F491328

General Info

Members Datasets Scaffolds Average Seq Length
1182 614 1003 112

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2824653114|2824656974
Length 122
Sequence RCADPELSMTTSDTAVPEPTPEQAALFARVRRMMLIAGLTTALAICAVLIAVGYRLFKSEGRAVEAAGDVTATLPKGAKIVATGVAGDRLVVTLDVGGVIEIRTFDAHSLKPAGKLKFANEP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
22 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
23 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
24 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
25 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
26 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
27 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
28 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
29 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
30 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
31 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
32 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
33 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
34 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
35 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
36 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
37 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
38 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
39 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
53 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
58 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
59 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
60 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
61 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
62 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
63 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
64 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
65 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
66 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
72 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
73 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
74 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
75 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
76 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
77 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
78 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
79 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
80 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
81 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
82 2922368715
83 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
84 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
85 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
86 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
87 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
88 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
89 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
90 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
91 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
92 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
93 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
94 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
95 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
96 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
97 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
98 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
99 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
100 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
101 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
102 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
103 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
104 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
105 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
106 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
107 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
108 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
109 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
110 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
111 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
112 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
113 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
114 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
115 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
116 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
117 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
118 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
119 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
120 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
121 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
122 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
123 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
124 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
125 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
126 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
127 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
128 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
129 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
130 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
131 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
132 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
133 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
134 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
135 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
136 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
137 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
138 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
139 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
140 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
141 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
142 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
143 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
144 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
145 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
146 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
147 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
148 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
149 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
150 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
151 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
152 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
153 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
154 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
157 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
158 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
159 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
160 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
161 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
164 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
165 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
166 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
167 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
168 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
169 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
170 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
171 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
172 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
173 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
174 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
175 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
176 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
177 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
178 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
179 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
180 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
181 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
182 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
183 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
184 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
185 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
186 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
187 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
188 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
189 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
190 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
191 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
192 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
193 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
194 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
198 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
199 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
200 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
201 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
202 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
203 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
204 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
205 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
206 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
207 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
208 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
209 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
210 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
211 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
212 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
213 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
214 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
215 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
216 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
217 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
218 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
219 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
220 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
221 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
222 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
223 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
224 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
225 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
226 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
