_10847953 Ga0157372_108479532 129
852 3300013308 Ga0157375_10727784 Ga0157375_107277842 129
853 3300013308 Ga0157375_10893758 Ga0157375_108937581 129
854 3300014325 Ga0163163_10051838 Ga0163163_100518384 129
855 3300014325 Ga0163163_11384889 Ga0163163_113848892 129
856 3300014325 Ga0163163_11496423 Ga0163163_114964232 129
857 3300014326 Ga0157380_10344823 Ga0157380_103448232 129
858 3300014326 Ga0157380_10364467 Ga0157380_103644672 129
859 3300014326 Ga0157380_11012868 Ga0157380_110128682 129
860 3300014497 Ga0182008_10413741 Ga0182008_104137412 129
861 3300014745 Ga0157377_10003737 Ga0157377_100037375 129
862 3300014745 Ga0157377_10414002 Ga0157377_104140022 129
863 3300014968 Ga0157379_10997880 Ga0157379_109978801 129
864 3300014969 Ga0157376_10030022 Ga0157376_100300224 129
865 3300020069 Ga0197907_10473012 Ga0197907_104730122 129
866 3300020081 Ga0206354_10206908 Ga0206354_102069082 129
867 3300020082 Ga0206353_10452253 Ga0206353_104522532 129
868 3300020082 Ga0206353_11318428 Ga0206353_113184281 129
869 3300021377 Ga0213874_10383224 Ga0213874_103832242 129
870 3300021384 Ga0213876_10033411 Ga0213876_100334113 129
871 3300021384 Ga0213876_10055739 Ga0213876_100557392 129
872 3300021384 Ga0213876_10437910 Ga0213876_104379102 129
873 3300021388 Ga0213875_10011062 Ga0213875_100110622 129
874 3300021388 Ga0213875_10114793 Ga0213875_101147932 129
875 3300021388 Ga0213875_10313815 Ga0213875_103138152 129
876 3300022467 Ga0224712_10064589 Ga0224712_100645892 129
877 3300022467 Ga0224712_10319831 Ga0224712_103198311 129
878 3300025302 Ga0207426_1040103 Ga0207426_10401032 129
879 3300025898 Ga0207692_10000005 Ga0207692_10000005129 129
880 3300025901 Ga0207688_10003829 Ga0207688_100038296 129
881 3300025904 Ga0207647_10094864 Ga0207647_100948642 129
882 3300025906 Ga0207699_10057245 Ga0207699_100572453 129
883 3300025907 Ga0207645_10106839 Ga0207645_101068392 129
884 3300025909 Ga0207705_11380766 Ga0207705_113807662 129
885 3300025912 Ga0207707_10025333 Ga0207707_100253337 129
886 3300025912 Ga0207707_11043035 Ga0207707_110430351 129
887 3300025913 Ga0207695_10023649 Ga0207695_100236493 129
888 3300025913 Ga0207695_10288200 Ga0207695_102882001 129
889 3300025915 Ga0207693_10000009 Ga0207693_1000000974 129
890 3300025915 Ga0207693_10053117 Ga0207693_100531172 129
891 3300025916 Ga0207663_10298282 Ga0207663_102982822 129
892 3300025917 Ga0207660_10066549 Ga0207660_100665492 129
893 3300025919 Ga0207657_10004005 Ga0207657_1000400516 129
894 3300025919 Ga0207657_10036782 Ga0207657_100367822 129
895 3300025919 Ga0207657_10054538 Ga0207657_100545383 129
896 3300025920 Ga0207649_10342843 Ga0207649_103428432 129
897 3300025921 Ga0207652_10010707 Ga0207652_100107074 129
898 3300025923 Ga0207681_10000842 Ga0207681_100008422 129
899 3300025923 Ga0207681_10745143 Ga0207681_107451432 129
900 3300025925 Ga0207650_10519986 Ga0207650_105199862 129
