metagRoot

F491477

General Info

Members	Datasets	Scaffolds	Average Seq Length
1192	838	615	195

Family's Representative Sequence

Representative Sequence	3300009766\|Ga0123342_1027181\|Ga0123342_10271812
Length	234
Sequence	MLTVYGQSRHLPHRPENRNRFSQDARRYSGASIQRNDPMASRAYSIPNLLTYGRILAVPLIVLCFFIEGRLSISNTARWVALWIFVIASLTDFLDGYLARIWNQTSNIGRMLDPIADKLLVASILLLVAADQTIAGWSIWAAITILCREILVSGLREYLAALKVSVPVTRIAKWKTTLQLVAIAFLLAGPAGDEIFPYTTQTGIALLWIAALLTIYTGYDYFRAGLKHIVDDEE

Samples

	Sample ID	Description	Type	Environment
1	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
2	2509276019	Ensifer aridi TW10	Isolate	Nodule
3	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
4	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
5	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
6	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
7	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
8	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
9	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
10	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
11	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
12	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
13	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
14	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
15	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
16	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
17	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
18	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
19	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
20	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
21	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
22	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
23	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
24	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
25	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
26	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
27	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
28	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
29	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
30	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
31	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
32	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
33	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
34	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
35	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
36	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
37	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
38	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
39	2516143018	Ensifer sp. BR816	Isolate	Nodule
40	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
41	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
42	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
43	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
44	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
45	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
46	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
47	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
48	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
49	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
50	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
51	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
52	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
53	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
54	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
55	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
56	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
57	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
58	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
59	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
60	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
61	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
62	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
63	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
64	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
65	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
66	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
67	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
68	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
69	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
70	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
71	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
72	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
73	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
74	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
75	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
76	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
77	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
78	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
79	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
80	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
81	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
82	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
83	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
84	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
85	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
86	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
87	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
88	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
89	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
90	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
91	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
92	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
93	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
94	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
95	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
96	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
97	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
98	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
99	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
100	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
101	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
102	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
103	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
104	2643221557	Ensifer sp. Root558	Isolate	Unclassified
105	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
106	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
107	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
108	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
109	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
110	2643221610	Ensifer sp. Root74	Isolate	Unclassified
111	2643221618	Ensifer sp. Root231	Isolate	Unclassified
112	2643221626	Ensifer sp. Root31	Isolate	Unclassified
113	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
114	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
115	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
116	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
117	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
118	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
119	2643221659	Ensifer sp. Root127	Isolate	Unclassified
120	2643221668	Ensifer sp. Root423	Isolate	Unclassified
121	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
122	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
123	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
124	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
125	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
126	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
127	2643221698	Ensifer sp. Root142	Isolate	Unclassified
128	2643221712	Ensifer sp. Root258	Isolate	Unclassified
129	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
130	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
131	2643221723	Ensifer sp. Root278	Isolate	Unclassified
132	2643221726	Ensifer sp. Root954	Isolate	Unclassified
133	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
134	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
135	2718217882	Rhizobium sp. N741	Isolate	Nodule
136	2718217927	Rhizobium sp. N324	Isolate	Nodule
137	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
138	2718218009	Rhizobium sp. N561	Isolate	Nodule
139	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
140	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
141	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
142	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
143	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
144	2718218363	Rhizobium sp. N113	Isolate	Nodule
145	2718218365	Rhizobium sp. N731	Isolate	Nodule
146	2718218366	Rhizobium sp. N621	Isolate	Nodule
147	2718218423	Rhizobium sp. N941	Isolate	Nodule
148	2721755514	Rhizobium sp. N6212	Isolate	Nodule
149	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
150	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
151	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
152	2721755809	Rhizobium sp. N541	Isolate	Nodule
153	2721755810	Rhizobium sp. N871	Isolate	Nodule
154	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
155	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
156	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
157	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
158	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
159	2728369365	Rhizobium sp. N1341	Isolate	Nodule
160	2728369397	Rhizobium sp. N1314	Isolate	Nodule
161	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
162	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
163	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
164	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
165	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
166	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
167	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
168	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
169	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
170	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
171	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
172	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
173	2791355256	Rhizobium sp. M10	Isolate	Nodule
174	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
175	2791355260	Rhizobium sp. L9	Isolate	Nodule
176	2791355261	Rhizobium sp. J15	Isolate	Nodule
177	2791355262	Rhizobium sp. M1	Isolate	Nodule
178	2791355263	Rhizobium chutanense C5	Isolate	Nodule
179	2791355264	Rhizobium sp. S9	Isolate	Nodule
180	2791355265	Rhizobium sp. H4	Isolate	Nodule
181	2791355266	Rhizobium sp. L43	Isolate	Nodule
182	2791355267	Rhizobium sp. L18	Isolate	Nodule
183	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
184	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
185	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
186	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
187	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
188	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
189	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
190	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
191	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
192	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
193	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
194	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
195	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
196	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
197	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
198	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
199	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
200	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
201	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
202	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
203	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
204	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
205	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
206	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
207	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
208	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
209	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
210	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
211	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
212	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
213	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
214	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
215	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
216	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
217	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
218	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
219	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
220	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
221	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
222	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
223	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
224	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
225	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
226	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
227	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
228	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
229	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
230	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
231	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
232	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
233	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
234	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
235	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
236	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
237	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
238	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
239	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
240	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
241	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
242	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
243	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
244	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
245	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
246	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
247	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
248	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
249	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
250	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
251	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
252	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
253	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
254	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
255	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
256	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
257	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
258	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
259	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
260	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
261	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
262	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
263	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
264	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
265	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
266	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
267	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
268	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
269	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
270	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
271	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
272	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
273	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
274	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
275	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
276	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
277	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
278	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
279	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
280	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
281	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
282	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
283	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
284	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
285	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
286	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
287	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
288	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
289	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
290	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
291	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
292	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
293	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
294	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
295	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
296	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
297	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
298	2854896431	Neorhizobium alkalisoli DSM 21826	Isolate	Unclassified
299	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
300	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
301	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
302	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
303	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
304	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
305	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
306	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
307	2891048133	Martelella lutilitoris GH2-6	Isolate	Rhizosphere
308	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
309	2894817345	Aureimonas psammosilenae YIM DR1026	Isolate	Unclassified
310	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
311	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
312	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
313	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
314	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
315	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
316	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
317	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
318	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
319	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
320	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
321	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
322	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
323	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
324	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
325	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
326	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
327	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
328	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
329	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
330	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
331	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
332	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
333	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
334	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
335	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
336	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
337	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
338	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
339	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
340	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
341	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
342	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
343	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
344	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
345	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
346	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
347	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
348	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
349	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
350	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
351	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
352	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
353	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
354	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
355	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
356	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
357	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
358	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
359	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
360	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
361	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
362	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
363	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
364	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
365	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
366	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
367	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
368	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
369	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
370	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
371	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
372	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
373	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
374	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
375	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
376	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
377	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
378	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
379	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
380	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
381	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
382	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
383	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
384	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
385	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
386	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
387	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
388	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
389	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
390	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
391	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
392	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
393	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
394	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
395	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
396	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
397	2937843397	Mesorhizobium xinjiangense lm94	Isolate	Rhizosphere
398	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
399	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
400	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
401	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
402	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
403	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
404	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
405	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
406	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
407	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
408	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
409	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
410	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
411	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
412	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
413	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
414	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
415	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
416	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
417	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
418	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
419	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
420	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
421	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
422	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
423	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
424	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
425	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
426	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
427	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
428	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
429	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
430	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
431	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
432	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
433	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
434	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
435	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
436	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
437	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
438	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
439	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
440	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
441	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
442	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
443	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
444	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
445	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
446	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
447	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
448	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
449	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
450	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
451	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
452	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
453	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
454	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
455	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
456	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
457	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
458	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
459	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
460	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
461	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
462	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
463	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
464	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
465	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
466	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
467	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
468	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
469	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
470	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
471	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
472	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
473	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
474	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
475	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
476	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
477	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
478	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
479	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
480	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
481	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
482	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
483	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
484	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
485	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
486	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
487	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
488	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
489	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
490	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
491	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
492	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
493	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
494	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
495	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
496	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
497	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
498	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
499	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
500	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
501	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
502	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
503	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
504	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
505	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
506	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
507	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
508	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
509	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
510	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
511	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
512	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
513	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
514	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
515	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
516	2995392953	Martelella limonii NBRC 109441	Isolate	Unclassified
517	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
518	2996887358	Rhizobium sp. R711	Isolate	Nodule
519	2996893221	Rhizobium sp. R635	Isolate	Nodule
520	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
521	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
522	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
523	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
524	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
525	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
526	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
527	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
528	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
529	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
530	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
531	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
532	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
533	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
534	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
535	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
536	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
537	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
538	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
539	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
540	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
541	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
542	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
543	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
544	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
545	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
546	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
547	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
548	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
549	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
550	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
551	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
552	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
553	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
554	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
555	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
556	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
557	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
558	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
559	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
560	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
561	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
562	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
563	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
564	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
565	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
566	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
567	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
568	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
569	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
570	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
571	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
572	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
573	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
574	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
575	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
576	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
577	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
578	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
579	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
580	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
581	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
582	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
583	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
584	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
585	3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Metagenome	Rhizosphere
586	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
587	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
588	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
589	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
590	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
591	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
592	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
593	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
594	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
595	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
596	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
597	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
598	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
599	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
600	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
601	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
602	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
603	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
604	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
605	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
606	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
607	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
608	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
609	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
610	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
611	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
612	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
613	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
614	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
615	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
616	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
617	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
618	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
619	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
620	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
621	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
622	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
623	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
624	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
625	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
626	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
627	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
628	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
629	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
630	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
631	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
632	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
633	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
634	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
635	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
636	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
637	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
638	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
639	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
640	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
641	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
642	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
643	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
644	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
645	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
646	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
647	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
648	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
649	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
650	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
651	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
652	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
653	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
654	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
655	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
656	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
657	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
658	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
659	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
660	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
661	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
662	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
663	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
664	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
665	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
666	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
667	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
668	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
669	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
670	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
671	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
672	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
673	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
674	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
675	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
676	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
677	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
678	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
679	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
680	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
681	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
682	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
683	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
684	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
685	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
686	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
687	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
688	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
689	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
690	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
691	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
692	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
693	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
694	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
695	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
696	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
697	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
698	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
699	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
700	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
701	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
702	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
703	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
704	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
705	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
706	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
707	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
708	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
709	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
710	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
711	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
712	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
713	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
714	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
715	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
716	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
717	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
718	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
719	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
720	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
721	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
722	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
723	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
724	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
725	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
726	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
727	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
728	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
729	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
730	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
731	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
732	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
733	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
734	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
735	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
736	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
737	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
738	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
739	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
740	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
741	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
742	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
743	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
744	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
745	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
746	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
747	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
748	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
749	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
750	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
751	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
752	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
753	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
754	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
755	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
756	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
757	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
758	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
759	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
760	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
761	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
762	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
763	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
764	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
765	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
766	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
767	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
768	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
769	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
770	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
771	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
772	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
773	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
774	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
775	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
776	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
777	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
778	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
779	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
780	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
781	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
782	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
783	3300059639	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
784	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
785	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
786	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
787	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
788	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
789	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
790	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
791	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
792	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
793	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
794	8005258706	Rhizobium sp. R693	Isolate	Nodule
795	8005275841	Rhizobium sp. N4311	Isolate	Nodule
796	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
797	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
798	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
799	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
800	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
801	8005321885	Rhizobium sp. R72	Isolate	Nodule
802	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
803	8005382845	Rhizobium sp. R634	Isolate	Nodule
804	8005395548	Rhizobium sp. R339	Isolate	Nodule
805	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
806	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
807	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
808	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
809	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
810	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
811	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
812	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
813	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
814	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
815	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
816	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
817	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
818	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
819	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
820	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
821	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
822	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
823	8018176218	Rhizobium sp. N122	Isolate	Nodule
824	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
825	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
826	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
827	8024501048	Rhizobium sp. H4	Isolate	Nodule
828	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
829	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
830	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
831	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
832	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
833	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
834	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
835	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
836	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
837	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
838	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	51.43
Metatranscriptomes	0.17
Isolates	48.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0.42
Bulb	0
Endosphere	19.97
Nodule	36.58
Rhizoplane	1.09
Rhizosphere	25.76
Stem	0
Stem Tuber	0
Unclassified	16.19