227 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
228 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
229 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
231 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
232 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
233 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
234 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
235 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
236 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
237 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
238 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
239 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
240 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
241 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
242 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
243 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
244 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
245 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
246 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
247 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
248 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
249 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
250 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
251 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
252 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
253 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
254 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
255 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
256 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
259 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
260 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
261 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
265 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
266 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
267 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
268 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
269 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
270 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
271 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
330 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
331 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
332 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
333 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
337 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
339 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
340 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
341 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
342 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
343 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
344 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
345 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
346 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
347 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
350 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
351 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
352 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
353 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
354 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
355 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
356 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
357 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
358 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
359 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
360 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
361 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
362 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
363 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
364 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
365 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
366 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
367 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
368 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
369 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
370 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
371 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
372 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
373 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
374 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
375 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
376 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
377 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
378 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
379 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
380 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
381 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
382 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
383 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
384 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
385 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
386 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
387 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
388 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
389 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
390 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
391 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
392 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
393 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
394 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
395 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
396 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
397 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
398 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
399 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
400 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
403 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
404 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
405 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
406 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
407 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
408 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
409 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
410 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
411 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
412 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
413 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
414 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
415 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
416 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
417 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
418 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
419 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
420 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
421 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
422 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
423 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
424 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
425 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
426 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
427 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
428 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
432 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
433 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
434 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
435 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
436 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
437 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
438 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
439 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
440 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
441 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
442 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
443 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
444 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
445 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
446 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
447 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
448 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
449 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
450 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
451 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
452 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
453 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
454 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
455 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
456 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
457 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
458 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
459 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
460 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
461 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
462 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
463 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
464 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
465 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
468 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
469 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
470 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
471 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
472 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
473 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
474 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
475 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
476 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
477 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
478 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
479 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
480 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
481 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
482 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
483 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
484 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