901 3300025925 Ga0207650_11376744 Ga0207650_113767441 129
902 3300025926 Ga0207659_10584440 Ga0207659_105844402 129
903 3300025927 Ga0207687_10014755 Ga0207687_100147552 129
904 3300025927 Ga0207687_11064065 Ga0207687_110640652 129
905 3300025928 Ga0207700_10496315 Ga0207700_104963152 129
906 3300025929 Ga0207664_10000060 Ga0207664_1000006091 129
907 3300025929 Ga0207664_10188242 Ga0207664_101882422 129
908 3300025929 Ga0207664_10318717 Ga0207664_103187172 129
909 3300025929 Ga0207664_11047159 Ga0207664_110471592 129
910 3300025929 Ga0207664_11817532 Ga0207664_118175322 129
911 3300025932 Ga0207690_10000117 Ga0207690_1000011730 129
912 3300025932 Ga0207690_10049659 Ga0207690_100496593 129
913 3300025932 Ga0207690_11208100 Ga0207690_112081001 129
914 3300025933 Ga0207706_10440371 Ga0207706_104403711 129
915 3300025935 Ga0207709_10622508 Ga0207709_106225081 129
916 3300025935 Ga0207709_10703700 Ga0207709_107037002 129
917 3300025937 Ga0207669_10266074 Ga0207669_102660742 129
918 3300025939 Ga0207665_10428987 Ga0207665_104289872 129
919 3300025939 Ga0207665_10684908 Ga0207665_106849081 129
920 3300025940 Ga0207691_10178584 Ga0207691_101785842 129
921 3300025940 Ga0207691_10225485 Ga0207691_102254852 129
922 3300025944 Ga0207661_10006238 Ga0207661_100062387 129
923 3300025944 Ga0207661_10058321 Ga0207661_100583212 129
924 3300025944 Ga0207661_10117253 Ga0207661_101172532 129
925 3300025945 Ga0207679_10338246 Ga0207679_103382462 129
926 3300025960 Ga0207651_10044941 Ga0207651_100449413 129
927 3300025961 Ga0207712_10429568 Ga0207712_104295682 129
928 3300025961 Ga0207712_10456486 Ga0207712_104564862 129
929 3300025961 Ga0207712_11284097 Ga0207712_112840972 129
930 3300025972 Ga0207668_10383025 Ga0207668_103830252 129
931 3300025981 Ga0207640_10034311 Ga0207640_100343113 129
932 3300025981 Ga0207640_10150101 Ga0207640_101501012 129
933 3300026023 Ga0207677_10018542 Ga0207677_100185422 129
934 3300026041 Ga0207639_10253122 Ga0207639_102531222 129
935 3300026067 Ga0207678_10083252 Ga0207678_100832522 129
936 3300026067 Ga0207678_10646927 Ga0207678_106469272 129
937 3300026075 Ga0207708_10000504 Ga0207708_1000050419 129
938 3300026078 Ga0207702_10038108 Ga0207702_100381083 129
939 3300026078 Ga0207702_10188237 Ga0207702_101882372 129
940 3300026078 Ga0207702_10753456 Ga0207702_107534562 129
941 3300026078 Ga0207702_11489325 Ga0207702_114893252 129
942 3300026089 Ga0207648_10514494 Ga0207648_105144942 129
943 3300026089 Ga0207648_11133347 Ga0207648_111333472 129
944 3300026095 Ga0207676_10249333 Ga0207676_102493332 129
945 3300026095 Ga0207676_10828493 Ga0207676_108284932 129
946 3300026116 Ga0207674_10052366 Ga0207674_100523664 129
947 3300026116 Ga0207674_10580589 Ga0207674_105805892 129
948 3300026118 Ga0207675_100170004 Ga0207675_1001700042 129
949 3300026118 Ga0207675_100261448 Ga0207675_1002614482 129
950 3300026121 Ga0207683_10017272 Ga0207683_100172724 129