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000075	3300001979	Bacteria	33245
2	JGI25155J39150_1000032	3300002704	Bacteria	105511
3	JGI25156J39149_1000129	3300002705	Bacteria	54812
4	JGI25162J39368_1001169	3300002737	Bacteria	15592
5	JGI25162J39368_1001727	3300002737	Bacteria	10548
6	JGI25162J39368_1003463	3300002737	Bacteria	4530
7	JGI25154J39366_1000324	3300002738	Bacteria	27739
8	JGI25158J39367_1000210	3300002739	Bacteria	13780
9	JGI25158J39367_1007242	3300002739	Bacteria	1569
10	JGI25157J39369_1000061	3300002741	Bacteria	105511
11	JGI25152J39213_1001642	3300002773	Bacteria	9322
12	JGI25152J39213_1003410	3300002773	Bacteria	5438
13	JGI25152J39213_1008674	3300002773	Bacteria	2498
14	JGI25152J39213_1009210	3300002773	Bacteria	2363
15	JGI25152J39213_1009211	3300002773	Bacteria	2363
16	JGI25152J39213_1024838	3300002773	Bacteria	1000
17	JGI25150J39212_1000033	3300002774	Bacteria	96269
18	JGI25159J45721_1000002	3300002987	Bacteria	289163
19	JGI25159J45721_1000136	3300002987	Bacteria	34768
20	JGI25159J45721_1000544	3300002987	Bacteria	17146
21	JGI25151J46595_10000108	3300003187	Bacteria	112874
22	JGI25151J46595_10000591	3300003187	Bacteria	32186
23	JGI25151J46595_10025400	3300003187	Bacteria	2411
24	JGI25151J46595_10034315	3300003187	Bacteria	1942
25	JGI25406J46586_10032747	3300003203	Bacteria	1928
26	JGI25165J46597_1000630	3300003214	Bacteria	29232
27	JGI25165J46597_1000944	3300003214	Bacteria	19880
28	JGI25153J46596_10007647	3300003215	Bacteria	5273
29	JGI25153J46596_10009089	3300003215	Bacteria	4666
30	JGI25153J46596_10010252	3300003215	Bacteria	4255
31	JGI25153J46596_10022011	3300003215	Bacteria	2363
32	JGI25153J46596_10022014	3300003215	Bacteria	2363
33	JGI25153J46596_10033605	3300003215	Bacteria	1691
34	rootH2_10025055	3300003320	Bacteria	4537
35	rootL2_10082663	3300003322	Bacteria	3939
36	JGI25160J50197_1000008	3300003354	Bacteria	289163
37	JGI25160J50197_1000015	3300003354	Bacteria	250902
38	JGI25160J50197_1000191	3300003354	Bacteria	51959
39	JGI25160J50197_1005784	3300003354	Bacteria	5097
40	JGI25160J50197_1023350	3300003354	Bacteria	1785
41	JGI25161J50226_1000005	3300003374	Bacteria	292548
42	JGI25161J50226_1000051	3300003374	Bacteria	110051
43	JGI25161J50226_1000489	3300003374	Bacteria	17865
44	JGI25161J50226_1000704	3300003374	Bacteria	13116
45	Ga0055526_1001505	3300003771	Bacteria	16503
46	Ga0055526_1001653	3300003771	Bacteria	15643
47	Ga0055526_1023905	3300003771	Bacteria	2021
48	Ga0055524_1001479	3300003775	Bacteria	13409
49	Ga0055524_1009931	3300003775	Bacteria	3826
50	Ga0055524_1015746	3300003775	Bacteria	2744
51	Ga0055524_1038585	3300003775	Bacteria	1247
52	Ga0055524_1049079	3300003775	Bacteria	977
53	Ga0055524_1049382	3300003775	Bacteria	971
54	Ga0055536_1000984	3300003781	Bacteria	18060
55	Ga0055536_1004520	3300003781	Bacteria	7076
56	Ga0055528_1000201	3300003790	Bacteria	50283
57	Ga0055528_1000460	3300003790	Bacteria	32499
58	Ga0055528_1001727	3300003790	Bacteria	12649
59	Ga0055528_1005249	3300003790	Bacteria	6079
60	Ga0055528_1026969	3300003790	Bacteria	1632
61	Ga0055528_1026972	3300003790	Bacteria	1632
62	Ga0055528_1040407	3300003790	Bacteria	1052
63	Ga0055530_10018919	3300003791	Bacteria	2105
64	Ga0055540_1000807	3300003792	Bacteria	21192
65	Ga0055540_1003756	3300003792	Bacteria	7166
66	Ga0055540_1012994	3300003792	Bacteria	2572
67	Ga0055540_1017252	3300003792	Bacteria	2020
68	Ga0055540_1017773	3300003792	Bacteria	1973
69	Ga0055540_1029479	3300003792	Bacteria	1284
70	Ga0055531_10002233	3300003794	Bacteria	13122
71	Ga0058692_1000457	3300003856	Bacteria	18459
72	Ga0058692_1002674	3300003856	Bacteria	5868
73	Ga0055543_1000012	3300004625	Bacteria	186581
74	Ga0055543_1000040	3300004625	Bacteria	122485
75	Ga0055543_1000258	3300004625	Bacteria	39859
76	Ga0055543_1001749	3300004625	Bacteria	8117
77	Ga0065165_1000015	3300005262	Bacteria	289201
78	Ga0065165_1000125	3300005262	Bacteria	130283
79	Ga0065165_1003558	3300005262	Bacteria	10770
80	Ga0065165_1034484	3300005262	Bacteria	1564
81	Ga0065704_10280662	3300005289	Bacteria	923
82	Ga0070670_100009220	3300005331	Bacteria	8432
83	Ga0070666_10148138	3300005335	Bacteria	1637
84	Ga0070682_100292531	3300005337	Bacteria	1192
85	Ga0070669_100070984	3300005353	Bacteria	2575
86	Ga0070671_100078659	3300005355	Bacteria	2756
87	Ga0070667_100136430	3300005367	Bacteria	2145
88	Ga0070667_100771659	3300005367	Bacteria	892
89	Ga0070663_100038200	3300005455	Bacteria	3348
90	Ga0070663_100052068	3300005455	Bacteria	2919
91	Ga0070663_100054895	3300005455	Bacteria	2850
92	Ga0070665_100012057	3300005548	Bacteria	8721
93	Ga0070665_100091686	3300005548	Bacteria	3043
94	Ga0070665_100098033	3300005548	Bacteria	2936
95	Ga0070665_100226673	3300005548	Bacteria	1869
96	Ga0070665_100284701	3300005548	Bacteria	1655
97	Ga0068862_100383807	3300005844	Bacteria	1311
98	Ga0081455_10522003	3300005937	Bacteria	792
99	Ga0081540_1023699	3300005983	Bacteria	3581
100	Ga0081539_10001131	3300005985	Bacteria	48406
101	Ga0075365_10004005	3300006038	Bacteria	7722
102	Ga0075365_10024163	3300006038	Bacteria	3829
103	Ga0075365_10045727	3300006038	Bacteria	2873
104	Ga0075368_10003964	3300006042	Bacteria	4988
105	Ga0075368_10065122	3300006042	Bacteria	1464
106	Ga0075363_100148711	3300006048	Bacteria	1321
107	Ga0075364_10012041	3300006051	Bacteria	5276
108	Ga0075364_10027201	3300006051	Bacteria	3653
109	Ga0075364_10110903	3300006051	Bacteria	1831
110	Ga0075364_10682895	3300006051	Bacteria	701
111	Ga0075362_10101028	3300006177	Bacteria	1348
112	Ga0075367_10169458	3300006178	Bacteria	1360
113	Ga0075367_10227761	3300006178	Bacteria	1167
114	Ga0075369_10002839	3300006186	Bacteria	6241
115	Ga0075369_10006353	3300006186	Bacteria	4465
116	Ga0075369_10038544	3300006186	Bacteria	2039
117	Ga0075366_10025990	3300006195	Bacteria	3425
118	Ga0075370_10023755	3300006353	Bacteria	3380
119	Ga0075370_10074796	3300006353	Bacteria	1941
120	Ga0075370_10088215	3300006353	Bacteria	1788
121	Ga0079104_1000032	3300006946	Bacteria	203094
122	Ga0079104_1001622	3300006946	Bacteria	14656
123	Ga0079104_1014853	3300006946	Bacteria	2333
124	Ga0099826_10000219	3300006948	Bacteria	24833
125	Ga0099826_10015017	3300006948	Bacteria	5850
126	Ga0105251_10008871	3300009011	Bacteria	6019
127	Ga0105240_10000032	3300009093	Bacteria	283907
128	Ga0105243_10008523	3300009148	Bacteria	7866
129	Ga0105237_10002365	3300009545	Bacteria	23399
130	Ga0105237_11028162	3300009545	Bacteria	831
131	Ga0105249_10266379	3300009553	Bacteria	1705
132	Ga0105249_11297882	3300009553	Bacteria	799
133	Ga0123341_1000062	3300009765	Bacteria	45834
134	Ga0123342_1027181	3300009766	Bacteria	3232
135	Ga0105239_10013157	3300010375	Bacteria	9193
136	Ga0157316_1005944	3300012510	Bacteria	983
137	Ga0157373_10135794	3300013100	Bacteria	1729
138	Ga0157371_10000073	3300013102	Bacteria	163215
139	Ga0157371_10007192	3300013102	Bacteria	9041
140	Ga0157370_10001154	3300013104	Bacteria	32919
141	Ga0157370_10003636	3300013104	Bacteria	18019
142	Ga0157370_10305394	3300013104	Bacteria	1468
143	Ga0157369_10185520	3300013105	Bacteria	2188
144	Ga0171463_1001	3300013249	Bacteria	1406070
145	Ga0157372_10588788	3300013307	Bacteria	1297
146	Ga0182008_10075376	3300014497	Bacteria	1659
147	Ga0182007_10000460	3300015262	Bacteria	24598
148	Ga0182005_1007165	3300015265	Bacteria	3362
149	Ga0182005_1015635	3300015265	Bacteria	2115
150	Ga0214544_1000017	3300021320	Bacteria	193638
151	Ga0214542_1000006	3300021321	Bacteria	345164
152	Ga0214542_1021608	3300021321	Bacteria	4357
153	Ga0214543_1000003	3300021327	Bacteria	692327
154	Ga0214543_1000014	3300021327	Bacteria	324986
155	Ga0213874_10014157	3300021377	Bacteria	2080
156	Ga0228711_1000001	3300022739	Bacteria	357377
157	Ga0228710_1000001	3300022740	Bacteria	314328
158	Ga0209435_100042	3300025206	Bacteria	105563
159	Ga0209436_100173	3300025208	Bacteria	30923
160	Ga0209436_101739	3300025208	Bacteria	7155
161	Ga0209563_104790	3300025230	Bacteria	2536
162	Ga0209437_100033	3300025233	Bacteria	512520
163	Ga0209437_100075	3300025233	Bacteria	297202
164	Ga0207425_1000031	3300025245	Bacteria	261181
165	Ga0207425_1001353	3300025245	Bacteria	10502
166	Ga0207425_1004550	3300025245	Bacteria	4125
167	Ga0207425_1022022	3300025245	Bacteria	1346
168	Ga0207425_1024030	3300025245	Bacteria	1270
169	Ga0207425_1046658	3300025245	Bacteria	806
170	Ga0209646_1000145	3300025246	Bacteria	105563
171	Ga0209646_1008549	3300025246	Bacteria	1644
172	Ga0209026_1000160	3300025250	Bacteria	105563
173	Ga0209677_100845	3300025253	Bacteria	15183
174	Ga0209759_1000177	3300025256	Bacteria	105563
175	Ga0209129_1000053	3300025258	Bacteria	262823
176	Ga0209129_1000137	3300025258	Bacteria	123213
177	Ga0209129_1000932	3300025258	Bacteria	17735
178	Ga0209129_1001697	3300025258	Bacteria	11899
179	Ga0209129_1002015	3300025258	Bacteria	10537
180	Ga0209129_1002041	3300025258	Bacteria	10434
181	Ga0209129_1005904	3300025258	Bacteria	4148
182	Ga0209129_1008188	3300025258	Bacteria	2953
183	Ga0209233_1000056	3300025261	Bacteria	438104
184	Ga0209233_1000064	3300025261	Bacteria	392156
185	Ga0209233_1000209	3300025261	Bacteria	115124
186	Ga0209565_1012288	3300025263	Bacteria	2049
187	Ga0209673_1000041	3300025273	Bacteria	307397
188	Ga0209673_1000319	3300025273	Bacteria	88129
189	Ga0209673_1000603	3300025273	Bacteria	55646
190	Ga0209673_1001326	3300025273	Bacteria	24843
191	Ga0209673_1004666	3300025273	Bacteria	7240
192	Ga0209673_1005348	3300025273	Bacteria	6492
193	Ga0209673_1006924	3300025273	Bacteria	5362
194	Ga0209673_1012129	3300025273	Bacteria	3495
195	Ga0209673_1029328	3300025273	Bacteria	1754
196	Ga0209130_1000006	3300025284	Bacteria	596528
197	Ga0209130_1000007	3300025284	Bacteria	591584
198	Ga0209130_1000018	3300025284	Bacteria	388301
199	Ga0209130_1013563	3300025284	Bacteria	2082
200	Ga0209130_1020891	3300025284	Bacteria	1488
201	Ga0209130_1022880	3300025284	Bacteria	1387
202	Ga0209130_1043490	3300025284	Bacteria	854
203	Ga0209675_1048180	3300025291	Bacteria	892
204	Ga0209676_1000694	3300025292	Bacteria	47316
205	Ga0209676_1004264	3300025292	Bacteria	8065
206	Ga0209676_1014196	3300025292	Bacteria	3010
207	Ga0209676_1017727	3300025292	Bacteria	2509
208	Ga0209025_1000074	3300025294	Bacteria	277445
209	Ga0209025_1000080	3300025294	Bacteria	267244
210	Ga0209025_1000087	3300025294	Bacteria	261181
211	Ga0209025_1000149	3300025294	Bacteria	173393
212	Ga0209025_1000199	3300025294	Bacteria	146058
213	Ga0209025_1000580	3300025294	Bacteria	66332
214	Ga0209025_1001440	3300025294	Bacteria	31293
215	Ga0209025_1001600	3300025294	Bacteria	28497
216	Ga0209025_1002011	3300025294	Bacteria	23229
217	Ga0209025_1009457	3300025294	Bacteria	6785
218	Ga0209025_1010350	3300025294	Bacteria	6330
219	Ga0209025_1015894	3300025294	Bacteria	4492
220	Ga0209025_1024824	3300025294	Bacteria	3079
221	Ga0209025_1048020	3300025294	Bacteria	1735
222	Ga0209025_1056024	3300025294	Bacteria	1519
223	Ga0209025_1105221	3300025294	Bacteria	882
224	Ga0209564_1000425	3300025295	Bacteria	74279
225	Ga0209564_1000431	3300025295	Bacteria	72866
226	Ga0209564_1001106	3300025295	Bacteria	31905
227	Ga0209564_1001342	3300025295	Bacteria	26169
228	Ga0209564_1036134	3300025295	Bacteria	1416
229	Ga0209758_1000081	3300025297	Bacteria	261181
230	Ga0209758_1000890	3300025297	Bacteria	40935
231	Ga0209758_1002000	3300025297	Bacteria	21958
232	Ga0209758_1003116	3300025297	Bacteria	15659
233	Ga0209758_1003638	3300025297	Bacteria	13764
234	Ga0209758_1006714	3300025297	Bacteria	8111
235	Ga0209758_1008032	3300025297	Bacteria	6972
236	Ga0209758_1009477	3300025297	Bacteria	6043
237	Ga0209758_1031764	3300025297	Bacteria	2159
238	Ga0209050_1002170	3300025298	Bacteria	17758
239	Ga0209050_1005227	3300025298	Bacteria	8284
240	Ga0209050_1007237	3300025298	Bacteria	6292
241	Ga0209256_1000877	3300025299	Bacteria	37183
242	Ga0209256_1001068	3300025299	Bacteria	31760
243	Ga0209256_1001698	3300025299	Bacteria	21247
244	Ga0209256_1001781	3300025299	Bacteria	20391
245	Ga0209256_1003487	3300025299	Bacteria	10975
246	Ga0209256_1005328	3300025299	Bacteria	7477
247	Ga0209256_1005451	3300025299	Bacteria	7322
248	Ga0209256_1008937	3300025299	Bacteria	4509
249	Ga0209256_1028344	3300025299	Bacteria	1580
250	Ga0209256_1033722	3300025299	Bacteria	1372
251	Ga0207426_1000044	3300025302	Bacteria	428043
252	Ga0207426_1000064	3300025302	Bacteria	358276
253	Ga0207426_1000106	3300025302	Bacteria	244368
254	Ga0207426_1000119	3300025302	Bacteria	221800
255	Ga0207426_1005259	3300025302	Bacteria	5969
256	Ga0209051_1000878	3300025303	Bacteria	30344
257	Ga0209051_1006558	3300025303	Bacteria	6535
258	Ga0209051_1010581	3300025303	Bacteria	4639
259	Ga0209051_1015125	3300025303	Bacteria	3565
260	Ga0209051_1018040	3300025303	Bacteria	3136
261	Ga0209051_1021615	3300025303	Bacteria	2731
262	Ga0209051_1022549	3300025303	Bacteria	2647
263	Ga0209051_1025554	3300025303	Bacteria	2399
264	Ga0209257_1001713	3300025304	Bacteria	24577
265	Ga0209257_1002246	3300025304	Bacteria	19809
266	Ga0209257_1004833	3300025304	Bacteria	9982
267	Ga0207656_10098617	3300025321	Bacteria	1337
268	Ga0207713_1016350	3300025735	Bacteria	3767
269	Ga0207645_10018659	3300025907	Bacteria	4557
270	Ga0207695_10000024	3300025913	Bacteria	632311
271	Ga0207695_10014597	3300025913	Bacteria	9290
272	Ga0207671_10000718	3300025914	Bacteria	42274
273	Ga0207671_10685999	3300025914	Bacteria	815
274	Ga0207657_10503275	3300025919	Bacteria	949
275	Ga0207681_10027640	3300025923	Bacteria	3670
276	Ga0207681_10350460	3300025923	Bacteria	1182
277	Ga0207694_10226723	3300025924	Bacteria	1525
278	Ga0207650_10005961	3300025925	Bacteria	8320
279	Ga0207690_10147147	3300025932	Bacteria	1742
280	Ga0207709_10011235	3300025935	Bacteria	4939
281	Ga0207711_10597097	3300025941	Bacteria	1030
282	Ga0207711_10797390	3300025941	Bacteria	880
283	Ga0207658_10129704	3300025986	Bacteria	2024
284	Ga0207678_10058238	3300026067	Bacteria	3324
285	Ga0207678_10357236	3300026067	Bacteria	1260
286	Ga0209281_1000053	3300027111	Bacteria	309587
287	Ga0209281_1000236	3300027111	Bacteria	113362
288	Ga0209281_1000266	3300027111	Bacteria	100574
289	Ga0209371_1000021	3300027312	Bacteria	555864
290	Ga0209371_1000966	3300027312	Bacteria	22312
291	Ga0209371_1001249	3300027312	Bacteria	18174
292	Ga0209282_1000007	3300027666	Bacteria	254917
293	Ga0209282_1003596	3300027666	Bacteria	9242
294	Ga0209282_1040178	3300027666	Bacteria	2783
295	Ga0268266_10014527	3300028379	Bacteria	6769
296	Ga0268266_10025861	3300028379	Bacteria	4994
297	Ga0268266_10107861	3300028379	Bacteria	2463
298	Ga0268266_10209519	3300028379	Bacteria	1787
299	Ga0268266_10292451	3300028379	Bacteria	1517
300	Ga0307515_10000070	3300028794	Bacteria	239322
301	Ga0307515_10009393	3300028794	Bacteria	18922
302	Ga0307515_10010607	3300028794	Bacteria	17629
303	Ga0307515_10061955	3300028794	Bacteria	5294
304	Ga0268256_1000020	3300030500	Bacteria	557873
305	Ga0268256_1000660	3300030500	Bacteria	26255
306	Ga0268256_1009668	3300030500	Bacteria	3175
307	Ga0316181_1231982	3300030744	Bacteria	1405
308	Ga0307513_10006330	3300031456	Bacteria	15498
309	Ga0307513_10197751	3300031456	Bacteria	1855
310	Ga0307513_10309409	3300031456	Bacteria	1343
311	Ga0307408_100057540	3300031548	Bacteria	2823
312	Ga0307408_100135901	3300031548	Bacteria	1924
313	Ga0307408_100318078	3300031548	Bacteria	1310
314	Ga0307516_10104873	3300031730	Bacteria	2639
315	Ga0307405_10001577	3300031731	Bacteria	9669
316	Ga0307405_10191204	3300031731	Bacteria	1479
317	Ga0307413_10395858	3300031824	Bacteria	1081
318	Ga0307410_11169618	3300031852	Bacteria	669
319	Ga0307406_10009795	3300031901	Bacteria	5391
320	Ga0307406_10462304	3300031901	Bacteria	1021
321	Ga0307412_10000728	3300031911	Bacteria	18975
322	Ga0315914_1000006	3300031967	Bacteria	239817
323	Ga0307409_100201513	3300031995	Bacteria	1781
324	Ga0307414_10350721	3300032004	Bacteria	1266