485 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
486 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
487 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
488 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
489 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
490 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
491 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
492 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
497 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
508 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
509 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
510 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
511 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
512 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
513 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
514 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
515 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
516 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
517 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
518 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
519 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
522 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
523 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
524 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
525 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
526 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
527 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
528 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
529 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
530 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
531 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
532 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
533 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
534 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
535 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
536 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
537 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
538 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
539 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
540 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
541 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
542 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
543 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
544 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
545 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
546 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
547 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
548 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
549 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
550 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
551 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
552 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
553 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
554 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
555 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
556 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
557 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
558 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
559 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
560 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
561 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
562 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
563 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
564 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
565 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
566 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
567 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
568 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
569 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
570 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
571 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
572 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
573 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
574 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
575 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
576 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
577 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
578 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
579 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
580 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
581 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
582 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
583 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
584 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
585 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
586 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
587 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
588 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
589 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
590 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
591 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
592 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
593 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
594 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
595 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
596 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
597 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
598 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
599 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
600 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
601 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
602 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
603 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
604 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
605 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
606 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
607 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
608 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
609 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
610 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
611 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
612 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
613 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
614 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.67
Metatranscriptomes 0.25
Isolates 15.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.93
Nodule 12.1
Rhizoplane 4.82
Rhizosphere 61
Stem 0
Stem Tuber 0
Unclassified 10.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1029370 3300001904 Bacteria 851
2 JGI24738J21930_10064151 3300002075 Bacteria 756
3 JGI25165J46597_1010336 3300003214 Bacteria 1365
4 JGI25165J46597_1010389 3300003214 Bacteria 1359
5 JGI25153J46596_10003375 3300003215 Bacteria 8960
6 JGI25153J46596_10011101 3300003215 Bacteria 4009
7 JGI25153J46596_10030143 3300003215 Bacteria 1851
8 rootH1_10110488 3300003323 Bacteria 1247
9 JGI25160J50197_1000799 3300003354 Bacteria 16961
10 JGI25160J50197_1014275 3300003354 Bacteria 2664
11 JGI25160J50197_1059286 3300003354 Bacteria 772
12 Ga0055539_1003625 3300003752 Bacteria 2136
13 Ga0055542_1028475 3300003762 Bacteria 735
14 Ga0055531_10008098 3300003794 Bacteria 5606
15 Ga0055531_10077245 3300003794 Bacteria 746
16 Ga0055543_1005956 3300004625 Bacteria 3029
17 Ga0065165_1002396 3300005262 Bacteria 16025
18 Ga0065165_1048792 3300005262 Bacteria 1213
19 Ga0065165_1053054 3300005262 Bacteria 1142
20 Ga0070658_10285892 3300005327 Bacteria 1404
21 Ga0070658_10619279 3300005327 Bacteria 939
22 Ga0070683_100419537 3300005329 Bacteria 1276
23 Ga0070683_100579330 3300005329 Bacteria 1073
24 Ga0070670_100736618 3300005331 Bacteria 888
25 Ga0070670_101179362 3300005331 Bacteria 700
26 Ga0070680_100057264 3300005336 Bacteria 3186
27 Ga0070680_100115737 3300005336 Bacteria 2234
28 Ga0070680_101094715 3300005336 Bacteria 689
29 Ga0070682_100587075 3300005337 Bacteria 877
30 Ga0068868_100433198 3300005338 Bacteria 1140
31 Ga0070660_100154366 3300005339 Bacteria 1847
32 Ga0070660_100196432 3300005339 Bacteria 1636
33 Ga0070660_101177188 3300005339 Bacteria 650
34 Ga0070691_10102109 3300005341 Bacteria 1426
35 Ga0070661_100157560 3300005344 Bacteria 1718
36 Ga0070661_100545210 3300005344 Bacteria 932
37 Ga0070661_100737911 3300005344 Bacteria 804
38 Ga0070692_11231595 3300005345 Bacteria 534
39 Ga0070668_100740209 3300005347 Bacteria 869
40 Ga0070671_100439394 3300005355 Bacteria 1119
41 Ga0070674_100770028 3300005356 Bacteria 829
42 Ga0070674_101691114 3300005356 Bacteria 572
43 Ga0070674_101930053 3300005356 Bacteria 537
44 Ga0070659_100224942 3300005366 Bacteria 1550
45 Ga0070659_100729093 3300005366 Bacteria 859
46 Ga0070709_10000143 3300005434 Bacteria 47770
47 Ga0070709_10003192 3300005434 Bacteria 8797
48 Ga0070709_10061173 3300005434 Bacteria 2396
49 Ga0070709_10788805 3300005434 Bacteria 745
50 Ga0070709_10896823 3300005434 Bacteria 701
51 Ga0070714_100021066 3300005435 Bacteria 5330
52 Ga0070714_100043580 3300005435 Bacteria 3795
53 Ga0070714_100464531 3300005435 Bacteria 1203
54 Ga0070714_101754616 3300005435 Bacteria 606
55 Ga0070713_100002045 3300005436 Bacteria 13034
56 Ga0070713_100009055 3300005436 Bacteria 7100
57 Ga0070713_100039395 3300005436 Bacteria 3835
58 Ga0070713_100151725 3300005436 Bacteria 2062
59 Ga0070713_100168645 3300005436 Bacteria 1960
60 Ga0070713_100204529 3300005436 Bacteria 1785
61 Ga0070710_10003824 3300005437 Bacteria 7115
62 Ga0070710_10127757 3300005437 Bacteria 1546
63 Ga0070710_10801804 3300005437 Bacteria 673
64 Ga0070710_11365781 3300005437 Bacteria 529
65 Ga0070711_100107157 3300005439 Bacteria 2045
66 Ga0070711_100127365 3300005439 Bacteria 1892
67 Ga0070711_100230263 3300005439 Bacteria 1444
68 Ga0070711_100415078 3300005439 Bacteria 1095
69 Ga0070711_101764233 3300005439 Bacteria 543
70 Ga0070663_100102169 3300005455 Bacteria 2141
71 Ga0070663_100294724 3300005455 Bacteria 1296
72 Ga0070663_100544314 3300005455 Bacteria 969
73 Ga0070663_101188199 3300005455 Bacteria 670
74 Ga0070678_100500507 3300005456 Bacteria 1072
75 Ga0070678_100614595 3300005456 Bacteria 971
76 Ga0070681_10189005 3300005458 Bacteria 1979
77 Ga0070681_10319858 3300005458 Bacteria 1461