951 3300026142 Ga0207698_10012232 Ga0207698_100122324 129
952 3300026142 Ga0207698_10049753 Ga0207698_100497532 129
953 3300026142 Ga0207698_11387147 Ga0207698_113871471 129
954 3300026142 Ga0207698_11455637 Ga0207698_114556372 129
955 3300027907 Ga0207428_10116975 Ga0207428_101169752 129
956 3300028379 Ga0268266_10069326 Ga0268266_100693261 129
957 3300028381 Ga0268264_12693824 Ga0268264_126938241 129
958 3300028558 Ga0265326_10000024 Ga0265326_1000002414 129
959 3300028563 Ga0265319_1002433 Ga0265319_10024335 129
960 3300028573 Ga0265334_10000078 Ga0265334_1000007856 129
961 3300028800 Ga0265338_10011681 Ga0265338_100116814 129
962 3300029957 Ga0265324_10009205 Ga0265324_100092053 129
963 3300031240 Ga0265320_10046594 Ga0265320_100465942 129
964 3300031731 Ga0307405_10381189 Ga0307405_103811892 129
965 3300031824 Ga0307413_10685547 Ga0307413_106855471 129
966 3300031852 Ga0307410_11361494 Ga0307410_113614941 129
967 3300031901 Ga0307406_10169877 Ga0307406_101698772 129
968 3300031995 Ga0307409_100081803 Ga0307409_1000818032 129
969 3300032002 Ga0307416_100178288 Ga0307416_1001782882 129
970 3300032005 Ga0307411_11522553 Ga0307411_115225532 129
971 3300032126 Ga0307415_100043520 Ga0307415_1000435202 129
972 3300035119 Ga0373956_0402941 Ga0373956_0402941_117_530 129
973 3300037418 Ga0395900_0056497 Ga0395900_0056497_312_737 129
974 3300037418 Ga0395900_0847330 Ga0395900_0847330_143_556 129
975 3300037418 Ga0395900_1844523 Ga0395900_1844523_20_448 129
976 3300037466 Ga0395898_0060062 Ga0395898_0060062_281_706 129
977 3300037466 Ga0395898_0319916 Ga0395898_0319916_400_813 129
978 3300037466 Ga0395898_0536122 Ga0395898_0536122_56_484 129
979 3300037853 Ga0436364_0004833 Ga0436364_0004833_268_681 129
980 3300037853 Ga0436364_0176805 Ga0436364_0176805_7972_8385 129
981 3300037853 Ga0436364_0362965 Ga0436364_0362965_622_1038 129
982 3300037853 Ga0436364_0618250 Ga0436364_0618250_2868_3281 129
983 3300037853 Ga0436364_0623278 Ga0436364_0623278_47_463 129
984 3300037853 Ga0436364_0858177 Ga0436364_0858177_828_1244 129
985 3300037853 Ga0436364_1105959 Ga0436364_1105959_2200_2616 129
986 3300037853 Ga0436364_1277692 Ga0436364_1277692_37_450 129
987 3300037853 Ga0436364_1551956 Ga0436364_1551956_142_558 129
988 3300037853 Ga0436364_1562180 Ga0436364_1562180_405_818 129
989 3300038443 Ga0395901_0306132 Ga0395901_0306132_652_1065 129
990 3300038443 Ga0395901_0330672 Ga0395901_0330672_334_759 129
991 3300039437 Ga0436365_0156161 Ga0436365_0156161_3601_4017 129
992 3300039437 Ga0436365_0746115 Ga0436365_0746115_134_547 129
993 3300039437 Ga0436365_0818994 Ga0436365_0818994_1768_2181 129
994 3300039437 Ga0436365_1351567 Ga0436365_1351567_305_721 129
995 3300039437 Ga0436365_1887722 Ga0436365_1887722_302_718 129
996 3300039438 Ga0436360_1130529 Ga0436360_1130529_489_902 129
997 3300039450 Ga0436363_0675171 Ga0436363_0675171_298_714 129