325	Ga0315913_1000002	3300033430	Bacteria	241452
326	Ga0315915_1000001	3300033464	Bacteria	481518
327	Ga0395900_0745401	3300037418	Bacteria	910
328	Ga0395905_0002291	3300037471	Bacteria	21471
329	Ga0395905_0011083	3300037471	Bacteria	8726
330	Ga0436363_0775146	3300039450	Bacteria	11928
331	Ga0439436_0006455	3300041404	Bacteria	3600
332	Ga0439436_0050833	3300041404	Bacteria	1172
333	Ga0439438_017861	3300041405	Bacteria	2031
334	Ga0439465_0001711	3300041413	Bacteria	7165
335	Ga0439465_0006038	3300041413	Bacteria	3851
336	Ga0439465_0027353	3300041413	Bacteria	1806
337	Ga0439465_0089399	3300041413	Bacteria	1052
338	Ga0439465_0104335	3300041413	Bacteria	981
339	Ga0451787_155138	3300041441	Bacteria	1255
340	Ga0451833_0721085	3300041491	Bacteria	1258
341	Ga0451835_0004513	3300041492	Bacteria	3521
342	Ga0451839_1200455	3300041496	Bacteria	3440
343	Ga0451841_0820828	3300041498	Bacteria	2459
344	Ga0451851_0769438	3300041507	Bacteria	1667
345	Ga0451843_1404302	3300041509	Bacteria	2772
346	Ga0451853_0813657	3300041512	Bacteria	2372
347	Ga0439431_0026182	3300041997	Bacteria	1428
348	Ga0439432_040707	3300042006	Bacteria	1474
349	Ga0439449_0001047	3300042007	Bacteria	10900
350	Ga0439449_0111404	3300042007	Bacteria	1014
351	Ga0439449_0215998	3300042007	Bacteria	718
352	Ga0439462_0147695	3300042015	Bacteria	660
353	Ga0450920_036575	3300042122	Bacteria	974
354	Ga0450923_039887	3300042125	Bacteria	984
355	Ga0450906_008450	3300042145	Bacteria	1991
356	Ga0450907_010532	3300042146	Bacteria	1534
357	Ga0439434_0020056	3300042435	Bacteria	2006
358	Ga0450918_001738	3300042531	Bacteria	4242
359	Ga0466965_0132221	3300044683	Bacteria	1295
360	Ga0466963_0020949	3300044694	Bacteria	4119
361	Ga0495592_0046201	3300046454	Bacteria	3246
362	Ga0495629_0222663	3300046459	Bacteria	1301
363	Ga0495638_0000789	3300046460	Bacteria	33427
364	Ga0495638_0016460	3300046460	Bacteria	4953
365	Ga0495638_0129544	3300046460	Bacteria	1483
366	Ga0495605_0003154	3300046474	Bacteria	9917
367	Ga0495584_0048781	3300046491	Bacteria	2134
368	Ga0495585_0002715	3300046492	Bacteria	12376
369	Ga0495607_0048831	3300046501	Bacteria	2472
370	Ga0495607_0077834	3300046501	Bacteria	1831
371	Ga0495583_0074101	3300046506	Bacteria	1491
372	Ga0495606_0010031	3300046507	Bacteria	7916
373	Ga0495606_0065988	3300046507	Bacteria	2297
374	Ga0495610_0014129	3300046512	Bacteria	4708
375	Ga0495620_0014659	3300046515	Bacteria	3978
376	Ga0495631_0001716	3300046518	Bacteria	13010
377	Ga0495632_0008931	3300046519	Bacteria	6085
378	Ga0495643_0004836	3300046522	Bacteria	9281
379	Ga0495643_0037538	3300046522	Bacteria	2656
380	Ga0495643_0053945	3300046522	Bacteria	2154
381	Ga0495643_0082839	3300046522	Bacteria	1666
382	Ga0495648_0127865	3300046524	Bacteria	1355
383	Ga0495654_0000092	3300046530	Bacteria	101504
384	Ga0495654_0059986	3300046530	Bacteria	1830
385	Ga0495654_0110767	3300046530	Bacteria	1253
386	Ga0495640_0305551	3300046533	Bacteria	987
387	Ga0495609_0020381	3300046538	Bacteria	3064
388	Ga0495633_0076654	3300046558	Bacteria	1557
389	Ga0495656_0007841	3300046615	Bacteria	3793
390	Ga0495668_0013369	3300046616	Bacteria	4844
391	Ga0495668_0022328	3300046616	Bacteria	3618
392	Ga0495625_0000883	3300046660	Bacteria	40600
393	Ga0495625_0213945	3300046660	Bacteria	1266
394	Ga0495588_0008991	3300046674	Bacteria	4601
395	Ga0495658_0120709	3300046683	Bacteria	1585
396	Ga0495670_0016707	3300046691	Bacteria	3609
397	Ga0495670_0026742	3300046691	Bacteria	2857
398	Ga0495649_0080678	3300046694	Bacteria	1740
399	Ga0495600_0123827	3300046809	Bacteria	1681
400	Ga0495660_0111606	3300046810	Bacteria	1394
401	Ga0495660_0117507	3300046810	Bacteria	1349
402	Ga0495676_0445333	3300047321	Bacteria	855
403	Ga0495683_0056540	3300047323	Bacteria	1952
404	Ga0495687_015580	3300047443	Bacteria	3860
405	Ga0495681_0001410	3300047470	Bacteria	18089
406	Ga0495686_0002844	3300047472	Bacteria	15625
407	Ga0495686_0028624	3300047472	Bacteria	3628
408	Ga0496106_0016430	3300048909	Bacteria	5476
409	Ga0496110_1103467	3300048913	Bacteria	701
410	Ga0496111_0002285	3300048914	Bacteria	11511
411	Ga0496116_0000026	3300048919	Bacteria	450803
412	Ga0496116_0002669	3300048919	Bacteria	18458
413	Ga0496116_0002740	3300048919	Bacteria	18103
414	Ga0496116_0039748	3300048919	Bacteria	3247
415	Ga0496116_0061983	3300048919	Bacteria	2417
416	Ga0496116_0091597	3300048919	Bacteria	1847
417	Ga0496116_0156092	3300048919	Bacteria	1259
418	Ga0496116_0226716	3300048919	Bacteria	952
419	Ga0496117_0000002	3300048920	Bacteria	2483758
420	Ga0496117_0006751	3300048920	Bacteria	11463
421	Ga0496117_0011444	3300048920	Bacteria	7948
422	Ga0496117_0024779	3300048920	Bacteria	4732
423	Ga0496117_0080253	3300048920	Bacteria	2146
424	Ga0496118_0000214	3300048921	Bacteria	100898
425	Ga0496118_0003715	3300048921	Bacteria	18909
426	Ga0496118_0010030	3300048921	Bacteria	9443
427	Ga0496118_0030002	3300048921	Bacteria	4551
428	Ga0496118_0085449	3300048921	Bacteria	2197
429	Ga0496118_0154472	3300048921	Bacteria	1430
430	Ga0496118_0191196	3300048921	Bacteria	1224
431	Ga0496119_0042057	3300048922	Bacteria	2901
432	Ga0496119_0042848	3300048922	Bacteria	2866
433	Ga0496119_0122081	3300048922	Bacteria	1430
434	Ga0496120_0000125	3300048923	Bacteria	128983
435	Ga0496120_0030565	3300048923	Bacteria	3271
436	Ga0496120_0062583	3300048923	Bacteria	2073
437	Ga0496121_0000001	3300048924	Bacteria	1830318
438	Ga0496121_0018097	3300048924	Bacteria	7128
439	Ga0496121_0033723	3300048924	Bacteria	4627
440	Ga0496121_0074664	3300048924	Bacteria	2711
441	Ga0496121_0146696	3300048924	Bacteria	1742
442	Ga0496121_0148676	3300048924	Bacteria	1727
443	Ga0496121_0586710	3300048924	Bacteria	690
444	Ga0496122_0000001	3300048925	Bacteria	1827766
445	Ga0496122_0000160	3300048925	Bacteria	159236
446	Ga0496122_0001107	3300048925	Bacteria	46550
447	Ga0496122_0006166	3300048925	Bacteria	13941
448	Ga0496122_0023327	3300048925	Bacteria	5460
449	Ga0496122_0031570	3300048925	Bacteria	4405
450	Ga0496122_0078819	3300048925	Bacteria	2305
451	Ga0496122_0109886	3300048925	Bacteria	1813
452	Ga0496123_0000001	3300048926	Bacteria	1831497
453	Ga0496123_0000034	3300048926	Bacteria	274836
454	Ga0496123_0000562	3300048926	Bacteria	63590
455	Ga0496123_0007779	3300048926	Bacteria	9986
456	Ga0496123_0011987	3300048926	Bacteria	7438
457	Ga0496123_0019336	3300048926	Bacteria	5373
458	Ga0496123_0035527	3300048926	Bacteria	3549
459	Ga0496124_0000349	3300048927	Bacteria	84498
460	Ga0496124_0007559	3300048927	Bacteria	11527
461	Ga0496124_0015423	3300048927	Bacteria	7324
462	Ga0496124_0065160	3300048927	Bacteria	3039
463	Ga0496124_0169581	3300048927	Bacteria	1692
464	Ga0496124_0246652	3300048927	Bacteria	1324
465	Ga0496124_0290724	3300048927	Bacteria	1186
466	Ga0496124_0298245	3300048927	Bacteria	1166
467	Ga0496124_0478554	3300048927	Bacteria	841
468	Ga0496124_0498202	3300048927	Bacteria	817
469	Ga0496125_0000001	3300048928	Bacteria	1766138
470	Ga0496125_0001370	3300048928	Bacteria	35861
471	Ga0496125_0004855	3300048928	Bacteria	15262
472	Ga0496125_0080969	3300048928	Bacteria	2483
473	Ga0496125_0083675	3300048928	Bacteria	2426
474	Ga0496125_0186235	3300048928	Bacteria	1376
475	Ga0496126_0000069	3300048929	Bacteria	246935
476	Ga0496126_0003015	3300048929	Bacteria	21841
477	Ga0496126_0099712	3300048929	Bacteria	2543
478	Ga0496126_0108899	3300048929	Bacteria	2415
479	Ga0496126_0167746	3300048929	Bacteria	1872
480	Ga0501031_0241416	3300049568	Bacteria	1174
481	Ga0501032_0000025	3300049569	Bacteria	138521
482	Ga0501032_0088775	3300049569	Bacteria	2052
483	Ga0501032_0161776	3300049569	Bacteria	1470
484	Ga0501032_0757992	3300049569	Bacteria	614
485	Ga0501033_0000229	3300049570	Bacteria	54036
486	Ga0501033_0001216	3300049570	Bacteria	23119
487	Ga0501033_0001969	3300049570	Bacteria	17888
488	Ga0501033_0026545	3300049570	Bacteria	4359
489	Ga0501033_0072521	3300049570	Bacteria	2528
490	Ga0501033_0467902	3300049570	Bacteria	874
491	Ga0501033_0512912	3300049570	Bacteria	829
492	Ga0501034_0001862	3300049571	Bacteria	26764
493	Ga0501034_0007112	3300049571	Bacteria	11938
494	Ga0501034_0280892	3300049571	Bacteria	1604
495	Ga0501034_0291447	3300049571	Bacteria	1570
496	Ga0501034_0378691	3300049571	Bacteria	1340
497	Ga0501034_0393811	3300049571	Bacteria	1309
498	Ga0501034_0827030	3300049571	Bacteria	817
499	Ga0501034_0874898	3300049571	Bacteria	787
500	Ga0501034_0874933	3300049571	Bacteria	787
501	Ga0501036_0001402	3300049572	Bacteria	18518
502	Ga0501037_0000176	3300049573	Bacteria	60011
503	Ga0501037_0000828	3300049573	Bacteria	23090
504	Ga0501037_0099630	3300049573	Bacteria	2099
505	Ga0501037_0100166	3300049573	Bacteria	2092
506	Ga0501038_0000862	3300049574	Bacteria	26891
507	Ga0501038_0220923	3300049574	Bacteria	1512
508	Ga0501038_0457805	3300049574	Bacteria	980
509	Ga0501039_0000003	3300049575	Bacteria	357424
510	Ga0501043_0000051	3300049579	Bacteria	106957
511	Ga0501043_0000114	3300049579	Bacteria	75782
512	Ga0501043_0097713	3300049579	Bacteria	2308
513	Ga0501043_0228973	3300049579	Bacteria	1436
514	Ga0501043_0313276	3300049579	Bacteria	1197
515	Ga0501043_0348760	3300049579	Bacteria	1125
516	Ga0501043_0745426	3300049579	Bacteria	712
517	Ga0501046_0375254	3300049580	Bacteria	1030
518	Ga0501047_0007205	3300049581	Bacteria	10455
519	Ga0501047_0024244	3300049581	Bacteria	5824
520	Ga0501047_0037480	3300049581	Bacteria	4688
521	Ga0501047_0057902	3300049581	Bacteria	3746
522	Ga0501047_0068361	3300049581	Bacteria	3421
523	Ga0501047_0317553	3300049581	Bacteria	1398
524	Ga0501067_0148337	3300049583	Bacteria	1307
525	Ga0501069_0000016	3300049585	Bacteria	142565
526	Ga0501069_0046007	3300049585	Bacteria	2419
527	Ga0501070_0000186	3300049586	Bacteria	58369
528	Ga0501070_0000931	3300049586	Bacteria	26365
529	Ga0501070_0006421	3300049586	Bacteria	10006
530	Ga0501070_0107402	3300049586	Bacteria	2306
531	Ga0501070_0126598	3300049586	Bacteria	2111
532	Ga0501070_0346140	3300049586	Bacteria	1207
533	Ga0501070_0401071	3300049586	Bacteria	1109
534	Ga0501071_0370700	3300049587	Bacteria	1091
535	Ga0501073_0156523	3300049589	Bacteria	1579
536	Ga0501073_0769924	3300049589	Bacteria	664
537	Ga0501074_0001818	3300049590	Bacteria	14602
538	Ga0501074_0099182	3300049590	Bacteria	2085
539	Ga0501074_0459747	3300049590	Bacteria	902
540	Ga0501079_0095573	3300049741	Bacteria	2303
541	Ga0501080_0001450	3300049742	Bacteria	19946
542	Ga0501080_0004427	3300049742	Bacteria	12498
543	Ga0501080_0011492	3300049742	Bacteria	8106
544	Ga0501080_0033685	3300049742	Bacteria	4782
545	Ga0501081_0213841	3300049743	Bacteria	1401
546	Ga0501083_0000111	3300049744	Bacteria	55529
547	Ga0501083_0075792	3300049744	Bacteria	2233
548	Ga0501083_0150491	3300049744	Bacteria	1524
549	Ga0501280_001370	3300049776	Bacteria	4580
550	Ga0501035_0000102	3300049822	Bacteria	106915
551	Ga0501035_0000690	3300049822	Bacteria	36838
552	Ga0501035_0000752	3300049822	Bacteria	34903
553	Ga0501035_0001093	3300049822	Bacteria	28434
554	Ga0501035_0001914	3300049822	Bacteria	20905
555	Ga0501035_0012136	3300049822	Bacteria	7968
556	Ga0501035_0098972	3300049822	Bacteria	2560
557	Ga0501044_0000003	3300049823	Bacteria	345647
558	Ga0501044_0002922	3300049823	Bacteria	19435
559	Ga0501044_0021665	3300049823	Bacteria	6852
560	Ga0501044_0049355	3300049823	Bacteria	4345
561	Ga0501044_0089157	3300049823	Bacteria	3113
562	Ga0501044_0131509	3300049823	Bacteria	2496
563	Ga0501044_0142371	3300049823	Bacteria	2386
564	Ga0501044_0164118	3300049823	Bacteria	2196
565	Ga0501044_0399241	3300049823	Bacteria	1288
566	Ga0501044_1013441	3300049823	Bacteria	702
567	nmdc:mga03683_308204_c1	3300050489	Bacteria	744
568	nmdc:mga03683_71286_c1	3300050489	Bacteria	1486
569	nmdc:mga03n38_453662_c1	3300050490	Bacteria	714
570	nmdc:mga00v17_107251_c1	3300050491	Bacteria	1769
571	nmdc:mga00v17_115_c2	3300050491	Bacteria	47780
572	nmdc:mga00v17_1990_c1	3300050491	Bacteria	10551
573	nmdc:mga0yw44_141277_c1	3300050492	Bacteria	1565
574	nmdc:mga0yw44_263058_c1	3300050492	Bacteria	1150
575	nmdc:mga0yw44_37408_c1	3300050492	Bacteria	2865
576	nmdc:mga0yw44_616149_c1	3300050492	Bacteria	738
577	nmdc:mga06z11_23123_c1	3300050494	Bacteria	2914
578	nmdc:mga06z11_65760_c1	3300050494	Bacteria	1904
579	nmdc:mga04h51_2806_c1	3300050495	Bacteria	4163
580	nmdc:mga0sz30_3703_c1	3300050516	Bacteria	5511
581	Ga0500610_0002202	3300053079	Bacteria	7052
582	Ga0500578_0003995	3300053086	Bacteria	10656
583	Ga0500578_0107924	3300053086	Bacteria	1757
584	Ga0500643_010419	3300053087	Bacteria	3461
585	Ga0500644_0014616	3300053088	Bacteria	2220
586	Ga0500560_035559	3300053107	Bacteria	1534
587	Ga0500569_063791	3300053109	Bacteria	1143
588	Ga0500594_0001136	3300053118	Bacteria	5737
589	Ga0500608_060608	3300053122	Bacteria	1809
590	Ga0500618_000227	3300053125	Bacteria	44231
591	Ga0500618_002042	3300053125	Bacteria	8158
592	Ga0500618_047482	3300053125	Bacteria	976
593	Ga0500658_0001177	3300053134	Bacteria	10656
594	Ga0500559_0003764	3300053136	Bacteria	7366
595	Ga0500568_0002384	3300053139	Bacteria	11116
596	Ga0500568_0003084	3300053139	Bacteria	9512
597	Ga0500568_0195888	3300053139	Bacteria	741
598	Ga0500573_0049947	3300053140	Bacteria	2406
599	Ga0500590_001637	3300053148	Bacteria	9350
600	Ga0500616_0001190	3300053153	Bacteria	26447
601	Ga0500616_0012101	3300053153	Bacteria	5062
602	Ga0500616_0014746	3300053153	Bacteria	4483
603	Ga0500616_0051734	3300053153	Bacteria	2163
604	Ga0500622_0000364	3300053156	Bacteria	43740
605	Ga0500622_0000757	3300053156	Bacteria	28152
606	Ga0500627_0041956	3300053158	Bacteria	1968
607	Ga0500627_0202896	3300053158	Bacteria	888
608	Ga0500634_0002302	3300053161	Bacteria	7985
609	Ga0500634_0046216	3300053161	Bacteria	2353
610	Ga0500636_0000070	3300053177	Bacteria	50168
611	Ga0501084_0424693	3300054114	Bacteria	1124
612	Ga0587062_022137	3300059639	Bacteria	910
613	Ga0587072_009121	3300059643	Bacteria	1582
614	Ga0501082_0153547	3300060353	Bacteria	2000
615	Ga0501082_0926477	3300060353	Bacteria	762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300054114	Ga0501084_0424693	Ga0501084_0424693_156_827	174
2	3300049571	Ga0501034_0393811	Ga0501034_0393811_237_806	184
3	3300049581	Ga0501047_0317553	Ga0501047_0317553_797_1357	184
4	3300026067	Ga0207678_10357236	Ga0207678_103572362	185
5	3300053088	Ga0500644_0014616	Ga0500644_0014616_1436_2002	185
6	3300053122	Ga0500608_060608	Ga0500608_060608_50_616	185
7	3300053139	Ga0500568_0195888	Ga0500568_0195888_26_589	185
8	3300053156	Ga0500622_0000364	Ga0500622_0000364_32485_33051	185
9	3300049743	Ga0501081_0213841	Ga0501081_0213841_804_1373	188
10	iso_pu_bacteria	2894817345	2894819738	188
11	3300006038	Ga0075365_10045727	Ga0075365_100457273	189
12	3300050492	nmdc:mga0yw44_37408_c1	nmdc:mga0yw44_37408_c1_1601_2200	189
13	iso_pu_bacteria	2510461069	2510839659	189
14	iso_pu_bacteria	2643221653	2644296792	189
15	iso_pu_bacteria	2643221719	2644655046	189
16	iso_pu_bacteria	2738541317	2738946508	189
17	iso_pu_bacteria	2818991272	2819242504	189
18	iso_pu_bacteria	2837678835	2837683382	189
19	iso_pu_bacteria	2913308742	2913310923	189
20	iso_pu_bacteria	2989776772	2989778224	189
21	iso_pu_bacteria	3003930520	3003932713	189
22	iso_pu_bacteria	8005246636	8005251278	189
23	iso_pu_bacteria	8045864390	8045865877	189
24	iso_pu_bacteria	8056875544	8056876548	189
25	3300005367	Ga0070667_100771659	Ga0070667_1007716591	190
26	3300009545	Ga0105237_11028162	Ga0105237_110281621	190
27	3300015265	Ga0182005_1007165	Ga0182005_10071656	190
28	3300021377	Ga0213874_10014157	Ga0213874_100141571	190
29	3300025913	Ga0207695_10014597	Ga0207695_100145978	190
30	3300025914	Ga0207671_10685999	Ga0207671_106859992	190
31	3300025924	Ga0207694_10226723	Ga0207694_102267231	190
32	3300039450	Ga0436363_0775146	Ga0436363_0775146_9345_9977	190
33	iso_pu_bacteria	2558860983	2561466088	190
34	iso_pu_bacteria	2775507049	2776912859	190