78 Ga0070681_10543503 3300005458 Bacteria 1075
79 Ga0070681_10607161 3300005458 Bacteria 1008
80 Ga0070681_10897494 3300005458 Bacteria 805
81 Ga0068867_100403919 3300005459 Bacteria 1153
82 Ga0070685_10858470 3300005466 Bacteria 673
83 Ga0070706_101333660 3300005467 Bacteria 658
84 Ga0070706_101865351 3300005467 Bacteria 546
85 Ga0070698_101352577 3300005471 Bacteria 663
86 Ga0070679_100100050 3300005530 Bacteria 2886
87 Ga0070679_100135371 3300005530 Bacteria 2445
88 Ga0070679_100241550 3300005530 Bacteria 1763
89 Ga0070684_100174595 3300005535 Bacteria 1952
90 Ga0070684_100772185 3300005535 Bacteria 898
91 Ga0070697_100143823 3300005536 Bacteria 2007
92 Ga0068853_100597861 3300005539 Bacteria 1047
93 Ga0068853_100806856 3300005539 Bacteria 899
94 Ga0068853_101142511 3300005539 Bacteria 751
95 Ga0070695_100789063 3300005545 Bacteria 760
96 Ga0070696_101675678 3300005546 Bacteria 548
97 Ga0070693_100036361 3300005547 Bacteria 2737
98 Ga0070693_100789984 3300005547 Bacteria 703
99 Ga0070693_100999916 3300005547 Bacteria 632
100 Ga0070665_100097042 3300005548 Bacteria 2952
101 Ga0070665_100170533 3300005548 Bacteria 2177
102 Ga0070665_101277442 3300005548 Bacteria 744
103 Ga0068855_100092442 3300005563 Bacteria 3489
104 Ga0068855_100373210 3300005563 Bacteria 1567
105 Ga0068855_100766770 3300005563 Bacteria 1027
106 Ga0068855_100982715 3300005563 Bacteria 888
107 Ga0068855_101990740 3300005563 Bacteria 587
108 Ga0070664_101297307 3300005564 Bacteria 687
109 Ga0068857_100007213 3300005577 Bacteria 9571
110 Ga0068857_100456149 3300005577 Bacteria 1196
111 Ga0068857_100491713 3300005577 Bacteria 1150
112 Ga0068857_101519794 3300005577 Bacteria 653
113 Ga0068854_100302366 3300005578 Bacteria 1295
114 Ga0068854_101028884 3300005578 Bacteria 731
115 Ga0068854_101275018 3300005578 Bacteria 661
116 Ga0068856_100020597 3300005614 Bacteria 6407
117 Ga0068856_100188639 3300005614 Bacteria 2075
118 Ga0068856_102312137 3300005614 Bacteria 546
119 Ga0070702_100898400 3300005615 Bacteria 693
120 Ga0070702_100976847 3300005615 Bacteria 669
121 Ga0068852_100115685 3300005616 Bacteria 2445
122 Ga0068852_100115767 3300005616 Bacteria 2444
123 Ga0068852_100650407 3300005616 Bacteria 1062
124 Ga0068852_102516539 3300005616 Bacteria 535
125 Ga0068859_100702615 3300005617 Bacteria 1102
126 Ga0068864_100284359 3300005618 Bacteria 1545
127 Ga0068864_100289255 3300005618 Bacteria 1532
128 Ga0068861_100203197 3300005719 Bacteria 1664
129 Ga0068851_10006319 3300005834 Bacteria 5405
130 Ga0068851_10528203 3300005834 Bacteria 711
131 Ga0068851_10548057 3300005834 Bacteria 699
132 Ga0068863_100333957 3300005841 Bacteria 1474
133 Ga0068858_100207113 3300005842 Bacteria 1855
134 Ga0068858_100327572 3300005842 Bacteria 1465
135 Ga0068858_100350618 3300005842 Bacteria 1414
136 Ga0068858_100493513 3300005842 Bacteria 1182
137 Ga0068858_100663562 3300005842 Bacteria 1014
138 Ga0068860_100000217 3300005843 Bacteria 90245
139 Ga0068860_100641480 3300005843 Bacteria 1070
140 Ga0068860_100726539 3300005843 Bacteria 1004
141 Ga0068862_100807042 3300005844 Bacteria 917
142 Ga0081455_10001626 3300005937 Bacteria 27421
143 Ga0081455_10113701 3300005937 Bacteria 2146
144 Ga0081540_1209013 3300005983 Bacteria 703
145 Ga0070717_10070944 3300006028 Bacteria 2904
146 Ga0070717_10140806 3300006028 Bacteria 2080
147 Ga0070717_10156821 3300006028 Bacteria 1972
148 Ga0070717_11019647 3300006028 Bacteria 754
149 Ga0070717_11045830 3300006028 Bacteria 744
150 Ga0070717_11210540 3300006028 Bacteria 687
151 Ga0075365_10198537 3300006038 Bacteria 1405
152 Ga0075365_10245977 3300006038 Bacteria 1256
153 Ga0075368_10020458 3300006042 Bacteria 2507
154 Ga0075363_100044320 3300006048 Bacteria 2356
155 Ga0075364_10183530 3300006051 Bacteria 1416
156 Ga0075364_10524594 3300006051 Bacteria 810
157 Ga0070715_10001767 3300006163 Bacteria 6432
158 Ga0070715_10002320 3300006163 Bacteria 5809
159 Ga0070716_100015839 3300006173 Bacteria 3883
160 Ga0070716_100083540 3300006173 Bacteria 1913
161 Ga0070716_100273398 3300006173 Bacteria 1162
162 Ga0070712_100287940 3300006175 Bacteria 1325
163 Ga0070712_100481674 3300006175 Bacteria 1037
164 Ga0070712_100593392 3300006175 Bacteria 937
165 Ga0070712_100705105 3300006175 Bacteria 861
166 Ga0075362_10185477 3300006177 Bacteria 1009
167 Ga0075369_10006412 3300006186 Bacteria 4445
168 Ga0075369_10060642 3300006186 Bacteria 1650
169 Ga0075369_10115845 3300006186 Bacteria 1210
170 Ga0075366_10104549 3300006195 Bacteria 1701
171 Ga0075366_10979134 3300006195 Bacteria 527
172 Ga0097621_100100941 3300006237 Bacteria 2428
173 Ga0097621_100510822 3300006237 Bacteria 1089
174 Ga0097621_100816059 3300006237 Bacteria 865
175 Ga0075370_10941610 3300006353 Bacteria 528
176 Ga0068871_100590150 3300006358 Bacteria 1009
177 Ga0068871_100814064 3300006358 Bacteria 862
178 Ga0068871_101293409 3300006358 Bacteria 686
179 Ga0075434_101573331 3300006871 Bacteria 666
180 Ga0068865_100990364 3300006881 Bacteria 736
181 Ga0075436_100579168 3300006914 Bacteria 826
182 Ga0097620_100702529 3300006931 Bacteria 1102
183 Ga0099824_1008631 3300006942 Bacteria 12955
184 Ga0075435_100340144 3300007076 Bacteria 1286
185 Ga0099794_10718968 3300007265 Bacteria 532
186 Ga0099795_10005381 3300007788 Bacteria 3398
187 Ga0099795_10025396 3300007788 Bacteria 1987
188 Ga0099795_10177057 3300007788 Bacteria 889
189 Ga0099795_10224741 3300007788 Bacteria 800
190 Ga0105251_10170095 3300009011 Bacteria 982
191 Ga0105240_10002281 3300009093 Bacteria 31075
192 Ga0105240_10006402 3300009093 Bacteria 17307
193 Ga0105240_10007359 3300009093 Bacteria 16017
194 Ga0105240_10069586 3300009093 Bacteria 4355
195 Ga0105240_10215009 3300009093 Bacteria 2243
196 Ga0105240_10722385 3300009093 Bacteria 1085
197 Ga0105245_10731922 3300009098 Bacteria 1024
198 Ga0105245_11154132 3300009098 Bacteria 822
199 Ga0105245_12288876 3300009098 Bacteria 594
200 Ga0105247_10006054 3300009101 Bacteria 7524
201 Ga0105247_10025451 3300009101 Bacteria 3569
202 Ga0105247_10081822 3300009101 Bacteria 2037
203 Ga0105247_11650762 3300009101 Bacteria 528
204 Ga0105243_10078436 3300009148 Bacteria 2689
205 Ga0105241_10000387 3300009174 Bacteria 33305
206 Ga0105241_10029931 3300009174 Bacteria 4066
207 Ga0105241_10357468 3300009174 Bacteria 1270
208 Ga0105241_10363687 3300009174 Bacteria 1259
209 Ga0105242_10925838 3300009176 Bacteria 874
210 Ga0105248_10425987 3300009177 Bacteria 1494
211 Ga0105248_11124666 3300009177 Bacteria 888
212 Ga0105237_10032208 3300009545 Bacteria 5309
213 Ga0105237_10036037 3300009545 Bacteria 5005
214 Ga0105237_10045417 3300009545 Bacteria 4421
215 Ga0105237_10053783 3300009545 Bacteria 4037
216 Ga0105237_10182076 3300009545 Bacteria 2101
217 Ga0105237_10225019 3300009545 Bacteria 1876
218 Ga0105237_10314522 3300009545 Bacteria 1569
219 Ga0105237_10357531 3300009545 Bacteria 1465
220 Ga0105237_10775472 3300009545 Bacteria 965
221 Ga0105238_10017279 3300009551 Bacteria 7329
222 Ga0105238_10071566 3300009551 Bacteria 3465
223 Ga0105238_10266889 3300009551 Bacteria 1692
224 Ga0105238_10661043 3300009551 Bacteria 1055
225 Ga0105238_10826177 3300009551 Bacteria 943
226 Ga0105238_10830796 3300009551 Bacteria 940
227 Ga0105238_11305842 3300009551 Bacteria 751
228 Ga0105238_11799722 3300009551 Bacteria 644
229 Ga0105249_12920968 3300009553 Bacteria 549
230 Ga0099796_10008671 3300010159 Bacteria 2718
231 Ga0099796_10032297 3300010159 Bacteria 1714
232 Ga0099796_10134752 3300010159 Bacteria 961
233 Ga0099796_10255034 3300010159 Bacteria 730
234 Ga0105239_10010998 3300010375 Bacteria 10102
235 Ga0105239_10018870 3300010375 Bacteria 7620
236 Ga0105239_10053182 3300010375 Bacteria 4442
237 Ga0105239_10055799 3300010375 Bacteria 4333
238 Ga0105239_10277385 3300010375 Bacteria 1887
239 Ga0105239_10289336 3300010375 Bacteria 1845
240 Ga0105239_10612230 3300010375 Bacteria 1243
241 Ga0105239_11532551 3300010375 Bacteria 770
242 Ga0105239_11886933 3300010375 Bacteria 693
243 Ga0105239_12631672 3300010375 Bacteria 587
244 Ga0105246_10007034 3300011119 Bacteria 6886
245 Ga0157313_1015514 3300012503 Bacteria 717
246 Ga0157373_10386352 3300013100 Bacteria 1002
247 Ga0157373_10758192 3300013100 Bacteria 714
248 Ga0157371_10163667 3300013102 Bacteria 1589
249 Ga0157370_10113453 3300013104 Bacteria 2533
250 Ga0157370_10208177 3300013104 Bacteria 1813
251 Ga0157370_10918416 3300013104 Bacteria 794
252 Ga0157369_10017915 3300013105 Bacteria 7950
253 Ga0157369_10076750 3300013105 Bacteria 3582
254 Ga0157369_10333113 3300013105 Bacteria 1577
255 Ga0157374_10199234 3300013296 Bacteria 1960
256 Ga0157374_11659942 3300013296 Bacteria 663
257 Ga0157378_11066198 3300013297 Bacteria 844
258 Ga0157378_11179419 3300013297 Bacteria 805
259 Ga0157378_11888699 3300013297 Bacteria 646
260 Ga0157378_12140132 3300013297 Bacteria 610
261 Ga0163162_11262114 3300013306 Bacteria 839
262 Ga0163162_12733162 3300013306 Bacteria 568
263 Ga0157372_10011343 3300013307 Bacteria 9478
264 Ga0157372_10216613 3300013307 Bacteria 2219
265 Ga0157372_12474379 3300013307 Bacteria 596
266 Ga0157375_10241813 3300013308 Bacteria 1965
267 Ga0157375_12953067 3300013308 Bacteria 568
268 Ga0182008_10333335 3300014497 Bacteria 801
269 Ga0157379_10625262 3300014968 Bacteria 1007
270 Ga0157379_12114810 3300014968 Bacteria 558
271 Ga0157376_10286400 3300014969 Bacteria 1554
272 Ga0157376_11447165 3300014969 Bacteria 719
273 Ga0182006_1315673 3300015261 Bacteria 513
274 Ga0163161_10298666 3300017792 Bacteria 1268
275 Ga0206356_11596629 3300020070 Bacteria 1315
276 Ga0214544_1000163 3300021320 Bacteria 101631
277 Ga0214542_1000156 3300021321 Bacteria 101631
278 Ga0214545_1000078 3300021324 Bacteria 101631
279 Ga0214543_1000136 3300021327 Bacteria 101629
280 Ga0213874_10064245 3300021377 Bacteria 1157
281 Ga0213876_10001030 3300021384 Bacteria 17995
282 Ga0213876_10058650 3300021384 Bacteria 2032
283 Ga0213875_10458362 3300021388 Bacteria 611
284 Ga0209563_102445 3300025230 Bacteria 4204
285 Ga0209677_102384 3300025253 Bacteria 7162
286 Ga0209148_1000333 3300025254 Bacteria 64490
287 Ga0209233_1000526 3300025261 Bacteria 22038
288 Ga0209233_1046951 3300025261 Bacteria 900
289 Ga0209455_1003625 3300025272 Bacteria 5373
290 Ga0209673_1008762 3300025273 Bacteria 4463
291 Ga0209564_1002609 3300025295 Bacteria 13780
292 Ga0209564_1028827 3300025295 Bacteria 1763
293 Ga0209758_1000109 3300025297 Bacteria 214759
294 Ga0209758_1000416 3300025297 Bacteria 72312
295 Ga0209758_1001062 3300025297 Bacteria 35786
296 Ga0209758_1006263 3300025297 Bacteria 8660