998 3300039450 Ga0436363_0795428 Ga0436363_0795428_766_1179 129
999 3300039450 Ga0436363_0951790 Ga0436363_0951790_247_660 129
1000 3300039450 Ga0436363_1303994 Ga0436363_1303994_69_482 129
1001 3300039450 Ga0436363_1339470 Ga0436363_1339470_646_1059 129
1002 3300039450 Ga0436363_1720810 Ga0436363_1720810_729_1145 129
1003 3300039453 Ga0436362_0736330 Ga0436362_0736330_192_605 129
1004 3300039453 Ga0436362_0992033 Ga0436362_0992033_1084_1497 129
1005 3300041451 Ga0451791_0546527 Ga0451791_0546527_283_696 129
1006 3300041453 Ga0451797_1414214 Ga0451797_1414214_294_707 129
1007 3300041463 Ga0451804_0879486 Ga0451804_0879486_20_433 129
1008 3300041494 Ga0451837_0425334 Ga0451837_0425334_311_724 129
1009 3300041511 Ga0451855_1358094 Ga0451855_1358094_52_468 129
1010 3300041512 Ga0451853_2611373 Ga0451853_2611373_716_1138 129
1011 3300042126 Ga0450888_037860 Ga0450888_037860_214_630 129
1012 3300044658 Ga0466972_0378525 Ga0466972_0378525_193_606 129
1013 3300044683 Ga0466965_0040897 Ga0466965_0040897_20_433 129
1014 3300044684 Ga0466966_0040682 Ga0466966_0040682_472_885 129
1015 3300044684 Ga0466966_0316202 Ga0466966_0316202_321_746 129
1016 3300044684 Ga0466966_0742985 Ga0466966_0742985_34_450 129
1017 3300044693 Ga0466961_0257037 Ga0466961_0257037_130_543 129
1018 3300044694 Ga0466963_0021568 Ga0466963_0021568_3036_3452 129
1019 3300044694 Ga0466963_0084764 Ga0466963_0084764_1088_1504 129
1020 3300044694 Ga0466963_0132117 Ga0466963_0132117_747_1160 129
1021 3300044694 Ga0466963_1160138 Ga0466963_1160138_62_475 129
1022 3300044719 Ga0466971_0044510 Ga0466971_0044510_257_670 129
1023 3300044719 Ga0466971_0116326 Ga0466971_0116326_139_555 129
1024 3300044735 Ga0466968_0116729 Ga0466968_0116729_75_488 129
1025 3300044735 Ga0466968_0175033 Ga0466968_0175033_164_577 129
1026 3300044735 Ga0466968_0283751 Ga0466968_0283751_232_645 129
1027 3300044735 Ga0466968_0630579 Ga0466968_0630579_56_472 129
1028 3300044765 Ga0466970_0059077 Ga0466970_0059077_1623_2042 129
1029 3300044765 Ga0466970_0102444 Ga0466970_0102444_240_653 129
1030 3300044842 Ga0466957_0019541 Ga0466957_0019541_1320_1733 129
1031 3300044842 Ga0466957_0294371 Ga0466957_0294371_217_633 129
1032 3300044842 Ga0466957_0393551 Ga0466957_0393551_66_479 129
1033 3300044901 Ga0466960_0000213 Ga0466960_0000213_15710_16141 129
1034 3300044901 Ga0466960_0617000 Ga0466960_0617000_77_490 129
1035 3300045049 Ga0466959_0253925 Ga0466959_0253925_671_1084 129
1036 3300045049 Ga0466959_0257734 Ga0466959_0257734_750_1163 129
1037 3300045049 Ga0466959_0275738 Ga0466959_0275738_139_552 129
1038 3300045049 Ga0466959_0291655 Ga0466959_0291655_425_841 129
1039 3300045049 Ga0466959_0693210 Ga0466959_0693210_60_476 129
1040 3300045836 Ga0466958_0047094 Ga0466958_0047094_2124_2540 129
1041 3300045836 Ga0466958_0107606 Ga0466958_0107606_10_429 129
1042 3300045836 Ga0466958_0204335 Ga0466958_0204335_465_881 129
1043 3300045836 Ga0466958_0260538 Ga0466958_0260538_124_537 129