35	iso_pu_bacteria	2837651117	2837652624	190
36	iso_pu_bacteria	2891373044	2891376995	190
37	iso_pu_bacteria	2937843397	2937846818	190
38	iso_pu_bacteria	2989349275	2989354118	190
39	iso_pu_bacteria	2996336353	2996338378	190
40	iso_pu_bacteria	8005658619	8005659944	190
41	iso_pu_bacteria	8055431914	8055434224	190
42	iso_pu_bacteria	2509276021	2509387683	191
43	iso_pu_bacteria	2509276033	2509443041	191
44	iso_pu_bacteria	2510065019	2510132330	191
45	iso_pu_bacteria	2510461076	2510898670	191
46	iso_pu_bacteria	2510917022	2511137066	191
47	iso_pu_bacteria	2510917026	2511168606	191
48	iso_pu_bacteria	2510917028	2511186396	191
49	iso_pu_bacteria	2510917030	2511197163	191
50	iso_pu_bacteria	2512875026	2512972195	191
51	iso_pu_bacteria	2513237084	2513569169	191
52	iso_pu_bacteria	2513237085	2513578845	191
53	iso_pu_bacteria	2513237088	2513596282	191
54	iso_pu_bacteria	2513237089	2513603274	191
55	iso_pu_bacteria	2513237093	2513632723	191
56	iso_pu_bacteria	2513237103	2513709175	191
57	iso_pu_bacteria	2513237138	2513868803	191
58	iso_pu_bacteria	2513237140	2513881055	191
59	iso_pu_bacteria	2513237144	2513907491	191
60	iso_pu_bacteria	2513237146	2513925737	191
61	iso_pu_bacteria	2513237159	2514001921	191
62	iso_pu_bacteria	2513237162	2514020718	191
63	iso_pu_bacteria	2515075009	2515111315	191
64	iso_pu_bacteria	2515154113	2515638485	191
65	iso_pu_bacteria	2515154114	2515642550	191
66	iso_pu_bacteria	2515154116	2515659159	191
67	iso_pu_bacteria	2515154134	2515740502	191
68	iso_pu_bacteria	2516653077	2517039958	191
69	iso_pu_bacteria	2516653085	2517075508	191
70	iso_pu_bacteria	2517093000	2517094091	191
71	iso_pu_bacteria	2517287029	2517405908	191
72	iso_pu_bacteria	2519899620	2520375241	191
73	iso_pu_bacteria	2524023209	2524460612	191
74	iso_pu_bacteria	2529292951	2530643853	191
75	iso_pu_bacteria	2534681796	2535515752	191
76	iso_pu_bacteria	2537561587	2537874115	191
77	iso_pu_bacteria	2554235003	2554247146	191
78	iso_pu_bacteria	2558860242	2559294370	191
79	iso_pu_bacteria	2582581283	2585165600	191
80	iso_pu_bacteria	2582581294	2585203112	191
81	iso_pu_bacteria	2582581298	2585221027	191
82	iso_pu_bacteria	2582581299	2585231459	191
83	iso_pu_bacteria	2582581304	2585256580	191
84	iso_pu_bacteria	2582581306	2585266124	191
85	iso_pu_bacteria	2582581307	2585273224	191
86	iso_pu_bacteria	2582581308	2585278941	191
87	iso_pu_bacteria	2582581315	2585325444	191
88	iso_pu_bacteria	2582581316	2585329604	191
89	iso_pu_bacteria	2582581865	2585387124	191
90	iso_pu_bacteria	2582581866	2585392756	191
91	iso_pu_bacteria	2582581867	2585400090	191
92	iso_pu_bacteria	2585427526	2585528005	191
93	iso_pu_bacteria	2585427527	2585530738	191
94	iso_pu_bacteria	2585427528	2585541393	191
95	iso_pu_bacteria	2585427529	2585549229	191
96	iso_pu_bacteria	2585427530	2585554918	191
97	iso_pu_bacteria	2585427531	2585559476	191
98	iso_pu_bacteria	2585427590	2585822649	191
99	iso_pu_bacteria	2585427593	2585839475	191
100	iso_pu_bacteria	2585427594	2585847179	191
101	iso_pu_bacteria	2585427608	2585902147	191
102	iso_pu_bacteria	2585427609	2585905148	191
103	iso_pu_bacteria	2585427633	2585995153	191
104	iso_pu_bacteria	2585427634	2585999702	191
105	iso_pu_bacteria	2585428125	2587979737	191
106	iso_pu_bacteria	2599185170	2599418559	191
107	iso_pu_bacteria	2599185210	2599602562	191
108	iso_pu_bacteria	2599185236	2599722047	191
109	iso_pu_bacteria	2599185352	2600191975	191
110	iso_pu_bacteria	2600254933	2600375303	191
111	iso_pu_bacteria	2600255279	2601608641	191
112	iso_pu_bacteria	2600255308	2601745415	191
113	iso_pu_bacteria	2615840624	2616296180	191
114	iso_pu_bacteria	2615840626	2616305786	191
115	iso_pu_bacteria	2615840698	2616553974	191
116	iso_pu_bacteria	2643221557	2643807160	191
117	iso_pu_bacteria	2643221558	2643809971	191
118	iso_pu_bacteria	2643221568	2643857856	191
119	iso_pu_bacteria	2643221582	2643918748	191
120	iso_pu_bacteria	2643221599	2644007959	191
121	iso_pu_bacteria	2643221607	2644046522	191
122	iso_pu_bacteria	2643221610	2644069574	191
123	iso_pu_bacteria	2643221618	2644108950	191
124	iso_pu_bacteria	2643221626	2644151472	191
125	iso_pu_bacteria	2643221634	2644196549	191
126	iso_pu_bacteria	2643221636	2644202228	191
127	iso_pu_bacteria	2643221637	2644206161	191
128	iso_pu_bacteria	2643221643	2644242916	191
129	iso_pu_bacteria	2643221655	2644311606	191
130	iso_pu_bacteria	2643221659	2644329864	191
131	iso_pu_bacteria	2643221668	2644380542	191
132	iso_pu_bacteria	2643221675	2644420728	191
133	iso_pu_bacteria	2643221680	2644454253	191
134	iso_pu_bacteria	2643221686	2644479312	191
135	iso_pu_bacteria	2643221689	2644502360	191
136	iso_pu_bacteria	2643221693	2644518712	191
137	iso_pu_bacteria	2643221698	2644546538	191
138	iso_pu_bacteria	2643221712	2644617405	191
139	iso_pu_bacteria	2643221718	2644649808	191
140	iso_pu_bacteria	2643221723	2644675607	191
141	iso_pu_bacteria	2643221726	2644689590	191
142	iso_pu_bacteria	2667528174	2671115272	191
143	iso_pu_bacteria	2718217882	2719180325	191
144	iso_pu_bacteria	2718217927	2719384900	191
145	iso_pu_bacteria	2718217997	2719664647	191
146	iso_pu_bacteria	2718218009	2719731074	191
147	iso_pu_bacteria	2718218199	2720491067	191
148	iso_pu_bacteria	2718218232	2720612436	191
149	iso_pu_bacteria	2718218233	2720619275	191
150	iso_pu_bacteria	2718218235	2720630675	191
151	iso_pu_bacteria	2718218269	2720774368	191
152	iso_pu_bacteria	2718218363	2721146419	191
153	iso_pu_bacteria	2718218365	2721157940	191
154	iso_pu_bacteria	2718218366	2721163298	191
155	iso_pu_bacteria	2718218423	2721398620	191
156	iso_pu_bacteria	2721755514	2722839468	191
157	iso_pu_bacteria	2721755556	2723026095	191
158	iso_pu_bacteria	2721755684	2723559640	191
159	iso_pu_bacteria	2721755685	2723566256	191
160	iso_pu_bacteria	2721755809	2724037433	191
161	iso_pu_bacteria	2721755810	2724043830	191
162	iso_pu_bacteria	2721755819	2724088975	191
163	iso_pu_bacteria	2721755822	2724103521	191
164	iso_pu_bacteria	2721755823	2724109360	191
165	iso_pu_bacteria	2724679232	2725946785	191
166	iso_pu_bacteria	2728369352	2730107031	191
167	iso_pu_bacteria	2728369365	2730163562	191
168	iso_pu_bacteria	2728369397	2730297572	191
169	iso_pu_bacteria	2738541293	2738802196	191
170	iso_pu_bacteria	2738541333	2739035935	191
171	iso_pu_bacteria	2751185821	2753460847	191
172	iso_pu_bacteria	2765235942	2766067572	191
173	iso_pu_bacteria	2775507266	2778177519	191
174	iso_pu_bacteria	2791355094	2792638305	191
175	iso_pu_bacteria	2791355256	2793296232	191
176	iso_pu_bacteria	2791355259	2793317557	191
177	iso_pu_bacteria	2791355260	2793321066	191
178	iso_pu_bacteria	2791355261	2793327098	191
179	iso_pu_bacteria	2791355262	2793333649	191
180	iso_pu_bacteria	2791355263	2793339757	191
181	iso_pu_bacteria	2791355264	2793347966	191
182	iso_pu_bacteria	2791355265	2793357401	191
183	iso_pu_bacteria	2791355266	2793358950	191
184	iso_pu_bacteria	2791355267	2793367881	191
185	iso_pu_bacteria	2802429605	2805926547	191
186	iso_pu_bacteria	2802429606	2805933346	191
187	iso_pu_bacteria	2802429633	2806046886	191
188	iso_pu_bacteria	2802429634	2806052469	191
189	iso_pu_bacteria	2802429635	2806058760	191
190	iso_pu_bacteria	2802429636	2806067472	191
191	iso_pu_bacteria	2802429637	2806074023	191
192	iso_pu_bacteria	2808606387	2808985857	191
193	iso_pu_bacteria	2818991448	2819611562	191
194	iso_pu_bacteria	2818991453	2819639215	191
195	iso_pu_bacteria	2818991461	2819684076	191
196	iso_pu_bacteria	2821123053	2821124317	191
197	iso_pu_bacteria	2838016132	2838017317	191
198	iso_pu_bacteria	2838022645	2838023112	191
199	iso_pu_bacteria	2838029111	2838031463	191
200	iso_pu_bacteria	2838035591	2838037745	191
201	iso_pu_bacteria	2838042994	2838047936	191
202	iso_pu_bacteria	2838048938	2838049199	191
203	iso_pu_bacteria	2838061910	2838063355	191
204	iso_pu_bacteria	2838068647	2838074188	191
205	iso_pu_bacteria	2838074704	2838076482	191
206	iso_pu_bacteria	2838661181	2838662758	191
207	iso_pu_bacteria	2838668709	2838670878	191
208	iso_pu_bacteria	2838675328	2838676694	191
209	iso_pu_bacteria	2838680041	2838681372	191
210	iso_pu_bacteria	2838686498	2838688577	191
211	iso_pu_bacteria	2838694306	2838694593	191
212	iso_pu_bacteria	2838701080	2838703249	191
213	iso_pu_bacteria	2838707686	2838707971	191
214	iso_pu_bacteria	2838714209	2838715578	191
215	iso_pu_bacteria	2838719591	2838720622	191
216	iso_pu_bacteria	2838724970	2838726334	191
217	iso_pu_bacteria	2838729681	2838730872	191
218	iso_pu_bacteria	2838736955	2838741190	191
219	iso_pu_bacteria	2838742623	2838744234	191
220	iso_pu_bacteria	2841840854	2841844913	191
221	iso_pu_bacteria	2841846520	2841847555	191
222	iso_pu_bacteria	2841851746	2841856915	191
223	iso_pu_bacteria	2841859092	2841859908	191
224	iso_pu_bacteria	2841864319	2841865443	191
225	iso_pu_bacteria	2842077413	2842080798	191
226	iso_pu_bacteria	2842110456	2842115007	191
227	iso_pu_bacteria	2842118031	2842121417	191
228	iso_pu_bacteria	2842124991	2842126415	191
229	iso_pu_bacteria	2842130223	2842131587	191
230	iso_pu_bacteria	2842140634	2842144635	191
231	iso_pu_bacteria	2842146304	2842147527	191
232	iso_pu_bacteria	2842152218	2842153244	191
233	iso_pu_bacteria	2842156927	2842160085	191
234	iso_pu_bacteria	2842163707	2842168328	191
235	iso_pu_bacteria	2842170452	2842171821	191
236	iso_pu_bacteria	2842175837	2842176863	191
237	iso_pu_bacteria	2842180545	2842183298	191
238	iso_pu_bacteria	2842187318	2842188686	191
239	iso_pu_bacteria	2842192696	2842197980	191
240	iso_pu_bacteria	2842198810	2842199540	191
241	iso_pu_bacteria	2842205361	2842207667	191
242	iso_pu_bacteria	2842211629	2842212997	191
243	iso_pu_bacteria	2842217011	2842221234	191
244	iso_pu_bacteria	2842224351	2842225384	191
245	iso_pu_bacteria	2842229732	2842235101	191
246	iso_pu_bacteria	2842237096	2842237382	191
247	iso_pu_bacteria	2842243621	2842245698	191
248	iso_pu_bacteria	2842250916	2842252593	191
249	iso_pu_bacteria	2842257432	2842259652	191
250	iso_pu_bacteria	2842264693	2842266891	191
251	iso_pu_bacteria	2842271015	2842274491	191
252	iso_pu_bacteria	2842278818	2842281538	191
253	iso_pu_bacteria	2842285085	2842287087	191
254	iso_pu_bacteria	2842291075	2842294454	191
255	iso_pu_bacteria	2842298080	2842302416	191
256	iso_pu_bacteria	2842304105	2842306734	191
257	iso_pu_bacteria	2842311132	2842314776	191
258	iso_pu_bacteria	2842317721	2842318621	191
259	iso_pu_bacteria	2842341865	2842343562	191
260	iso_pu_bacteria	2842357229	2842360851	191
261	iso_pu_bacteria	2842363717	2842365281	191
262	iso_pu_bacteria	2842370503	2842371835	191
263	iso_pu_bacteria	2842377471	2842380852	191
264	iso_pu_bacteria	2842384541	2842387923	191
265	iso_pu_bacteria	2842395702	2842398226	191
266	iso_pu_bacteria	2842402390	2842404355	191
267	iso_pu_bacteria	2842409023	2842410960	191
268	iso_pu_bacteria	2842415677	2842417584	191
269	iso_pu_bacteria	2842422224	2842427393	191
270	iso_pu_bacteria	2842428310	2842431022	191
271	iso_pu_bacteria	2842434925	2842436980	191
272	iso_pu_bacteria	2842441272	2842443058	191
273	iso_pu_bacteria	2842447887	2842453280	191
274	iso_pu_bacteria	2842462802	2842465069	191
275	iso_pu_bacteria	2842469257	2842471705	191
276	iso_pu_bacteria	2842475841	2842477941	191
277	iso_pu_bacteria	2842482326	2842482885	191
278	iso_pu_bacteria	2842489311	2842493788	191
279	iso_pu_bacteria	2842495871	2842497256	191
280	iso_pu_bacteria	2842502639	2842504750	191
281	iso_pu_bacteria	2842509118	2842509759	191
282	iso_pu_bacteria	2842515876	2842516693	191
283	iso_pu_bacteria	2842521101	2842526307	191
284	iso_pu_bacteria	2844163670	2844168474	191
285	iso_pu_bacteria	2844454524	2844455093	191
286	iso_pu_bacteria	2850079185	2850080518	191
287	iso_pu_bacteria	2852387548	2852389112	191
288	iso_pu_bacteria	2854896431	2854897219	191
289	iso_pu_bacteria	2854916844	2854921240	191
290	iso_pu_bacteria	2855825444	2855831411	191
291	iso_pu_bacteria	2855839649	2855840535	191
292	iso_pu_bacteria	2857516855	2857520261	191
293	iso_pu_bacteria	2857531043	2857531897	191
294	iso_pu_bacteria	2858800743	2858801063	191
295	iso_pu_bacteria	2891048133	2891051888	191
296	iso_pu_bacteria	2896384573	2896386682	191
297	iso_pu_bacteria	2899792073	2899796642	191
298	iso_pu_bacteria	2899803654	2899803811	191
299	iso_pu_bacteria	2899845264	2899846993	191
300	iso_pu_bacteria	2915980308	2915986263	191
301	iso_pu_bacteria	2915986958	2915988467	191
302	iso_pu_bacteria	2915993759	2915996172	191
303	iso_pu_bacteria	2916000859	2916002079	191
304	iso_pu_bacteria	2916007675	2916014018	191
305	iso_pu_bacteria	2916014648	2916015412	191
306	iso_pu_bacteria	2916021584	2916025140	191
307	iso_pu_bacteria	2916028427	2916032625	191
308	iso_pu_bacteria	2916035215	2916040264	191
309	iso_pu_bacteria	2916041962	2916042457	191
310	iso_pu_bacteria	2916048683	2916052552	191
311	iso_pu_bacteria	2916055098	2916055271	191
312	iso_pu_bacteria	2916061851	2916062913	191
313	iso_pu_bacteria	2916068649	2916076101	191
314	iso_pu_bacteria	2916076590	2916077631	191
315	iso_pu_bacteria	2919100787	2919103862	191
316	iso_pu_bacteria	2919114240	2919115782	191
317	iso_pu_bacteria	2919166419	2919168420	191
318	iso_pu_bacteria	2919171160	2919171382	191
319	iso_pu_bacteria	2919408235	2919409345	191
320	iso_pu_bacteria	2920760137	2920762834	191
321	iso_pu_bacteria	2920822456	2920823886	191
322	iso_pu_bacteria	2921201388	2921204354	191
323	iso_pu_bacteria	2921208531	2921209984	191
324	iso_pu_bacteria	2921237296	2921240057	191
325	iso_pu_bacteria	2921244191	2921246182	191
326	iso_pu_bacteria	2921250672	2921251044	191
327	iso_pu_bacteria	2921257292	2921257873	191
328	iso_pu_bacteria	2921263974	2921264148	191
329	iso_pu_bacteria	2921282425	2921286235	191
330	iso_pu_bacteria	2921289301	2921294843	191
331	iso_pu_bacteria	2921296804	2921302358	191
332	iso_pu_bacteria	2923556063	2923557537	191
333	iso_pu_bacteria	2924144063	2924146599	191
334	iso_pu_bacteria	2924150972	2924151185	191
335	iso_pu_bacteria	2924158325	2924160662	191
336	iso_pu_bacteria	2924165586	2924171700	191
337	iso_pu_bacteria	2924172951	2924177537	191
338	iso_pu_bacteria	2924179722	2924185903	191
339	iso_pu_bacteria	2924186466	2924187090	191
340	iso_pu_bacteria	2924193448	2924198151	191
341	iso_pu_bacteria	2924200457	2924203008	191
342	iso_pu_bacteria	2924207177	2924212645	191
343	iso_pu_bacteria	2924214083	2924220179	191
344	iso_pu_bacteria	2924221636	2924226749	191
345	iso_pu_bacteria	2924228884	2924230278	191
346	iso_pu_bacteria	2926754445	2926756722	191
347	iso_pu_bacteria	2926760298	2926760967	191
348	iso_pu_bacteria	2929138655	2929139555	191
349	iso_pu_bacteria	2933006813	2933007887	191
350	iso_pu_bacteria	2933011516	2933012665	191
351	iso_pu_bacteria	2933016740	2933018970	191
352	iso_pu_bacteria	2933570622	2933573152	191
353	iso_pu_bacteria	2933586486	2933591406	191
354	iso_pu_bacteria	2933594066	2933595102	191
355	iso_pu_bacteria	2933599457	2933604642	191
356	iso_pu_bacteria	2935894831	2935895115	191
357	iso_pu_bacteria	2935901341	2935904099	191
358	iso_pu_bacteria	2936367885	2936368091	191
359	iso_pu_bacteria	2936375103	2936381515	191
360	iso_pu_bacteria	2936381700	2936384912	191
361	iso_pu_bacteria	2937084907	2937090514	191
362	iso_pu_bacteria	2941499720	2941500173	191
363	iso_pu_bacteria	2967686174	2967687124	191
364	iso_pu_bacteria	2967728569	2967734644	191
365	iso_pu_bacteria	2970143518	2970144463	191
366	iso_pu_bacteria	2978969890	2978971089	191
367	iso_pu_bacteria	2979089926	2979093755	191
368	iso_pu_bacteria	2979095461	2979098860	191
369	iso_pu_bacteria	2979100975	2979105736	191
370	iso_pu_bacteria	2984587000	2984588251	191
371	iso_pu_bacteria	2989771324	2989772103	191
372	iso_pu_bacteria	2995392953	2995393271	191
373	iso_pu_bacteria	2996887358	2996891574	191
374	iso_pu_bacteria	2996893221	2996895118	191
375	iso_pu_bacteria	3005409236	3005412478	191
376	iso_pu_bacteria	3005416602	3005417175	191