297 Ga0209758_1006913 3300025297 Bacteria 7921
298 Ga0209758_1038250 3300025297 Bacteria 1842
299 Ga0209758_1068444 3300025297 Bacteria 1130
300 Ga0209256_1019931 3300025299 Bacteria 2114
301 Ga0207426_1000522 3300025302 Bacteria 55802
302 Ga0207426_1000971 3300025302 Bacteria 28287
303 Ga0207426_1023477 3300025302 Bacteria 2103
304 Ga0207426_1033892 3300025302 Bacteria 1642
305 Ga0209051_1075097 3300025303 Bacteria 999
306 Ga0209257_1011890 3300025304 Bacteria 4113
307 Ga0209257_1035061 3300025304 Bacteria 1556
308 Ga0209257_1053235 3300025304 Bacteria 1133
309 Ga0207656_10063721 3300025321 Bacteria 1623
310 Ga0207656_10565558 3300025321 Bacteria 580
311 Ga0207692_10014570 3300025898 Bacteria 3439
312 Ga0207692_10039490 3300025898 Bacteria 2322
313 Ga0207692_10042963 3300025898 Bacteria 2246
314 Ga0207710_10040294 3300025900 Bacteria 2070
315 Ga0207710_10116804 3300025900 Bacteria 1271
316 Ga0207688_10116819 3300025901 Bacteria 1554
317 Ga0207688_10270301 3300025901 Bacteria 1034
318 Ga0207647_10002364 3300025904 Bacteria 14329
319 Ga0207647_10040764 3300025904 Bacteria 2923
320 Ga0207685_10022592 3300025905 Bacteria 2129
321 Ga0207685_10023966 3300025905 Bacteria 2085
322 Ga0207685_10092948 3300025905 Bacteria 1274
323 Ga0207699_10000504 3300025906 Bacteria 19475
324 Ga0207699_10007966 3300025906 Bacteria 5201
325 Ga0207699_10176325 3300025906 Bacteria 1434
326 Ga0207699_10539520 3300025906 Bacteria 845
327 Ga0207699_10853068 3300025906 Bacteria 671
328 Ga0207705_10212241 3300025909 Bacteria 1468
329 Ga0207654_10106045 3300025911 Bacteria 1740
330 Ga0207654_10128056 3300025911 Bacteria 1603
331 Ga0207707_10001479 3300025912 Bacteria 21748
332 Ga0207707_10012648 3300025912 Bacteria 7334
333 Ga0207707_10053075 3300025912 Bacteria 3528
334 Ga0207695_10000378 3300025913 Bacteria 101352
335 Ga0207695_10056577 3300025913 Bacteria 4080
336 Ga0207695_10777583 3300025913 Bacteria 838
337 Ga0207671_10014103 3300025914 Bacteria 6333
338 Ga0207671_10143988 3300025914 Bacteria 1838
339 Ga0207671_10205510 3300025914 Bacteria 1539
340 Ga0207671_10380751 3300025914 Bacteria 1121
341 Ga0207671_10402253 3300025914 Bacteria 1089
342 Ga0207693_10006678 3300025915 Bacteria 9530
343 Ga0207693_10025530 3300025915 Bacteria 4684
344 Ga0207693_10170699 3300025915 Bacteria 1713
345 Ga0207693_10223631 3300025915 Bacteria 1478
346 Ga0207693_10399658 3300025915 Bacteria 1074
347 Ga0207663_10001118 3300025916 Bacteria 12328
348 Ga0207663_10985163 3300025916 Bacteria 676
349 Ga0207660_10017029 3300025917 Bacteria 4821
350 Ga0207660_10196043 3300025917 Bacteria 1575
351 Ga0207657_10053480 3300025919 Bacteria 3498
352 Ga0207657_10598678 3300025919 Bacteria 860
353 Ga0207657_10764977 3300025919 Bacteria 748
354 Ga0207649_10603451 3300025920 Bacteria 844
355 Ga0207652_10005915 3300025921 Bacteria 9894
356 Ga0207652_10519351 3300025921 Bacteria 1071
357 Ga0207652_10558208 3300025921 Bacteria 1029
358 Ga0207694_10280205 3300025924 Bacteria 1369
359 Ga0207694_10792917 3300025924 Bacteria 800
360 Ga0207687_11083003 3300025927 Bacteria 688
361 Ga0207700_10046865 3300025928 Bacteria 3200
362 Ga0207700_10066647 3300025928 Bacteria 2753
363 Ga0207700_10200060 3300025928 Bacteria 1683
364 Ga0207700_10394441 3300025928 Bacteria 1212
365 Ga0207700_10651051 3300025928 Bacteria 939
366 Ga0207664_10019715 3300025929 Bacteria 4990
367 Ga0207664_10070113 3300025929 Bacteria 2820
368 Ga0207644_10554366 3300025931 Bacteria 952
369 Ga0207644_10572107 3300025931 Bacteria 936
370 Ga0207690_10201877 3300025932 Bacteria 1510
371 Ga0207690_10320373 3300025932 Bacteria 1219
372 Ga0207706_10350008 3300025933 Bacteria 1285
373 Ga0207709_11540464 3300025935 Bacteria 552
374 Ga0207669_10369115 3300025937 Bacteria 1115
375 Ga0207704_11270574 3300025938 Bacteria 629
376 Ga0207665_10004372 3300025939 Bacteria 9383
377 Ga0207665_10074448 3300025939 Bacteria 2324
378 Ga0207665_10189654 3300025939 Bacteria 1493
379 Ga0207665_10670882 3300025939 Bacteria 814
380 Ga0207665_11072513 3300025939 Bacteria 642
381 Ga0207691_10463611 3300025940 Bacteria 1078
382 Ga0207711_10610019 3300025941 Bacteria 1018
383 Ga0207661_10033385 3300025944 Bacteria 3993
384 Ga0207661_10455642 3300025944 Bacteria 1165
385 Ga0207667_10207653 3300025949 Bacteria 2008
386 Ga0207667_10421394 3300025949 Bacteria 1358
387 Ga0207667_11116168 3300025949 Bacteria 771
388 Ga0207668_10241672 3300025972 Bacteria 1461
389 Ga0207640_10038737 3300025981 Bacteria 3011
390 Ga0207640_10123034 3300025981 Bacteria 1863
391 Ga0207640_10453615 3300025981 Bacteria 1057
392 Ga0207658_10131707 3300025986 Bacteria 2010
393 Ga0207677_10722919 3300026023 Bacteria 885
394 Ga0207677_11316707 3300026023 Bacteria 664
395 Ga0207703_10268356 3300026035 Bacteria 1545
396 Ga0207703_10420600 3300026035 Bacteria 1243
397 Ga0207703_10585561 3300026035 Bacteria 1054
398 Ga0207703_11869909 3300026035 Bacteria 576
399 Ga0207639_10068421 3300026041 Bacteria 2767
400 Ga0207639_10166179 3300026041 Bacteria 1864
401 Ga0207678_10142121 3300026067 Bacteria 2048
402 Ga0207678_10807829 3300026067 Bacteria 828
403 Ga0207678_11132178 3300026067 Bacteria 693
404 Ga0207678_11212483 3300026067 Bacteria 668
405 Ga0207648_10413850 3300026089 Bacteria 1223
406 Ga0207676_10172067 3300026095 Bacteria 1888
407 Ga0207676_11364822 3300026095 Bacteria 704
408 Ga0207674_10002366 3300026116 Bacteria 23835
409 Ga0207674_10338042 3300026116 Bacteria 1456
410 Ga0207674_10739100 3300026116 Bacteria 950
411 Ga0207674_11006404 3300026116 Bacteria 803
412 Ga0207675_100126349 3300026118 Bacteria 2422
413 Ga0207675_101732921 3300026118 Bacteria 644
414 Ga0207683_10338033 3300026121 Bacteria 1381
415 Ga0207683_10692530 3300026121 Bacteria 945
416 Ga0207698_10065719 3300026142 Bacteria 2850
417 Ga0207698_10103631 3300026142 Bacteria 2365
418 Ga0209389_1000230 3300027296 Bacteria 37484
419 Ga0209389_1002940 3300027296 Bacteria 13400
420 Ga0209589_1000897 3300027357 Bacteria 45637
421 Ga0209489_100110 3300027361 Bacteria 117680
422 Ga0209489_102489 3300027361 Bacteria 37484
423 Ga0209700_102336 3300027363 Bacteria 38715
424 Ga0209588_1001138 3300027671 Bacteria 6848
425 Ga0268266_10055646 3300028379 Bacteria 3401
426 Ga0268264_10000271 3300028381 Bacteria 90154
427 Ga0268264_10357532 3300028381 Bacteria 1392
428 Ga0307511_10138741 3300030521 Bacteria 1437
429 Ga0307511_10193517 3300030521 Bacteria 1070
430 Ga0265762_1188664 3300030760 Bacteria 511
431 Ga0265330_10029779 3300031235 Bacteria 2453
432 Ga0265339_10106083 3300031249 Bacteria 1458
433 Ga0265339_10291540 3300031249 Bacteria 780
434 Ga0265331_10047281 3300031250 Bacteria 2070
435 Ga0307509_10066441 3300031507 Bacteria 3783
436 Ga0307509_10147325 3300031507 Bacteria 2277
437 Ga0307508_10000541 3300031616 Bacteria 44822
438 Ga0307508_10652651 3300031616 Bacteria 657
439 Ga0265314_10085107 3300031711 Bacteria 2074
440 Ga0265342_10034049 3300031712 Bacteria 3127
441 Ga0307516_10016567 3300031730 Bacteria 7706
442 Ga0307415_100313972 3300032126 Bacteria 1304
443 Ga0307507_10180798 3300033179 Bacteria 1508
444 Ga0307510_10002289 3300033180 Bacteria 21616
445 Ga0307510_10156570 3300033180 Bacteria 1884
446 Ga0316214_1016739 3300033545 Bacteria 1015
447 Ga0373926_0008279 3300035083 Bacteria 3459
448 Ga0373926_0102798 3300035083 Bacteria 1069
449 Ga0373926_0294854 3300035083 Bacteria 633
450 Ga0373923_0044205 3300035111 Bacteria 1846
451 Ga0373923_0399400 3300035111 Bacteria 661
452 Ga0373936_0046381 3300035113 Bacteria 1752
453 Ga0373936_0048109 3300035113 Bacteria 1721
454 Ga0373945_0026055 3300035116 Bacteria 2035
455 Ga0373945_0052796 3300035116 Bacteria 1499
456 Ga0373945_0481877 3300035116 Bacteria 551
457 Ga0373953_0045173 3300035117 Bacteria 1764
458 Ga0373953_0131244 3300035117 Bacteria 1068
459 Ga0373954_0011541 3300035118 Bacteria 3917
460 Ga0373954_0067297 3300035118 Bacteria 1697
461 Ga0373954_0166130 3300035118 Bacteria 1080
462 Ga0373954_0421341 3300035118 Bacteria 660
463 Ga0373956_0170189 3300035119 Bacteria 1028
464 Ga0373956_0282485 3300035119 Bacteria 790
465 Ga0373957_0019273 3300035120 Bacteria 2398
466 Ga0373943_0011684 3300035170 Bacteria 3952
467 Ga0373943_0024472 3300035170 Bacteria 2815
468 Ga0373943_0284016 3300035170 Bacteria 936
469 Ga0373943_0988811 3300035170 Bacteria 504
470 Ga0373946_0100132 3300035171 Bacteria 1298
471 Ga0373955_0362572 3300035172 Bacteria 878
472 Ga0373955_0373130 3300035172 Bacteria 865
473 Ga0373955_0569120 3300035172 Bacteria 693
474 Ga0373955_1021243 3300035172 Bacteria 509
475 Ga0373924_0141622 3300035410 Bacteria 1049
476 Ga0373924_0267719 3300035410 Bacteria 757
477 Ga0373935_0012834 3300035692 Bacteria 5046
478 Ga0373935_0040630 3300035692 Bacteria 2919
479 Ga0373935_0044908 3300035692 Bacteria 2786
480 Ga0373935_0107798 3300035692 Bacteria 1845
481 Ga0373935_0343294 3300035692 Bacteria 1063
482 Ga0373935_0504404 3300035692 Bacteria 879
483 Ga0373927_0001230 3300035695 Bacteria 19452
484 Ga0373927_0005221 3300035695 Bacteria 8984
485 Ga0373927_0011945 3300035695 Bacteria 5779
486 Ga0373927_0103934 3300035695 Bacteria 1849
487 Ga0373927_0214044 3300035695 Bacteria 1266
488 Ga0373927_0246425 3300035695 Bacteria 1174
489 Ga0373933_0000127 3300035724 Bacteria 48988
490 Ga0373933_0235676 3300035724 Bacteria 1176
491 Ga0373933_0311888 3300035724 Bacteria 1019
492 Ga0373933_0480671 3300035724 Bacteria 813
493 Ga0373933_0715247 3300035724 Bacteria 659
494 Ga0373947_0006336 3300035725 Bacteria 6876
495 Ga0373947_0093150 3300035725 Bacteria 1883
496 Ga0373947_0139383 3300035725 Bacteria 1554
497 Ga0373947_0283339 3300035725 Bacteria 1102
498 Ga0373937_0051021 3300036401 Bacteria 3792
499 Ga0373937_0064183 3300036401 Bacteria 3378
500 Ga0373937_0085421 3300036401 Bacteria 2920
501 Ga0373937_0522338 3300036401 Bacteria 1128
502 Ga0372808_050709 3300036459 Bacteria 594
503 Ga0373925_0002121 3300037068 Bacteria 16252
504 Ga0373925_0082948 3300037068 Bacteria 2440
505 Ga0373925_0202744 3300037068 Bacteria 1578
506 Ga0373925_0538975 3300037068 Bacteria 959
507 Ga0395900_0832897 3300037418 Bacteria 849
508 Ga0395898_0251747 3300037466 Bacteria 1685
509 Ga0395898_0822048 3300037466 Bacteria 869
510 Ga0395905_0030447 3300037471 Bacteria 5085
511 Ga0436364_0566534 3300037853 Bacteria 1785
512 Ga0436365_0022683 3300039437 Bacteria 28266
513 Ga0436365_0354924 3300039437 Bacteria 903
514 Ga0436365_0365629 3300039437 Bacteria 4324
515 Ga0436365_0547188 3300039437 Bacteria 805
516 Ga0436365_0825888 3300039437 Bacteria 1030
517 Ga0436360_0536456 3300039438 Bacteria 1491
518 Ga0436360_0546753 3300039438 Bacteria 700
