F491346

General Info

Members Datasets Scaffolds Average Seq Length
1184 341 2368 86

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10617919|Ga0070676_106179192
Length 99
Sequence MKRVRLKPDATHMKTSIFDKHRDTLEHHETMMGTARGRLAVALDLLTDSLALVGQHGVYCRSERFPGQPRMDIALVLEQLDDAKQLVQSAMEELRSPRS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
209 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
210 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
215 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
253 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
323 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 4.05
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 19.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10617919 3300005328 Unclassified 783
2 JGI24751J29686_10076665 3300002459 Unclassified 691
3 JGI25406J46586_10001443 3300003203 Bacteria 11210
4 JGI25406J46586_10046294 3300003203 Bacteria 1491
5 Ga0065714_10505957 3300005288 Unclassified 521
6 Ga0065704_10517662 3300005289 Bacteria 656
7 Ga0065712_10179239 3300005290 Bacteria 1201
8 Ga0065712_10319700 3300005290 Bacteria 830
9 Ga0065715_10030943 3300005293 Bacteria 1066
10 Ga0065715_10355510 3300005293 Bacteria 943
11 Ga0065715_10887407 3300005293 Bacteria 579
12 Ga0065715_11095894 3300005293 Unclassified 521
13 Ga0065707_10192094 3300005295 Bacteria 1355
14 Ga0065707_10211977 3300005295 Bacteria 1261
15 Ga0065707_10459115 3300005295 Bacteria 793
16 Ga0065707_10459560 3300005295 Unclassified 779
17 Ga0065707_10713965 3300005295 Unclassified 633
18 Ga0065707_10781274 3300005295 Unclassified 604
19 Ga0065707_10939846 3300005295 Bacteria 555
20 Ga0070658_10088267 3300005327 Bacteria 2553
21 Ga0070676_10002829 3300005328 Bacteria 8970
22 Ga0070676_10308474 3300005328 Unclassified 1075
23 Ga0070683_100010952 3300005329 Bacteria 7812
24 Ga0070683_100120425 3300005329 Bacteria 2479
25 Ga0070683_100191500 3300005329 Bacteria 1942
26 Ga0070683_101531751 3300005329 Bacteria 641
27 Ga0070683_102212497 3300005329 Unclassified 528
28 Ga0070690_100002909 3300005330 Bacteria 9237
29 Ga0070690_100065413 3300005330 Bacteria 2351
30 Ga0070690_100139636 3300005330 Bacteria 1644
31 Ga0070690_100202466 3300005330 Bacteria 1382
32 Ga0070690_100761986 3300005330 Unclassified 748
33 Ga0070670_100068994 3300005331 Unclassified 3035
34 Ga0070670_100107967 3300005331 Bacteria 2398
35 Ga0070670_100140923 3300005331 Bacteria 2085
36 Ga0070670_100153584 3300005331 Bacteria 1993
37 Ga0070670_100401143 3300005331 Bacteria 1211
38 Ga0070670_100975301 3300005331 Bacteria 770
39 Ga0070670_101628146 3300005331 Bacteria 594
40 Ga0070677_10017845 3300005333 Bacteria 2547
41 Ga0070677_10234972 3300005333 Bacteria 902
42 Ga0070677_10433019 3300005333 Unclassified 700
43 Ga0068869_100331359 3300005334 Bacteria 1237
44 Ga0068869_100422664 3300005334 Bacteria 1100
45 Ga0068869_100896731 3300005334 Bacteria 767
46 Ga0070666_10056183 3300005335 Bacteria 2658
47 Ga0070666_10181937 3300005335 Bacteria 1475
48 Ga0070666_10249629 3300005335 Bacteria 1256
49 Ga0070666_10275088 3300005335 Unclassified 1196
50 Ga0070680_100510916 3300005336 Bacteria 1028
51 Ga0070682_100390026 3300005337 Bacteria 1050
52 Ga0070682_100821847 3300005337 Bacteria 757
53 Ga0070682_100903563 3300005337 Bacteria 726
54 Ga0068868_100017279 3300005338 Bacteria 5371
55 Ga0068868_100071960 3300005338 Bacteria 2758
56 Ga0068868_100422125 3300005338 Bacteria 1155
57 Ga0068868_100521727 3300005338 Bacteria 1043
58 Ga0068868_101853441 3300005338 Unclassified 570
59 Ga0068868_102256449 3300005338 Unclassified 519
60 Ga0070660_100012100 3300005339 Bacteria 6159
61 Ga0070660_100816055 3300005339 Bacteria 785
62 Ga0070691_10004528 3300005341 Bacteria 6311
63 Ga0070687_100010488 3300005343 Bacteria 4010
64 Ga0070687_100483534 3300005343 Bacteria 830
65 Ga0070661_100525998 3300005344 Unclassified 949
66 Ga0070661_100775527 3300005344 Archaea 785
67 Ga0070661_101246025 3300005344 Unclassified 623
68 Ga0070692_10096882 3300005345 Unclassified 1612
69 Ga0070692_10493896 3300005345 Unclassified 792
70 Ga0070692_10868785 3300005345 Bacteria 621
71 Ga0070692_11358450 3300005345 Unclassified 512
72 Ga0070668_100255898 3300005347 Bacteria 1455
73 Ga0070668_100994456 3300005347 Bacteria 754
74 Ga0070668_101840138 3300005347 Bacteria 557
75 Ga0070669_100005781 3300005353 Bacteria 8917
76 Ga0070669_100055082 3300005353 Bacteria 2914
77 Ga0070669_100296301 3300005353 Bacteria 1300
78 Ga0070669_100312106 3300005353 Bacteria 1268
79 Ga0070669_100480947 3300005353 Unclassified 1028
80 Ga0070669_101630096 3300005353 Unclassified 562
81 Ga0070669_101707510 3300005353 Bacteria 549
82 Ga0070675_100000497 3300005354 Bacteria 26931
83 Ga0070675_100064291 3300005354 Bacteria 3033
84 Ga0070675_100183963 3300005354 Bacteria 1808
85 Ga0070675_101316718 3300005354 Bacteria 666
86 Ga0070671_100224706 3300005355 Bacteria 1593
87 Ga0070671_100488290 3300005355 Bacteria 1059
88 Ga0070671_101113363 3300005355 Bacteria 694
89 Ga0070674_100138576 3300005356 Bacteria 1823
90 Ga0070674_100200591 3300005356 Bacteria 1540
91 Ga0070674_101454394 3300005356 Unclassified 615
92 Ga0070674_102007238 3300005356 Bacteria 527
93 Ga0070673_100047628 3300005364 Unclassified 3336
94 Ga0070673_100049204 3300005364 Bacteria 3291
95 Ga0070673_100071506 3300005364 Bacteria 2788
96 Ga0070673_100143852 3300005364 Bacteria 2014
97 Ga0070673_100166625 3300005364 Bacteria 1878
98 Ga0070673_100215487 3300005364 Bacteria 1660
99 Ga0070673_100649964 3300005364 Bacteria 965
100 Ga0070673_100804073 3300005364 Bacteria 868
101 Ga0070673_101031492 3300005364 Bacteria 767
102 Ga0070673_101119809 3300005364 Bacteria 736
103 Ga0070673_101235672 3300005364 Unclassified 700
104 Ga0070688_101389290 3300005365 Unclassified 569
105 Ga0070659_100176700 3300005366 Bacteria 1751
106 Ga0070659_100825285 3300005366 Archaea 807
107 Ga0070659_101196720 3300005366 Bacteria 672
108 Ga0070659_101993370 3300005366 Unclassified 521
109 Ga0070667_100002707 3300005367 Bacteria 15346
110 Ga0070667_100197505 3300005367 Bacteria 1784
111 Ga0070667_100200237 3300005367 Bacteria 1772
112 Ga0070667_100974166 3300005367 Unclassified 791
113 Ga0070667_101240529 3300005367 Unclassified 698
114 Ga0070703_10269321 3300005406 Bacteria 698
115 Ga0070703_10406614 3300005406 Bacteria 594
116 Ga0070714_100012845 3300005435 Bacteria 6693
117 Ga0070713_100099749 3300005436 Bacteria 2513
118 Ga0070710_11314241 3300005437 Bacteria 538
119 Ga0070701_10006149 3300005438 Bacteria 5032
120 Ga0070701_11029938 3300005438 Archaea 576
121 Ga0070705_100007684 3300005440 Bacteria 5319
122 Ga0070705_100857279 3300005440 Unclassified 727
123 Ga0070705_101281706 3300005440 Bacteria 607
124 Ga0070700_100006138 3300005441 Bacteria 6402
125 Ga0070700_100036897 3300005441 Bacteria 2968
126 Ga0070700_100275881 3300005441 Unclassified 1217
127 Ga0070700_100662454 3300005441 Unclassified 825
128 Ga0070700_101251455 3300005441 Archaea 622
129 Ga0070694_100032864 3300005444 Bacteria 3409
130 Ga0070694_100348859 3300005444 Bacteria 1146
131 Ga0070694_100372681 3300005444 Bacteria 1111
132 Ga0070694_100475271 3300005444 Bacteria 991
133 Ga0070694_100756720 3300005444 Bacteria 794
134 Ga0070694_100833257 3300005444 Bacteria 758
135 Ga0070694_100948748 3300005444 Unclassified 712
136 Ga0070708_100016776 3300005445 Bacteria 6087
137 Ga0070708_100526572 3300005445 Bacteria 1115
138 Ga0070708_100938202 3300005445 Bacteria 812
139 Ga0070663_100470351 3300005455 Bacteria 1039
140 Ga0070678_100195473 3300005456 Unclassified 1666
141 Ga0070678_100291948 3300005456 Bacteria 1383
142 Ga0070678_100437436 3300005456 Bacteria 1143
143 Ga0070678_100446598 3300005456 Bacteria 1132
144 Ga0070678_101987231 3300005456 Unclassified 550
145 Ga0070662_100102139 3300005457 Bacteria 2172
146 Ga0070662_100600023 3300005457 Bacteria 926
147 Ga0070662_101448937 3300005457 Bacteria 592
148 Ga0070681_10281149 3300005458 Bacteria 1575
149 Ga0070681_11137261 3300005458 Bacteria 702
150 Ga0070681_11594793 3300005458 Bacteria 578
151 Ga0070681_11930900 3300005458 Bacteria 518
152 Ga0068867_100005238 3300005459 Bacteria 9152
153 Ga0068867_100015049 3300005459 Bacteria 5485
154 Ga0068867_100064649 3300005459 Bacteria 2721
155 Ga0068867_100853810 3300005459 Bacteria 816
156 Ga0068867_100855608 3300005459 Bacteria 815
157 Ga0068867_101420690 3300005459 Bacteria 644
158 Ga0068867_101668908 3300005459 Bacteria 597
159 Ga0070685_10308889 3300005466 Bacteria 1068
160 Ga0070685_10415482 3300005466 Bacteria 935
161 Ga0070706_100302272 3300005467 Unclassified 1493
162 Ga0070706_100780501 3300005467 Bacteria 885
163 Ga0070706_101040237 3300005467 Unclassified 755
164 Ga0070706_101248397 3300005467 Bacteria 682
165 Ga0070706_101671695 3300005467 Bacteria 580
166 Ga0070707_100015695 3300005468 Bacteria 7113
167 Ga0070707_100037924 3300005468 Bacteria 4601
168 Ga0070707_100120381 3300005468 Bacteria 2548
169 Ga0070707_100192773 3300005468 Unclassified 1987
170 Ga0070707_100350824 3300005468 Unclassified 1433
171 Ga0070707_101727928 3300005468 Unclassified 593
172 Ga0070698_100154703 3300005471 Bacteria 2239
173 Ga0070698_100959533 3300005471 Unclassified 801
174 Ga0070698_101019419 3300005471 Unclassified 775
175 Ga0070698_101222430 3300005471 Bacteria 701
176 Ga0070698_101439943 3300005471 Unclassified 640
177 Ga0070699_100018361 3300005518 Bacteria 6009
178 Ga0070699_100108289 3300005518 Bacteria 2439
179 Ga0070699_100239449 3300005518 Unclassified 1619
180 Ga0070699_100670147 3300005518 Bacteria 947
181 Ga0070699_101112164 3300005518 Unclassified 725
182 Ga0070679_100129098 3300005530 Bacteria 2509
183 Ga0070679_100220081 3300005530 Bacteria 1860
184 Ga0070679_100692641 3300005530 Bacteria 962
185 Ga0070679_101606833 3300005530 Unclassified 598
186 Ga0070679_101904645 3300005530 Unclassified 543
187 Ga0070684_100094588 3300005535 Bacteria 2662
188 Ga0070684_100184919 3300005535 Bacteria 1895
189 Ga0070684_100430054 3300005535 Bacteria 1219
190 Ga0070684_100862729 3300005535 Bacteria 847
191 Ga0070684_101325382 3300005535 Bacteria 678
192 Ga0070684_101456124 3300005535 Bacteria 645
193 Ga0070684_102093463 3300005535 Bacteria 534
194 Ga0070684_102211059 3300005535 Bacteria 519
195 Ga0070697_100032589 3300005536 Bacteria 4194
196 Ga0070697_100106205 3300005536 Bacteria 2336
197 Ga0070697_100215901 3300005536 Bacteria 1634
198 Ga0070697_100422629 3300005536 Unclassified 1158
199 Ga0070697_100994061 3300005536 Bacteria 746
200 Ga0068853_100337748 3300005539 Bacteria 1399
201 Ga0068853_100931165 3300005539 Bacteria 835
202 Ga0068853_100970069 3300005539 Bacteria 818
203 Ga0068853_101534798 3300005539 Bacteria 645
204 Ga0070672_100023372 3300005543 Bacteria 4555
205 Ga0070672_100118427 3300005543 Bacteria 2166
206 Ga0070672_100168419 3300005543 Bacteria 1821
207 Ga0070672_100596611 3300005543 Bacteria 962
208 Ga0070672_100789938 3300005543 Unclassified 835
209 Ga0070686_100002672 3300005544 Bacteria 9819
210 Ga0070686_100042563 3300005544 Bacteria 2846
211 Ga0070686_100072638 3300005544 Bacteria 2257
212 Ga0070686_100173255 3300005544 Bacteria 1528