377	iso_pu_bacteria	3005445848	3005446790	191
378	iso_pu_bacteria	3005452660	3005453479	191
379	iso_pu_bacteria	639633055	639647463	191
380	iso_pu_bacteria	650716007	650739567	191
381	iso_pu_bacteria	8003570095	8003570615	191
382	iso_pu_bacteria	8005258706	8005262912	191
383	iso_pu_bacteria	8005275841	8005279620	191
384	iso_pu_bacteria	8005282627	8005284745	191
385	iso_pu_bacteria	8005289223	8005292823	191
386	iso_pu_bacteria	8005301065	8005304629	191
387	iso_pu_bacteria	8005307578	8005311125	191
388	iso_pu_bacteria	8005314921	8005315236	191
389	iso_pu_bacteria	8005321885	8005326101	191
390	iso_pu_bacteria	8005376324	8005376578	191
391	iso_pu_bacteria	8005382845	8005385967	191
392	iso_pu_bacteria	8005395548	8005400251	191
393	iso_pu_bacteria	8005430974	8005432299	191
394	iso_pu_bacteria	8005460587	8005461959	191
395	iso_pu_bacteria	8005484373	8005485594	191
396	iso_pu_bacteria	8005497431	8005499369	191
397	iso_pu_bacteria	8005542996	8005544386	191
398	iso_pu_bacteria	8005556819	8005558896	191
399	iso_pu_bacteria	8005570704	8005572721	191
400	iso_pu_bacteria	8005619151	8005620557	191
401	iso_pu_bacteria	8005626139	8005627478	191
402	iso_pu_bacteria	8005645114	8005649882	191
403	iso_pu_bacteria	8005668836	8005670785	191
404	iso_pu_bacteria	8005682033	8005684533	191
405	iso_pu_bacteria	8005688590	8005691054	191
406	iso_pu_bacteria	8005695170	8005698749	191
407	iso_pu_bacteria	8018127388	8018131365	191
408	iso_pu_bacteria	8018150411	8018152520	191
409	iso_pu_bacteria	8018163183	8018169189	191
410	iso_pu_bacteria	8018176218	8018177205	191
411	iso_pu_bacteria	8023680758	8023686916	191
412	iso_pu_bacteria	8024479707	8024481135	191
413	iso_pu_bacteria	8024501048	8024503221	191
414	iso_pu_bacteria	8046767195	8046767711	191
415	iso_pu_bacteria	8054460903	8054461934	191
416	iso_pu_bacteria	8054558443	8054562081	191
417	iso_pu_bacteria	8056375014	8056380761	191
418	iso_pu_bacteria	8056382006	8056384715	191
419	iso_pu_bacteria	8057575449	8057582163	191
420	iso_pu_bacteria	8057874678	8057879924	191
421	3300025284	Ga0209130_1020891	Ga0209130_10208912	192
422	3300046460	Ga0495638_0016460	Ga0495638_0016460_1384_1974	192
423	3300048924	Ga0496121_0586710	Ga0496121_0586710_46_636	192
424	iso_pu_bacteria	2599185156	2599333722	192
425	iso_pu_bacteria	2842922631	2842924840	192
426	3300005289	Ga0065704_10280662	Ga0065704_102806621	193
427	3300006051	Ga0075364_10110903	Ga0075364_101109033	193
428	3300025294	Ga0209025_1056024	Ga0209025_10560242	193
429	3300025297	Ga0209758_1031764	Ga0209758_10317644	193
430	3300028794	Ga0307515_10000070	Ga0307515_10000070143	193
431	3300028794	Ga0307515_10010607	Ga0307515_1001060717	193
432	3300028794	Ga0307515_10061955	Ga0307515_100619555	193
433	3300031456	Ga0307513_10006330	Ga0307513_100063307	193
434	3300031548	Ga0307408_100057540	Ga0307408_1000575405	193
435	3300031548	Ga0307408_100318078	Ga0307408_1003180782	193
436	3300031730	Ga0307516_10104873	Ga0307516_101048733	193
437	3300032004	Ga0307414_10350721	Ga0307414_103507212	193
438	3300037471	Ga0395905_0011083	Ga0395905_0011083_3239_3832	193
439	3300041404	Ga0439436_0006455	Ga0439436_0006455_1765_2358	193
440	3300041405	Ga0439438_017861	Ga0439438_017861_1302_1895	193
441	3300041413	Ga0439465_0001711	Ga0439465_0001711_148_741	193
442	3300041997	Ga0439431_0026182	Ga0439431_0026182_620_1213	193
443	3300042007	Ga0439449_0111404	Ga0439449_0111404_224_817	193
444	3300042122	Ga0450920_036575	Ga0450920_036575_357_950	193
445	3300042125	Ga0450923_039887	Ga0450923_039887_366_959	193
446	3300042145	Ga0450906_008450	Ga0450906_008450_670_1263	193
447	3300042146	Ga0450907_010532	Ga0450907_010532_733_1326	193
448	3300042435	Ga0439434_0020056	Ga0439434_0020056_703_1296	193
449	3300042531	Ga0450918_001738	Ga0450918_001738_2854_3447	193
450	3300048919	Ga0496116_0002669	Ga0496116_0002669_3607_4203	193
451	3300049570	Ga0501033_0512912	Ga0501033_0512912_127_708	193
452	3300049571	Ga0501034_0007112	Ga0501034_0007112_8056_8637	193
453	3300049571	Ga0501034_0874898	Ga0501034_0874898_129_710	193
454	3300049571	Ga0501034_0874933	Ga0501034_0874933_129_710	193
455	3300049581	Ga0501047_0024244	Ga0501047_0024244_335_916	193
456	3300049776	Ga0501280_001370	Ga0501280_001370_3108_3689	193
457	3300049823	Ga0501044_1013441	Ga0501044_1013441_61_657	193
458	iso_pu_bacteria	2643221688	2644493358	193
459	3300002739	JGI25158J39367_1007242	JGI25158J39367_10072422	194
460	3300002987	JGI25159J45721_1000002	JGI25159J45721_1000002190	194
461	3300003187	JGI25151J46595_10034315	JGI25151J46595_100343152	194
462	3300003203	JGI25406J46586_10032747	JGI25406J46586_100327472	194
463	3300003354	JGI25160J50197_1000008	JGI25160J50197_1000008190	194
464	3300003374	JGI25161J50226_1000489	JGI25161J50226_100048910	194
465	3300003775	Ga0055524_1001479	Ga0055524_100147912	194
466	3300003775	Ga0055524_1049382	Ga0055524_10493821	194
467	3300003781	Ga0055536_1000984	Ga0055536_100098411	194
468	3300003791	Ga0055530_10018919	Ga0055530_100189192	194
469	3300003792	Ga0055540_1029479	Ga0055540_10294792	194
470	3300004625	Ga0055543_1000040	Ga0055543_100004050	194
471	3300005262	Ga0065165_1000015	Ga0065165_1000015191	194
472	3300005337	Ga0070682_100292531	Ga0070682_1002925312	194
473	3300005455	Ga0070663_100052068	Ga0070663_1000520684	194
474	3300005455	Ga0070663_100054895	Ga0070663_1000548952	194
475	3300005548	Ga0070665_100012057	Ga0070665_1000120577	194
476	3300005548	Ga0070665_100091686	Ga0070665_1000916865	194
477	3300005983	Ga0081540_1023699	Ga0081540_10236995	194
478	3300005985	Ga0081539_10001131	Ga0081539_1000113118	194
479	3300006051	Ga0075364_10012041	Ga0075364_100120416	194
480	3300006946	Ga0079104_1001622	Ga0079104_10016226	194
481	3300006946	Ga0079104_1014853	Ga0079104_10148534	194
482	3300009553	Ga0105249_11297882	Ga0105249_112978821	194
483	3300012510	Ga0157316_1005944	Ga0157316_10059442	194
484	3300013104	Ga0157370_10305394	Ga0157370_103053943	194
485	3300013249	Ga0171463_1001	Ga0171463_1001180	194
486	3300013307	Ga0157372_10588788	Ga0157372_105887882	194
487	3300021320	Ga0214544_1000017	Ga0214544_1000017148	194
488	3300021321	Ga0214542_1000006	Ga0214542_100000682	194
489	3300021321	Ga0214542_1021608	Ga0214542_10216083	194
490	3300021327	Ga0214543_1000003	Ga0214543_1000003519	194
491	3300021327	Ga0214543_1000014	Ga0214543_1000014241	194
492	3300022739	Ga0228711_1000001	Ga0228711_100000123	194
493	3300022740	Ga0228710_1000001	Ga0228710_1000001302	194
494	3300025208	Ga0209436_101739	Ga0209436_1017392	194
495	3300025284	Ga0209130_1000007	Ga0209130_1000007112	194
496	3300025292	Ga0209676_1000694	Ga0209676_100069431	194
497	3300025294	Ga0209025_1000149	Ga0209025_1000149114	194
498	3300025294	Ga0209025_1000580	Ga0209025_100058021	194
499	3300025295	Ga0209564_1001342	Ga0209564_100134221	194
500	3300025295	Ga0209564_1036134	Ga0209564_10361341	194
501	3300025298	Ga0209050_1002170	Ga0209050_100217010	194
502	3300025299	Ga0209256_1000877	Ga0209256_100087720	194
503	3300025299	Ga0209256_1001781	Ga0209256_10017818	194
504	3300025302	Ga0207426_1000064	Ga0207426_1000064112	194
505	3300025303	Ga0209051_1015125	Ga0209051_10151256	194
506	3300025304	Ga0209257_1001713	Ga0209257_10017131	194
507	3300025907	Ga0207645_10018659	Ga0207645_100186591	194
508	3300025932	Ga0207690_10147147	Ga0207690_101471474	194
509	3300027111	Ga0209281_1000236	Ga0209281_100023630	194
510	3300027111	Ga0209281_1000266	Ga0209281_100026676	194
511	3300027666	Ga0209282_1000007	Ga0209282_1000007230	194
512	3300028379	Ga0268266_10014527	Ga0268266_100145278	194
513	3300028379	Ga0268266_10107861	Ga0268266_101078612	194
514	3300031548	Ga0307408_100135901	Ga0307408_1001359013	194
515	3300031731	Ga0307405_10191204	Ga0307405_101912042	194
516	3300031824	Ga0307413_10395858	Ga0307413_103958582	194
517	3300031852	Ga0307410_11169618	Ga0307410_111696181	194
518	3300031901	Ga0307406_10462304	Ga0307406_104623042	194
519	3300031967	Ga0315914_1000006	Ga0315914_100000613	194
520	3300033430	Ga0315913_1000002	Ga0315913_1000002229	194
521	3300033464	Ga0315915_1000001	Ga0315915_1000001257	194
522	3300037418	Ga0395900_0745401	Ga0395900_0745401_147_731	194
523	3300041404	Ga0439436_0050833	Ga0439436_0050833_170_757	194
524	3300041413	Ga0439465_0089399	Ga0439465_0089399_170_760	194
525	3300042006	Ga0439432_040707	Ga0439432_040707_406_1098	194
526	3300042007	Ga0439449_0001047	Ga0439449_0001047_4526_5113	194
527	3300042007	Ga0439449_0215998	Ga0439449_0215998_16_603	194
528	3300042015	Ga0439462_0147695	Ga0439462_0147695_56_643	194
529	3300046460	Ga0495638_0129544	Ga0495638_0129544_248_838	194
530	3300046491	Ga0495584_0048781	Ga0495584_0048781_1511_2095	194
531	3300048920	Ga0496117_0006751	Ga0496117_0006751_9984_10568	194
532	3300048924	Ga0496121_0148676	Ga0496121_0148676_926_1510	194
533	3300048925	Ga0496122_0001107	Ga0496122_0001107_19633_20217	194
534	3300048926	Ga0496123_0000562	Ga0496123_0000562_26362_26946	194
535	3300048927	Ga0496124_0007559	Ga0496124_0007559_8852_9436	194
536	3300048928	Ga0496125_0001370	Ga0496125_0001370_9173_9757	194
537	3300048929	Ga0496126_0003015	Ga0496126_0003015_8971_9555	194
538	3300049568	Ga0501031_0241416	Ga0501031_0241416_260_844	194
539	3300049569	Ga0501032_0000025	Ga0501032_0000025_51970_52656	194
540	3300049569	Ga0501032_0088775	Ga0501032_0088775_566_1150	194
541	3300049569	Ga0501032_0757992	Ga0501032_0757992_15_599	194
542	3300049570	Ga0501033_0000229	Ga0501033_0000229_1410_2096	194
543	3300049570	Ga0501033_0001216	Ga0501033_0001216_6609_7193	194
544	3300049570	Ga0501033_0001969	Ga0501033_0001969_9701_10285	194
545	3300049570	Ga0501033_0026545	Ga0501033_0026545_84_668	194
546	3300049570	Ga0501033_0072521	Ga0501033_0072521_930_1514	194
547	3300049570	Ga0501033_0467902	Ga0501033_0467902_58_642	194
548	3300049571	Ga0501034_0001862	Ga0501034_0001862_7667_8353	194
549	3300049571	Ga0501034_0280892	Ga0501034_0280892_76_660	194
550	3300049571	Ga0501034_0291447	Ga0501034_0291447_652_1236	194
551	3300049571	Ga0501034_0378691	Ga0501034_0378691_220_804	194
552	3300049572	Ga0501036_0001402	Ga0501036_0001402_1397_2083	194
553	3300049573	Ga0501037_0000176	Ga0501037_0000176_46717_47403	194
554	3300049573	Ga0501037_0000828	Ga0501037_0000828_3903_4487	194
555	3300049573	Ga0501037_0099630	Ga0501037_0099630_482_1066	194
556	3300049573	Ga0501037_0100166	Ga0501037_0100166_745_1329	194
557	3300049574	Ga0501038_0000862	Ga0501038_0000862_9588_10274	194
558	3300049574	Ga0501038_0220923	Ga0501038_0220923_773_1357	194
559	3300049574	Ga0501038_0457805	Ga0501038_0457805_99_683	194
560	3300049575	Ga0501039_0000003	Ga0501039_0000003_113466_114152	194
561	3300049579	Ga0501043_0000051	Ga0501043_0000051_1408_2094	194
562	3300049579	Ga0501043_0000114	Ga0501043_0000114_68088_68672	194
563	3300049579	Ga0501043_0097713	Ga0501043_0097713_779_1363	194
564	3300049579	Ga0501043_0313276	Ga0501043_0313276_596_1180	194
565	3300049579	Ga0501043_0348760	Ga0501043_0348760_459_1043	194
566	3300049579	Ga0501043_0745426	Ga0501043_0745426_105_689	194
567	3300049581	Ga0501047_0007205	Ga0501047_0007205_9578_10162	194
568	3300049581	Ga0501047_0037480	Ga0501047_0037480_1994_2578	194
569	3300049581	Ga0501047_0068361	Ga0501047_0068361_2674_3258	194
570	3300049583	Ga0501067_0148337	Ga0501067_0148337_555_1139	194
571	3300049585	Ga0501069_0000016	Ga0501069_0000016_7550_8134	194
572	3300049585	Ga0501069_0046007	Ga0501069_0046007_41_625	194
573	3300049586	Ga0501070_0000186	Ga0501070_0000186_41664_42248	194
574	3300049586	Ga0501070_0000931	Ga0501070_0000931_9428_10012	194
575	3300049586	Ga0501070_0006421	Ga0501070_0006421_4330_4914	194
576	3300049586	Ga0501070_0107402	Ga0501070_0107402_1363_1947	194
577	3300049586	Ga0501070_0126598	Ga0501070_0126598_766_1350	194
578	3300049586	Ga0501070_0346140	Ga0501070_0346140_519_1103	194
579	3300049586	Ga0501070_0401071	Ga0501070_0401071_67_651	194
580	3300049587	Ga0501071_0370700	Ga0501071_0370700_336_926	194
581	3300049589	Ga0501073_0156523	Ga0501073_0156523_293_877	194
582	3300049589	Ga0501073_0769924	Ga0501073_0769924_14_622	194
583	3300049590	Ga0501074_0001818	Ga0501074_0001818_7459_8043	194
584	3300049590	Ga0501074_0099182	Ga0501074_0099182_486_1070	194
585	3300049590	Ga0501074_0459747	Ga0501074_0459747_113_697	194
586	3300049741	Ga0501079_0095573	Ga0501079_0095573_1558_2142	194
587	3300049742	Ga0501080_0001450	Ga0501080_0001450_17672_18256	194
588	3300049742	Ga0501080_0004427	Ga0501080_0004427_10654_11238	194
589	3300049742	Ga0501080_0011492	Ga0501080_0011492_2270_2854	194
590	3300049742	Ga0501080_0033685	Ga0501080_0033685_1627_2211	194
591	3300049744	Ga0501083_0000111	Ga0501083_0000111_8350_8934	194
592	3300049744	Ga0501083_0150491	Ga0501083_0150491_335_919	194
593	3300049822	Ga0501035_0000102	Ga0501035_0000102_104862_105548	194
594	3300049822	Ga0501035_0000690	Ga0501035_0000690_32551_33135	194
595	3300049822	Ga0501035_0000752	Ga0501035_0000752_14662_15246	194
596	3300049822	Ga0501035_0001093	Ga0501035_0001093_2948_3532	194
597	3300049822	Ga0501035_0001914	Ga0501035_0001914_8466_9050	194
598	3300049822	Ga0501035_0012136	Ga0501035_0012136_5707_6291	194
599	3300049822	Ga0501035_0098972	Ga0501035_0098972_1207_1791	194
600	3300049823	Ga0501044_0000003	Ga0501044_0000003_82152_82736	194
601	3300049823	Ga0501044_0002922	Ga0501044_0002922_5019_5603	194
602	3300049823	Ga0501044_0021665	Ga0501044_0021665_3084_3668	194
603	3300049823	Ga0501044_0049355	Ga0501044_0049355_3142_3828	194
604	3300049823	Ga0501044_0089157	Ga0501044_0089157_949_1533	194
605	3300049823	Ga0501044_0131509	Ga0501044_0131509_903_1487	194
606	3300049823	Ga0501044_0164118	Ga0501044_0164118_1183_1767	194
607	3300050491	nmdc:mga00v17_115_c2	nmdc:mga00v17_115_c2_44305_44889	194
608	3300050492	nmdc:mga0yw44_141277_c1	nmdc:mga0yw44_141277_c1_895_1485	194
609	3300050492	nmdc:mga0yw44_263058_c1	nmdc:mga0yw44_263058_c1_93_683	194
610	3300053087	Ga0500643_010419	Ga0500643_010419_778_1368	194
611	3300053153	Ga0500616_0051734	Ga0500616_0051734_188_802	194
612	3300059639	Ga0587062_022137	Ga0587062_022137_239_847	194
613	3300060353	Ga0501082_0153547	Ga0501082_0153547_29_613	194
614	3300060353	Ga0501082_0926477	Ga0501082_0926477_33_617	194
615	iso_pu_bacteria	2508501122	2509108557	194
616	iso_pu_bacteria	2509276019	2509374416	194
617	iso_pu_bacteria	2510065057	2510307208	194
618	iso_pu_bacteria	2511231052	2511501058	194
619	iso_pu_bacteria	2512047086	2512532466	194
620	iso_pu_bacteria	2513237086	2513582833	194
621	iso_pu_bacteria	2513237091	2513618988	194
622	iso_pu_bacteria	2513237143	2513902291	194
623	iso_pu_bacteria	2513237156	2513983880	194
624	iso_pu_bacteria	2513237160	2514004729	194
625	iso_pu_bacteria	2515154107	2515608168	194
626	iso_pu_bacteria	2516143018	2516208919	194
627	iso_pu_bacteria	2516653046	2516892339	194
628	iso_pu_bacteria	2517487022	2517569139	194
629	iso_pu_bacteria	2524023207	2524451094	194
630	iso_pu_bacteria	2551306084	2551680477	194
631	iso_pu_bacteria	2551306085	2551683864	194
632	iso_pu_bacteria	2551306086	2551695308	194
633	iso_pu_bacteria	2551306087	2551704082	194
634	iso_pu_bacteria	2551306089	2551709738	194
635	iso_pu_bacteria	2551306090	2551722570	194
636	iso_pu_bacteria	2551306091	2551727264	194
637	iso_pu_bacteria	2551306092	2551737882	194
638	iso_pu_bacteria	2551306093	2551743478	194
639	iso_pu_bacteria	2558860100	2558863443	194
640	iso_pu_bacteria	2617270742	2617386743	194
641	iso_pu_bacteria	2657244999	2657683223	194
642	iso_pu_bacteria	2791355082	2792584204	194
643	iso_pu_bacteria	2791355091	2792622645	194
644	iso_pu_bacteria	2791355092	2792628434	194
645	iso_pu_bacteria	2791355253	2793282342	194
646	iso_pu_bacteria	2802428858	2802717783	194
647	iso_pu_bacteria	2802428859	2802723288	194
648	iso_pu_bacteria	2802428860	2802733151	194
649	iso_pu_bacteria	2802428861	2802736267	194
650	iso_pu_bacteria	2802428862	2802743523	194