1044 3300045836 Ga0466958_0337781 Ga0466958_0337781_31_444 129
1045 3300045836 Ga0466958_0791623 Ga0466958_0791623_123_536 129
1046 3300045976 Ga0466967_0006662 Ga0466967_0006662_6989_7402 129
1047 3300045976 Ga0466967_0021890 Ga0466967_0021890_565_981 129
1048 3300045976 Ga0466967_0077437 Ga0466967_0077437_2314_2730 129
1049 3300045976 Ga0466967_0415651 Ga0466967_0415651_637_1050 129
1050 3300045976 Ga0466967_0558642 Ga0466967_0558642_375_788 129
1051 3300045976 Ga0466967_0714330 Ga0466967_0714330_258_671 129
1052 3300045976 Ga0466967_0954268 Ga0466967_0954268_242_670 129
1053 3300045976 Ga0466967_1089489 Ga0466967_1089489_259_672 129
1054 3300045976 Ga0466967_1223594 Ga0466967_1223594_119_532 129
1055 3300045976 Ga0466967_1449726 Ga0466967_1449726_184_597 129
1056 3300045976 Ga0466967_1588489 Ga0466967_1588489_34_447 129
1057 3300045976 Ga0466967_1829685 Ga0466967_1829685_114_527 129
1058 3300046459 Ga0495629_0733573 Ga0495629_0733573_134_562 129
1059 3300046471 Ga0495650_0000055 Ga0495650_0000055_237630_238052 129
1060 3300046477 Ga0495664_0221690 Ga0495664_0221690_189_602 129
1061 3300046511 Ga0495608_0178117 Ga0495608_0178117_686_1099 129
1062 3300046529 Ga0495652_0569606 Ga0495652_0569606_351_764 129
1063 3300046535 Ga0495586_0178729 Ga0495586_0178729_341_754 129
1064 3300046675 Ga0495657_0436274 Ga0495657_0436274_267_680 129
1065 3300046679 Ga0495623_0549572 Ga0495623_0549572_140_556 129
1066 3300046680 Ga0495646_0581624 Ga0495646_0581624_113_526 129
1067 3300046689 Ga0495613_0319774 Ga0495613_0319774_618_1031 129
1068 3300047317 Ga0495604_0407448 Ga0495604_0407448_181_594 129
1069 3300047320 Ga0495672_0004233 Ga0495672_0004233_681_1097 129
1070 3300047320 Ga0495672_0320297 Ga0495672_0320297_95_508 129
1071 3300047471 Ga0495684_1090262 Ga0495684_1090262_55_468 129
1072 3300048088 Ga0495602_0584238 Ga0495602_0584238_274_687 129
1073 3300048903 Ga0496100_0064551 Ga0496100_0064551_758_1171 129
1074 3300048903 Ga0496100_0277635 Ga0496100_0277635_817_1230 129
1075 3300048904 Ga0496101_0023275 Ga0496101_0023275_1322_1735 129
1076 3300048904 Ga0496101_0224586 Ga0496101_0224586_53_481 129
1077 3300048904 Ga0496101_1126087 Ga0496101_1126087_63_476 129
1078 3300048905 Ga0496102_0006596 Ga0496102_0006596_4022_4435 129
1079 3300048905 Ga0496102_0385772 Ga0496102_0385772_159_572 129
1080 3300048906 Ga0496103_0262702 Ga0496103_0262702_434_847 129
1081 3300048907 Ga0496104_0004544 Ga0496104_0004544_9878_10291 129
1082 3300048907 Ga0496104_0073904 Ga0496104_0073904_322_735 129
1083 3300048908 Ga0496105_0001407 Ga0496105_0001407_4096_4509 129
1084 3300048908 Ga0496105_0466659 Ga0496105_0466659_282_707 129
1085 3300048908 Ga0496105_0873748 Ga0496105_0873748_243_665 129
1086 3300048909 Ga0496106_0015850 Ga0496106_0015850_4729_5142 129
1087 3300048910 Ga0496107_0095717 Ga0496107_0095717_446_859 129
1088 3300048911 Ga0496108_0112393 Ga0496108_0112393_1310_1723 129