519 Ga0436363_0186306 3300039450 Bacteria 4704
520 Ga0436363_0714205 3300039450 Bacteria 714
521 Ga0436362_0842663 3300039453 Bacteria 6079
522 Ga0436362_0871182 3300039453 Bacteria 686
523 Ga0451787_703960 3300041441 Bacteria 680
524 Ga0451793_0761067 3300041452 Bacteria 752
525 Ga0451793_1046715 3300041452 Bacteria 817
526 Ga0451797_1546518 3300041453 Bacteria 903
527 Ga0451795_1610771 3300041456 Bacteria 637
528 Ga0451833_0979399 3300041491 Bacteria 923
529 Ga0451849_1115692 3300041505 Bacteria 593
530 Ga0451851_0230066 3300041507 Bacteria 608
531 Ga0451853_2103161 3300041512 Bacteria 528
532 Ga0451853_3411604 3300041512 Bacteria 615
533 Ga0466969_0005173 3300044656 Bacteria 6936
534 Ga0466972_0000115 3300044658 Bacteria 68073
535 Ga0466972_0032818 3300044658 Bacteria 2548
536 Ga0466972_0406312 3300044658 Bacteria 638
537 Ga0466966_0025622 3300044684 Bacteria 3852
538 Ga0466961_0000066 3300044693 Bacteria 63201
539 Ga0466963_0029979 3300044694 Bacteria 3506
540 Ga0466963_0106052 3300044694 Bacteria 1926
541 Ga0466963_0585322 3300044694 Bacteria 788
542 Ga0466968_0005163 3300044735 Bacteria 4885
543 Ga0466968_0063005 3300044735 Bacteria 1602
544 Ga0466968_0121163 3300044735 Bacteria 1183
545 Ga0466970_0131669 3300044765 Bacteria 1374
546 Ga0466960_0078634 3300044901 Bacteria 1656
547 Ga0466960_0150967 3300044901 Bacteria 1241
548 Ga0466960_0909638 3300044901 Bacteria 537
549 Ga0451576_0796465 3300045051 Bacteria 992
550 Ga0466967_0128644 3300045976 Bacteria 2348
551 Ga0466967_0349897 3300045976 Bacteria 1430
552 Ga0495617_164548 3300046452 Bacteria 702
553 Ga0495592_0026498 3300046454 Bacteria 4395
554 Ga0495592_0425717 3300046454 Bacteria 836
555 Ga0495592_0443558 3300046454 Bacteria 814
556 Ga0495592_0957101 3300046454 Bacteria 500
557 Ga0495603_0000667 3300046455 Bacteria 19417
558 Ga0495603_0108451 3300046455 Bacteria 1620
559 Ga0495603_0216295 3300046455 Bacteria 1106
560 Ga0495629_0000283 3300046459 Bacteria 43929
561 Ga0495629_0025350 3300046459 Bacteria 4215
562 Ga0495629_0059945 3300046459 Bacteria 2660
563 Ga0495638_0011191 3300046460 Bacteria 6195
564 Ga0495638_0556750 3300046460 Bacteria 569
565 Ga0495641_0006447 3300046461 Bacteria 7606
566 Ga0495651_0022916 3300046462 Bacteria 4856
567 Ga0495651_0040170 3300046462 Bacteria 3640
568 Ga0495651_0066864 3300046462 Bacteria 2742
569 Ga0495653_0455846 3300046463 Bacteria 804
570 Ga0495650_0127441 3300046471 Bacteria 932
571 Ga0495580_0002411 3300046472 Bacteria 16335
572 Ga0495580_0028511 3300046472 Bacteria 4058
573 Ga0495582_0032135 3300046473 Bacteria 2887
574 Ga0495582_0055453 3300046473 Bacteria 2184
575 Ga0495605_0076546 3300046474 Bacteria 1571
576 Ga0495605_0133725 3300046474 Bacteria 1116
577 Ga0495639_0000423 3300046475 Bacteria 20176
578 Ga0495639_0102827 3300046475 Bacteria 1350
579 Ga0495639_0104588 3300046475 Bacteria 1339
580 Ga0495662_0000186 3300046476 Bacteria 25137
581 Ga0495664_0004204 3300046477 Bacteria 7858
582 Ga0495664_0058995 3300046477 Bacteria 2284
583 Ga0495664_0118980 3300046477 Bacteria 1597
584 Ga0495664_0539502 3300046477 Bacteria 695
585 Ga0495664_0829734 3300046477 Bacteria 543
586 Ga0495585_0328902 3300046492 Bacteria 746
587 Ga0495594_0001986 3300046499 Bacteria 10660
588 Ga0495594_0291210 3300046499 Bacteria 930
589 Ga0495607_0139837 3300046501 Bacteria 1250
590 Ga0495583_0167219 3300046506 Bacteria 905
591 Ga0495606_0001397 3300046507 Bacteria 32530
592 Ga0495606_0038607 3300046507 Bacteria 3228
593 Ga0495608_0143664 3300046511 Bacteria 1522
594 Ga0495608_0610130 3300046511 Bacteria 654
595 Ga0495610_0188039 3300046512 Bacteria 854
596 Ga0495610_0369912 3300046512 Bacteria 535
597 Ga0495616_0173399 3300046513 Bacteria 963
598 Ga0495618_0023307 3300046514 Bacteria 3827
599 Ga0495618_0040958 3300046514 Bacteria 2916
600 Ga0495618_0092687 3300046514 Bacteria 1931
601 Ga0495628_0012222 3300046516 Bacteria 7238
602 Ga0495628_0025773 3300046516 Bacteria 4801
603 Ga0495628_0037593 3300046516 Bacteria 3881
604 Ga0495628_0235378 3300046516 Bacteria 1371
605 Ga0495630_0021544 3300046517 Bacteria 4759
606 Ga0495630_0025317 3300046517 Bacteria 4386
607 Ga0495630_0422188 3300046517 Bacteria 1022
608 Ga0495648_0001145 3300046524 Bacteria 26801
609 Ga0495648_0057238 3300046524 Bacteria 2340
610 Ga0495648_0153738 3300046524 Bacteria 1197
611 Ga0495648_0410799 3300046524 Bacteria 602
612 Ga0495666_0169613 3300046526 Bacteria 1010
613 Ga0495652_0015775 3300046529 Bacteria 6763
614 Ga0495652_0026046 3300046529 Bacteria 5168
615 Ga0495652_0143000 3300046529 Bacteria 1879
616 Ga0495652_0143215 3300046529 Bacteria 1877
617 Ga0495652_0153554 3300046529 Bacteria 1795
618 Ga0495652_0537655 3300046529 Bacteria 805
619 Ga0495665_0001096 3300046531 Bacteria 14317
620 Ga0495665_0105411 3300046531 Bacteria 1479
621 Ga0495640_0030086 3300046533 Bacteria 3891
622 Ga0495640_0065433 3300046533 Bacteria 2455
623 Ga0495640_0077705 3300046533 Bacteria 2212
624 Ga0495586_0099069 3300046535 Bacteria 1616
625 Ga0495587_0058721 3300046536 Bacteria 2260
626 Ga0495587_0653882 3300046536 Bacteria 577
627 Ga0495597_0336347 3300046542 Bacteria 581
628 Ga0495645_0063646 3300046543 Bacteria 2670
629 Ga0495645_0148431 3300046543 Bacteria 1631
630 Ga0495645_0541065 3300046543 Bacteria 723
631 Ga0495645_0863905 3300046543 Bacteria 539
632 Ga0495622_0013019 3300046557 Bacteria 3860
633 Ga0495622_0013289 3300046557 Bacteria 3820
634 Ga0495622_0017461 3300046557 Bacteria 3340
635 Ga0495667_0010532 3300046559 Bacteria 6256
636 Ga0495667_0063250 3300046559 Bacteria 2422
637 Ga0495667_0090293 3300046559 Bacteria 1985
638 Ga0495668_0128689 3300046616 Bacteria 1386
639 Ga0495668_0715470 3300046616 Bacteria 554
640 Ga0495634_0031856 3300046642 Bacteria 3630
641 Ga0495634_0074401 3300046642 Bacteria 2232
642 Ga0495634_0104953 3300046642 Bacteria 1822
643 Ga0495634_0116335 3300046642 Bacteria 1715
644 Ga0495611_0055368 3300046648 Bacteria 1794
645 Ga0495625_0095197 3300046660 Bacteria 2053
646 Ga0495625_0280052 3300046660 Bacteria 1073
647 Ga0495635_0002530 3300046663 Bacteria 12506
648 Ga0495635_0005323 3300046663 Bacteria 8957
649 Ga0495635_0144414 3300046663 Bacteria 1620
650 Ga0495635_0201842 3300046663 Bacteria 1348
651 Ga0495588_0007115 3300046674 Bacteria 5074
652 Ga0495588_0017451 3300046674 Bacteria 3487
653 Ga0495588_0310257 3300046674 Bacteria 830
654 Ga0495657_0015963 3300046675 Bacteria 5479
655 Ga0495657_0049749 3300046675 Bacteria 2821
656 Ga0495657_0057001 3300046675 Bacteria 2599
657 Ga0495599_0029223 3300046678 Bacteria 3455
658 Ga0495599_0115407 3300046678 Bacteria 1671
659 Ga0495599_0117960 3300046678 Bacteria 1650
660 Ga0495599_0142769 3300046678 Bacteria 1485
661 Ga0495623_0026575 3300046679 Bacteria 3725
662 Ga0495623_0211706 3300046679 Bacteria 1109
663 Ga0495623_0217396 3300046679 Bacteria 1091
664 Ga0495623_0477763 3300046679 Bacteria 660
665 Ga0495646_0007232 3300046680 Bacteria 7052
666 Ga0495646_0029944 3300046680 Bacteria 3400
667 Ga0495647_0001483 3300046681 Bacteria 7279
668 Ga0495658_0281842 3300046683 Bacteria 1049
669 Ga0495658_0507566 3300046683 Bacteria 771
670 Ga0495613_0001910 3300046689 Bacteria 15801
671 Ga0495613_0021869 3300046689 Bacteria 4768
672 Ga0495613_0099154 3300046689 Bacteria 2105
673 Ga0495613_0104432 3300046689 Bacteria 2045
674 Ga0495613_0565336 3300046689 Bacteria 760
675 Ga0495624_0001800 3300046690 Bacteria 16366
676 Ga0495624_0043889 3300046690 Bacteria 2850
677 Ga0495624_0208994 3300046690 Bacteria 1184
678 Ga0495624_0258095 3300046690 Bacteria 1053
679 Ga0495670_0360309 3300046691 Bacteria 783
680 Ga0495649_0178548 3300046694 Bacteria 1108
681 Ga0495649_0197583 3300046694 Bacteria 1045
682 Ga0495649_0391518 3300046694 Bacteria 698
683 Ga0495589_0032117 3300046794 Bacteria 2641
684 Ga0495600_0012830 3300046809 Bacteria 5248
685 Ga0495600_0028095 3300046809 Bacteria 3638
686 Ga0495600_0101770 3300046809 Bacteria 1872
687 Ga0495600_0823894 3300046809 Bacteria 552
688 Ga0495581_0000346 3300047315 Bacteria 23081
689 Ga0495581_0094303 3300047315 Bacteria 1737
690 Ga0495581_0096893 3300047315 Bacteria 1713
691 Ga0495581_0200019 3300047315 Bacteria 1169
692 Ga0495604_0007903 3300047317 Bacteria 8423
693 Ga0495604_0013112 3300047317 Bacteria 6602
694 Ga0495604_0165859 3300047317 Bacteria 1557
695 Ga0495674_0024064 3300047319 Bacteria 5603
696 Ga0495674_0025391 3300047319 Bacteria 5433
697 Ga0495674_0089250 3300047319 Bacteria 2635
698 Ga0495674_0272343 3300047319 Bacteria 1389
699 Ga0495674_0656974 3300047319 Bacteria 826
700 Ga0495674_1035960 3300047319 Bacteria 627
701 Ga0495676_0049875 3300047321 Bacteria 3361
702 Ga0495676_0121149 3300047321 Bacteria 1902
703 Ga0495676_0138278 3300047321 Bacteria 1748
704 Ga0495676_0243605 3300047321 Bacteria 1230
705 Ga0495680_0001058 3300047322 Bacteria 30479
706 Ga0495680_0348673 3300047322 Bacteria 1031
707 Ga0495680_0360978 3300047322 Bacteria 1010
708 Ga0495683_0245432 3300047323 Bacteria 788
709 Ga0495687_004881 3300047443 Bacteria 8799
710 Ga0495675_0008446 3300047444 Bacteria 6381
711 Ga0495675_0136140 3300047444 Bacteria 1525
712 Ga0495673_0043711 3300047469 Bacteria 2003
713 Ga0495673_0067532 3300047469 Bacteria 1513
714 Ga0495673_0287550 3300047469 Bacteria 592
715 Ga0495684_0023592 3300047471 Bacteria 4730
716 Ga0495684_0092904 3300047471 Bacteria 2285
717 Ga0495684_0330432 3300047471 Bacteria 1087
718 Ga0495684_0823378 3300047471 Bacteria 605
719 Ga0495686_0426559 3300047472 Bacteria 708
720 Ga0495593_0001297 3300047673 Bacteria 14662
721 Ga0495593_0027280 3300047673 Bacteria 3144
722 Ga0495602_0005801 3300048088 Bacteria 12957
723 Ga0495602_0130086 3300048088 Bacteria 2009
724 Ga0495602_0776588 3300048088 Bacteria 645
725 Ga0495614_0023670 3300048089 Bacteria 2651
726 Ga0495614_0055500 3300048089 Bacteria 1699
727 Ga0495614_0141927 3300048089 Bacteria 1068
728 Ga0495614_0513173 3300048089 Bacteria 571
729 Ga0496100_0191229 3300048903 Bacteria 1486
730 Ga0496100_0258693 3300048903 Bacteria 1290
731 Ga0496100_0273342 3300048903 Bacteria 1257
732 Ga0496100_0278761 3300048903 Bacteria 1246
733 Ga0496100_0354848 3300048903 Bacteria 1108
734 Ga0496100_1311317 3300048903 Bacteria 571
735 Ga0496101_0299475 3300048904 Bacteria 1259
736 Ga0496102_0134052 3300048905 Bacteria 2320
737 Ga0496102_0237439 3300048905 Bacteria 1719
738 Ga0496102_0344820 3300048905 Bacteria 1402
739 Ga0496102_0873973 3300048905 Bacteria 821
740 Ga0496102_1497719 3300048905 Bacteria 593
741 Ga0496103_0007344 3300048906 Bacteria 6568
742 Ga0496104_0190611 3300048907 Bacteria 1961