651	iso_pu_bacteria	2802428863	2802750764	194
652	iso_pu_bacteria	2802429268	2804751388	194
653	iso_pu_bacteria	2889790730	2889794276	194
654	iso_pu_bacteria	2889914905	2889916765	194
655	iso_pu_bacteria	2913295892	2913297404	194
656	iso_pu_bacteria	2936996657	2937001014	194
657	iso_pu_bacteria	2937002841	2937004304	194
658	iso_pu_bacteria	2937009748	2937011057	194
659	iso_pu_bacteria	2937016420	2937019389	194
660	iso_pu_bacteria	2937023124	2937028489	194
661	iso_pu_bacteria	2937029754	2937029776	194
662	iso_pu_bacteria	2937036028	2937036802	194
663	iso_pu_bacteria	2937042894	2937048330	194
664	iso_pu_bacteria	2937049772	2937052064	194
665	iso_pu_bacteria	2937056579	2937059160	194
666	iso_pu_bacteria	2937063883	2937067852	194
667	iso_pu_bacteria	2937071275	2937073955	194
668	iso_pu_bacteria	2937078374	2937082882	194
669	iso_pu_bacteria	2937091812	2937095678	194
670	iso_pu_bacteria	2937098957	2937104129	194
671	iso_pu_bacteria	2937106411	2937110746	194
672	iso_pu_bacteria	2937113482	2937113955	194
673	iso_pu_bacteria	2937119839	2937125452	194
674	iso_pu_bacteria	2937126314	2937129020	194
675	iso_pu_bacteria	2957375807	2957379935	194
676	iso_pu_bacteria	2957382221	2957385816	194
677	iso_pu_bacteria	2957388812	2957389043	194
678	iso_pu_bacteria	2957395598	2957398347	194
679	iso_pu_bacteria	2957402308	2957407522	194
680	iso_pu_bacteria	2957408893	2957411626	194
681	iso_pu_bacteria	2957415311	2957418895	194
682	iso_pu_bacteria	2957422303	2957423189	194
683	iso_pu_bacteria	2957430029	2957432527	194
684	iso_pu_bacteria	2957437181	2957438782	194
685	iso_pu_bacteria	2957443900	2957446509	194
686	iso_pu_bacteria	2957450854	2957456599	194
687	iso_pu_bacteria	2957457609	2957463327	194
688	iso_pu_bacteria	2957464669	2957466644	194
689	iso_pu_bacteria	2957471148	2957473161	194
690	iso_pu_bacteria	2957478035	2957479931	194
691	iso_pu_bacteria	2957484790	2957485734	194
692	iso_pu_bacteria	2957491536	2957496243	194
693	iso_pu_bacteria	2957498199	2957505366	194
694	iso_pu_bacteria	2957505466	2957506172	194
695	iso_pu_bacteria	2960584000	2960588745	194
696	iso_pu_bacteria	2960591022	2960595663	194
697	iso_pu_bacteria	2960597568	2960601618	194
698	iso_pu_bacteria	2960603979	2960608574	194
699	iso_pu_bacteria	2960610863	2960617356	194
700	iso_pu_bacteria	2960617483	2960617789	194
701	iso_pu_bacteria	2960624210	2960625343	194
702	iso_pu_bacteria	2960631154	2960633135	194
703	iso_pu_bacteria	2960637947	2960643178	194
704	iso_pu_bacteria	2960645483	2960645885	194
705	iso_pu_bacteria	2960652885	2960658022	194
706	iso_pu_bacteria	2960660292	2960666493	194
707	iso_pu_bacteria	2960667422	2960668680	194
708	iso_pu_bacteria	2960674078	2960676940	194
709	iso_pu_bacteria	2960680706	2960684252	194
710	iso_pu_bacteria	2960687367	2960687703	194
711	iso_pu_bacteria	2960693952	2960696780	194
712	iso_pu_bacteria	2964607997	2964608718	194
713	iso_pu_bacteria	2964615318	2964616344	194
714	iso_pu_bacteria	2964621998	2964628879	194
715	iso_pu_bacteria	2964628898	2964635395	194
716	iso_pu_bacteria	2964636051	2964642551	194
717	iso_pu_bacteria	2964643177	2964646937	194
718	iso_pu_bacteria	2964649959	2964656324	194
719	iso_pu_bacteria	2964656573	2964659209	194
720	iso_pu_bacteria	2964663802	2964665564	194
721	iso_pu_bacteria	2964678106	2964679399	194
722	iso_pu_bacteria	2964685014	2964685505	194
723	iso_pu_bacteria	2964691889	2964692127	194
724	iso_pu_bacteria	2964698721	2964703506	194
725	iso_pu_bacteria	2964705432	2964705905	194
726	iso_pu_bacteria	2964712639	2964714328	194
727	iso_pu_bacteria	2964719344	2964720827	194
728	iso_pu_bacteria	2967664464	2967668691	194
729	iso_pu_bacteria	2967671571	2967677127	194
730	iso_pu_bacteria	2967693043	2967693334	194
731	iso_pu_bacteria	2967699805	2967701243	194
732	iso_pu_bacteria	2967706974	2967714299	194
733	iso_pu_bacteria	2967714385	2967716440	194
734	iso_pu_bacteria	2967721400	2967723340	194
735	iso_pu_bacteria	2967735183	2967735532	194
736	iso_pu_bacteria	2967742019	2967742754	194
737	iso_pu_bacteria	2967748971	2967754517	194
738	iso_pu_bacteria	2967755722	2967756983	194
739	iso_pu_bacteria	2967762386	2967764520	194
740	iso_pu_bacteria	2967769361	2967771692	194
741	iso_pu_bacteria	2967775926	2967776713	194
742	iso_pu_bacteria	2970019648	2970020527	194
743	iso_pu_bacteria	2970026789	2970032665	194
744	iso_pu_bacteria	2970033650	2970035744	194
745	iso_pu_bacteria	2970040964	2970041627	194
746	iso_pu_bacteria	2970047711	2970050493	194
747	iso_pu_bacteria	2970054988	2970057908	194
748	iso_pu_bacteria	2970061556	2970067774	194
749	iso_pu_bacteria	2970068827	2970075523	194
750	iso_pu_bacteria	2970076120	2970081383	194
751	iso_pu_bacteria	2970082768	2970085363	194
752	iso_pu_bacteria	2970088815	2970091625	194
753	iso_pu_bacteria	2970095765	2970100943	194
754	iso_pu_bacteria	2970102677	2970105087	194
755	iso_pu_bacteria	2970109326	2970114575	194
756	iso_pu_bacteria	2970116247	2970122596	194
757	iso_pu_bacteria	2970122695	2970124368	194
758	iso_pu_bacteria	2970129317	2970129606	194
759	iso_pu_bacteria	2970136068	2970137312	194
760	iso_pu_bacteria	2970149975	2970155815	194
761	iso_pu_bacteria	2970156795	2970159799	194
762	iso_pu_bacteria	2970164137	2970166837	194
763	iso_pu_bacteria	2970170962	2970176014	194
764	iso_pu_bacteria	2970177841	2970182248	194
765	iso_pu_bacteria	2970184632	2970190901	194
766	iso_pu_bacteria	2970191845	2970194292	194
767	iso_pu_bacteria	2977516862	2977517986	194
768	iso_pu_bacteria	2977523885	2977529792	194
769	iso_pu_bacteria	2977530762	2977531989	194
770	iso_pu_bacteria	2977537788	2977538076	194
771	iso_pu_bacteria	2977544691	2977546003	194
772	iso_pu_bacteria	2977551784	2977552076	194
773	iso_pu_bacteria	2977558990	2977562797	194
774	iso_pu_bacteria	2977565890	2977566301	194
775	iso_pu_bacteria	2977572785	2977576521	194
776	iso_pu_bacteria	2977579622	2977585718	194
777	iso_pu_bacteria	643692032	643825124	194
778	iso_pu_bacteria	648276728	648736453	194
779	iso_pu_bacteria	8003992118	8003993034	194
780	iso_pu_bacteria	8003999396	8004000273	194
781	iso_pu_bacteria	8049293176	8049293962	194
782	3300001979	JGI24740J21852_10000075	JGI24740J21852_100000753	195
783	3300002704	JGI25155J39150_1000032	JGI25155J39150_100003223	195
784	3300002705	JGI25156J39149_1000129	JGI25156J39149_100012923	195
785	3300002737	JGI25162J39368_1001169	JGI25162J39368_100116919	195
786	3300002737	JGI25162J39368_1001727	JGI25162J39368_100172712	195
787	3300002737	JGI25162J39368_1003463	JGI25162J39368_10034637	195
788	3300002738	JGI25154J39366_1000324	JGI25154J39366_10003243	195
789	3300002739	JGI25158J39367_1000210	JGI25158J39367_10002109	195
790	3300002741	JGI25157J39369_1000061	JGI25157J39369_100006123	195
791	3300002773	JGI25152J39213_1001642	JGI25152J39213_10016427	195
792	3300002773	JGI25152J39213_1003410	JGI25152J39213_10034109	195
793	3300002773	JGI25152J39213_1008674	JGI25152J39213_10086742	195
794	3300002773	JGI25152J39213_1009210	JGI25152J39213_10092102	195
795	3300002773	JGI25152J39213_1009211	JGI25152J39213_10092112	195
796	3300002773	JGI25152J39213_1024838	JGI25152J39213_10248382	195
797	3300002774	JGI25150J39212_1000033	JGI25150J39212_100003361	195
798	3300002987	JGI25159J45721_1000136	JGI25159J45721_100013625	195
799	3300002987	JGI25159J45721_1000544	JGI25159J45721_100054418	195
800	3300003187	JGI25151J46595_10000108	JGI25151J46595_1000010835	195
801	3300003187	JGI25151J46595_10000591	JGI25151J46595_1000059115	195
802	3300003187	JGI25151J46595_10025400	JGI25151J46595_100254004	195
803	3300003214	JGI25165J46597_1000630	JGI25165J46597_100063022	195
804	3300003214	JGI25165J46597_1000944	JGI25165J46597_100094419	195
805	3300003215	JGI25153J46596_10007647	JGI25153J46596_100076472	195
806	3300003215	JGI25153J46596_10009089	JGI25153J46596_100090898	195
807	3300003215	JGI25153J46596_10010252	JGI25153J46596_100102527	195
808	3300003215	JGI25153J46596_10022011	JGI25153J46596_100220112	195
809	3300003215	JGI25153J46596_10022014	JGI25153J46596_100220142	195
810	3300003215	JGI25153J46596_10033605	JGI25153J46596_100336053	195
811	3300003320	rootH2_10025055	rootH2_100250558	195
812	3300003322	rootL2_10082663	rootL2_100826632	195
813	3300003354	JGI25160J50197_1000015	JGI25160J50197_100001538	195
814	3300003354	JGI25160J50197_1000191	JGI25160J50197_100019126	195
815	3300003354	JGI25160J50197_1005784	JGI25160J50197_10057847	195
816	3300003354	JGI25160J50197_1023350	JGI25160J50197_10233502	195
817	3300003374	JGI25161J50226_1000005	JGI25161J50226_1000005203	195
818	3300003374	JGI25161J50226_1000051	JGI25161J50226_10000518	195
819	3300003374	JGI25161J50226_1000704	JGI25161J50226_10007048	195
820	3300003771	Ga0055526_1001505	Ga0055526_100150512	195
821	3300003771	Ga0055526_1001653	Ga0055526_10016538	195
822	3300003771	Ga0055526_1023905	Ga0055526_10239052	195
823	3300003775	Ga0055524_1009931	Ga0055524_10099313	195
824	3300003775	Ga0055524_1015746	Ga0055524_10157463	195
825	3300003775	Ga0055524_1038585	Ga0055524_10385853	195
826	3300003775	Ga0055524_1049079	Ga0055524_10490792	195
827	3300003781	Ga0055536_1004520	Ga0055536_10045203	195
828	3300003790	Ga0055528_1000201	Ga0055528_100020143	195
829	3300003790	Ga0055528_1000460	Ga0055528_10004606	195
830	3300003790	Ga0055528_1001727	Ga0055528_10017274	195
831	3300003790	Ga0055528_1005249	Ga0055528_10052492	195
832	3300003790	Ga0055528_1026969	Ga0055528_10269692	195
833	3300003790	Ga0055528_1026972	Ga0055528_10269722	195
834	3300003790	Ga0055528_1040407	Ga0055528_10404071	195
835	3300003792	Ga0055540_1000807	Ga0055540_10008073	195
836	3300003792	Ga0055540_1003756	Ga0055540_10037565	195
837	3300003792	Ga0055540_1012994	Ga0055540_10129942	195
838	3300003792	Ga0055540_1017252	Ga0055540_10172524	195
839	3300003792	Ga0055540_1017773	Ga0055540_10177732	195
840	3300003794	Ga0055531_10002233	Ga0055531_100022332	195
841	3300003856	Ga0058692_1000457	Ga0058692_10004578	195
842	3300003856	Ga0058692_1002674	Ga0058692_10026743	195
843	3300004625	Ga0055543_1000012	Ga0055543_100001239	195
844	3300004625	Ga0055543_1000258	Ga0055543_100025816	195
845	3300004625	Ga0055543_1001749	Ga0055543_10017492	195
846	3300005262	Ga0065165_1000125	Ga0065165_1000125102	195
847	3300005262	Ga0065165_1003558	Ga0065165_100355812	195
848	3300005262	Ga0065165_1034484	Ga0065165_10344842	195
849	3300005331	Ga0070670_100009220	Ga0070670_1000092204	195
850	3300005335	Ga0070666_10148138	Ga0070666_101481381	195
851	3300005353	Ga0070669_100070984	Ga0070669_1000709842	195
852	3300005355	Ga0070671_100078659	Ga0070671_1000786594	195
853	3300005367	Ga0070667_100136430	Ga0070667_1001364303	195
854	3300005455	Ga0070663_100038200	Ga0070663_1000382002	195
855	3300005548	Ga0070665_100098033	Ga0070665_1000980332	195
856	3300005548	Ga0070665_100226673	Ga0070665_1002266733	195
857	3300005548	Ga0070665_100284701	Ga0070665_1002847013	195
858	3300005844	Ga0068862_100383807	Ga0068862_1003838072	195
859	3300005937	Ga0081455_10522003	Ga0081455_105220031	195
860	3300006038	Ga0075365_10004005	Ga0075365_1000400511	195
861	3300006038	Ga0075365_10024163	Ga0075365_100241634	195
862	3300006042	Ga0075368_10003964	Ga0075368_100039643	195
863	3300006042	Ga0075368_10065122	Ga0075368_100651222	195
864	3300006048	Ga0075363_100148711	Ga0075363_1001487112	195
865	3300006051	Ga0075364_10027201	Ga0075364_100272012	195
866	3300006051	Ga0075364_10682895	Ga0075364_106828951	195
867	3300006177	Ga0075362_10101028	Ga0075362_101010281	195
868	3300006178	Ga0075367_10169458	Ga0075367_101694583	195
869	3300006178	Ga0075367_10227761	Ga0075367_102277611	195
870	3300006186	Ga0075369_10002839	Ga0075369_100028392	195
871	3300006186	Ga0075369_10006353	Ga0075369_100063535	195
872	3300006186	Ga0075369_10038544	Ga0075369_100385441	195
873	3300006195	Ga0075366_10025990	Ga0075366_100259902	195
874	3300006353	Ga0075370_10023755	Ga0075370_100237556	195
875	3300006353	Ga0075370_10074796	Ga0075370_100747962	195
876	3300006353	Ga0075370_10088215	Ga0075370_100882151	195
877	3300006946	Ga0079104_1000032	Ga0079104_1000032119	195
878	3300006948	Ga0099826_10000219	Ga0099826_1000021918	195
879	3300006948	Ga0099826_10015017	Ga0099826_100150176	195
880	3300009011	Ga0105251_10008871	Ga0105251_100088715	195
881	3300009093	Ga0105240_10000032	Ga0105240_10000032181	195
882	3300009148	Ga0105243_10008523	Ga0105243_100085237	195
883	3300009545	Ga0105237_10002365	Ga0105237_1000236510	195
884	3300009553	Ga0105249_10266379	Ga0105249_102663792	195
885	3300009765	Ga0123341_1000062	Ga0123341_10000629	195
886	3300009766	Ga0123342_1027181	Ga0123342_10271812	195
887	3300010375	Ga0105239_10013157	Ga0105239_100131577	195
888	3300013100	Ga0157373_10135794	Ga0157373_101357942	195
889	3300013102	Ga0157371_10000073	Ga0157371_1000007332	195
890	3300013102	Ga0157371_10007192	Ga0157371_100071925	195
891	3300013104	Ga0157370_10001154	Ga0157370_1000115414	195
892	3300013104	Ga0157370_10003636	Ga0157370_1000363613	195
893	3300013105	Ga0157369_10185520	Ga0157369_101855202	195
894	3300014497	Ga0182008_10075376	Ga0182008_100753761	195
895	3300015262	Ga0182007_10000460	Ga0182007_1000046018	195
896	3300015265	Ga0182005_1015635	Ga0182005_10156352	195
897	3300025206	Ga0209435_100042	Ga0209435_10004224	195
898	3300025208	Ga0209436_100173	Ga0209436_1001739	195
899	3300025230	Ga0209563_104790	Ga0209563_1047901	195
900	3300025233	Ga0209437_100033	Ga0209437_100033312	195
901	3300025233	Ga0209437_100075	Ga0209437_100075194	195
902	3300025245	Ga0207425_1000031	Ga0207425_100003181	195
903	3300025245	Ga0207425_1001353	Ga0207425_10013535	195
904	3300025245	Ga0207425_1004550	Ga0207425_10045503	195
905	3300025245	Ga0207425_1022022	Ga0207425_10220223	195
906	3300025245	Ga0207425_1024030	Ga0207425_10240303	195
907	3300025245	Ga0207425_1046658	Ga0207425_10466581	195
908	3300025246	Ga0209646_1000145	Ga0209646_100014524	195
909	3300025246	Ga0209646_1008549	Ga0209646_10085493	195
910	3300025250	Ga0209026_1000160	Ga0209026_100016024	195
911	3300025253	Ga0209677_100845	Ga0209677_10084511	195
912	3300025256	Ga0209759_1000177	Ga0209759_100017724	195
913	3300025258	Ga0209129_1000053	Ga0209129_100005382	195
914	3300025258	Ga0209129_1000137	Ga0209129_100013713	195
915	3300025258	Ga0209129_1000932	Ga0209129_100093212	195
916	3300025258	Ga0209129_1001697	Ga0209129_10016975	195
917	3300025258	Ga0209129_1002015	Ga0209129_10020154	195
918	3300025258	Ga0209129_1002041	Ga0209129_10020413	195
919	3300025258	Ga0209129_1005904	Ga0209129_10059042	195
920	3300025258	Ga0209129_1008188	Ga0209129_10081882	195
921	3300025261	Ga0209233_1000056	Ga0209233_100005620	195
922	3300025261	Ga0209233_1000064	Ga0209233_1000064110	195
923	3300025261	Ga0209233_1000209	Ga0209233_100020998	195
924	3300025263	Ga0209565_1012288	Ga0209565_10122882	195
925	3300025273	Ga0209673_1000041	Ga0209673_1000041102	195
926	3300025273	Ga0209673_1000319	Ga0209673_100031938	195
927	3300025273	Ga0209673_1000603	Ga0209673_100060332	195
928	3300025273	Ga0209673_1001326	Ga0209673_100132622	195
929	3300025273	Ga0209673_1004666	Ga0209673_10046669	195
930	3300025273	Ga0209673_1005348	Ga0209673_10053488	195
931	3300025273	Ga0209673_1006924	Ga0209673_10069245	195
932	3300025273	Ga0209673_1012129	Ga0209673_10121293	195
933	3300025273	Ga0209673_1029328	Ga0209673_10293282	195
934	3300025284	Ga0209130_1000006	Ga0209130_1000006504	195
935	3300025284	Ga0209130_1000018	Ga0209130_1000018232	195
936	3300025284	Ga0209130_1013563	Ga0209130_10135632	195
937	3300025284	Ga0209130_1022880	Ga0209130_10228802	195
938	3300025284	Ga0209130_1043490	Ga0209130_10434901	195
939	3300025291	Ga0209675_1048180	Ga0209675_10481802	195
940	3300025292	Ga0209676_1004264	Ga0209676_10042644	195
941	3300025292	Ga0209676_1014196	Ga0209676_10141964	195
942	3300025292	Ga0209676_1017727	Ga0209676_10177272	195
943	3300025294	Ga0209025_1000074	Ga0209025_1000074291	195