1089 3300048911 Ga0496108_0783126 Ga0496108_0783126_87_509 129
1090 3300048912 Ga0496109_0005281 Ga0496109_0005281_4067_4480 129
1091 3300048912 Ga0496109_0245480 Ga0496109_0245480_1217_1630 129
1092 3300048912 Ga0496109_0767304 Ga0496109_0767304_399_827 129
1093 3300048913 Ga0496110_0046036 Ga0496110_0046036_472_885 129
1094 3300048913 Ga0496110_0360550 Ga0496110_0360550_489_902 129
1095 3300048913 Ga0496110_0579542 Ga0496110_0579542_139_552 129
1096 3300048913 Ga0496110_0608401 Ga0496110_0608401_289_717 129
1097 3300048914 Ga0496111_0019707 Ga0496111_0019707_971_1384 129
1098 3300048914 Ga0496111_0159698 Ga0496111_0159698_1031_1444 129
1099 3300048914 Ga0496111_0322857 Ga0496111_0322857_550_963 129
1100 3300048915 Ga0496112_0000411 Ga0496112_0000411_2264_2677 129
1101 3300048915 Ga0496112_0016212 Ga0496112_0016212_695_1108 129
1102 3300048915 Ga0496112_0162688 Ga0496112_0162688_1128_1556 129
1103 3300048915 Ga0496112_0784677 Ga0496112_0784677_84_497 129
1104 3300048916 Ga0496113_0037504 Ga0496113_0037504_1085_1498 129
1105 3300048916 Ga0496113_0430564 Ga0496113_0430564_79_507 129
1106 3300048916 Ga0496113_0790171 Ga0496113_0790171_298_711 129
1107 3300048916 Ga0496113_0833394 Ga0496113_0833394_193_606 129
1108 3300048917 Ga0496114_0128052 Ga0496114_0128052_1600_2013 129
1109 3300048917 Ga0496114_0460034 Ga0496114_0460034_395_808 129
1110 3300048918 Ga0496115_0154470 Ga0496115_0154470_1331_1744 129
1111 3300048918 Ga0496115_0692406 Ga0496115_0692406_304_717 129
1112 3300048929 Ga0496126_0515789 Ga0496126_0515789_310_732 129
1113 3300049127 Ga0501306_059166 Ga0501306_059166_199_612 129
1114 3300049130 Ga0501310_055308 Ga0501310_055308_152_565 129
1115 3300049528 Ga0501312_066044 Ga0501312_066044_68_499 129
1116 3300049534 Ga0501318_059975 Ga0501318_059975_152_565 129
1117 3300049539 Ga0501323_040575 Ga0501323_040575_258_671 129
1118 3300049568 Ga0501031_0074946 Ga0501031_0074946_1453_1878 129
1119 3300049569 Ga0501032_0236057 Ga0501032_0236057_460_885 129
1120 3300049571 Ga0501034_0059629 Ga0501034_0059629_1088_1516 129
1121 3300049571 Ga0501034_0826968 Ga0501034_0826968_186_611 129
1122 3300049571 Ga0501034_1075038 Ga0501034_1075038_237_656 129
1123 3300049571 Ga0501034_1161417 Ga0501034_1161417_11_424 129
1124 3300049572 Ga0501036_0256667 Ga0501036_0256667_1024_1449 129
1125 3300049573 Ga0501037_0028680 Ga0501037_0028680_3502_3927 129
1126 3300049574 Ga0501038_0028807 Ga0501038_0028807_1262_1687 129
1127 3300049574 Ga0501038_0211572 Ga0501038_0211572_1112_1525 129
1128 3300049574 Ga0501038_0215540 Ga0501038_0215540_549_962 129
1129 3300049575 Ga0501039_0267196 Ga0501039_0267196_32_457 129
1130 3300049575 Ga0501039_0576475 Ga0501039_0576475_374_787 129
1131 3300049576 Ga0501040_0042133 Ga0501040_0042133_1694_2107 129
1132 3300049576 Ga0501040_0942599 Ga0501040_0942599_38_451 129
1133 3300049576 Ga0501040_1381930 Ga0501040_1381930_30_443 129