743 Ga0496104_0196275 3300048907 Bacteria 1930
744 Ga0496104_0299154 3300048907 Bacteria 1521
745 Ga0496104_1481670 3300048907 Bacteria 581
746 Ga0496105_0003004 3300048908 Bacteria 12398
747 Ga0496105_0026626 3300048908 Bacteria 4720
748 Ga0496105_0877426 3300048908 Bacteria 677
749 Ga0496106_0004187 3300048909 Bacteria 10754
750 Ga0496106_0011609 3300048909 Bacteria 6510
751 Ga0496106_0225975 3300048909 Bacteria 1493
752 Ga0496106_0234764 3300048909 Bacteria 1465
753 Ga0496106_0332278 3300048909 Bacteria 1220
754 Ga0496106_0395328 3300048909 Bacteria 1111
755 Ga0496107_0048726 3300048910 Bacteria 3053
756 Ga0496107_0732302 3300048910 Bacteria 726
757 Ga0496108_0009483 3300048911 Bacteria 7881
758 Ga0496108_0053316 3300048911 Bacteria 3391
759 Ga0496108_0118230 3300048911 Bacteria 2272
760 Ga0496108_1396351 3300048911 Bacteria 586
761 Ga0496109_0012953 3300048912 Bacteria 7210
762 Ga0496109_0267726 3300048912 Bacteria 1610
763 Ga0496110_0031727 3300048913 Bacteria 4561
764 Ga0496110_0135920 3300048913 Bacteria 2221
765 Ga0496110_0402693 3300048913 Bacteria 1247
766 Ga0496110_0888079 3300048913 Bacteria 797
767 Ga0496111_0186422 3300048914 Bacteria 1542
768 Ga0496111_0479652 3300048914 Bacteria 916
769 Ga0496112_0000036 3300048915 Bacteria 106325
770 Ga0496112_0149030 3300048915 Bacteria 2307
771 Ga0496112_0397234 3300048915 Bacteria 1318
772 Ga0496112_0788306 3300048915 Bacteria 875
773 Ga0496113_0023104 3300048916 Bacteria 4406
774 Ga0496113_0284613 3300048916 Bacteria 1322
775 Ga0496114_0126394 3300048917 Bacteria 2204
776 Ga0496114_0489371 3300048917 Bacteria 1088
777 Ga0496114_0694584 3300048917 Bacteria 893
778 Ga0496115_0022821 3300048918 Bacteria 4852
779 Ga0496115_0144172 3300048918 Bacteria 1965
780 Ga0496115_0241214 3300048918 Bacteria 1489
781 Ga0496116_0038973 3300048919 Bacteria 3291
782 Ga0496116_0381962 3300048919 Bacteria 631
783 Ga0496117_0014725 3300048920 Bacteria 6717
784 Ga0496117_0021587 3300048920 Bacteria 5202
785 Ga0496117_0041129 3300048920 Bacteria 3391
786 Ga0496117_0435072 3300048920 Bacteria 653
787 Ga0496118_0006821 3300048921 Bacteria 12391
788 Ga0496118_0030236 3300048921 Bacteria 4524
789 Ga0496118_0071213 3300048921 Bacteria 2504
790 Ga0496118_0095356 3300048921 Bacteria 2031
791 Ga0496118_0102456 3300048921 Bacteria 1929
792 Ga0496118_0469373 3300048921 Bacteria 634
793 Ga0496119_0013006 3300048922 Bacteria 6685
794 Ga0496119_0063130 3300048922 Bacteria 2204
795 Ga0496119_0180984 3300048922 Bacteria 1105
796 Ga0496119_0213474 3300048922 Bacteria 991
797 Ga0496120_0019431 3300048923 Bacteria 4346
798 Ga0496120_0095701 3300048923 Bacteria 1578
799 Ga0496121_0000218 3300048924 Bacteria 126175
800 Ga0496121_0002143 3300048924 Bacteria 30998
801 Ga0496121_0024547 3300048924 Bacteria 5760
802 Ga0496121_0093483 3300048924 Bacteria 2341
803 Ga0496121_0194653 3300048924 Bacteria 1450
804 Ga0496121_0340818 3300048924 Bacteria 1002
805 Ga0496121_0551111 3300048924 Bacteria 721
806 Ga0496121_0880585 3300048924 Bacteria 517
807 Ga0496122_0028335 3300048925 Bacteria 4756
808 Ga0496123_0140579 3300048926 Bacteria 1321
809 Ga0496123_0163544 3300048926 Bacteria 1183
810 Ga0496124_0001333 3300048927 Bacteria 37071
811 Ga0496124_0089207 3300048927 Bacteria 2518
812 Ga0496124_0100322 3300048927 Bacteria 2347
813 Ga0496124_0369241 3300048927 Bacteria 1008
814 Ga0496125_0030379 3300048928 Bacteria 4835
815 Ga0496125_0064474 3300048928 Bacteria 2911
816 Ga0496125_0203673 3300048928 Bacteria 1292
817 Ga0496126_0001598 3300048929 Bacteria 34515
818 Ga0496126_0008691 3300048929 Bacteria 10906
819 Ga0496126_0085347 3300048929 Bacteria 2783
820 Ga0496126_0097984 3300048929 Bacteria 2569
821 Ga0496126_0241475 3300048929 Bacteria 1509
822 Ga0496126_0257554 3300048929 Bacteria 1452
823 Ga0496126_0312868 3300048929 Bacteria 1292
824 Ga0496126_0659480 3300048929 Bacteria 818
825 Ga0495682_0017747 3300049460 Bacteria 2682
826 Ga0501031_0004410 3300049568 Bacteria 9122
827 Ga0501031_0021326 3300049568 Bacteria 4223
828 Ga0501032_0002147 3300049569 Bacteria 15526
829 Ga0501032_0130164 3300049569 Bacteria 1660
830 Ga0501033_0000060 3300049570 Bacteria 103159
831 Ga0501033_0021876 3300049570 Bacteria 4825
832 Ga0501033_0027600 3300049570 Bacteria 4268
833 Ga0501034_0000117 3300049571 Bacteria 144865
834 Ga0501034_0049060 3300049571 Bacteria 4260
835 Ga0501034_0100173 3300049571 Bacteria 2891
836 Ga0501034_0577466 3300049571 Bacteria 1031
837 Ga0501036_0000188 3300049572 Bacteria 41101
838 Ga0501036_0087493 3300049572 Bacteria 2633
839 Ga0501036_0857463 3300049572 Bacteria 746
840 Ga0501037_0000402 3300049573 Bacteria 36091
841 Ga0501037_0003037 3300049573 Bacteria 12181
842 Ga0501037_0031760 3300049573 Bacteria 3899
843 Ga0501037_0190184 3300049573 Bacteria 1453
844 Ga0501038_0000540 3300049574 Bacteria 33178
845 Ga0501038_0051880 3300049574 Bacteria 3537
846 Ga0501038_0105274 3300049574 Bacteria 2343
847 Ga0501038_0218519 3300049574 Bacteria 1521
848 Ga0501039_0000431 3300049575 Bacteria 30281
849 Ga0501039_0016436 3300049575 Bacteria 5668
850 Ga0501040_0103606 3300049576 Bacteria 1986
851 Ga0501041_0483703 3300049577 Bacteria 787
852 Ga0501042_0011425 3300049578 Bacteria 5992
853 Ga0501042_0070294 3300049578 Bacteria 2504
854 Ga0501042_0102846 3300049578 Bacteria 2055
855 Ga0501043_0002749 3300049579 Bacteria 14715
856 Ga0501043_0018739 3300049579 Bacteria 5430
857 Ga0501046_0001915 3300049580 Bacteria 19766
858 Ga0501046_0014783 3300049580 Bacteria 6571
859 Ga0501046_0027066 3300049580 Bacteria 4681
860 Ga0501046_0069536 3300049580 Bacteria 2739
861 Ga0501047_0000246 3300049581 Bacteria 64361
862 Ga0501047_0079183 3300049581 Bacteria 3160
863 Ga0501047_0218672 3300049581 Bacteria 1761
864 Ga0501048_0000878 3300049582 Bacteria 22207
865 Ga0501048_0020139 3300049582 Bacteria 4892
866 Ga0501048_1291810 3300049582 Bacteria 525
867 Ga0501067_0000320 3300049583 Bacteria 26233
868 Ga0501067_0382677 3300049583 Bacteria 784
869 Ga0501068_0002924 3300049584 Bacteria 9095
870 Ga0501068_0017885 3300049584 Bacteria 4103
871 Ga0501069_0005134 3300049585 Bacteria 6798
872 Ga0501070_0000779 3300049586 Bacteria 28961
873 Ga0501070_0018706 3300049586 Bacteria 5812
874 Ga0501070_0765766 3300049586 Bacteria 760
875 Ga0501070_1356414 3300049586 Bacteria 541
876 Ga0501071_0174123 3300049587 Bacteria 1611
877 Ga0501072_0004819 3300049588 Bacteria 10273
878 Ga0501072_0108254 3300049588 Bacteria 2211
879 Ga0501073_0000093 3300049589 Bacteria 56882
880 Ga0501073_0144808 3300049589 Bacteria 1646
881 Ga0501073_0390209 3300049589 Bacteria 962
882 Ga0501074_0000127 3300049590 Bacteria 38795
883 Ga0501074_0025558 3300049590 Bacteria 4286
884 Ga0501077_0239533 3300049593 Bacteria 1153
885 Ga0501079_0001174 3300049741 Bacteria 18341
886 Ga0501079_0598781 3300049741 Bacteria 867
887 Ga0501080_0001845 3300049742 Bacteria 18181
888 Ga0501080_0034825 3300049742 Bacteria 4702
889 Ga0501083_0008877 3300049744 Bacteria 7098
890 Ga0501083_0232920 3300049744 Bacteria 1199
891 Ga0501035_0000798 3300049822 Bacteria 33520
892 Ga0501035_0084415 3300049822 Bacteria 2801
893 Ga0501035_0116281 3300049822 Bacteria 2340
894 Ga0501035_0314792 3300049822 Bacteria 1316
895 Ga0501035_0710922 3300049822 Bacteria 809
896 Ga0501035_1228109 3300049822 Bacteria 580
897 Ga0501044_0005195 3300049823 Bacteria 14487
898 Ga0501044_0023777 3300049823 Bacteria 6516
899 Ga0501044_0729152 3300049823 Bacteria 875
900 Ga0501044_1208904 3300049823 Bacteria 623
901 Ga0501045_1043881 3300049824 Bacteria 599
902 nmdc:mga00v17_202500_c1 3300050491 Bacteria 1283
903 nmdc:mga00v17_30000_c1 3300050491 Bacteria 3195
904 nmdc:mga00v17_49354_c1 3300050491 Bacteria 2553
905 nmdc:mga0yw44_207786_c1 3300050492 Bacteria 1294
906 nmdc:mga0yw44_358288_c1 3300050492 Bacteria 983
907 nmdc:mga0yw44_882248_c1 3300050492 Bacteria 607
908 nmdc:mga0k408_209215_c1 3300050493 Bacteria 1165
909 nmdc:mga06z11_97715_c1 3300050494 Bacteria 1606
910 nmdc:mga07m45_18827_c1 3300050496 Bacteria 3734
911 nmdc:mga07m45_55859_c1 3300050496 Bacteria 2232
912 nmdc:mga0n895_1900863_c1 3300050512 Bacteria 554
913 nmdc:mga0n895_203510_c1 3300050512 Bacteria 2010
914 nmdc:mga0sz30_372005_c1 3300050516 Bacteria 639
915 nmdc:mga0sz30_58617_c1 3300050516 Bacteria 1642
916 Ga0495601_0127648 3300053077 Bacteria 1655
917 Ga0495601_0161268 3300053077 Bacteria 1465
918 Ga0495601_0299334 3300053077 Bacteria 1048
919 Ga0495601_1084072 3300053077 Bacteria 502
920 Ga0495612_0007154 3300053078 Bacteria 4565
921 Ga0500635_0005826 3300053080 Bacteria 3260
922 Ga0500635_0052312 3300053080 Bacteria 1402
923 Ga0495595_0099694 3300053084 Bacteria 1401
924 Ga0495595_0345974 3300053084 Bacteria 750
925 Ga0495619_0084347 3300053085 Bacteria 2144
926 Ga0495619_0090441 3300053085 Bacteria 2072
927 Ga0495619_0503838 3300053085 Bacteria 832
928 Ga0500578_0195237 3300053086 Bacteria 1241
929 Ga0500578_0414710 3300053086 Bacteria 773
930 Ga0500578_0525968 3300053086 Bacteria 661
931 Ga0500643_000013 3300053087 Bacteria 324296
932 Ga0500646_0195593 3300053090 Bacteria 691
933 Ga0500647_0063581 3300053091 Bacteria 1775
934 Ga0500651_0005693 3300053093 Bacteria 7135
935 Ga0500651_0131518 3300053093 Bacteria 1513
936 Ga0500651_0457679 3300053093 Bacteria 709
937 Ga0500566_0059465 3300053094 Bacteria 2166
938 Ga0500566_0323904 3300053094 Bacteria 716
939 Ga0500566_0488259 3300053094 Bacteria 532
940 Ga0500640_133320 3300053095 Bacteria 976
941 Ga0500648_056450 3300053097 Bacteria 2227
942 Ga0500650_0071799 3300053098 Bacteria 1618
943 Ga0500650_0275510 3300053098 Bacteria 749
944 Ga0500554_002561 3300053102 Bacteria 3593
945 Ga0500555_001072 3300053103 Bacteria 9178
946 Ga0500556_0069527 3300053104 Bacteria 1312
947 Ga0500562_021204 3300053108 Bacteria 1689
948 Ga0500569_011527 3300053109 Bacteria 2114
949 Ga0500592_002866 3300053116 Bacteria 2772
950 Ga0500594_0016326 3300053118 Bacteria 1803
951 Ga0500595_008262 3300053119 Bacteria 4261
952 Ga0500595_027430 3300053119 Bacteria 1950
953 Ga0500597_410958 3300053120 Bacteria 512
954 Ga0500607_071125 3300053121 Bacteria 1796
955 Ga0500614_010829 3300053123 Bacteria 1963
956 Ga0500642_0000376 3300053130 Bacteria 15008
957 Ga0500642_0313319 3300053130 Bacteria 705
958 Ga0500652_091010 3300053131 Bacteria 1274
959 Ga0500559_0006437 3300053136 Bacteria 5304
960 Ga0500559_0039350 3300053136 Bacteria 2056
961 Ga0500559_0569048 3300053136 Bacteria 515
962 Ga0500564_098383 3300053138 Bacteria 1295
963 Ga0500568_0018290 3300053139 Bacteria 3070
964 Ga0500573_0041160 3300053140 Bacteria 2667