213 Ga0070686_100225499 3300005544 Unclassified 1356
214 Ga0070686_100323942 3300005544 Bacteria 1150
215 Ga0070686_100676961 3300005544 Bacteria 820
216 Ga0070695_100000438 3300005545 Bacteria 21655
217 Ga0070695_100012060 3300005545 Bacteria 5181
218 Ga0070695_100172756 3300005545 Bacteria 1525
219 Ga0070695_100342562 3300005545 Bacteria 1117
220 Ga0070695_101246016 3300005545 Bacteria 613
221 Ga0070696_100041212 3300005546 Bacteria 3190
222 Ga0070696_100175759 3300005546 Bacteria 1586
223 Ga0070696_100192695 3300005546 Bacteria 1518
224 Ga0070696_100414876 3300005546 Bacteria 1056
225 Ga0070696_100546289 3300005546 Bacteria 928
226 Ga0070693_100025651 3300005547 Bacteria 3174
227 Ga0070693_100072572 3300005547 Bacteria 2031
228 Ga0070693_101492961 3300005547 Bacteria 528
229 Ga0070665_100004450 3300005548 Bacteria 14719
230 Ga0070665_100005752 3300005548 Bacteria 12729
231 Ga0070665_100033141 3300005548 Bacteria 5197
232 Ga0070665_100219869 3300005548 Bacteria 1900
233 Ga0070665_100279523 3300005548 Bacteria 1671
234 Ga0070665_100374864 3300005548 Bacteria 1430
235 Ga0070665_100449464 3300005548 Bacteria 1298
236 Ga0070665_101628732 3300005548 Bacteria 653
237 Ga0070704_100004322 3300005549 Bacteria 8213
238 Ga0070704_100070647 3300005549 Bacteria 2534
239 Ga0070704_100325064 3300005549 Bacteria 1290
240 Ga0070704_100605893 3300005549 Bacteria 963
241 Ga0070704_100719370 3300005549 Bacteria 887
242 Ga0070704_101689670 3300005549 Unclassified 585
243 Ga0068855_100059811 3300005563 Bacteria 4457
244 Ga0068855_100265906 3300005563 Bacteria 1909
245 Ga0068855_100507643 3300005563 Bacteria 1309
246 Ga0068855_100623698 3300005563 Bacteria 1161
247 Ga0070664_100266114 3300005564 Bacteria 1543
248 Ga0070664_100515456 3300005564 Unclassified 1103
249 Ga0070664_101136629 3300005564 Bacteria 736
250 Ga0068857_100734215 3300005577 Bacteria 940
251 Ga0068854_100009213 3300005578 Bacteria 6370
252 Ga0068854_100036996 3300005578 Bacteria 3423
253 Ga0068854_100111166 3300005578 Unclassified 2067
254 Ga0068854_100431513 3300005578 Bacteria 1096
255 Ga0068854_101000450 3300005578 Unclassified 740
256 Ga0068854_101872934 3300005578 Bacteria 551
257 Ga0068856_100429855 3300005614 Bacteria 1341
258 Ga0068856_100539593 3300005614 Bacteria 1187
259 Ga0068856_100701419 3300005614 Bacteria 1032
260 Ga0068856_100816647 3300005614 Bacteria 952
261 Ga0070702_100028191 3300005615 Bacteria 3041
262 Ga0070702_100419030 3300005615 Unclassified 963
263 Ga0070702_100612274 3300005615 Unclassified 818
264 Ga0070702_100770343 3300005615 Bacteria 741
265 Ga0070702_100833453 3300005615 Unclassified 716
266 Ga0068852_102566218 3300005616 Unclassified 529
267 Ga0068859_100405334 3300005617 Bacteria 1459
268 Ga0068859_100569062 3300005617 Unclassified 1227
269 Ga0068859_101183514 3300005617 Bacteria 842
270 Ga0068859_101266106 3300005617 Bacteria 813
271 Ga0068859_101292232 3300005617 Bacteria 804
272 Ga0068859_101744159 3300005617 Bacteria 688
273 Ga0068859_102932890 3300005617 Bacteria 522
274 Ga0068864_100025813 3300005618 Bacteria 4951
275 Ga0068864_101438717 3300005618 Bacteria 692
276 Ga0068864_101559636 3300005618 Unclassified 664
277 Ga0068864_102233479 3300005618 Unclassified 554
278 Ga0068866_10116745 3300005718 Bacteria 1497
279 Ga0068866_10181307 3300005718 Unclassified 1244
280 Ga0068866_10320109 3300005718 Unclassified 975
281 Ga0068866_10474100 3300005718 Bacteria 823
282 Ga0068866_10542761 3300005718 Bacteria 776
283 Ga0068866_10547979 3300005718 Unclassified 773
284 Ga0068866_10708882 3300005718 Bacteria 691
285 Ga0068866_10871405 3300005718 Bacteria 631
286 Ga0068866_11256242 3300005718 Bacteria 536
287 Ga0068861_100023988 3300005719 Bacteria 4406
288 Ga0068861_100071293 3300005719 Bacteria 2693
289 Ga0068861_100360857 3300005719 Bacteria 1278
290 Ga0068861_100384670 3300005719 Unclassified 1241
291 Ga0068861_100598411 3300005719 Unclassified 1012
292 Ga0068861_100855059 3300005719 Bacteria 858
293 Ga0068851_10320831 3300005834 Unclassified 895
294 Ga0068870_10789161 3300005840 Unclassified 663
295 Ga0068870_10923687 3300005840 Unclassified 618
296 Ga0068870_11146231 3300005840 Bacteria 561
297 Ga0068863_100020067 3300005841 Bacteria 6393
298 Ga0068863_100136935 3300005841 Bacteria 2339
299 Ga0068863_100439648 3300005841 Bacteria 1279
300 Ga0068863_100567917 3300005841 Bacteria 1121
301 Ga0068863_100748542 3300005841 Bacteria 973
302 Ga0068863_100874131 3300005841 Unclassified 898
303 Ga0068858_100012439 3300005842 Bacteria 8024
304 Ga0068858_100031470 3300005842 Bacteria 4928
305 Ga0068858_100111323 3300005842 Bacteria 2557
306 Ga0068858_100193100 3300005842 Bacteria 1924
307 Ga0068858_100269556 3300005842 Bacteria 1620
308 Ga0068858_100308421 3300005842 Bacteria 1511
309 Ga0068858_100316235 3300005842 Bacteria 1491
310 Ga0068858_100351790 3300005842 Bacteria 1411
311 Ga0068858_100550558 3300005842 Bacteria 1117
312 Ga0068858_100783245 3300005842 Unclassified 930
313 Ga0068858_100828456 3300005842 Unclassified 903
314 Ga0068858_100942534 3300005842 Bacteria 845
315 Ga0068858_100995916 3300005842 Bacteria 821
316 Ga0068858_101035937 3300005842 Unclassified 805
317 Ga0068858_101055384 3300005842 Unclassified 797
318 Ga0068858_101069378 3300005842 Bacteria 792
319 Ga0068858_101439104 3300005842 Bacteria 679
320 Ga0068858_101697464 3300005842 Bacteria 624
321 Ga0068860_100046097 3300005843 Bacteria 4157
322 Ga0068860_100066552 3300005843 Bacteria 3423
323 Ga0068860_100920506 3300005843 Bacteria 891
324 Ga0068860_101028693 3300005843 Bacteria 842
325 Ga0068860_101277257 3300005843 Bacteria 755
326 Ga0068860_101602405 3300005843 Bacteria 673
327 Ga0068860_101752315 3300005843 Unclassified 643
328 Ga0068862_100003835 3300005844 Bacteria 12806
329 Ga0068862_100069595 3300005844 Bacteria 3038
330 Ga0068862_100157026 3300005844 Bacteria 2028
331 Ga0068862_100242564 3300005844 Unclassified 1639
332 Ga0068862_100274549 3300005844 Bacteria 1543
333 Ga0068862_100447793 3300005844 Unclassified 1217
334 Ga0068862_100860431 3300005844 Unclassified 889
335 Ga0068862_101929067 3300005844 Unclassified 601
336 Ga0081455_10052514 3300005937 Bacteria 3488
337 Ga0081455_10102908 3300005937 Bacteria 2288
338 Ga0081539_10000093 3300005985 Bacteria 207314
339 Ga0081539_10015507 3300005985 Bacteria 5531
340 Ga0081539_10256234 3300005985 Bacteria 774
341 Ga0081539_10299172 3300005985 Bacteria 692
342 Ga0070717_10553161 3300006028 Bacteria 1042
343 Ga0075363_100485822 3300006048 Bacteria 732
344 Ga0075432_10015554 3300006058 Bacteria 2595
345 Ga0075432_10326609 3300006058 Bacteria 644
346 Ga0070715_10021000 3300006163 Unclassified 2526
347 Ga0070715_10240045 3300006163 Bacteria 942
348 Ga0097621_100002574 3300006237 Bacteria 12427
349 Ga0097621_100004951 3300006237 Bacteria 9338
350 Ga0097621_100034981 3300006237 Bacteria 4011
351 Ga0097621_100167258 3300006237 Bacteria 1893
352 Ga0097621_100253700 3300006237 Bacteria 1541
353 Ga0097621_100896349 3300006237 Bacteria 826
354 Ga0097621_101019092 3300006237 Bacteria 775
355 Ga0068871_100005083 3300006358 Bacteria 9187
356 Ga0068871_100047990 3300006358 Bacteria 3445
357 Ga0068871_100053257 3300006358 Bacteria 3279
358 Ga0068871_100069455 3300006358 Bacteria 2893
359 Ga0068871_100149079 3300006358 Bacteria 1994
360 Ga0068871_100153015 3300006358 Bacteria 1968
361 Ga0068871_100201302 3300006358 Bacteria 1719
362 Ga0068871_100285322 3300006358 Bacteria 1445
363 Ga0068871_100326579 3300006358 Bacteria 1352
364 Ga0068871_100944624 3300006358 Bacteria 801
365 Ga0068871_101351708 3300006358 Bacteria 671
366 Ga0075428_100200148 3300006844 Bacteria 2159
367 Ga0075428_100487097 3300006844 Bacteria 1320
368 Ga0075428_100798735 3300006844 Unclassified 1003
369 Ga0075428_100883205 3300006844 Bacteria 949
370 Ga0075428_101417339 3300006844 Bacteria 729
371 Ga0075430_101055076 3300006846 Bacteria 669
372 Ga0075431_100061494 3300006847 Bacteria 3875
373 Ga0075431_100188285 3300006847 Bacteria 2115
374 Ga0075431_100905956 3300006847 Bacteria 851
375 Ga0075433_10004006 3300006852 Bacteria 11400
376 Ga0075433_10008066 3300006852 Bacteria 8384
377 Ga0075433_10078306 3300006852 Bacteria 2913
378 Ga0075433_10081534 3300006852 Bacteria 2853
379 Ga0075433_10136204 3300006852 Bacteria 2183
380 Ga0075433_10145548 3300006852 Bacteria 2106
381 Ga0075433_10241369 3300006852 Bacteria 1604
382 Ga0075433_10286334 3300006852 Bacteria 1459
383 Ga0075433_10423353 3300006852 Bacteria 1174
384 Ga0075433_10638355 3300006852 Bacteria 934
385 Ga0075433_10743464 3300006852 Bacteria 858
386 Ga0075433_11108651 3300006852 Unclassified 688
387 Ga0075433_11336466 3300006852 Bacteria 621
388 Ga0075434_100001869 3300006871 Bacteria 18216
389 Ga0075434_100002721 3300006871 Bacteria 15619
390 Ga0075434_100008420 3300006871 Bacteria 9592
391 Ga0075434_100017907 3300006871 Bacteria 6834
392 Ga0075434_100144858 3300006871 Bacteria 2396
393 Ga0075434_100257108 3300006871 Bacteria 1765
394 Ga0075434_100360804 3300006871 Bacteria 1474
395 Ga0075434_100452508 3300006871 Bacteria 1305
396 Ga0075434_100675281 3300006871 Bacteria 1051
397 Ga0075434_100698530 3300006871 Bacteria 1032
398 Ga0075434_101095967 3300006871 Bacteria 810
399 Ga0075434_101382597 3300006871 Bacteria 714
400 Ga0075434_102180223 3300006871 Unclassified 558
401 Ga0075434_102666690 3300006871 Bacteria 500
402 Ga0075429_100401658 3300006880 Bacteria 1200
403 Ga0068865_100035521 3300006881 Bacteria 3353
404 Ga0068865_100222893 3300006881 Bacteria 1475
405 Ga0068865_100994483 3300006881 Bacteria 734
406 Ga0068865_101117395 3300006881 Bacteria 695
407 Ga0068865_102167036 3300006881 Unclassified 506
408 Ga0075436_100011598 3300006914 Bacteria 6046
409 Ga0075436_100012944 3300006914 Bacteria 5719
410 Ga0075436_100412746 3300006914 Bacteria 979
411 Ga0075436_100445469 3300006914 Bacteria 942
412 Ga0075436_101411092 3300006914 Bacteria 528
413 Ga0097620_100405336 3300006931 Bacteria 1459
414 Ga0097620_100569101 3300006931 Unclassified 1227
415 Ga0097620_101183432 3300006931 Bacteria 842
416 Ga0097620_101266067 3300006931 Bacteria 813
417 Ga0097620_101292370 3300006931 Bacteria 804
418 Ga0097620_101744456 3300006931 Bacteria 688
419 Ga0097620_102931819 3300006931 Bacteria 522
420 Ga0075435_100000147 3300007076 Bacteria 39845
421 Ga0075435_100011353 3300007076 Bacteria 6548
422 Ga0075435_100067200 3300007076 Bacteria 2918
423 Ga0075435_100586894 3300007076 Bacteria 966
424 Ga0075435_100828142 3300007076 Bacteria 806
425 Ga0099794_10592275 3300007265 Unclassified 587
426 Ga0099795_10084929 3300007788 Bacteria 1217
427 Ga0105251_10181236 3300009011 Bacteria 949
428 Ga0105251_10270599 3300009011 Bacteria 767
429 Ga0105250_10460149 3300009092 Unclassified 572
430 Ga0105240_10086821 3300009093 Bacteria 3832
431 Ga0105240_10101178 3300009093 Bacteria 3506
432 Ga0105240_10108880 3300009093 Bacteria 3356
433 Ga0105240_10335776 3300009093 Bacteria 1718
434 Ga0105240_11212062 3300009093 Unclassified 799
435 Ga0105240_12191873 3300009093 Bacteria 573
436 Ga0105240_12254747 3300009093 Unclassified 564
437 Ga0105240_12458519 3300009093 Bacteria 539
438 Ga0111539_10002429 3300009094 Bacteria 24773