944	3300025294	Ga0209025_1000080	Ga0209025_10000802	195
945	3300025294	Ga0209025_1000087	Ga0209025_100008781	195
946	3300025294	Ga0209025_1000199	Ga0209025_100019942	195
947	3300025294	Ga0209025_1001440	Ga0209025_10014402	195
948	3300025294	Ga0209025_1001600	Ga0209025_10016002	195
949	3300025294	Ga0209025_1002011	Ga0209025_10020115	195
950	3300025294	Ga0209025_1009457	Ga0209025_10094577	195
951	3300025294	Ga0209025_1010350	Ga0209025_10103502	195
952	3300025294	Ga0209025_1015894	Ga0209025_10158942	195
953	3300025294	Ga0209025_1024824	Ga0209025_10248242	195
954	3300025294	Ga0209025_1048020	Ga0209025_10480203	195
955	3300025294	Ga0209025_1105221	Ga0209025_11052211	195
956	3300025295	Ga0209564_1000425	Ga0209564_100042524	195
957	3300025295	Ga0209564_1000431	Ga0209564_100043129	195
958	3300025295	Ga0209564_1001106	Ga0209564_100110617	195
959	3300025297	Ga0209758_1000081	Ga0209758_100008181	195
960	3300025297	Ga0209758_1000890	Ga0209758_100089015	195
961	3300025297	Ga0209758_1002000	Ga0209758_100200015	195
962	3300025297	Ga0209758_1003116	Ga0209758_10031164	195
963	3300025297	Ga0209758_1003638	Ga0209758_100363815	195
964	3300025297	Ga0209758_1006714	Ga0209758_10067142	195
965	3300025297	Ga0209758_1008032	Ga0209758_10080327	195
966	3300025297	Ga0209758_1009477	Ga0209758_10094779	195
967	3300025298	Ga0209050_1005227	Ga0209050_10052275	195
968	3300025298	Ga0209050_1007237	Ga0209050_10072372	195
969	3300025299	Ga0209256_1001068	Ga0209256_10010687	195
970	3300025299	Ga0209256_1001698	Ga0209256_10016985	195
971	3300025299	Ga0209256_1003487	Ga0209256_100348715	195
972	3300025299	Ga0209256_1005328	Ga0209256_10053283	195
973	3300025299	Ga0209256_1005451	Ga0209256_10054516	195
974	3300025299	Ga0209256_1008937	Ga0209256_10089372	195
975	3300025299	Ga0209256_1028344	Ga0209256_10283443	195
976	3300025299	Ga0209256_1033722	Ga0209256_10337222	195
977	3300025302	Ga0207426_1000044	Ga0207426_1000044157	195
978	3300025302	Ga0207426_1000106	Ga0207426_100010680	195
979	3300025302	Ga0207426_1000119	Ga0207426_1000119178	195
980	3300025302	Ga0207426_1005259	Ga0207426_10052593	195
981	3300025303	Ga0209051_1000878	Ga0209051_10008787	195
982	3300025303	Ga0209051_1006558	Ga0209051_10065584	195
983	3300025303	Ga0209051_1010581	Ga0209051_10105815	195
984	3300025303	Ga0209051_1018040	Ga0209051_10180402	195
985	3300025303	Ga0209051_1021615	Ga0209051_10216151	195
986	3300025303	Ga0209051_1022549	Ga0209051_10225492	195
987	3300025303	Ga0209051_1025554	Ga0209051_10255544	195
988	3300025304	Ga0209257_1002246	Ga0209257_10022464	195
989	3300025304	Ga0209257_1004833	Ga0209257_10048337	195
990	3300025321	Ga0207656_10098617	Ga0207656_100986172	195
991	3300025735	Ga0207713_1016350	Ga0207713_10163503	195
992	3300025913	Ga0207695_10000024	Ga0207695_10000024182	195
993	3300025914	Ga0207671_10000718	Ga0207671_1000071817	195
994	3300025919	Ga0207657_10503275	Ga0207657_105032752	195
995	3300025923	Ga0207681_10027640	Ga0207681_100276403	195
996	3300025923	Ga0207681_10350460	Ga0207681_103504602	195
997	3300025925	Ga0207650_10005961	Ga0207650_100059614	195
998	3300025935	Ga0207709_10011235	Ga0207709_100112355	195
999	3300025941	Ga0207711_10597097	Ga0207711_105970971	195
1000	3300025941	Ga0207711_10797390	Ga0207711_107973901	195
1001	3300025986	Ga0207658_10129704	Ga0207658_101297042	195
1002	3300026067	Ga0207678_10058238	Ga0207678_100582386	195
1003	3300027111	Ga0209281_1000053	Ga0209281_1000053228	195
1004	3300027312	Ga0209371_1000021	Ga0209371_1000021446	195
1005	3300027312	Ga0209371_1000966	Ga0209371_10009666	195
1006	3300027312	Ga0209371_1001249	Ga0209371_100124914	195
1007	3300027666	Ga0209282_1003596	Ga0209282_10035969	195
1008	3300027666	Ga0209282_1040178	Ga0209282_10401782	195
1009	3300028379	Ga0268266_10025861	Ga0268266_100258612	195
1010	3300028379	Ga0268266_10209519	Ga0268266_102095192	195
1011	3300028379	Ga0268266_10292451	Ga0268266_102924512	195
1012	3300028794	Ga0307515_10009393	Ga0307515_1000939316	195
1013	3300030500	Ga0268256_1000020	Ga0268256_1000020452	195
1014	3300030500	Ga0268256_1000660	Ga0268256_10006607	195
1015	3300030500	Ga0268256_1009668	Ga0268256_10096683	195
1016	3300030744	Ga0316181_1231982	Ga0316181_12319823	195
1017	3300031456	Ga0307513_10197751	Ga0307513_101977512	195
1018	3300031456	Ga0307513_10309409	Ga0307513_103094093	195
1019	3300031731	Ga0307405_10001577	Ga0307405_1000157712	195
1020	3300031901	Ga0307406_10009795	Ga0307406_100097957	195
1021	3300031911	Ga0307412_10000728	Ga0307412_1000072816	195
1022	3300031995	Ga0307409_100201513	Ga0307409_1002015132	195
1023	3300037471	Ga0395905_0002291	Ga0395905_0002291_13484_14074	195
1024	3300041413	Ga0439465_0006038	Ga0439465_0006038_32_622	195
1025	3300041413	Ga0439465_0027353	Ga0439465_0027353_698_1288	195
1026	3300041413	Ga0439465_0104335	Ga0439465_0104335_346_936	195
1027	3300041441	Ga0451787_155138	Ga0451787_155138_41_631	195
1028	3300041491	Ga0451833_0721085	Ga0451833_0721085_536_1126	195
1029	3300041492	Ga0451835_0004513	Ga0451835_0004513_1262_1852	195
1030	3300041496	Ga0451839_1200455	Ga0451839_1200455_699_1289	195
1031	3300041498	Ga0451841_0820828	Ga0451841_0820828_568_1158	195
1032	3300041507	Ga0451851_0769438	Ga0451851_0769438_919_1509	195
1033	3300041509	Ga0451843_1404302	Ga0451843_1404302_663_1253	195
1034	3300041512	Ga0451853_0813657	Ga0451853_0813657_86_676	195
1035	3300044683	Ga0466965_0132221	Ga0466965_0132221_162_749	195
1036	3300044694	Ga0466963_0020949	Ga0466963_0020949_460_1146	195
1037	3300046454	Ga0495592_0046201	Ga0495592_0046201_519_1166	195
1038	3300046459	Ga0495629_0222663	Ga0495629_0222663_517_1164	195
1039	3300046460	Ga0495638_0000789	Ga0495638_0000789_28734_29324	195
1040	3300046474	Ga0495605_0003154	Ga0495605_0003154_5368_5958	195
1041	3300046492	Ga0495585_0002715	Ga0495585_0002715_9156_9746	195
1042	3300046501	Ga0495607_0048831	Ga0495607_0048831_928_1518	195
1043	3300046501	Ga0495607_0077834	Ga0495607_0077834_445_1035	195
1044	3300046506	Ga0495583_0074101	Ga0495583_0074101_259_849	195
1045	3300046507	Ga0495606_0010031	Ga0495606_0010031_2944_3534	195
1046	3300046507	Ga0495606_0065988	Ga0495606_0065988_1205_1795	195
1047	3300046512	Ga0495610_0014129	Ga0495610_0014129_3866_4456	195
1048	3300046515	Ga0495620_0014659	Ga0495620_0014659_435_1025	195
1049	3300046518	Ga0495631_0001716	Ga0495631_0001716_5943_6533	195
1050	3300046519	Ga0495632_0008931	Ga0495632_0008931_3038_3628	195
1051	3300046522	Ga0495643_0004836	Ga0495643_0004836_4654_5244	195
1052	3300046522	Ga0495643_0037538	Ga0495643_0037538_1466_2056	195
1053	3300046522	Ga0495643_0053945	Ga0495643_0053945_1392_1982	195
1054	3300046522	Ga0495643_0082839	Ga0495643_0082839_451_1038	195
1055	3300046524	Ga0495648_0127865	Ga0495648_0127865_522_1112	195
1056	3300046530	Ga0495654_0000092	Ga0495654_0000092_44547_45134	195
1057	3300046530	Ga0495654_0059986	Ga0495654_0059986_620_1210	195
1058	3300046530	Ga0495654_0110767	Ga0495654_0110767_326_916	195
1059	3300046533	Ga0495640_0305551	Ga0495640_0305551_173_820	195
1060	3300046538	Ga0495609_0020381	Ga0495609_0020381_783_1373	195
1061	3300046558	Ga0495633_0076654	Ga0495633_0076654_164_751	195
1062	3300046615	Ga0495656_0007841	Ga0495656_0007841_189_779	195
1063	3300046616	Ga0495668_0013369	Ga0495668_0013369_2723_3313	195
1064	3300046616	Ga0495668_0022328	Ga0495668_0022328_2350_2940	195
1065	3300046660	Ga0495625_0000883	Ga0495625_0000883_25437_26027	195
1066	3300046660	Ga0495625_0213945	Ga0495625_0213945_478_1065	195
1067	3300046674	Ga0495588_0008991	Ga0495588_0008991_786_1373	195
1068	3300046683	Ga0495658_0120709	Ga0495658_0120709_365_1012	195
1069	3300046691	Ga0495670_0016707	Ga0495670_0016707_1377_1967	195
1070	3300046691	Ga0495670_0026742	Ga0495670_0026742_468_1058	195
1071	3300046694	Ga0495649_0080678	Ga0495649_0080678_125_715	195
1072	3300046809	Ga0495600_0123827	Ga0495600_0123827_175_822	195
1073	3300046810	Ga0495660_0111606	Ga0495660_0111606_521_1111	195
1074	3300046810	Ga0495660_0117507	Ga0495660_0117507_580_1170	195
1075	3300047321	Ga0495676_0445333	Ga0495676_0445333_153_800	195
1076	3300047323	Ga0495683_0056540	Ga0495683_0056540_1073_1663	195
1077	3300047443	Ga0495687_015580	Ga0495687_015580_1589_2179	195
1078	3300047470	Ga0495681_0001410	Ga0495681_0001410_5637_6224	195
1079	3300047472	Ga0495686_0002844	Ga0495686_0002844_14338_14928	195
1080	3300047472	Ga0495686_0028624	Ga0495686_0028624_140_730	195
1081	3300048909	Ga0496106_0016430	Ga0496106_0016430_3351_3941	195
1082	3300048913	Ga0496110_1103467	Ga0496110_1103467_10_597	195
1083	3300048914	Ga0496111_0002285	Ga0496111_0002285_4881_5468	195
1084	3300048919	Ga0496116_0000026	Ga0496116_0000026_221930_222517	195
1085	3300048919	Ga0496116_0002740	Ga0496116_0002740_14416_15006	195
1086	3300048919	Ga0496116_0039748	Ga0496116_0039748_2080_2667	195
1087	3300048919	Ga0496116_0061983	Ga0496116_0061983_55_642	195
1088	3300048919	Ga0496116_0091597	Ga0496116_0091597_581_1168	195
1089	3300048919	Ga0496116_0156092	Ga0496116_0156092_27_614	195
1090	3300048919	Ga0496116_0226716	Ga0496116_0226716_336_923	195
1091	3300048920	Ga0496117_0000002	Ga0496117_0000002_1457509_1458096	195
1092	3300048920	Ga0496117_0011444	Ga0496117_0011444_1688_2275	195
1093	3300048920	Ga0496117_0024779	Ga0496117_0024779_2890_3540	195
1094	3300048920	Ga0496117_0080253	Ga0496117_0080253_1261_1848	195
1095	3300048921	Ga0496118_0000214	Ga0496118_0000214_90894_91481	195
1096	3300048921	Ga0496118_0003715	Ga0496118_0003715_18022_18612	195
1097	3300048921	Ga0496118_0010030	Ga0496118_0010030_8340_8927	195
1098	3300048921	Ga0496118_0030002	Ga0496118_0030002_902_1552	195
1099	3300048921	Ga0496118_0085449	Ga0496118_0085449_1475_2062	195
1100	3300048921	Ga0496118_0154472	Ga0496118_0154472_788_1378	195
1101	3300048921	Ga0496118_0191196	Ga0496118_0191196_447_1034	195
1102	3300048922	Ga0496119_0042057	Ga0496119_0042057_1432_2019	195
1103	3300048922	Ga0496119_0042848	Ga0496119_0042848_1266_1853	195
1104	3300048922	Ga0496119_0122081	Ga0496119_0122081_262_849	195
1105	3300048923	Ga0496120_0000125	Ga0496120_0000125_26156_26743	195
1106	3300048923	Ga0496120_0030565	Ga0496120_0030565_1849_2436	195
1107	3300048923	Ga0496120_0062583	Ga0496120_0062583_621_1208	195
1108	3300048924	Ga0496121_0000001	Ga0496121_0000001_922421_923008	195
1109	3300048924	Ga0496121_0018097	Ga0496121_0018097_1839_2426	195
1110	3300048924	Ga0496121_0033723	Ga0496121_0033723_1198_1788	195
1111	3300048924	Ga0496121_0074664	Ga0496121_0074664_1581_2168	195
1112	3300048924	Ga0496121_0146696	Ga0496121_0146696_699_1289	195
1113	3300048925	Ga0496122_0000001	Ga0496122_0000001_828298_828885	195
1114	3300048925	Ga0496122_0000160	Ga0496122_0000160_83621_84208	195
1115	3300048925	Ga0496122_0006166	Ga0496122_0006166_8825_9412	195
1116	3300048925	Ga0496122_0023327	Ga0496122_0023327_1505_2095	195
1117	3300048925	Ga0496122_0031570	Ga0496122_0031570_864_1451	195
1118	3300048925	Ga0496122_0078819	Ga0496122_0078819_39_626	195
1119	3300048925	Ga0496122_0109886	Ga0496122_0109886_522_1112	195
1120	3300048926	Ga0496123_0000001	Ga0496123_0000001_832029_832616	195
1121	3300048926	Ga0496123_0000034	Ga0496123_0000034_113299_113886	195
1122	3300048926	Ga0496123_0007779	Ga0496123_0007779_7239_7829	195
1123	3300048926	Ga0496123_0011987	Ga0496123_0011987_844_1434	195
1124	3300048926	Ga0496123_0019336	Ga0496123_0019336_2213_2800	195
1125	3300048926	Ga0496123_0035527	Ga0496123_0035527_2862_3449	195
1126	3300048927	Ga0496124_0000349	Ga0496124_0000349_11266_11853	195
1127	3300048927	Ga0496124_0015423	Ga0496124_0015423_3170_3760	195
1128	3300048927	Ga0496124_0065160	Ga0496124_0065160_2108_2695	195
1129	3300048927	Ga0496124_0169581	Ga0496124_0169581_1068_1658	195
1130	3300048927	Ga0496124_0246652	Ga0496124_0246652_695_1285	195
1131	3300048927	Ga0496124_0290724	Ga0496124_0290724_201_788	195
1132	3300048927	Ga0496124_0298245	Ga0496124_0298245_85_672	195
1133	3300048927	Ga0496124_0478554	Ga0496124_0478554_56_643	195
1134	3300048927	Ga0496124_0498202	Ga0496124_0498202_217_804	195
1135	3300048928	Ga0496125_0000001	Ga0496125_0000001_1036302_1036889	195
1136	3300048928	Ga0496125_0004855	Ga0496125_0004855_37_627	195
1137	3300048928	Ga0496125_0080969	Ga0496125_0080969_742_1329	195
1138	3300048928	Ga0496125_0083675	Ga0496125_0083675_1237_1824	195
1139	3300048928	Ga0496125_0186235	Ga0496125_0186235_114_701	195
1140	3300048929	Ga0496126_0000069	Ga0496126_0000069_70799_71446	195
1141	3300048929	Ga0496126_0099712	Ga0496126_0099712_477_1064	195
1142	3300048929	Ga0496126_0108899	Ga0496126_0108899_459_1046	195
1143	3300048929	Ga0496126_0167746	Ga0496126_0167746_164_751	195
1144	3300049569	Ga0501032_0161776	Ga0501032_0161776_412_1002	195
1145	3300049571	Ga0501034_0827030	Ga0501034_0827030_44_634	195
1146	3300049579	Ga0501043_0228973	Ga0501043_0228973_670_1260	195
1147	3300049580	Ga0501046_0375254	Ga0501046_0375254_86_676	195
1148	3300049581	Ga0501047_0057902	Ga0501047_0057902_2055_2645	195
1149	3300049744	Ga0501083_0075792	Ga0501083_0075792_1463_2053	195
1150	3300049823	Ga0501044_0142371	Ga0501044_0142371_756_1346	195
1151	3300049823	Ga0501044_0399241	Ga0501044_0399241_210_842	195
1152	3300050489	nmdc:mga03683_308204_c1	nmdc:mga03683_308204_c1_27_614	195
1153	3300050489	nmdc:mga03683_71286_c1	nmdc:mga03683_71286_c1_720_1310	195
1154	3300050490	nmdc:mga03n38_453662_c1	nmdc:mga03n38_453662_c1_98_685	195
1155	3300050491	nmdc:mga00v17_107251_c1	nmdc:mga00v17_107251_c1_54_641	195
1156	3300050491	nmdc:mga00v17_1990_c1	nmdc:mga00v17_1990_c1_1611_2198	195
1157	3300050492	nmdc:mga0yw44_616149_c1	nmdc:mga0yw44_616149_c1_30_617	195
1158	3300050494	nmdc:mga06z11_23123_c1	nmdc:mga06z11_23123_c1_1273_1863	195
1159	3300050494	nmdc:mga06z11_65760_c1	nmdc:mga06z11_65760_c1_845_1432	195
1160	3300050495	nmdc:mga04h51_2806_c1	nmdc:mga04h51_2806_c1_945_1532	195
1161	3300050516	nmdc:mga0sz30_3703_c1	nmdc:mga0sz30_3703_c1_1839_2426	195
1162	3300053079	Ga0500610_0002202	Ga0500610_0002202_1404_1994	195
1163	3300053086	Ga0500578_0003995	Ga0500578_0003995_4734_5324	195
1164	3300053086	Ga0500578_0107924	Ga0500578_0107924_132_722	195
1165	3300053107	Ga0500560_035559	Ga0500560_035559_456_1043	195
1166	3300053109	Ga0500569_063791	Ga0500569_063791_240_830	195
1167	3300053118	Ga0500594_0001136	Ga0500594_0001136_34_624	195
1168	3300053125	Ga0500618_000227	Ga0500618_000227_2568_3155	195
1169	3300053125	Ga0500618_002042	Ga0500618_002042_1233_1823	195
1170	3300053125	Ga0500618_047482	Ga0500618_047482_77_664	195
1171	3300053134	Ga0500658_0001177	Ga0500658_0001177_9774_10364	195
1172	3300053136	Ga0500559_0003764	Ga0500559_0003764_1950_2540	195
1173	3300053139	Ga0500568_0002384	Ga0500568_0002384_6007_6597	195
1174	3300053139	Ga0500568_0003084	Ga0500568_0003084_704_1294	195
1175	3300053140	Ga0500573_0049947	Ga0500573_0049947_71_658	195
1176	3300053148	Ga0500590_001637	Ga0500590_001637_685_1332	195
1177	3300053153	Ga0500616_0001190	Ga0500616_0001190_9501_10088	195
1178	3300053153	Ga0500616_0012101	Ga0500616_0012101_490_1080	195
1179	3300053153	Ga0500616_0014746	Ga0500616_0014746_853_1443	195
1180	3300053156	Ga0500622_0000757	Ga0500622_0000757_1452_2042	195
1181	3300053158	Ga0500627_0041956	Ga0500627_0041956_228_818	195
1182	3300053158	Ga0500627_0202896	Ga0500627_0202896_100_687	195
1183	3300053161	Ga0500634_0002302	Ga0500634_0002302_4705_5292	195
1184	3300053161	Ga0500634_0046216	Ga0500634_0046216_855_1442	195
1185	3300053177	Ga0500636_0000070	Ga0500636_0000070_36612_37199	195
1186	3300059643	Ga0587072_009121	Ga0587072_009121_140_727	195
1187	iso_pu_bacteria	2818991439	2819555971	195
1188	iso_pu_bacteria	2984509177	2984512417	195
1189	iso_pu_bacteria	2984518228	2984521221	195
1190	iso_pu_bacteria	2984537506	2984540515	195
1191	iso_pu_bacteria	2984601300	2984602712	195
1192	iso_pu_bacteria	8024486573	8024489724	195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