1134 3300049577 Ga0501041_0191422 Ga0501041_0191422_92_505 129
1135 3300049578 Ga0501042_0021613 Ga0501042_0021613_1036_1449 129
1136 3300049578 Ga0501042_0205985 Ga0501042_0205985_922_1347 129
1137 3300049578 Ga0501042_1131911 Ga0501042_1131911_70_486 129
1138 3300049579 Ga0501043_0092731 Ga0501043_0092731_488_913 129
1139 3300049580 Ga0501046_0203022 Ga0501046_0203022_847_1260 129
1140 3300049581 Ga0501047_1259067 Ga0501047_1259067_110_535 129
1141 3300049582 Ga0501048_0074714 Ga0501048_0074714_835_1260 129
1142 3300049582 Ga0501048_0080369 Ga0501048_0080369_1022_1435 129
1143 3300049583 Ga0501067_0169944 Ga0501067_0169944_138_563 129
1144 3300049584 Ga0501068_0012280 Ga0501068_0012280_349_774 129
1145 3300049584 Ga0501068_0515389 Ga0501068_0515389_123_554 129
1146 3300049585 Ga0501069_0006139 Ga0501069_0006139_5743_6174 129
1147 3300049585 Ga0501069_0997723 Ga0501069_0997723_60_473 129
1148 3300049586 Ga0501070_0037404 Ga0501070_0037404_3594_4019 129
1149 3300049587 Ga0501071_0232695 Ga0501071_0232695_354_767 129
1150 3300049587 Ga0501071_0393860 Ga0501071_0393860_536_961 129
1151 3300049588 Ga0501072_0046952 Ga0501072_0046952_2826_3239 129
1152 3300049588 Ga0501072_0688579 Ga0501072_0688579_262_687 129
1153 3300049590 Ga0501074_0015338 Ga0501074_0015338_603_1028 129
1154 3300049590 Ga0501074_0203190 Ga0501074_0203190_785_1216 129
1155 3300049591 Ga0501075_0071037 Ga0501075_0071037_1431_1844 129
1156 3300049592 Ga0501076_0041764 Ga0501076_0041764_2942_3355 129
1157 3300049592 Ga0501076_0221161 Ga0501076_0221161_225_650 129
1158 3300049593 Ga0501077_0212812 Ga0501077_0212812_362_775 129
1159 3300049741 Ga0501079_0178887 Ga0501079_0178887_384_815 129
1160 3300049743 Ga0501081_0112648 Ga0501081_0112648_688_1101 129
1161 3300049822 Ga0501035_0078436 Ga0501035_0078436_1600_2025 129
1162 3300049823 Ga0501044_0316300 Ga0501044_0316300_300_713 129
1163 3300049824 Ga0501045_0264112 Ga0501045_0264112_136_549 129
1164 3300050490 nmdc:mga03n38_825230_c1 nmdc:mga03n38_825230_c1_104_523 129
1165 3300050492 nmdc:mga0yw44_897668_c1 nmdc:mga0yw44_897668_c1_94_519 129
1166 3300050508 nmdc:mga09592_2788_c1 nmdc:mga09592_2788_c1_3582_3995 129
1167 3300050509 nmdc:mga0qj67_3507_c1 nmdc:mga0qj67_3507_c1_7994_8407 129
1168 3300050509 nmdc:mga0qj67_963363_c1 nmdc:mga0qj67_963363_c1_189_602 129
1169 3300050510 nmdc:mga06r32_833171_c1 nmdc:mga06r32_833171_c1_368_781 129
1170 3300050510 nmdc:mga06r32_97728_c1 nmdc:mga06r32_97728_c1_1749_2162 129
1171 3300050511 nmdc:mga08y16_39120_c1 nmdc:mga08y16_39120_c1_1233_1646 129
1172 3300050511 nmdc:mga08y16_402796_c1 nmdc:mga08y16_402796_c1_561_974 129
1173 3300050512 nmdc:mga0n895_1178757_c1 nmdc:mga0n895_1178757_c1_165_578 129
1174 3300050512 nmdc:mga0n895_7725_c1 nmdc:mga0n895_7725_c1_3950_4363 129
1175 3300050513 nmdc:mga0rr50_206084_c1 nmdc:mga0rr50_206084_c1_681_1094 129