439 Ga0111539_10009286 3300009094 Bacteria 12419
440 Ga0111539_10029720 3300009094 Bacteria 6652
441 Ga0111539_10234475 3300009094 Bacteria 2136
442 Ga0111539_10415081 3300009094 Bacteria 1568
443 Ga0111539_10575139 3300009094 Unclassified 1312
444 Ga0111539_10681255 3300009094 Unclassified 1197
445 Ga0111539_11951937 3300009094 Bacteria 681
446 Ga0105245_10006678 3300009098 Bacteria 10125
447 Ga0105245_10007298 3300009098 Bacteria 9679
448 Ga0105245_10192583 3300009098 Bacteria 1954
449 Ga0105245_10415585 3300009098 Bacteria 1347
450 Ga0105245_10972069 3300009098 Bacteria 893
451 Ga0105245_11377599 3300009098 Bacteria 755
452 Ga0105245_11744339 3300009098 Unclassified 675
453 Ga0105245_13032543 3300009098 Unclassified 520
454 Ga0105247_10008855 3300009101 Bacteria 6136
455 Ga0105247_10101722 3300009101 Bacteria 1838
456 Ga0105247_10252248 3300009101 Bacteria 1206
457 Ga0114129_10001820 3300009147 Bacteria 29050
458 Ga0114129_10015831 3300009147 Bacteria 10723
459 Ga0114129_10019712 3300009147 Bacteria 9601
460 Ga0114129_10025101 3300009147 Bacteria 8447
461 Ga0114129_10025144 3300009147 Bacteria 8440
462 Ga0114129_10032186 3300009147 Bacteria 7413
463 Ga0114129_10076474 3300009147 Bacteria 4660
464 Ga0114129_10253574 3300009147 Bacteria 2361
465 Ga0114129_10803474 3300009147 Unclassified 1200
466 Ga0114129_10970667 3300009147 Bacteria 1072
467 Ga0114129_11073871 3300009147 Bacteria 1009
468 Ga0114129_11084795 3300009147 Bacteria 1003
469 Ga0114129_11452249 3300009147 Unclassified 844
470 Ga0114129_13492770 3300009147 Bacteria 503
471 Ga0105243_10069901 3300009148 Bacteria 2833
472 Ga0105243_10138860 3300009148 Bacteria 2071
473 Ga0105243_10897448 3300009148 Bacteria 881
474 Ga0105243_11415040 3300009148 Bacteria 716
475 Ga0105243_11877748 3300009148 Bacteria 631
476 Ga0105241_10044228 3300009174 Bacteria 3374
477 Ga0105241_10064908 3300009174 Unclassified 2820
478 Ga0105241_11030093 3300009174 Bacteria 772
479 Ga0105241_11270258 3300009174 Bacteria 700
480 Ga0105242_10000877 3300009176 Bacteria 23362
481 Ga0105242_10001630 3300009176 Bacteria 17704
482 Ga0105242_10014880 3300009176 Bacteria 6028
483 Ga0105242_10088227 3300009176 Unclassified 2605
484 Ga0105242_10516561 3300009176 Unclassified 1139
485 Ga0105242_10798473 3300009176 Bacteria 934
486 Ga0105242_10832954 3300009176 Bacteria 916
487 Ga0105242_10916429 3300009176 Bacteria 878
488 Ga0105242_11021994 3300009176 Bacteria 836
489 Ga0105242_11037657 3300009176 Unclassified 830
490 Ga0105242_11397150 3300009176 Bacteria 727
491 Ga0105242_11492648 3300009176 Bacteria 706
492 Ga0105242_12099727 3300009176 Bacteria 609
493 Ga0105242_12292304 3300009176 Bacteria 586
494 Ga0105248_10008069 3300009177 Bacteria 11556
495 Ga0105248_10009184 3300009177 Bacteria 10875
496 Ga0105248_10009873 3300009177 Bacteria 10511
497 Ga0105248_10071127 3300009177 Bacteria 3907
498 Ga0105248_10090434 3300009177 Bacteria 3447
499 Ga0105248_10131072 3300009177 Bacteria 2829
500 Ga0105248_10143416 3300009177 Unclassified 2695
501 Ga0105248_10162179 3300009177 Bacteria 2521
502 Ga0105248_10409294 3300009177 Bacteria 1527
503 Ga0105248_10936244 3300009177 Unclassified 978
504 Ga0105248_10943290 3300009177 Bacteria 975
505 Ga0105248_10947433 3300009177 Bacteria 972
506 Ga0105248_10978029 3300009177 Unclassified 956
507 Ga0105248_11197113 3300009177 Bacteria 859
508 Ga0105248_11238238 3300009177 Bacteria 844
509 Ga0105248_11441244 3300009177 Bacteria 779
510 Ga0105248_11652182 3300009177 Bacteria 726
511 Ga0105237_11024002 3300009545 Bacteria 832
512 Ga0105237_11048847 3300009545 Bacteria 822
513 Ga0105237_11228199 3300009545 Unclassified 756
514 Ga0105238_10059793 3300009551 Bacteria 3817
515 Ga0105238_10996215 3300009551 Bacteria 859
516 Ga0105238_11123611 3300009551 Bacteria 809
517 Ga0105238_11458848 3300009551 Bacteria 712
518 Ga0105249_10141194 3300009553 Bacteria 2310
519 Ga0105249_10305988 3300009553 Bacteria 1596
520 Ga0105249_10406986 3300009553 Unclassified 1392
521 Ga0105249_10777548 3300009553 Bacteria 1021
522 Ga0105249_10949482 3300009553 Bacteria 928
523 Ga0105249_11835049 3300009553 Unclassified 679
524 Ga0105249_12955176 3300009553 Bacteria 546
525 Ga0105239_11037762 3300010375 Bacteria 943
526 Ga0105239_11887619 3300010375 Bacteria 693
527 Ga0105239_12647791 3300010375 Bacteria 585
528 Ga0105246_10174622 3300011119 Bacteria 1649
529 Ga0105246_11098452 3300011119 Bacteria 726
530 Ga0105246_11804457 3300011119 Unclassified 584
531 Ga0157374_10150465 3300013296 Bacteria 2263
532 Ga0157374_11827610 3300013296 Bacteria 633
533 Ga0157374_12695745 3300013296 Unclassified 525
534 Ga0157378_10286942 3300013297 Bacteria 1588
535 Ga0157378_10531792 3300013297 Unclassified 1178
536 Ga0157378_10812892 3300013297 Unclassified 961
537 Ga0157378_11264968 3300013297 Unclassified 778
538 Ga0157378_11369428 3300013297 Bacteria 750
539 Ga0157378_11651356 3300013297 Bacteria 687
540 Ga0157378_11965293 3300013297 Unclassified 634
541 Ga0157378_12117925 3300013297 Bacteria 613
542 Ga0163162_10012729 3300013306 Bacteria 8216
543 Ga0163162_10075961 3300013306 Bacteria 3421
544 Ga0163162_10974527 3300013306 Bacteria 958
545 Ga0163162_12424611 3300013306 Unclassified 603
546 Ga0163162_13454081 3300013306 Bacteria 503
547 Ga0157372_11312963 3300013307 Bacteria 835
548 Ga0157375_10054526 3300013308 Bacteria 3937
549 Ga0157375_10178852 3300013308 Bacteria 2272
550 Ga0157375_10279863 3300013308 Bacteria 1831
551 Ga0157375_10324512 3300013308 Bacteria 1704
552 Ga0157375_11199460 3300013308 Bacteria 890
553 Ga0157375_11978195 3300013308 Bacteria 693
554 Ga0157375_12663426 3300013308 Unclassified 598
555 Ga0163163_10009838 3300014325 Bacteria 8568
556 Ga0163163_10013073 3300014325 Bacteria 7583
557 Ga0163163_10021725 3300014325 Bacteria 6061
558 Ga0163163_10035979 3300014325 Bacteria 4807
559 Ga0163163_10081813 3300014325 Bacteria 3232
560 Ga0163163_10343222 3300014325 Bacteria 1549
561 Ga0163163_10550154 3300014325 Bacteria 1217
562 Ga0163163_10989432 3300014325 Bacteria 904
563 Ga0163163_11270635 3300014325 Unclassified 798
564 Ga0163163_12197664 3300014325 Unclassified 611
565 Ga0157380_10036144 3300014326 Bacteria 3820
566 Ga0157380_10083787 3300014326 Bacteria 2613
567 Ga0157380_10352333 3300014326 Bacteria 1378
568 Ga0157380_10475718 3300014326 Bacteria 1207
569 Ga0157380_10602459 3300014326 Bacteria 1087
570 Ga0157380_10865483 3300014326 Unclassified 927
571 Ga0157380_11247121 3300014326 Bacteria 789
572 Ga0157380_11783790 3300014326 Bacteria 674
573 Ga0157377_11041413 3300014745 Unclassified 623
574 Ga0157377_11476697 3300014745 Bacteria 539
575 Ga0157379_10011668 3300014968 Bacteria 7671
576 Ga0157379_10030703 3300014968 Bacteria 4785
577 Ga0157379_10036677 3300014968 Bacteria 4371
578 Ga0157379_10038943 3300014968 Bacteria 4241
579 Ga0157379_10111018 3300014968 Bacteria 2462
580 Ga0157379_10934789 3300014968 Bacteria 824
581 Ga0157379_11879483 3300014968 Bacteria 590
582 Ga0157376_10002406 3300014969 Bacteria 12640
583 Ga0157376_10006560 3300014969 Bacteria 8235
584 Ga0157376_10055607 3300014969 Bacteria 3303
585 Ga0157376_10065847 3300014969 Bacteria 3062
586 Ga0157376_10084685 3300014969 Bacteria 2730
587 Ga0157376_10203000 3300014969 Bacteria 1825
588 Ga0157376_10288322 3300014969 Bacteria 1549
589 Ga0157376_10330227 3300014969 Bacteria 1453
590 Ga0157376_10467419 3300014969 Unclassified 1233
591 Ga0157376_10527513 3300014969 Bacteria 1165
592 Ga0157376_11007169 3300014969 Bacteria 856
593 Ga0157376_11585730 3300014969 Bacteria 689
594 Ga0182007_10100067 3300015262 Bacteria 959
595 Ga0182005_1118435 3300015265 Bacteria 752
596 Ga0163161_10107006 3300017792 Bacteria 2087
597 Ga0163161_10970160 3300017792 Unclassified 724
598 Ga0163161_11461233 3300017792 Unclassified 599
599 Ga0163161_11648231 3300017792 Unclassified 567
600 Ga0206356_10415914 3300020070 Bacteria 567
601 Ga0213876_10325332 3300021384 Unclassified 817
602 Ga0207697_10074372 3300025315 Bacteria 1427
603 Ga0207697_10175307 3300025315 Bacteria 938
604 Ga0207653_10241259 3300025885 Bacteria 690
605 Ga0207682_10014992 3300025893 Bacteria 3018
606 Ga0207692_10926331 3300025898 Bacteria 574
607 Ga0207642_10108633 3300025899 Bacteria 1408
608 Ga0207642_10286314 3300025899 Bacteria 950
609 Ga0207642_10379912 3300025899 Bacteria 840
610 Ga0207642_10429716 3300025899 Unclassified 796
611 Ga0207642_10450907 3300025899 Bacteria 779
612 Ga0207642_10882570 3300025899 Unclassified 572
613 Ga0207642_11082728 3300025899 Bacteria 518
614 Ga0207710_10010670 3300025900 Bacteria 3867
615 Ga0207710_10038913 3300025900 Bacteria 2104
616 Ga0207688_10609389 3300025901 Unclassified 688
617 Ga0207680_10066327 3300025903 Bacteria 2219
618 Ga0207680_10152686 3300025903 Bacteria 1541
619 Ga0207680_10231309 3300025903 Unclassified 1271
620 Ga0207680_10301403 3300025903 Bacteria 1117
621 Ga0207680_10345083 3300025903 Unclassified 1045
622 Ga0207680_10349554 3300025903 Unclassified 1038
623 Ga0207680_10685421 3300025903 Bacteria 734
624 Ga0207680_10910902 3300025903 Bacteria 630
625 Ga0207685_10867880 3300025905 Bacteria 500
626 Ga0207699_11123232 3300025906 Bacteria 582
627 Ga0207645_10004347 3300025907 Bacteria 10494
628 Ga0207645_10107947 3300025907 Bacteria 1801
629 Ga0207645_10318205 3300025907 Bacteria 1038
630 Ga0207645_10594717 3300025907 Bacteria 751
631 Ga0207645_11073605 3300025907 Bacteria 544
632 Ga0207645_11122953 3300025907 Unclassified 529
633 Ga0207643_11058554 3300025908 Bacteria 524
634 Ga0207705_10075672 3300025909 Bacteria 2446
635 Ga0207684_11272169 3300025910 Bacteria 607
636 Ga0207684_11353778 3300025910 Bacteria 584
637 Ga0207684_11641771 3300025910 Bacteria 519
638 Ga0207654_10072697 3300025911 Bacteria 2048
639 Ga0207654_10084416 3300025911 Bacteria 1920
640 Ga0207654_10649650 3300025911 Bacteria 755
641 Ga0207707_10012114 3300025912 Bacteria 7495
642 Ga0207707_10413653 3300025912 Bacteria 1157
643 Ga0207707_10535823 3300025912 Bacteria 996
644 Ga0207695_10123308 3300025913 Bacteria 2557
645 Ga0207695_10240339 3300025913 Bacteria 1712
646 Ga0207695_10358969 3300025913 Bacteria 1344
647 Ga0207671_11422948 3300025914 Unclassified 537
648 Ga0207660_11039666 3300025917 Bacteria 668
649 Ga0207662_10007671 3300025918 Bacteria 5879
650 Ga0207662_10049850 3300025918 Bacteria 2485
651 Ga0207662_10213139 3300025918 Bacteria 1254
652 Ga0207662_11074297 3300025918 Unclassified 572
653 Ga0207657_10004241 3300025919 Bacteria 15196
654 Ga0207657_10110433 3300025919 Bacteria 2271
655 Ga0207649_10104530 3300025920 Bacteria 1881
656 Ga0207652_10188629 3300025921 Bacteria 1854
657 Ga0207652_10500662 3300025921 Unclassified 1094
658 Ga0207652_11248801 3300025921 Unclassified 645
659 Ga0207646_10028604 3300025922 Bacteria 5071
660 Ga0207646_10035347 3300025922 Bacteria 4513
661 Ga0207646_10163049 3300025922 Bacteria 2012
662 Ga0207646_10226069 3300025922 Bacteria 1690
663 Ga0207646_10310824 3300025922 Unclassified 1424
664 Ga0207681_10016129 3300025923 Bacteria 4667
665 Ga0207681_10046254 3300025923 Bacteria 2927
666 Ga0207681_10188803 3300025923 Bacteria 1575
667 Ga0207681_10224755 3300025923 Unclassified 1454