44

216

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7drk-assembly1.cif.gz_B	crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol	0.8151	7	185
7drk-assembly1.cif.gz_B	crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol	0.7873	7	185
6h5a-assembly1.cif.gz_B	crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate	0.7243	4	186
6h53-assembly1.cif.gz_A	crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form	0.7121	4	186
5d92-assembly2.cif.gz_C	structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum	0.7031	7	195

ID	Description	Score	Start	End	Superfamily
af_P0ABF8_3_179_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.9375	6	190	1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.9273	6	190	1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8782	2	191	1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8599	4	191	1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain	0.8555	2	191	1.20.120.1760

ID	Description	Score	Start	End	GO Terms
AF-A0A0F9XYF6-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	0.9913	2	191	GO:0005886 GO:0008444 GO:0046474
AF-A0A2A6LYD8-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)	0.9901	4	193	GO:0005886 GO:0008444 GO:0046474
AF-A0A7Z1UR43-F1-model_v4	deleted	0.9898	5	193
AF-A0A2E2M4P7-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	0.9898	80	193	GO:0008654 GO:0016020 GO:0016780
AF-A0A0Q6T356-F1-model_v4	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)	0.9892	4	193	GO:0005886 GO:0008444 GO:0046474

Feature Viewer

pLDDT	pTM	Quality
84.63	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F491477

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

44

216

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map