1176 3300050513 nmdc:mga0rr50_494288_c1 nmdc:mga0rr50_494288_c1_23_436 129
1177 3300050514 nmdc:mga08x19_728106_c1 nmdc:mga08x19_728106_c1_91_504 129
1178 3300050514 nmdc:mga08x19_8490_c1 nmdc:mga08x19_8490_c1_416_829 129
1179 3300050515 nmdc:mga0a205_12690_c1 nmdc:mga0a205_12690_c1_7324_7737 129
1180 3300050515 nmdc:mga0a205_238380_c1 nmdc:mga0a205_238380_c1_1075_1488 129
1181 3300053077 Ga0495601_0282114 Ga0495601_0282114_560_973 129
1182 3300053083 Ga0495655_0010843 Ga0495655_0010843_576_995 129
1183 3300053085 Ga0495619_0571145 Ga0495619_0571145_194_607 129
1184 3300053104 Ga0500556_0000185 Ga0500556_0000185_5970_6389 129
1185 3300053153 Ga0500616_0120701 Ga0500616_0120701_818_1237 129
1186 3300054114 Ga0501084_0036418 Ga0501084_0036418_656_1081 129
1187 3300054114 Ga0501084_0123090 Ga0501084_0123090_1432_1845 129
1188 3300060353 Ga0501082_0007046 Ga0501082_0007046_7964_8389 129
1189 3300060353 Ga0501082_0030710 Ga0501082_0030710_2904_3317 129
1190 3300061719 Ga0466962_0007109 Ga0466962_0007109_827_1243 129
1191 3300061719 Ga0466962_0009079 Ga0466962_0009079_3991_4410 129
1192 3300061719 Ga0466962_0011598 Ga0466962_0011598_1253_1666 129
1193 3300061719 Ga0466962_0030703 Ga0466962_0030703_1406_1819 129
1194 3300061734 Ga0530510_0286779 Ga0530510_0286779_748_1161 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

6

86

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9377 11 82
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9304 22 80
3fks-assembly1.cif.gz_H yeast f1 atpase in the absence of bound nucleotides 0.93 8 86
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9279 6 91
4asu-assembly1.cif.gz_H f1-atpase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the empty site 0.9157 9 86
ID Description Score Start End Superfamily
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9523 4 91 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.952 4 91 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9481 4 91 2.60.15.10
af_P30049_23_125_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9469 5 91 2.60.15.10
af_Q55F42_29_165_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9438 5 108 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A7V8W9Q4-F1-model_v4 ATP synthase F1 subunit epsilon 1.006 11 106 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A7V9PPK9-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9991 1 106 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A838CZC7-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9956 1 106 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A7V9MI53-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9946 1 105 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A838IAP9-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9915 9 109 GO:0005524
GO:0005886
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
96.64 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map