668 Ga0207681_10424665 3300025923 Bacteria 1077
669 Ga0207681_10771157 3300025923 Bacteria 802
670 Ga0207694_10238619 3300025924 Bacteria 1485
671 Ga0207650_10051730 3300025925 Unclassified 3041
672 Ga0207650_10121003 3300025925 Bacteria 2038
673 Ga0207650_10274763 3300025925 Bacteria 1370
674 Ga0207650_10299166 3300025925 Unclassified 1314
675 Ga0207650_10862035 3300025925 Unclassified 768
676 Ga0207659_10009079 3300025926 Bacteria 6204
677 Ga0207659_10145137 3300025926 Bacteria 1847
678 Ga0207659_10413582 3300025926 Bacteria 1130
679 Ga0207659_10490237 3300025926 Unclassified 1039
680 Ga0207659_10678728 3300025926 Bacteria 881
681 Ga0207687_10163790 3300025927 Bacteria 1709
682 Ga0207687_10458028 3300025927 Bacteria 1059
683 Ga0207687_10628807 3300025927 Bacteria 907
684 Ga0207687_11224907 3300025927 Bacteria 645
685 Ga0207700_10286121 3300025928 Bacteria 1419
686 Ga0207664_10374306 3300025929 Bacteria 1263
687 Ga0207644_10105113 3300025931 Bacteria 2127
688 Ga0207644_10454776 3300025931 Bacteria 1052
689 Ga0207690_10237398 3300025932 Bacteria 1402
690 Ga0207690_10289636 3300025932 Bacteria 1278
691 Ga0207706_10086190 3300025933 Bacteria 2761
692 Ga0207706_10689708 3300025933 Bacteria 873
693 Ga0207706_11318325 3300025933 Bacteria 596
694 Ga0207686_10653854 3300025934 Bacteria 832
695 Ga0207686_10836956 3300025934 Bacteria 739
696 Ga0207686_10966996 3300025934 Unclassified 690
697 Ga0207686_11016379 3300025934 Bacteria 673
698 Ga0207686_11050679 3300025934 Unclassified 662
699 Ga0207686_11067162 3300025934 Bacteria 657
700 Ga0207686_11088345 3300025934 Unclassified 651
701 Ga0207686_11530043 3300025934 Bacteria 550
702 Ga0207686_11530365 3300025934 Bacteria 550
703 Ga0207709_10159220 3300025935 Bacteria 1573
704 Ga0207709_10179260 3300025935 Bacteria 1495
705 Ga0207670_10181034 3300025936 Bacteria 1588
706 Ga0207670_10596799 3300025936 Bacteria 906
707 Ga0207670_10730107 3300025936 Bacteria 822
708 Ga0207670_11513299 3300025936 Bacteria 570
709 Ga0207669_10062662 3300025937 Bacteria 2292
710 Ga0207669_10235201 3300025937 Bacteria 1354
711 Ga0207704_10087834 3300025938 Bacteria 2032
712 Ga0207704_10290884 3300025938 Bacteria 1247
713 Ga0207704_10644611 3300025938 Bacteria 872
714 Ga0207691_10037678 3300025940 Bacteria 4476
715 Ga0207691_10109974 3300025940 Bacteria 2451
716 Ga0207691_10115152 3300025940 Bacteria 2387
717 Ga0207691_10275983 3300025940 Bacteria 1447
718 Ga0207691_10277744 3300025940 Bacteria 1442
719 Ga0207691_10730613 3300025940 Bacteria 834
720 Ga0207691_11649070 3300025940 Bacteria 520
721 Ga0207711_10032122 3300025941 Bacteria 4438
722 Ga0207711_10079114 3300025941 Bacteria 2869
723 Ga0207711_10097866 3300025941 Bacteria 2591
724 Ga0207711_10108761 3300025941 Unclassified 2463
725 Ga0207711_10247305 3300025941 Bacteria 1636
726 Ga0207711_10341187 3300025941 Unclassified 1386
727 Ga0207711_10381105 3300025941 Bacteria 1308
728 Ga0207711_10400956 3300025941 Bacteria 1274
729 Ga0207711_10576718 3300025941 Bacteria 1049
730 Ga0207711_10615076 3300025941 Bacteria 1014
731 Ga0207711_10722306 3300025941 Bacteria 929
732 Ga0207711_10868253 3300025941 Bacteria 839
733 Ga0207711_11273353 3300025941 Bacteria 677
734 Ga0207689_10130786 3300025942 Bacteria 2066
735 Ga0207689_10240381 3300025942 Bacteria 1497
736 Ga0207689_10962086 3300025942 Unclassified 720
737 Ga0207689_11110759 3300025942 Bacteria 666
738 Ga0207661_10023782 3300025944 Bacteria 4635
739 Ga0207661_10154534 3300025944 Bacteria 1986
740 Ga0207661_11092197 3300025944 Bacteria 735
741 Ga0207679_10417844 3300025945 Unclassified 1183
742 Ga0207679_10521591 3300025945 Bacteria 1063
743 Ga0207679_10665503 3300025945 Bacteria 943
744 Ga0207679_11229299 3300025945 Unclassified 688
745 Ga0207667_10094461 3300025949 Bacteria 3087
746 Ga0207667_10728579 3300025949 Bacteria 992
747 Ga0207667_11005254 3300025949 Unclassified 821
748 Ga0207667_11280002 3300025949 Bacteria 710
749 Ga0207667_11559338 3300025949 Bacteria 630
750 Ga0207651_10035486 3300025960 Bacteria 3243
751 Ga0207651_10044857 3300025960 Bacteria 2962
752 Ga0207651_10220195 3300025960 Bacteria 1534
753 Ga0207651_10351786 3300025960 Bacteria 1241
754 Ga0207651_10859893 3300025960 Bacteria 806
755 Ga0207651_10920141 3300025960 Bacteria 779
756 Ga0207651_11262230 3300025960 Bacteria 664
757 Ga0207651_11927238 3300025960 Bacteria 531
758 Ga0207651_11952095 3300025960 Bacteria 528
759 Ga0207651_12054760 3300025960 Bacteria 513
760 Ga0207712_10080377 3300025961 Bacteria 2371
761 Ga0207712_10345620 3300025961 Bacteria 1235
762 Ga0207712_10837948 3300025961 Unclassified 810
763 Ga0207668_10383434 3300025972 Bacteria 1184
764 Ga0207668_11270904 3300025972 Bacteria 662
765 Ga0207668_11598533 3300025972 Bacteria 588
766 Ga0207668_12069541 3300025972 Unclassified 513
767 Ga0207640_10029275 3300025981 Bacteria 3379
768 Ga0207640_10034330 3300025981 Bacteria 3165
769 Ga0207640_10043190 3300025981 Bacteria 2880
770 Ga0207640_10634805 3300025981 Bacteria 908
771 Ga0207640_10825746 3300025981 Bacteria 805
772 Ga0207640_10920801 3300025981 Bacteria 765
773 Ga0207640_11927965 3300025981 Unclassified 535
774 Ga0207658_10022090 3300025986 Bacteria 4426
775 Ga0207658_10174462 3300025986 Bacteria 1774
776 Ga0207658_10650671 3300025986 Bacteria 950
777 Ga0207677_10110808 3300026023 Bacteria 2044
778 Ga0207677_10263279 3300026023 Bacteria 1406
779 Ga0207677_11224951 3300026023 Bacteria 688
780 Ga0207677_11591727 3300026023 Unclassified 605
781 Ga0207703_10021948 3300026035 Bacteria 5000
782 Ga0207703_10031719 3300026035 Bacteria 4179
783 Ga0207703_10094284 3300026035 Bacteria 2523
784 Ga0207703_10101544 3300026035 Unclassified 2439
785 Ga0207703_10105111 3300026035 Bacteria 2400
786 Ga0207703_10106964 3300026035 Bacteria 2380
787 Ga0207703_10111656 3300026035 Bacteria 2334
788 Ga0207703_10205039 3300026035 Bacteria 1754
789 Ga0207703_10206246 3300026035 Bacteria 1749
790 Ga0207703_10226360 3300026035 Bacteria 1674
791 Ga0207703_10416186 3300026035 Bacteria 1250
792 Ga0207703_10658795 3300026035 Bacteria 993
793 Ga0207703_10763338 3300026035 Bacteria 922
794 Ga0207703_10934377 3300026035 Bacteria 831
795 Ga0207703_11495744 3300026035 Bacteria 650
796 Ga0207703_11507792 3300026035 Unclassified 647
797 Ga0207703_11549236 3300026035 Bacteria 638
798 Ga0207703_11676268 3300026035 Unclassified 611
799 Ga0207639_10299603 3300026041 Bacteria 1421
800 Ga0207639_10587920 3300026041 Bacteria 1025
801 Ga0207639_11146553 3300026041 Bacteria 729
802 Ga0207639_11493269 3300026041 Bacteria 634
803 Ga0207678_10147916 3300026067 Bacteria 2005
804 Ga0207708_10010921 3300026075 Bacteria 6753
805 Ga0207708_10048675 3300026075 Bacteria 3227
806 Ga0207708_10303594 3300026075 Bacteria 1299
807 Ga0207708_10360136 3300026075 Bacteria 1195
808 Ga0207708_11013575 3300026075 Bacteria 722
809 Ga0207708_11013668 3300026075 Unclassified 722
810 Ga0207708_11475172 3300026075 Unclassified 597
811 Ga0207708_11611019 3300026075 Bacteria 570
812 Ga0207702_10284494 3300026078 Bacteria 1564
813 Ga0207702_10708561 3300026078 Bacteria 992
814 Ga0207702_11300826 3300026078 Bacteria 721
815 Ga0207641_10025246 3300026088 Bacteria 4900
816 Ga0207641_10088599 3300026088 Bacteria 2703
817 Ga0207641_10131137 3300026088 Bacteria 2251
818 Ga0207641_10209309 3300026088 Bacteria 1803
819 Ga0207641_10336598 3300026088 Bacteria 1435
820 Ga0207641_10802596 3300026088 Bacteria 931
821 Ga0207641_11217147 3300026088 Bacteria 753
822 Ga0207648_10007047 3300026089 Bacteria 11110
823 Ga0207648_10012113 3300026089 Bacteria 8087
824 Ga0207648_10026798 3300026089 Bacteria 5119
825 Ga0207648_10219126 3300026089 Bacteria 1691
826 Ga0207648_10388454 3300026089 Bacteria 1263
827 Ga0207648_10646853 3300026089 Bacteria 977
828 Ga0207648_10745485 3300026089 Bacteria 909
829 Ga0207648_10883315 3300026089 Bacteria 834
830 Ga0207648_12208632 3300026089 Unclassified 511
831 Ga0207676_10019436 3300026095 Bacteria 4956
832 Ga0207676_10976676 3300026095 Bacteria 834
833 Ga0207676_11082677 3300026095 Bacteria 792
834 Ga0207676_11362883 3300026095 Bacteria 705
835 Ga0207676_12408808 3300026095 Unclassified 523
836 Ga0207674_10142983 3300026116 Bacteria 2352
837 Ga0207675_100007173 3300026118 Bacteria 10536
838 Ga0207675_100052636 3300026118 Bacteria 3799
839 Ga0207675_100185917 3300026118 Bacteria 1991
840 Ga0207675_100257248 3300026118 Bacteria 1691
841 Ga0207675_100330960 3300026118 Bacteria 1489
842 Ga0207675_100350994 3300026118 Bacteria 1446
843 Ga0207675_100373488 3300026118 Bacteria 1401
844 Ga0207675_100404639 3300026118 Bacteria 1345
845 Ga0207675_100710224 3300026118 Bacteria 1015
846 Ga0207675_101453355 3300026118 Unclassified 706
847 Ga0207675_101760621 3300026118 Bacteria 639
848 Ga0207683_10149267 3300026121 Bacteria 2109
849 Ga0207683_10319010 3300026121 Bacteria 1423
850 Ga0207683_10442495 3300026121 Unclassified 1198
851 Ga0207683_11179820 3300026121 Bacteria 710
852 Ga0207698_10087119 3300026142 Bacteria 2542
853 Ga0207698_10412352 3300026142 Bacteria 1294
854 Ga0207698_12097238 3300026142 Bacteria 579
855 Ga0207428_10010365 3300027907 Bacteria 8332
856 Ga0207428_10225352 3300027907 Bacteria 1404
857 Ga0207428_10442532 3300027907 Bacteria 948
858 Ga0268266_10237264 3300028379 Bacteria 1681
859 Ga0268266_10256956 3300028379 Bacteria 1618
860 Ga0268266_10347326 3300028379 Bacteria 1394
861 Ga0268266_10420946 3300028379 Unclassified 1266
862 Ga0268266_10431253 3300028379 Bacteria 1251
863 Ga0268266_10896425 3300028379 Bacteria 857
864 Ga0268266_10982710 3300028379 Bacteria 817
865 Ga0268265_10036615 3300028380 Bacteria 3595
866 Ga0268265_10150977 3300028380 Bacteria 1959
867 Ga0268265_10153918 3300028380 Bacteria 1943
868 Ga0268265_10239667 3300028380 Bacteria 1599
869 Ga0268265_10502272 3300028380 Bacteria 1143
870 Ga0268265_11859515 3300028380 Bacteria 609
871 Ga0268265_11874708 3300028380 Bacteria 606
872 Ga0268264_10100371 3300028381 Bacteria 2514
873 Ga0268264_10211052 3300028381 Bacteria 1782
874 Ga0268264_10665450 3300028381 Bacteria 1032
875 Ga0268264_11246803 3300028381 Bacteria 753
876 Ga0268264_11277293 3300028381 Unclassified 744
877 Ga0268264_11743294 3300028381 Bacteria 633
878 Ga0268264_11795762 3300028381 Bacteria 623
879 Ga0268264_12271767 3300028381 Bacteria 550
880 Ga0265322_10151321 3300028654 Unclassified 663
881 Ga0265336_10201651 3300028666 Unclassified 591
882 Ga0265771_1027625 3300031010 Unclassified 528
883 Ga0265320_10152775 3300031240 Bacteria 1042
884 Ga0265316_10447417 3300031344 Unclassified 927
885 Ga0307408_100184767 3300031548 Bacteria 1675
886 Ga0307408_100868768 3300031548 Bacteria 823
887 Ga0307410_10617428 3300031852 Bacteria 906
888 Ga0307410_11938868 3300031852 Bacteria 525
889 Ga0307412_10917454 3300031911 Unclassified 769
890 Ga0307412_11618237 3300031911 Unclassified 592
891 Ga0307416_100466964 3300032002 Unclassified 1319
892 Ga0307416_100921062 3300032002 Bacteria 975
893 Ga0307416_102586457 3300032002 Unclassified 605
894 Ga0307416_102914928 3300032002 Unclassified 572
895 Ga0307416_103173529 3300032002 Bacteria 550
896 Ga0373930_0028688 3300034816 Bacteria 1134
897 Ga0373948_0002730 3300034817 Bacteria 2642
898 Ga0373950_0017571 3300034818 Bacteria 1233
899 Ga0373958_0011434 3300034819 Bacteria 1500
900 Ga0373959_0011124 3300034820 Bacteria 1584
901 Ga0373938_0012616 3300034957 Bacteria 1589
902 Ga0373928_0009559 3300035084 Bacteria 1894
903 Ga0373929_0023622 3300035085 Bacteria 1264
904 Ga0373940_0095161 3300035088 Unclassified 897
905 Ga0373944_0003264 3300035089 Bacteria 4172
906 Ga0373949_0004437 3300035090 Bacteria 3219
907 Ga0373949_0016243 3300035090 Bacteria 1668
908 Ga0373951_0080233 3300035091 Bacteria 843
909 Ga0373952_0002927 3300035092 Bacteria 3087
910 Ga0373952_0164882 3300035092 Unclassified 630
911 Ga0373923_0483427 3300035111 Bacteria 603
912 Ga0373932_0001360 3300035112 Bacteria 6856
913 Ga0373932_0361710 3300035112 Unclassified 554
914 Ga0373936_0277992 3300035113 Bacteria 752
915 Ga0373939_0091781 3300035114 Bacteria 1027
916 Ga0373941_0012551 3300035115 Bacteria 2218
917 Ga0373941_0014609 3300035115 Bacteria 2101
918 Ga0373941_0198198 3300035115 Unclassified 762
919 Ga0373953_0069485 3300035117 Bacteria 1451
920 Ga0373953_0236455 3300035117 Bacteria 793
921 Ga0373953_0347275 3300035117 Bacteria 650
922 Ga0373954_0614911 3300035118 Unclassified 539
923 Ga0373954_0647021 3300035118 Bacteria 524
924 Ga0373957_0089984 3300035120 Bacteria 1219
925 Ga0373960_0039195 3300035121 Bacteria 1361
926 Ga0373943_0117213 3300035170 Bacteria 1412
927 Ga0373943_0328683 3300035170 Unclassified 873
928 Ga0373946_0291760 3300035171 Bacteria 805
929 Ga0373955_0329458 3300035172 Bacteria 923
930 Ga0373942_0002582 3300035207 Bacteria 4367
931 Ga0373961_0007661 3300035241 Bacteria 2616
932 Ga0373961_0128308 3300035241 Bacteria 847
933 Ga0373961_0134841 3300035241 Bacteria 830
934 Ga0373962_0013114 3300035242 Bacteria 2095
935 Ga0373924_0096641 3300035410 Bacteria 1268
936 Ga0373931_0117980 3300035691 Bacteria 1513
937 Ga0373931_0172492 3300035691 Unclassified 1275
938 Ga0373931_0853390 3300035691 Unclassified 610
939 Ga0373935_0328445 3300035692 Bacteria 1087
940 Ga0373935_0409480 3300035692 Bacteria 975
941 Ga0373935_1096061 3300035692 Bacteria 592
942 Ga0373927_0211748 3300035695 Bacteria 1273
943 Ga0373927_0216335 3300035695 Bacteria 1259
944 Ga0373947_0319070 3300035725 Bacteria 1039
945 Ga0373947_0577107 3300035725 Bacteria 766
946 Ga0373937_0116672 3300036401 Bacteria 2486
947 Ga0373937_0129226 3300036401 Bacteria 2359
948 Ga0373937_0275966 3300036401 Bacteria 1587
949 Ga0373937_0653847 3300036401 Bacteria 997
950 Ga0373937_1068883 3300036401 Unclassified 756
951 Ga0373925_0111048 3300037068 Unclassified 2118
952 Ga0373925_0132918 3300037068 Bacteria 1942
953 Ga0373925_0160596 3300037068 Unclassified 1770
954 Ga0395900_0417670 3300037418 Bacteria 1303
955 Ga0395898_0674429 3300037466 Bacteria 976
956 Ga0395898_0767835 3300037466 Bacteria 905
957 Ga0395905_0691623 3300037471 Unclassified 922
958 Ga0395901_1734855 3300038443 Unclassified 575
959 Ga0436365_0197130 3300039437 Bacteria 2909
960 Ga0436365_1724930 3300039437 Bacteria 643
961 Ga0436361_0069171 3300039447 Bacteria 2061
962 Ga0436363_0503056 3300039450 Unclassified 520
963 Ga0436362_0855640 3300039453 Unclassified 509
964 Ga0451807_1892845 3300041486 Bacteria 1446
965 Ga0451853_1242347 3300041512 Bacteria 546
966 Ga0451853_2105717 3300041512 Bacteria 1259
967 Ga0450891_024626 3300042129 Unclassified 604
968 Ga0450896_095364 3300042133 Bacteria 511
969 Ga0439446_0128646 3300042156 Bacteria 820
970 Ga0439435_0033483 3300042436 Unclassified 1407
971 Ga0439459_0121000 3300042438 Bacteria 660
972 Ga0439464_0110625 3300042439 Bacteria 841
973 Ga0450916_020492 3300042530 Unclassified 904
974 Ga0453683_0352287 3300044673 Bacteria 946
975 Ga0466963_0055226 3300044694 Bacteria 2641
976 Ga0466963_0855423 3300044694 Bacteria 641
977 Ga0451576_0086105 3300045051 Bacteria 3268
978 Ga0451576_0367360 3300045051 Bacteria 1507
979 Ga0451576_1142879 3300045051 Bacteria 814
980 Ga0451576_1173086 3300045051 Bacteria 802
981 Ga0451576_1949051 3300045051 Unclassified 606
982 Ga0466967_0213772 3300045976 Bacteria 1830
983 Ga0466967_0485347 3300045976 Bacteria 1211
984 Ga0466967_0706999 3300045976 Bacteria 998
985 Ga0466967_1485525 3300045976 Bacteria 675
986 Ga0466967_2031255 3300045976 Unclassified 571
987 Ga0495592_0212037 3300046454 Bacteria 1300
988 Ga0495592_0798459 3300046454 Unclassified 561
989 Ga0495603_0053507 3300046455 Bacteria 2395
990 Ga0495603_0275523 3300046455 Bacteria 967
991 Ga0495629_0141224 3300046459 Bacteria 1676
992 Ga0495629_0201505 3300046459 Bacteria 1376
993 Ga0495629_0393910 3300046459 Bacteria 942
994 Ga0495651_0068778 3300046462 Bacteria 2699
995 Ga0495653_0841465 3300046463 Bacteria 549
996 Ga0495580_0128680 3300046472 Bacteria 1757
997 Ga0495580_0712047 3300046472 Unclassified 656
998 Ga0495582_0272356 3300046473 Bacteria 972
999 Ga0495582_0366485 3300046473 Bacteria 830
1000 Ga0495582_0884084 3300046473 Unclassified 517
1001 Ga0495639_0011745 3300046475 Bacteria 3778
1002 Ga0495639_0180415 3300046475 Bacteria 1028
1003 Ga0495639_0683958 3300046475 Bacteria 530
1004 Ga0495662_0099528 3300046476 Unclassified 1422
1005 Ga0495662_0212932 3300046476 Bacteria 953
1006 Ga0495584_0524094 3300046491 Unclassified 604
1007 Ga0495594_0353529 3300046499 Bacteria 837
1008 Ga0495594_0888065 3300046499 Bacteria 501
1009 Ga0495607_0221919 3300046501 Bacteria 924
1010 Ga0495610_0194124 3300046512 Bacteria 836
1011 Ga0495618_0192533 3300046514 Bacteria 1293
1012 Ga0495628_0091525 3300046516 Bacteria 2354
1013 Ga0495630_0136938 3300046517 Bacteria 1861
1014 Ga0495630_0559749 3300046517 Unclassified 877
1015 Ga0495640_0077252 3300046533 Bacteria 2220
1016 Ga0495640_0350776 3300046533 Bacteria 911
1017 Ga0495640_0422378 3300046533 Unclassified 817
1018 Ga0495640_0500004 3300046533 Bacteria 740
1019 Ga0495586_0072928 3300046535 Bacteria 1878
1020 Ga0495645_0126732 3300046543 Bacteria 1794
1021 Ga0495645_0287393 3300046543 Bacteria 1079
1022 Ga0495667_0734141 3300046559 Unclassified 611
1023 Ga0495656_0186367 3300046615 Bacteria 1023
1024 Ga0495656_0420394 3300046615 Bacteria 701
1025 Ga0495635_0028691 3300046663 Bacteria 3868
1026 Ga0495635_0333202 3300046663 Bacteria 1014
1027 Ga0495635_1092196 3300046663 Bacteria 505
1028 Ga0495659_0272260 3300046664 Bacteria 710
1029 Ga0495599_0094860 3300046678 Bacteria 1861
1030 Ga0495647_0031853 3300046681 Unclassified 1962
1031 Ga0495647_0138522 3300046681 Bacteria 1036
1032 Ga0495658_0140406 3300046683 Bacteria 1477
1033 Ga0495658_0280006 3300046683 Bacteria 1052
1034 Ga0495658_0437594 3300046683 Bacteria 835
1035 Ga0495658_0509504 3300046683 Bacteria 770
1036 Ga0495669_0114849 3300046684 Bacteria 1259
1037 Ga0495613_0217845 3300046689 Unclassified 1341
1038 Ga0495600_0562420 3300046809 Bacteria 696
1039 Ga0495600_0817358 3300046809 Bacteria 554
1040 Ga0495604_0617498 3300047317 Bacteria 694
1041 Ga0495674_0906897 3300047319 Unclassified 680
1042 Ga0495674_1110353 3300047319 Bacteria 601
1043 Ga0495674_1124399 3300047319 Unclassified 597
1044 Ga0495676_0394654 3300047321 Bacteria 919
1045 Ga0495680_0773677 3300047322 Bacteria 629
1046 Ga0495684_0021529 3300047471 Bacteria 4964
1047 Ga0495684_0071339 3300047471 Bacteria 2640
1048 Ga0495684_0361135 3300047471 Bacteria 1029
1049 Ga0495684_0591472 3300047471 Bacteria 750
1050 Ga0495686_0218058 3300047472 Bacteria 1087
1051 Ga0495593_0147796 3300047673 Bacteria 1189
1052 Ga0495614_0464556 3300048089 Bacteria 600
1053 Ga0495614_0580637 3300048089 Bacteria 537
1054 Ga0496100_0020242 3300048903 Unclassified 3986
1055 Ga0496100_0747568 3300048903 Bacteria 765
1056 Ga0496100_1679614 3300048903 Unclassified 502
1057 Ga0496101_0000348 3300048904 Bacteria 31198
1058 Ga0496101_0476238 3300048904 Bacteria 986
1059 Ga0496101_0548491 3300048904 Bacteria 914
1060 Ga0496101_0893788 3300048904 Bacteria 699
1061 Ga0496101_1504688 3300048904 Bacteria 524
1062 Ga0496102_0072157 3300048905 Bacteria 3172
1063 Ga0496102_0306671 3300048905 Bacteria 1496
1064 Ga0496102_0312704 3300048905 Unclassified 1480
1065 Ga0496102_0872958 3300048905 Bacteria 821
1066 Ga0496104_0054625 3300048907 Bacteria 3775
1067 Ga0496104_0420362 3300048907 Bacteria 1249
1068 Ga0496104_0643326 3300048907 Bacteria 969
1069 Ga0496104_0689111 3300048907 Bacteria 930
1070 Ga0496104_0737513 3300048907 Unclassified 892
1071 Ga0496105_0054031 3300048908 Bacteria 3317
1072 Ga0496105_0097741 3300048908 Bacteria 2425
1073 Ga0496105_0808876 3300048908 Unclassified 712
1074 Ga0496105_0913151 3300048908 Unclassified 661
1075 Ga0496106_0163315 3300048909 Unclassified 1762
1076 Ga0496106_0223923 3300048909 Bacteria 1501
1077 Ga0496106_0385092 3300048909 Unclassified 1127
1078 Ga0496108_0007098 3300048911 Bacteria 9072
1079 Ga0496108_0275187 3300048911 Bacteria 1466
1080 Ga0496108_1098962 3300048911 Unclassified 676
1081 Ga0496108_1161853 3300048911 Unclassified 654
1082 Ga0496109_0321166 3300048912 Bacteria 1461
1083 Ga0496109_0321875 3300048912 Bacteria 1459
1084 Ga0496110_0110599 3300048913 Bacteria 2469
1085 Ga0496110_0555100 3300048913 Bacteria 1044
1086 Ga0496111_0524964 3300048914 Bacteria 870
1087 Ga0496112_0023415 3300048915 Bacteria 5900
1088 Ga0496112_0315191 3300048915 Unclassified 1509
1089 Ga0496112_0323385 3300048915 Bacteria 1487
1090 Ga0496112_0334776 3300048915 Unclassified 1457
1091 Ga0496112_0429666 3300048915 Bacteria 1259
1092 Ga0496113_0007138 3300048916 Bacteria 7156
1093 Ga0496114_0011233 3300048917 Bacteria 7150
1094 Ga0496114_0037578 3300048917 Bacteria 4005
1095 Ga0496114_0065054 3300048917 Unclassified 3054
1096 Ga0496114_0193950 3300048917 Bacteria 1778
1097 Ga0496114_0294653 3300048917 Bacteria 1432
1098 Ga0496114_0817539 3300048917 Bacteria 811
1099 Ga0496115_0017231 3300048918 Bacteria 5516
1100 Ga0496115_0040457 3300048918 Bacteria 3706
1101 Ga0501034_0037699 3300049571 Bacteria 4896
1102 Ga0501034_0149031 3300049571 Bacteria 2316
1103 Ga0501041_0936668 3300049577 Bacteria 557
1104 Ga0501047_0018175 3300049581 Bacteria 6737
1105 Ga0501047_0086203 3300049581 Bacteria 3018
1106 Ga0501048_0465587 3300049582 Bacteria 906
1107 Ga0501048_0494413 3300049582 Unclassified 877
1108 Ga0501070_0840398 3300049586 Bacteria 719
1109 Ga0501072_0337534 3300049588 Bacteria 1197
1110 Ga0501073_0228692 3300049589 Bacteria 1285
1111 Ga0501073_0322842 3300049589 Bacteria 1066
1112 Ga0501076_0598340 3300049592 Bacteria 910
1113 Ga0501076_1524472 3300049592 Unclassified 549
1114 Ga0501201_054882 3300049651 Unclassified 505
1115 Ga0501216_042583 3300049660 Bacteria 873
1116 Ga0501257_099414 3300049686 Bacteria 763
1117 Ga0501261_053002 3300049690 Unclassified 670
1118 Ga0501079_0479195 3300049741 Bacteria 978
1119 Ga0501263_022499 3300049760 Bacteria 855
1120 Ga0501044_0004635 3300049823 Bacteria 15392
1121 Ga0501045_1024487 3300049824 Bacteria 605
1122 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
1123 nmdc:mga05p37_223977_c1 3300050507 Bacteria 2269
1124 nmdc:mga05p37_29228_c1 3300050507 Bacteria 6727
1125 nmdc:mga05p37_332650_c1 3300050507 Bacteria 1794
1126 nmdc:mga05p37_358936_c1 3300050507 Bacteria 1714
1127 nmdc:mga05p37_416644_c1 3300050507 Bacteria 1564
1128 nmdc:mga05p37_44060_c1 3300050507 Bacteria 5490
1129 nmdc:mga05p37_62142_c1 3300050507 Bacteria 4596
1130 nmdc:mga05p37_691873_c1 3300050507 Bacteria 1134
1131 nmdc:mga05p37_7600_c1 3300050507 Bacteria 12787
1132 nmdc:mga05p37_84595_c1 3300050507 Bacteria 3908
1133 nmdc:mga0qj67_882563_c1 3300050509 Bacteria 705
1134 nmdc:mga06r32_441844_c1 3300050510 Bacteria 1281
1135 nmdc:mga06r32_48359_c1 3300050510 Bacteria 4064
1136 nmdc:mga08y16_1639061_c1 3300050511 Unclassified 600
1137 nmdc:mga08y16_284927_c1 3300050511 Unclassified 1704
1138 nmdc:mga08y16_402010_c1 3300050511 Bacteria 1402
1139 nmdc:mga08y16_429206_c1 3300050511 Bacteria 1350
1140 nmdc:mga08y16_4349_c1 3300050511 Bacteria 14799
1141 nmdc:mga08y16_565010_c1 3300050511 Bacteria 1150
1142 nmdc:mga08y16_804039_c1 3300050511 Bacteria 933
1143 nmdc:mga0n895_1083963_c1 3300050512 Bacteria 779
1144 nmdc:mga0n895_1693113_c1 3300050512 Bacteria 595
1145 nmdc:mga0n895_191606_c1 3300050512 Bacteria 2075
1146 nmdc:mga0n895_200139_c1 3300050512 Bacteria 2029
1147 nmdc:mga0n895_2046809_c1 3300050512 Unclassified 530
1148 nmdc:mga0n895_2075893_c1 3300050512 Bacteria 525
1149 nmdc:mga0n895_40711_c1 3300050512 Bacteria 4514
1150 nmdc:mga0n895_607961_c1 3300050512 Bacteria 1095
1151 nmdc:mga0n895_66934_c1 3300050512 Bacteria 3557
1152 nmdc:mga0n895_69126_c1 3300050512 Bacteria 3498
1153 nmdc:mga0n895_71938_c1 3300050512 Bacteria 3430
1154 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
1155 nmdc:mga0rr50_180008_c1 3300050513 Bacteria 1727
1156 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
1157 nmdc:mga0rr50_224390_c1 3300050513 Bacteria 1553
1158 nmdc:mga0rr50_277164_c1 3300050513 Bacteria 1399
1159 nmdc:mga0rr50_287280_c1 3300050513 Bacteria 1374
1160 nmdc:mga0rr50_345089_c1 3300050513 Bacteria 1251
1161 nmdc:mga0rr50_61796_c1 3300050513 Bacteria 2823
1162 nmdc:mga0rr50_664142_c1 3300050513 Bacteria 889
1163 nmdc:mga08x19_1319352_c1 3300050514 Unclassified 511
1164 nmdc:mga08x19_14907_c1 3300050514 Bacteria 4722
1165 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
1166 nmdc:mga08x19_333139_c1 3300050514 Bacteria 1058
1167 nmdc:mga08x19_498286_c1 3300050514 Unclassified 860
1168 nmdc:mga08x19_70817_c1 3300050514 Bacteria 2273
1169 nmdc:mga0a205_107805_c1 3300050515 Bacteria 2684
1170 nmdc:mga0a205_1336740_c1 3300050515 Bacteria 564
1171 nmdc:mga0a205_136460_c1 3300050515 Bacteria 2354
1172 nmdc:mga0a205_144648_c1 3300050515 Bacteria 2277
1173 nmdc:mga0a205_52004_c1 3300050515 Bacteria 3954
1174 nmdc:mga0a205_747048_c1 3300050515 Bacteria 827
1175 nmdc:mga0a205_91397_c1 3300050515 Bacteria 2941
1176 nmdc:mga0a205_991722_c1 3300050515 Bacteria 687
1177 Ga0495601_0906044 3300053077 Bacteria 557
1178 Ga0495619_0029921 3300053085 Bacteria 3522
1179 Ga0495619_0072564 3300053085 Bacteria 2306
1180 Ga0495619_0084323 3300053085 Bacteria 2144
1181 Ga0501084_0485533 3300054114 Unclassified 1044
1182 Ga0501084_0742378 3300054114 Unclassified 827
1183 Ga0530510_0624247 3300061734 Unclassified 820
1184 Ga0530510_1466073 3300061734 Bacteria 524
1185 Ga0070676_10617919
1186 JGI24751J29686_10076665
1187 JGI25406J46586_10001443
1188 JGI25406J46586_10046294
1189 Ga0065714_10505957
1190 Ga0065704_10517662
1191 Ga0065712_10179239
1192 Ga0065712_10319700
1193 Ga0065715_10030943
1194 Ga0065715_10355510
1195 Ga0065715_10887407
1196 Ga0065715_11095894
1197 Ga0065707_10192094
1198 Ga0065707_10211977
1199 Ga0065707_10459115
1200 Ga0065707_10459560
1201 Ga0065707_10713965
1202 Ga0065707_10781274
1203 Ga0065707_10939846
1204 Ga0070658_10088267
1205 Ga0070676_10002829
1206 Ga0070676_10308474
1207 Ga0070683_100010952
1208 Ga0070683_100120425
1209 Ga0070683_100191500
1210 Ga0070683_101531751
1211 Ga0070683_102212497
1212 Ga0070690_100002909
1213 Ga0070690_100065413
1214 Ga0070690_100139636
1215 Ga0070690_100202466
1216 Ga0070690_100761986
1217 Ga0070670_100068994
1218 Ga0070670_100107967
1219 Ga0070670_100140923
1220 Ga0070670_100153584
1221 Ga0070670_100401143
1222 Ga0070670_100975301
1223 Ga0070670_101628146
1224 Ga0070677_10017845
1225 Ga0070677_10234972
1226 Ga0070677_10433019
1227 Ga0068869_100331359
1228 Ga0068869_100422664
1229 Ga0068869_100896731
1230 Ga0070666_10056183
1231 Ga0070666_10181937
1232 Ga0070666_10249629
1233 Ga0070666_10275088
1234 Ga0070680_100510916
1235 Ga0070682_100390026
1236 Ga0070682_100821847
1237 Ga0070682_100903563
1238 Ga0068868_100017279
1239 Ga0068868_100071960
1240 Ga0068868_100422125
1241 Ga0068868_100521727
1242 Ga0068868_101853441
1243 Ga0068868_102256449
1244 Ga0070660_100012100
1245 Ga0070660_100816055
1246 Ga0070691_10004528
1247 Ga0070687_100010488
1248 Ga0070687_100483534
1249 Ga0070661_100525998
1250 Ga0070661_100775527
1251 Ga0070661_101246025
1252 Ga0070692_10096882
1253 Ga0070692_10493896
1254 Ga0070692_10868785
1255 Ga0070692_11358450
1256 Ga0070668_100255898
1257 Ga0070668_100994456
1258 Ga0070668_101840138
1259 Ga0070669_100005781
1260 Ga0070669_100055082
1261 Ga0070669_100296301
1262 Ga0070669_100312106
1263 Ga0070669_100480947
1264 Ga0070669_101630096
1265 Ga0070669_101707510
1266 Ga0070675_100000497
1267 Ga0070675_100064291
1268 Ga0070675_100183963
1269 Ga0070675_101316718
1270 Ga0070671_100224706
1271 Ga0070671_100488290
1272 Ga0070671_101113363
1273 Ga0070674_100138576
1274 Ga0070674_100200591
1275 Ga0070674_101454394
1276 Ga0070674_102007238
1277 Ga0070673_100047628
1278 Ga0070673_100049204
1279 Ga0070673_100071506
1280 Ga0070673_100143852
1281 Ga0070673_100166625
1282 Ga0070673_100215487
1283 Ga0070673_100649964
1284 Ga0070673_100804073
1285 Ga0070673_101031492
1286 Ga0070673_101119809
1287 Ga0070673_101235672
1288 Ga0070688_101389290
1289 Ga0070659_100176700
1290 Ga0070659_100825285
1291 Ga0070659_101196720
1292 Ga0070659_101993370
1293 Ga0070667_100002707
1294 Ga0070667_100197505
1295 Ga0070667_100200237
1296 Ga0070667_100974166
1297 Ga0070667_101240529
1298 Ga0070703_10269321
1299 Ga0070703_10406614
1300 Ga0070714_100012845
1301 Ga0070713_100099749
1302 Ga0070710_11314241
1303 Ga0070701_10006149
1304 Ga0070701_11029938
1305 Ga0070705_100007684
1306 Ga0070705_100857279
1307 Ga0070705_101281706
1308 Ga0070700_100006138
1309 Ga0070700_100036897
1310 Ga0070700_100275881
1311 Ga0070700_100662454
1312 Ga0070700_101251455
1313 Ga0070694_100032864
1314 Ga0070694_100348859
1315 Ga0070694_100372681
1316 Ga0070694_100475271
1317 Ga0070694_100756720
1318 Ga0070694_100833257
1319 Ga0070694_100948748
1320 Ga0070708_100016776
1321 Ga0070708_100526572
1322 Ga0070708_100938202
1323 Ga0070663_100470351
1324 Ga0070678_100195473
1325 Ga0070678_100291948
1326 Ga0070678_100437436
1327 Ga0070678_100446598
1328 Ga0070678_101987231
1329 Ga0070662_100102139
1330 Ga0070662_100600023
1331 Ga0070662_101448937
1332 Ga0070681_10281149
1333 Ga0070681_11137261
1334 Ga0070681_11594793
1335 Ga0070681_11930900
1336 Ga0068867_100005238
1337 Ga0068867_100015049
1338 Ga0068867_100064649
1339 Ga0068867_100853810
1340 Ga0068867_100855608
1341 Ga0068867_101420690
1342 Ga0068867_101668908
1343 Ga0070685_10308889
1344 Ga0070685_10415482
1345 Ga0070706_100302272
1346 Ga0070706_100780501
1347 Ga0070706_101040237
1348 Ga0070706_101248397
1349 Ga0070706_101671695
1350 Ga0070707_100015695
1351 Ga0070707_100037924
1352 Ga0070707_100120381
1353 Ga0070707_100192773
1354 Ga0070707_100350824
1355 Ga0070707_101727928
1356 Ga0070698_100154703
1357 Ga0070698_100959533
1358 Ga0070698_101019419
1359 Ga0070698_101222430
1360 Ga0070698_101439943
1361 Ga0070699_100018361
1362 Ga0070699_100108289
1363 Ga0070699_100239449
1364 Ga0070699_100670147
1365 Ga0070699_101112164
1366 Ga0070679_100129098
1367 Ga0070679_100220081
1368 Ga0070679_100692641
1369 Ga0070679_101606833
1370 Ga0070679_101904645
1371 Ga0070684_100094588
1372 Ga0070684_100184919
1373 Ga0070684_100430054
1374 Ga0070684_100862729
1375 Ga0070684_101325382
1376 Ga0070684_101456124
1377 Ga0070684_102093463
1378 Ga0070684_102211059
1379 Ga0070697_100032589
1380 Ga0070697_100106205
1381 Ga0070697_100215901
1382 Ga0070697_100422629
1383 Ga0070697_100994061
1384 Ga0068853_100337748
1385 Ga0068853_100931165
1386 Ga0068853_100970069
1387 Ga0068853_101534798
1388 Ga0070672_100023372
1389 Ga0070672_100118427
1390 Ga0070672_100168419
1391 Ga0070672_100596611
1392 Ga0070672_100789938
1393 Ga0070686_100002672
1394 Ga0070686_100042563
1395 Ga0070686_100072638
1396 Ga0070686_100173255
1397 Ga0070686_100225499
1398 Ga0070686_100323942
1399 Ga0070686_100676961
1400 Ga0070695_100000438
1401 Ga0070695_100012060
1402 Ga0070695_100172756
1403 Ga0070695_100342562
1404 Ga0070695_101246016
1405 Ga0070696_100041212
1406 Ga0070696_100175759
1407 Ga0070696_100192695
1408 Ga0070696_100414876
1409 Ga0070696_100546289
1410 Ga0070693_100025651
1411 Ga0070693_100072572
1412 Ga0070693_101492961
1413 Ga0070665_100004450
1414 Ga0070665_100005752
1415 Ga0070665_100033141
1416 Ga0070665_100219869
1417 Ga0070665_100279523
1418 Ga0070665_100374864
1419 Ga0070665_100449464
1420 Ga0070665_101628732
1421 Ga0070704_100004322
1422 Ga0070704_100070647
1423 Ga0070704_100325064
1424 Ga0070704_100605893
1425 Ga0070704_100719370
1426 Ga0070704_101689670
1427 Ga0068855_100059811
1428 Ga0068855_100265906
1429 Ga0068855_100507643
1430 Ga0068855_100623698
1431 Ga0070664_100266114
1432 Ga0070664_100515456
1433 Ga0070664_101136629
1434 Ga0068857_100734215
1435 Ga0068854_100009213
1436 Ga0068854_100036996
1437 Ga0068854_100111166
1438 Ga0068854_100431513
1439 Ga0068854_101000450
1440 Ga0068854_101872934
1441 Ga0068856_100429855
1442 Ga0068856_100539593
1443 Ga0068856_100701419
1444 Ga0068856_100816647
1445 Ga0070702_100028191
1446 Ga0070702_100419030
1447 Ga0070702_100612274
1448 Ga0070702_100770343
1449 Ga0070702_100833453
1450 Ga0068852_102566218
1451 Ga0068859_100405334
1452 Ga0068859_100569062
1453 Ga0068859_101183514
1454 Ga0068859_101266106
1455 Ga0068859_101292232
1456 Ga0068859_101744159
1457 Ga0068859_102932890
1458 Ga0068864_100025813
1459 Ga0068864_101438717
1460 Ga0068864_101559636
1461 Ga0068864_102233479
1462 Ga0068866_10116745
1463 Ga0068866_10181307
1464 Ga0068866_10320109
1465 Ga0068866_10474100
1466 Ga0068866_10542761
1467 Ga0068866_10547979
1468 Ga0068866_10708882
1469 Ga0068866_10871405
1470 Ga0068866_11256242
1471 Ga0068861_100023988
1472 Ga0068861_100071293
1473 Ga0068861_100360857
1474 Ga0068861_100384670
1475 Ga0068861_100598411
1476 Ga0068861_100855059
1477 Ga0068851_10320831
1478 Ga0068870_10789161
1479 Ga0068870_10923687
1480 Ga0068870_11146231
1481 Ga0068863_100020067
1482 Ga0068863_100136935
1483 Ga0068863_100439648
1484 Ga0068863_100567917
1485 Ga0068863_100748542
1486 Ga0068863_100874131
1487 Ga0068858_100012439
1488 Ga0068858_100031470
1489 Ga0068858_100111323
1490 Ga0068858_100193100
1491 Ga0068858_100269556
1492 Ga0068858_100308421
1493 Ga0068858_100316235
1494 Ga0068858_100351790
1495 Ga0068858_100550558
1496 Ga0068858_100783245
1497 Ga0068858_100828456
1498 Ga0068858_100942534
1499 Ga0068858_100995916
1500 Ga0068858_101035937
1501 Ga0068858_101055384
1502 Ga0068858_101069378
1503 Ga0068858_101439104
1504 Ga0068858_101697464
1505 Ga0068860_100046097
1506 Ga0068860_100066552
1507 Ga0068860_100920506
1508 Ga0068860_101028693
1509 Ga0068860_101277257
1510 Ga0068860_101602405
1511 Ga0068860_101752315
1512 Ga0068862_100003835
1513 Ga0068862_100069595
1514 Ga0068862_100157026
1515 Ga0068862_100242564
1516 Ga0068862_100274549
1517 Ga0068862_100447793
1518 Ga0068862_100860431
1519 Ga0068862_101929067
1520 Ga0081455_10052514
1521 Ga0081455_10102908
1522 Ga0081539_10000093
1523 Ga0081539_10015507
1524 Ga0081539_10256234
1525 Ga0081539_10299172
1526 Ga0070717_10553161
1527 Ga0075363_100485822
1528 Ga0075432_10015554
1529 Ga0075432_10326609
1530 Ga0070715_10021000
1531 Ga0070715_10240045
1532 Ga0097621_100002574
1533 Ga0097621_100004951
1534 Ga0097621_100034981
1535 Ga0097621_100167258
1536 Ga0097621_100253700
1537 Ga0097621_100896349
1538 Ga0097621_101019092
1539 Ga0068871_100005083
1540 Ga0068871_100047990
1541 Ga0068871_100053257
1542 Ga0068871_100069455
1543 Ga0068871_100149079
1544 Ga0068871_100153015
1545 Ga0068871_100201302
1546 Ga0068871_100285322
1547 Ga0068871_100326579
1548 Ga0068871_100944624
1549 Ga0068871_101351708
1550 Ga0075428_100200148
1551 Ga0075428_100487097
1552 Ga0075428_100798735
1553 Ga0075428_100883205
1554 Ga0075428_101417339
1555 Ga0075430_101055076
1556 Ga0075431_100061494
1557 Ga0075431_100188285
1558 Ga0075431_100905956
1559 Ga0075433_10004006
1560 Ga0075433_10008066
1561 Ga0075433_10078306
1562 Ga0075433_10081534
1563 Ga0075433_10136204
1564 Ga0075433_10145548
1565 Ga0075433_10241369
1566 Ga0075433_10286334
1567 Ga0075433_10423353
1568 Ga0075433_10638355
1569 Ga0075433_10743464
1570 Ga0075433_11108651
1571 Ga0075433_11336466
1572 Ga0075434_100001869
1573 Ga0075434_100002721
1574 Ga0075434_100008420
1575 Ga0075434_100017907
1576 Ga0075434_100144858
1577 Ga0075434_100257108
1578 Ga0075434_100360804
1579 Ga0075434_100452508
1580 Ga0075434_100675281
1581 Ga0075434_100698530
1582 Ga0075434_101095967
1583 Ga0075434_101382597
1584 Ga0075434_102180223
1585 Ga0075434_102666690
1586 Ga0075429_100401658
1587 Ga0068865_100035521
1588 Ga0068865_100222893
1589 Ga0068865_100994483
1590 Ga0068865_101117395
1591 Ga0068865_102167036
1592 Ga0075436_100011598
1593 Ga0075436_100012944
1594 Ga0075436_100412746
1595 Ga0075436_100445469
1596 Ga0075436_101411092
1597 Ga0097620_100405336
1598 Ga0097620_100569101
1599 Ga0097620_101183432
1600 Ga0097620_101266067
1601 Ga0097620_101292370
1602 Ga0097620_101744456
1603 Ga0097620_102931819
1604 Ga0075435_100000147
1605 Ga0075435_100011353
1606 Ga0075435_100067200
1607 Ga0075435_100586894
1608 Ga0075435_100828142
1609 Ga0099794_10592275
1610 Ga0099795_10084929
1611 Ga0105251_10181236
1612 Ga0105251_10270599
1613 Ga0105250_10460149
1614 Ga0105240_10086821
1615 Ga0105240_10101178
1616 Ga0105240_10108880
1617 Ga0105240_10335776
1618 Ga0105240_11212062
1619 Ga0105240_12191873
1620 Ga0105240_12254747
1621 Ga0105240_12458519
1622 Ga0111539_10002429
1623 Ga0111539_10009286
1624 Ga0111539_10029720
1625 Ga0111539_10234475
1626 Ga0111539_10415081
1627 Ga0111539_10575139
1628 Ga0111539_10681255
1629 Ga0111539_11951937
1630 Ga0105245_10006678
1631 Ga0105245_10007298
1632 Ga0105245_10192583
1633 Ga0105245_10415585
1634 Ga0105245_10972069
1635 Ga0105245_11377599
1636 Ga0105245_11744339
1637 Ga0105245_13032543
1638 Ga0105247_10008855
1639 Ga0105247_10101722
1640 Ga0105247_10252248
1641 Ga0114129_10001820
1642 Ga0114129_10015831
1643 Ga0114129_10019712
1644 Ga0114129_10025101
1645 Ga0114129_10025144
1646 Ga0114129_10032186
1647 Ga0114129_10076474
1648 Ga0114129_10253574
1649 Ga0114129_10803474
1650 Ga0114129_10970667
1651 Ga0114129_11073871
1652 Ga0114129_11084795
1653 Ga0114129_11452249
1654 Ga0114129_13492770
1655 Ga0105243_10069901
1656 Ga0105243_10138860
1657 Ga0105243_10897448
1658 Ga0105243_11415040
1659 Ga0105243_11877748
1660 Ga0105241_10044228
1661 Ga0105241_10064908
1662 Ga0105241_11030093
1663 Ga0105241_11270258
1664 Ga0105242_10000877
1665 Ga0105242_10001630
1666 Ga0105242_10014880
1667 Ga0105242_10088227
1668 Ga0105242_10516561
1669 Ga0105242_10798473
1670 Ga0105242_10832954
1671 Ga0105242_10916429
1672 Ga0105242_11021994
1673 Ga0105242_11037657
1674 Ga0105242_11397150
1675 Ga0105242_11492648
1676 Ga0105242_12099727
1677 Ga0105242_12292304
1678 Ga0105248_10008069
1679 Ga0105248_10009184
1680 Ga0105248_10009873
1681 Ga0105248_10071127
1682 Ga0105248_10090434
1683 Ga0105248_10131072
1684 Ga0105248_10143416
1685 Ga0105248_10162179
1686 Ga0105248_10409294
1687 Ga0105248_10936244
1688 Ga0105248_10943290
1689 Ga0105248_10947433
1690 Ga0105248_10978029
1691 Ga0105248_11197113
1692 Ga0105248_11238238
1693 Ga0105248_11441244
1694 Ga0105248_11652182
1695 Ga0105237_11024002
1696 Ga0105237_11048847
1697 Ga0105237_11228199
1698 Ga0105238_10059793
1699 Ga0105238_10996215
1700 Ga0105238_11123611
1701 Ga0105238_11458848
1702 Ga0105249_10141194
1703 Ga0105249_10305988
1704 Ga0105249_10406986
1705 Ga0105249_10777548
1706 Ga0105249_10949482
1707 Ga0105249_11835049
1708 Ga0105249_12955176
1709 Ga0105239_11037762
1710 Ga0105239_11887619
1711 Ga0105239_12647791
1712 Ga0105246_10174622
1713 Ga0105246_11098452
1714 Ga0105246_11804457
1715 Ga0157374_10150465
1716 Ga0157374_11827610
1717 Ga0157374_12695745
1718 Ga0157378_10286942
1719 Ga0157378_10531792
1720 Ga0157378_10812892
1721 Ga0157378_11264968
1722 Ga0157378_11369428
1723 Ga0157378_11651356
1724 Ga0157378_11965293
1725 Ga0157378_12117925
1726 Ga0163162_10012729
1727 Ga0163162_10075961
1728 Ga0163162_10974527
1729 Ga0163162_12424611
1730 Ga0163162_13454081
1731 Ga0157372_11312963
1732 Ga0157375_10054526
1733 Ga0157375_10178852
1734 Ga0157375_10279863
1735 Ga0157375_10324512
1736 Ga0157375_11199460
1737 Ga0157375_11978195
1738 Ga0157375_12663426
1739 Ga0163163_10009838
1740 Ga0163163_10013073
1741 Ga0163163_10021725
1742 Ga0163163_10035979
1743 Ga0163163_10081813
1744 Ga0163163_10343222
1745 Ga0163163_10550154
1746 Ga0163163_10989432
1747 Ga0163163_11270635
1748 Ga0163163_12197664
1749 Ga0157380_10036144
1750 Ga0157380_10083787
1751 Ga0157380_10352333
1752 Ga0157380_10475718
1753 Ga0157380_10602459
1754 Ga0157380_10865483
1755 Ga0157380_11247121
1756 Ga0157380_11783790
1757 Ga0157377_11041413
1758 Ga0157377_11476697
1759 Ga0157379_10011668
1760 Ga0157379_10030703
1761 Ga0157379_10036677
1762 Ga0157379_10038943
1763 Ga0157379_10111018
1764 Ga0157379_10934789
1765 Ga0157379_11879483
1766 Ga0157376_10002406
1767 Ga0157376_10006560
1768 Ga0157376_10055607
1769 Ga0157376_10065847
1770 Ga0157376_10084685
1771 Ga0157376_10203000
1772 Ga0157376_10288322
1773 Ga0157376_10330227
1774 Ga0157376_10467419
1775 Ga0157376_10527513
1776 Ga0157376_11007169
1777 Ga0157376_11585730
1778 Ga0182007_10100067
1779 Ga0182005_1118435
1780 Ga0163161_10107006
1781 Ga0163161_10970160
1782 Ga0163161_11461233
1783 Ga0163161_11648231
1784 Ga0206356_10415914
1785 Ga0213876_10325332
1786 Ga0207697_10074372
1787 Ga0207697_10175307
1788 Ga0207653_10241259
1789 Ga0207682_10014992
1790 Ga0207692_10926331
1791 Ga0207642_10108633
1792 Ga0207642_10286314
1793 Ga0207642_10379912
1794 Ga0207642_10429716
1795 Ga0207642_10450907
1796 Ga0207642_10882570
1797 Ga0207642_11082728
1798 Ga0207710_10010670
1799 Ga0207710_10038913
1800 Ga0207688_10609389
1801 Ga0207680_10066327
1802 Ga0207680_10152686
1803 Ga0207680_10231309
1804 Ga0207680_10301403
1805 Ga0207680_10345083
1806 Ga0207680_10349554
1807 Ga0207680_10685421
1808 Ga0207680_10910902
1809 Ga0207685_10867880
1810 Ga0207699_11123232
1811 Ga0207645_10004347
1812 Ga0207645_10107947
1813 Ga0207645_10318205
1814 Ga0207645_10594717
1815 Ga0207645_11073605
1816 Ga0207645_11122953
1817 Ga0207643_11058554
1818 Ga0207705_10075672
1819 Ga0207684_11272169
1820 Ga0207684_11353778
1821 Ga0207684_11641771
1822 Ga0207654_10072697
1823 Ga0207654_10084416
1824 Ga0207654_10649650
1825 Ga0207707_10012114
1826 Ga0207707_10413653
1827 Ga0207707_10535823
1828 Ga0207695_10123308
1829 Ga0207695_10240339
1830 Ga0207695_10358969
1831 Ga0207671_11422948
1832 Ga0207660_11039666
1833 Ga0207662_10007671
1834 Ga0207662_10049850
1835 Ga0207662_10213139
1836 Ga0207662_11074297
1837 Ga0207657_10004241
1838 Ga0207657_10110433
1839 Ga0207649_10104530
1840 Ga0207652_10188629
1841 Ga0207652_10500662
1842 Ga0207652_11248801
1843 Ga0207646_10028604
1844 Ga0207646_10035347
1845 Ga0207646_10163049
1846 Ga0207646_10226069
1847 Ga0207646_10310824
1848 Ga0207681_10016129
1849 Ga0207681_10046254
1850 Ga0207681_10188803
1851 Ga0207681_10224755
1852 Ga0207681_10424665
1853 Ga0207681_10771157
1854 Ga0207694_10238619
1855 Ga0207650_10051730
1856 Ga0207650_10121003
1857 Ga0207650_10274763
1858 Ga0207650_10299166
1859 Ga0207650_10862035
1860 Ga0207659_10009079
1861 Ga0207659_10145137
1862 Ga0207659_10413582
1863 Ga0207659_10490237
1864 Ga0207659_10678728
1865 Ga0207687_10163790
1866 Ga0207687_10458028
1867 Ga0207687_10628807
1868 Ga0207687_11224907
1869 Ga0207700_10286121
1870 Ga0207664_10374306
1871 Ga0207644_10105113
1872 Ga0207644_10454776
1873 Ga0207690_10237398
1874 Ga0207690_10289636
1875 Ga0207706_10086190
1876 Ga0207706_10689708
1877 Ga0207706_11318325
1878 Ga0207686_10653854
1879 Ga0207686_10836956
1880 Ga0207686_10966996
1881 Ga0207686_11016379
1882 Ga0207686_11050679
1883 Ga0207686_11067162
1884 Ga0207686_11088345
1885 Ga0207686_11530043
1886 Ga0207686_11530365
1887 Ga0207709_10159220
1888 Ga0207709_10179260
1889 Ga0207670_10181034
1890 Ga0207670_10596799
1891 Ga0207670_10730107
1892 Ga0207670_11513299
1893 Ga0207669_10062662
1894 Ga0207669_10235201
1895 Ga0207704_10087834
1896 Ga0207704_10290884
1897 Ga0207704_10644611
1898 Ga0207691_10037678
1899 Ga0207691_10109974
1900 Ga0207691_10115152
1901 Ga0207691_10275983
1902 Ga0207691_10277744
1903 Ga0207691_10730613
1904 Ga0207691_11649070
1905 Ga0207711_10032122
1906 Ga0207711_10079114
1907 Ga0207711_10097866
1908 Ga0207711_10108761
1909 Ga0207711_10247305
1910 Ga0207711_10341187
1911 Ga0207711_10381105
1912 Ga0207711_10400956
1913 Ga0207711_10576718
1914 Ga0207711_10615076
1915 Ga0207711_10722306
1916 Ga0207711_10868253
1917 Ga0207711_11273353
1918 Ga0207689_10130786
1919 Ga0207689_10240381
1920 Ga0207689_10962086
1921 Ga0207689_11110759
1922 Ga0207661_10023782
1923 Ga0207661_10154534
1924 Ga0207661_11092197
1925 Ga0207679_10417844
1926 Ga0207679_10521591
1927 Ga0207679_10665503
1928 Ga0207679_11229299
1929 Ga0207667_10094461
1930 Ga0207667_10728579
1931 Ga0207667_11005254
1932 Ga0207667_11280002
1933 Ga0207667_11559338
1934 Ga0207651_10035486
1935 Ga0207651_10044857
1936 Ga0207651_10220195
1937 Ga0207651_10351786
1938 Ga0207651_10859893
1939 Ga0207651_10920141
1940 Ga0207651_11262230
1941 Ga0207651_11927238
1942 Ga0207651_11952095
1943 Ga0207651_12054760
1944 Ga0207712_10080377
1945 Ga0207712_10345620
1946 Ga0207712_10837948
1947 Ga0207668_10383434
1948 Ga0207668_11270904
1949 Ga0207668_11598533
1950 Ga0207668_12069541
1951 Ga0207640_10029275
1952 Ga0207640_10034330
1953 Ga0207640_10043190
1954 Ga0207640_10634805
1955 Ga0207640_10825746
1956 Ga0207640_10920801
1957 Ga0207640_11927965
1958 Ga0207658_10022090
1959 Ga0207658_10174462
1960 Ga0207658_10650671
1961 Ga0207677_10110808
1962 Ga0207677_10263279
1963 Ga0207677_11224951
1964 Ga0207677_11591727
1965 Ga0207703_10021948
1966 Ga0207703_10031719
1967 Ga0207703_10094284
1968 Ga0207703_10101544
1969 Ga0207703_10105111
1970 Ga0207703_10106964
1971 Ga0207703_10111656
1972 Ga0207703_10205039
1973 Ga0207703_10206246
1974 Ga0207703_10226360
1975 Ga0207703_10416186
1976 Ga0207703_10658795
1977 Ga0207703_10763338
1978 Ga0207703_10934377
1979 Ga0207703_11495744
1980 Ga0207703_11507792
1981 Ga0207703_11549236
1982 Ga0207703_11676268
1983 Ga0207639_10299603
1984 Ga0207639_10587920
1985 Ga0207639_11146553
1986 Ga0207639_11493269
1987 Ga0207678_10147916
1988 Ga0207708_10010921
1989 Ga0207708_10048675
1990 Ga0207708_10303594
1991 Ga0207708_10360136
1992 Ga0207708_11013575
1993 Ga0207708_11013668
1994 Ga0207708_11475172
1995 Ga0207708_11611019
1996 Ga0207702_10284494
1997 Ga0207702_10708561
1998 Ga0207702_11300826
1999 Ga0207641_10025246
2000 Ga0207641_10088599
2001 Ga0207641_10131137
2002 Ga0207641_10209309
2003 Ga0207641_10336598
2004 Ga0207641_10802596
2005 Ga0207641_11217147
2006 Ga0207648_10007047
2007 Ga0207648_10012113
2008 Ga0207648_10026798
2009 Ga0207648_10219126
2010 Ga0207648_10388454
2011 Ga0207648_10646853
2012 Ga0207648_10745485
2013 Ga0207648_10883315
2014 Ga0207648_12208632
2015 Ga0207676_10019436
2016 Ga0207676_10976676
2017 Ga0207676_11082677
2018 Ga0207676_11362883
2019 Ga0207676_12408808
2020 Ga0207674_10142983
2021 Ga0207675_100007173
2022 Ga0207675_100052636
2023 Ga0207675_100185917
2024 Ga0207675_100257248
2025 Ga0207675_100330960
2026 Ga0207675_100350994
2027 Ga0207675_100373488
2028 Ga0207675_100404639
2029 Ga0207675_100710224
2030 Ga0207675_101453355
2031 Ga0207675_101760621
2032 Ga0207683_10149267
2033 Ga0207683_10319010
2034 Ga0207683_10442495
2035 Ga0207683_11179820
2036 Ga0207698_10087119
2037 Ga0207698_10412352
2038 Ga0207698_12097238
2039 Ga0207428_10010365
2040 Ga0207428_10225352
2041 Ga0207428_10442532
2042 Ga0268266_10237264
2043 Ga0268266_10256956
2044 Ga0268266_10347326
2045 Ga0268266_10420946
2046 Ga0268266_10431253
2047 Ga0268266_10896425
2048 Ga0268266_10982710
2049 Ga0268265_10036615
2050 Ga0268265_10150977
2051 Ga0268265_10153918
2052 Ga0268265_10239667
2053 Ga0268265_10502272
2054 Ga0268265_11859515
2055 Ga0268265_11874708
2056 Ga0268264_10100371
2057 Ga0268264_10211052
2058 Ga0268264_10665450
2059 Ga0268264_11246803
2060 Ga0268264_11277293
2061 Ga0268264_11743294
2062 Ga0268264_11795762
2063 Ga0268264_12271767
2064 Ga0265322_10151321
2065 Ga0265336_10201651
2066 Ga0265771_1027625
2067 Ga0265320_10152775
2068 Ga0265316_10447417
2069 Ga0307408_100184767
2070 Ga0307408_100868768
2071 Ga0307410_10617428
2072 Ga0307410_11938868
2073 Ga0307412_10917454
2074 Ga0307412_11618237
2075 Ga0307416_100466964
2076 Ga0307416_100921062
2077 Ga0307416_102586457
2078 Ga0307416_102914928
2079 Ga0307416_103173529
2080 Ga0373930_0028688
2081 Ga0373948_0002730
2082 Ga0373950_0017571
2083 Ga0373958_0011434
2084 Ga0373959_0011124
2085 Ga0373938_0012616
2086 Ga0373928_0009559
2087 Ga0373929_0023622
2088 Ga0373940_0095161
2089 Ga0373944_0003264
2090 Ga0373949_0004437
2091 Ga0373949_0016243
2092 Ga0373951_0080233
2093 Ga0373952_0002927
2094 Ga0373952_0164882
2095 Ga0373923_0483427
2096 Ga0373932_0001360
2097 Ga0373932_0361710
2098 Ga0373936_0277992
2099 Ga0373939_0091781
2100 Ga0373941_0012551
2101 Ga0373941_0014609
2102 Ga0373941_0198198
2103 Ga0373953_0069485
2104 Ga0373953_0236455
2105 Ga0373953_0347275
2106 Ga0373954_0614911
2107 Ga0373954_0647021
2108 Ga0373957_0089984
2109 Ga0373960_0039195
2110 Ga0373943_0117213
2111 Ga0373943_0328683
2112 Ga0373946_0291760
2113 Ga0373955_0329458
2114 Ga0373942_0002582
2115 Ga0373961_0007661
2116 Ga0373961_0128308
2117 Ga0373961_0134841
2118 Ga0373962_0013114
2119 Ga0373924_0096641
2120 Ga0373931_0117980
2121 Ga0373931_0172492
2122 Ga0373931_0853390
2123 Ga0373935_0328445
2124 Ga0373935_0409480
2125 Ga0373935_1096061
2126 Ga0373927_0211748
2127 Ga0373927_0216335
2128 Ga0373947_0319070
2129 Ga0373947_0577107
2130 Ga0373937_0116672
2131 Ga0373937_0129226
2132 Ga0373937_0275966
2133 Ga0373937_0653847
2134 Ga0373937_1068883
2135 Ga0373925_0111048
2136 Ga0373925_0132918
2137 Ga0373925_0160596
2138 Ga0395900_0417670
2139 Ga0395898_0674429
2140 Ga0395898_0767835
2141 Ga0395905_0691623
2142 Ga0395901_1734855
2143 Ga0436365_0197130
2144 Ga0436365_1724930
2145 Ga0436361_0069171
2146 Ga0436363_0503056
2147 Ga0436362_0855640
2148 Ga0451807_1892845
2149 Ga0451853_1242347
2150 Ga0451853_2105717
2151 Ga0450891_024626
2152 Ga0450896_095364
2153 Ga0439446_0128646
2154 Ga0439435_0033483
2155 Ga0439459_0121000
2156 Ga0439464_0110625
2157 Ga0450916_020492
2158 Ga0453683_0352287
2159 Ga0466963_0055226
2160 Ga0466963_0855423
2161 Ga0451576_0086105
2162 Ga0451576_0367360
2163 Ga0451576_1142879
2164 Ga0451576_1173086
2165 Ga0451576_1949051
2166 Ga0466967_0213772
2167 Ga0466967_0485347
2168 Ga0466967_0706999
2169 Ga0466967_1485525
2170 Ga0466967_2031255
2171 Ga0495592_0212037
2172 Ga0495592_0798459
2173 Ga0495603_0053507
2174 Ga0495603_0275523
2175 Ga0495629_0141224
2176 Ga0495629_0201505
2177 Ga0495629_0393910
2178 Ga0495651_0068778
2179 Ga0495653_0841465
2180 Ga0495580_0128680
2181 Ga0495580_0712047
2182 Ga0495582_0272356
2183 Ga0495582_0366485
2184 Ga0495582_0884084
2185 Ga0495639_0011745
2186 Ga0495639_0180415
2187 Ga0495639_0683958
2188 Ga0495662_0099528
2189 Ga0495662_0212932
2190 Ga0495584_0524094
2191 Ga0495594_0353529
2192 Ga0495594_0888065
2193 Ga0495607_0221919
2194 Ga0495610_0194124
2195 Ga0495618_0192533
2196 Ga0495628_0091525
2197 Ga0495630_0136938
2198 Ga0495630_0559749
2199 Ga0495640_0077252
2200 Ga0495640_0350776
2201 Ga0495640_0422378
2202 Ga0495640_0500004
2203 Ga0495586_0072928
2204 Ga0495645_0126732
2205 Ga0495645_0287393
2206 Ga0495667_0734141
2207 Ga0495656_0186367
2208 Ga0495656_0420394
2209 Ga0495635_0028691
2210 Ga0495635_0333202
2211 Ga0495635_1092196
2212 Ga0495659_0272260
2213 Ga0495599_0094860
2214 Ga0495647_0031853
2215 Ga0495647_0138522
2216 Ga0495658_0140406
2217 Ga0495658_0280006
2218 Ga0495658_0437594
2219 Ga0495658_0509504
2220 Ga0495669_0114849
2221 Ga0495613_0217845
2222 Ga0495600_0562420
2223 Ga0495600_0817358
2224 Ga0495604_0617498
2225 Ga0495674_0906897
2226 Ga0495674_1110353
2227 Ga0495674_1124399
2228 Ga0495676_0394654
2229 Ga0495680_0773677
2230 Ga0495684_0021529
2231 Ga0495684_0071339
2232 Ga0495684_0361135
2233 Ga0495684_0591472
2234 Ga0495686_0218058
2235 Ga0495593_0147796
2236 Ga0495614_0464556
2237 Ga0495614_0580637
2238 Ga0496100_0020242
2239 Ga0496100_0747568
2240 Ga0496100_1679614
2241 Ga0496101_0000348
2242 Ga0496101_0476238
2243 Ga0496101_0548491
2244 Ga0496101_0893788
2245 Ga0496101_1504688
2246 Ga0496102_0072157
2247 Ga0496102_0306671
2248 Ga0496102_0312704
2249 Ga0496102_0872958
2250 Ga0496104_0054625
2251 Ga0496104_0420362
2252 Ga0496104_0643326
2253 Ga0496104_0689111
2254 Ga0496104_0737513
2255 Ga0496105_0054031
2256 Ga0496105_0097741
2257 Ga0496105_0808876
2258 Ga0496105_0913151
2259 Ga0496106_0163315
2260 Ga0496106_0223923
2261 Ga0496106_0385092
2262 Ga0496108_0007098
2263 Ga0496108_0275187
2264 Ga0496108_1098962
2265 Ga0496108_1161853
2266 Ga0496109_0321166
2267 Ga0496109_0321875
2268 Ga0496110_0110599
2269 Ga0496110_0555100
2270 Ga0496111_0524964
2271 Ga0496112_0023415
2272 Ga0496112_0315191
2273 Ga0496112_0323385
2274 Ga0496112_0334776
2275 Ga0496112_0429666
2276 Ga0496113_0007138
2277 Ga0496114_0011233
2278 Ga0496114_0037578
2279 Ga0496114_0065054
2280 Ga0496114_0193950
2281 Ga0496114_0294653
2282 Ga0496114_0817539
2283 Ga0496115_0017231
2284 Ga0496115_0040457
2285 Ga0501034_0037699
2286 Ga0501034_0149031
2287 Ga0501041_0936668
2288 Ga0501047_0018175
2289 Ga0501047_0086203
2290 Ga0501048_0465587
2291 Ga0501048_0494413
2292 Ga0501070_0840398
2293 Ga0501072_0337534
2294 Ga0501073_0228692
2295 Ga0501073_0322842
2296 Ga0501076_0598340
2297 Ga0501076_1524472
2298 Ga0501201_054882
2299 Ga0501216_042583
2300 Ga0501257_099414
2301 Ga0501261_053002
2302 Ga0501079_0479195
2303 Ga0501263_022499
2304 Ga0501044_0004635
2305 Ga0501045_1024487
2306 nmdc:mga05p37_2105_c1
2307 nmdc:mga05p37_223977_c1
2308 nmdc:mga05p37_29228_c1
2309 nmdc:mga05p37_332650_c1
2310 nmdc:mga05p37_358936_c1
2311 nmdc:mga05p37_416644_c1
2312 nmdc:mga05p37_44060_c1
2313 nmdc:mga05p37_62142_c1
2314 nmdc:mga05p37_691873_c1
2315 nmdc:mga05p37_7600_c1
2316 nmdc:mga05p37_84595_c1
2317 nmdc:mga0qj67_882563_c1
2318 nmdc:mga06r32_441844_c1
2319 nmdc:mga06r32_48359_c1
2320 nmdc:mga08y16_1639061_c1
2321 nmdc:mga08y16_284927_c1
2322 nmdc:mga08y16_402010_c1
2323 nmdc:mga08y16_429206_c1
2324 nmdc:mga08y16_4349_c1
2325 nmdc:mga08y16_565010_c1
2326 nmdc:mga08y16_804039_c1
2327 nmdc:mga0n895_1083963_c1
2328 nmdc:mga0n895_1693113_c1
2329 nmdc:mga0n895_191606_c1
2330 nmdc:mga0n895_200139_c1
2331 nmdc:mga0n895_2046809_c1
2332 nmdc:mga0n895_2075893_c1
2333 nmdc:mga0n895_40711_c1
2334 nmdc:mga0n895_607961_c1
2335 nmdc:mga0n895_66934_c1
2336 nmdc:mga0n895_69126_c1
2337 nmdc:mga0n895_71938_c1
2338 nmdc:mga0n895_97_c2
2339 nmdc:mga0rr50_180008_c1
2340 nmdc:mga0rr50_20_c1
2341 nmdc:mga0rr50_224390_c1
2342 nmdc:mga0rr50_277164_c1
2343 nmdc:mga0rr50_287280_c1
2344 nmdc:mga0rr50_345089_c1
2345 nmdc:mga0rr50_61796_c1
2346 nmdc:mga0rr50_664142_c1
2347 nmdc:mga08x19_1319352_c1
2348 nmdc:mga08x19_14907_c1
2349 nmdc:mga08x19_178_c1
2350 nmdc:mga08x19_333139_c1
2351 nmdc:mga08x19_498286_c1
2352 nmdc:mga08x19_70817_c1
2353 nmdc:mga0a205_107805_c1
2354 nmdc:mga0a205_1336740_c1
2355 nmdc:mga0a205_136460_c1
2356 nmdc:mga0a205_144648_c1
2357 nmdc:mga0a205_52004_c1
2358 nmdc:mga0a205_747048_c1
2359 nmdc:mga0a205_91397_c1
2360 nmdc:mga0a205_991722_c1
2361 Ga0495601_0906044
2362 Ga0495619_0029921
2363 Ga0495619_0072564
2364 Ga0495619_0084323
2365 Ga0501084_0485533
2366 Ga0501084_0742378
2367 Ga0530510_0624247
2368 Ga0530510_1466073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oht-assembly2.cif.gz_C structure of ebp and u18666a 0.7109 21 89
6he3-assembly1.cif.gz_A pseudomonas aeruginosa seryl-trna synthetase in complex with 5'-o-(n-(l-seryl)-sulfamoyl)cytidine 0.7007 13 88
4p3f-assembly1.cif.gz_A structure of the human srp68-rbd 0.6563 2 85
7nkh-assembly1.cif.gz_G mycobacterium smegmatis atp synthase f1 state 2 0.6485 22 88
8hfc-assembly1.cif.gz_A cryo-em structure of yeast erf2/erf4 complex 0.6462 15 84
ID Description Score Start End Superfamily
af_E7F3Z9_254_410_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.8199 22 80 1.20.58.390
af_Q497B3_19_206_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7421 22 89 1.20.140.150
af_Q55F44_2_187_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7356 22 87 1.20.1070.10
3zbhB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.7256 22 89 1.10.287.1060
af_I1J919_66_371_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7217 5 86 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V8F3K2-F1-model_v4 HEPN domain-containing protein 0.8854 1 87
AF-A0A2V8F3K2-F1-model_v4 HEPN domain-containing protein 0.8665 1 87
AF-A0A6L4Z292-F1-model_v4 HEPN domain-containing protein 0.8578 2 87
AF-A0A2U3K856-F1-model_v4 Uncharacterized protein 0.8471 4 85
AF-A0A5E8B7L6-F1-model_v4 Uncharacterized protein 0.8177 22 88

Map