965 Ga0500577_0131556 3300053142 Bacteria 1049
966 Ga0500588_0268301 3300053146 Bacteria 643
967 Ga0500590_108911 3300053148 Bacteria 1318
968 Ga0500590_241043 3300053148 Bacteria 727
969 Ga0500603_031587 3300053150 Bacteria 1370
970 Ga0500603_132247 3300053150 Bacteria 763
971 Ga0500603_285611 3300053150 Bacteria 533
972 Ga0500604_0095532 3300053151 Bacteria 975
973 Ga0500604_0167933 3300053151 Bacteria 749
974 Ga0500616_0015406 3300053153 Bacteria 4373
975 Ga0500619_162176 3300053154 Bacteria 758
976 Ga0500619_307169 3300053154 Bacteria 510
977 Ga0500620_016205 3300053155 Bacteria 2125
978 Ga0500622_0001687 3300053156 Bacteria 17213
979 Ga0500627_0078272 3300053158 Bacteria 1471
980 Ga0500627_0107403 3300053158 Bacteria 1255
981 Ga0500633_0150997 3300053160 Bacteria 871
982 Ga0500639_157090 3300053163 Bacteria 1040
983 Ga0500639_297888 3300053163 Bacteria 608
984 Ga0500636_0003998 3300053177 Bacteria 8311
985 Ga0500636_0017280 3300053177 Bacteria 4258
986 Ga0500636_0124922 3300053177 Bacteria 1439
987 Ga0500636_0197630 3300053177 Bacteria 1066
988 Ga0500636_0209106 3300053177 Bacteria 1025
989 Ga0500636_0246599 3300053177 Bacteria 913
990 Ga0500637_0509850 3300053178 Bacteria 593
991 Ga0500649_100608 3300053722 Bacteria 1142
992 Ga0500570_080332 3300053724 Bacteria 1473
993 Ga0500611_083046 3300053727 Bacteria 803
994 Ga0500625_041142 3300053729 Bacteria 2172
995 Ga0500645_099808 3300053730 Bacteria 819
996 Ga0500645_175617 3300053730 Bacteria 584
997 Ga0500609_003821 3300053731 Bacteria 2101
998 Ga0500599_000090 3300053736 Bacteria 8469
999 Ga0500601_000297 3300053737 Bacteria 9335
1000 Ga0501084_0095316 3300054114 Bacteria 2499
1001 Ga0501084_0144392 3300054114 Bacteria 2004
1002 Ga0500661_012063 3300055283 Bacteria 1562
1003 Ga0501082_0004139 3300060353 Bacteria 12672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053091 Ga0500647_0063581 Ga0500647_0063581_220_564 100
2 iso_pu_bacteria 2513237087 2513591301 102
3 3300044735 Ga0466968_0005163 Ga0466968_0005163_3169_3483 104
4 3300045051 Ga0451576_0796465 Ga0451576_0796465_115_465 105
5 3300005937 Ga0081455_10113701 Ga0081455_101137011 107
6 3300005262 Ga0065165_1048792 Ga0065165_10487921 109
7 3300005937 Ga0081455_10001626 Ga0081455_1000162620 109
8 3300006051 Ga0075364_10524594 Ga0075364_105245942 109
9 3300048921 Ga0496118_0469373 Ga0496118_0469373_13_351 109
10 3300048924 Ga0496121_0551111 Ga0496121_0551111_337_675 109
11 3300048925 Ga0496122_0028335 Ga0496122_0028335_1797_2135 109
12 3300048926 Ga0496123_0163544 Ga0496123_0163544_503_841 109
13 3300048927 Ga0496124_0100322 Ga0496124_0100322_1701_2039 109
14 3300050491 nmdc:mga00v17_202500_c1 nmdc:mga00v17_202500_c1_843_1181 109
15 iso_pu_bacteria 2513237104 2513720483 109
16 iso_pu_bacteria 2517093001 2517106139 109
17 iso_pu_bacteria 2524023205 2524438233 109
18 iso_pu_bacteria 2744054633 2745077336 109
19 3300002075 JGI24738J21930_10064151 JGI24738J21930_100641512 110
20 3300003323 rootH1_10110488 rootH1_101104882 110
21 3300005327 Ga0070658_10619279 Ga0070658_106192793 110
22 3300005329 Ga0070683_100419537 Ga0070683_1004195372 110
23 3300005329 Ga0070683_100579330 Ga0070683_1005793302 110
24 3300005331 Ga0070670_100736618 Ga0070670_1007366183 110
25 3300005336 Ga0070680_100057264 Ga0070680_1000572643 110
26 3300005336 Ga0070680_100115737 Ga0070680_1001157371 110
27 3300005336 Ga0070680_101094715 Ga0070680_1010947151 110
28 3300005339 Ga0070660_100154366 Ga0070660_1001543662 110
29 3300005339 Ga0070660_100196432 Ga0070660_1001964322 110
30 3300005341 Ga0070691_10102109 Ga0070691_101021091 110
31 3300005344 Ga0070661_100157560 Ga0070661_1001575603 110
32 3300005345 Ga0070692_11231595 Ga0070692_112315951 110
33 3300005356 Ga0070674_100770028 Ga0070674_1007700281 110
34 3300005366 Ga0070659_100224942 Ga0070659_1002249422 110
35 3300005366 Ga0070659_100729093 Ga0070659_1007290932 110
36 3300005434 Ga0070709_10000143 Ga0070709_1000014339 110
37 3300005434 Ga0070709_10003192 Ga0070709_100031929 110
38 3300005434 Ga0070709_10061173 Ga0070709_100611731 110
39 3300005434 Ga0070709_10788805 Ga0070709_107888052 110
40 3300005434 Ga0070709_10896823 Ga0070709_108968232 110
41 3300005435 Ga0070714_100021066 Ga0070714_1000210666 110
42 3300005435 Ga0070714_100043580 Ga0070714_1000435804 110
43 3300005435 Ga0070714_100464531 Ga0070714_1004645313 110
44 3300005435 Ga0070714_101754616 Ga0070714_1017546162 110
45 3300005436 Ga0070713_100002045 Ga0070713_1000020453 110
46 3300005436 Ga0070713_100009055 Ga0070713_1000090558 110
47 3300005436 Ga0070713_100039395 Ga0070713_1000393952 110
48 3300005436 Ga0070713_100151725 Ga0070713_1001517252 110
49 3300005436 Ga0070713_100168645 Ga0070713_1001686452 110
50 3300005436 Ga0070713_100204529 Ga0070713_1002045292 110
51 3300005437 Ga0070710_10003824 Ga0070710_100038241 110
52 3300005437 Ga0070710_10127757 Ga0070710_101277572 110
53 3300005437 Ga0070710_10801804 Ga0070710_108018041 110
54 3300005437 Ga0070710_11365781 Ga0070710_113657811 110
55 3300005439 Ga0070711_100127365 Ga0070711_1001273653 110
56 3300005439 Ga0070711_100230263 Ga0070711_1002302632 110
57 3300005439 Ga0070711_100415078 Ga0070711_1004150783 110
58 3300005439 Ga0070711_101764233 Ga0070711_1017642331 110
59 3300005455 Ga0070663_101188199 Ga0070663_1011881992 110
60 3300005456 Ga0070678_100500507 Ga0070678_1005005072 110
61 3300005458 Ga0070681_10189005 Ga0070681_101890051 110
62 3300005458 Ga0070681_10319858 Ga0070681_103198582 110
63 3300005458 Ga0070681_10543503 Ga0070681_105435031 110
64 3300005458 Ga0070681_10607161 Ga0070681_106071613 110
65 3300005458 Ga0070681_10897494 Ga0070681_108974942 110
66 3300005466 Ga0070685_10858470 Ga0070685_108584702 110
67 3300005467 Ga0070706_101333660 Ga0070706_1013336602 110
68 3300005467 Ga0070706_101865351 Ga0070706_1018653512 110
69 3300005471 Ga0070698_101352577 Ga0070698_1013525772 110
70 3300005530 Ga0070679_100100050 Ga0070679_1001000503 110
71 3300005530 Ga0070679_100135371 Ga0070679_1001353713 110
72 3300005530 Ga0070679_100241550 Ga0070679_1002415502 110
73 3300005535 Ga0070684_100174595 Ga0070684_1001745956 110
74 3300005535 Ga0070684_100772185 Ga0070684_1007721852 110
75 3300005536 Ga0070697_100143823 Ga0070697_1001438232 110
76 3300005539 Ga0068853_100806856 Ga0068853_1008068562 110
77 3300005539 Ga0068853_101142511 Ga0068853_1011425111 110
78 3300005545 Ga0070695_100789063 Ga0070695_1007890632 110
79 3300005546 Ga0070696_101675678 Ga0070696_1016756782 110
80 3300005547 Ga0070693_100036361 Ga0070693_1000363613 110
81 3300005547 Ga0070693_100999916 Ga0070693_1009999162 110
82 3300005548 Ga0070665_101277442 Ga0070665_1012774422 110
83 3300005563 Ga0068855_100092442 Ga0068855_1000924422 110
84 3300005563 Ga0068855_100766770 Ga0068855_1007667703 110
85 3300005563 Ga0068855_100982715 Ga0068855_1009827152 110
86 3300005563 Ga0068855_101990740 Ga0068855_1019907401 110
87 3300005577 Ga0068857_100007213 Ga0068857_1000072133 110
88 3300005577 Ga0068857_100456149 Ga0068857_1004561491 110
89 3300005577 Ga0068857_101519794 Ga0068857_1015197942 110
90 3300005578 Ga0068854_100302366 Ga0068854_1003023662 110
91 3300005578 Ga0068854_101028884 Ga0068854_1010288842 110
92 3300005614 Ga0068856_100020597 Ga0068856_1000205978 110
93 3300005614 Ga0068856_102312137 Ga0068856_1023121372 110
94 3300005615 Ga0070702_100898400 Ga0070702_1008984002 110
95 3300005616 Ga0068852_100115767 Ga0068852_1001157674 110
96 3300005616 Ga0068852_100650407 Ga0068852_1006504072 110
97 3300005616 Ga0068852_102516539 Ga0068852_1025165392 110
98 3300005834 Ga0068851_10006319 Ga0068851_100063195 110
99 3300005834 Ga0068851_10528203 Ga0068851_105282032 110
100 3300005841 Ga0068863_100333957 Ga0068863_1003339573 110
101 3300005842 Ga0068858_100207113 Ga0068858_1002071132 110
102 3300005842 Ga0068858_100327572 Ga0068858_1003275722 110
103 3300005842 Ga0068858_100350618 Ga0068858_1003506182 110
104 3300005843 Ga0068860_100000217 Ga0068860_1000002173 110
105 3300005843 Ga0068860_100726539 Ga0068860_1007265392 110
106 3300005983 Ga0081540_1209013 Ga0081540_12090131 110
107 3300006028 Ga0070717_10070944 Ga0070717_100709444 110
108 3300006028 Ga0070717_10140806 Ga0070717_101408063 110
109 3300006028 Ga0070717_10156821 Ga0070717_101568213 110
110 3300006028 Ga0070717_11019647 Ga0070717_110196472 110
111 3300006028 Ga0070717_11045830 Ga0070717_110458302 110
112 3300006028 Ga0070717_11210540 Ga0070717_112105401 110
113 3300006038 Ga0075365_10198537 Ga0075365_101985372 110
114 3300006163 Ga0070715_10001767 Ga0070715_100017672 110
115 3300006163 Ga0070715_10002320 Ga0070715_100023206 110
116 3300006173 Ga0070716_100015839 Ga0070716_1000158392 110
117 3300006173 Ga0070716_100083540 Ga0070716_1000835403 110
118 3300006173 Ga0070716_100273398 Ga0070716_1002733982 110
119 3300006175 Ga0070712_100287940 Ga0070712_1002879402 110
120 3300006175 Ga0070712_100481674 Ga0070712_1004816742 110
121 3300006175 Ga0070712_100593392 Ga0070712_1005933922 110
122 3300006175 Ga0070712_100705105 Ga0070712_1007051053 110
123 3300006177 Ga0075362_10185477 Ga0075362_101854772 110
124 3300006237 Ga0097621_100100941 Ga0097621_1001009414 110
125 3300006237 Ga0097621_100816059 Ga0097621_1008160592 110
126 3300006358 Ga0068871_100590150 Ga0068871_1005901502 110
127 3300006358 Ga0068871_101293409 Ga0068871_1012934091 110
128 3300006871 Ga0075434_101573331 Ga0075434_1015733311 110
129 3300006914 Ga0075436_100579168 Ga0075436_1005791682 110
130 3300007076 Ga0075435_100340144 Ga0075435_1003401442 110
131 3300007265 Ga0099794_10718968 Ga0099794_107189681 110
132 3300007788 Ga0099795_10005381 Ga0099795_100053813 110
133 3300007788 Ga0099795_10025396 Ga0099795_100253964 110
134 3300007788 Ga0099795_10177057 Ga0099795_101770572 110
135 3300007788 Ga0099795_10224741 Ga0099795_102247412 110
136 3300009093 Ga0105240_10002281 Ga0105240_100022817 110
137 3300009093 Ga0105240_10006402 Ga0105240_100064024 110
138 3300009093 Ga0105240_10069586 Ga0105240_100695862 110
139 3300009093 Ga0105240_10722385 Ga0105240_107223851 110
140 3300009098 Ga0105245_11154132 Ga0105245_111541322 110
141 3300009101 Ga0105247_10006054 Ga0105247_100060548 110
142 3300009101 Ga0105247_11650762 Ga0105247_116507621 110
143 3300009174 Ga0105241_10000387 Ga0105241_1000038730 110
144 3300009174 Ga0105241_10357468 Ga0105241_103574682 110
145 3300009177 Ga0105248_11124666 Ga0105248_111246662 110
146 3300009545 Ga0105237_10032208 Ga0105237_100322085 110
147 3300009545 Ga0105237_10045417 Ga0105237_100454175 110
148 3300009545 Ga0105237_10053783 Ga0105237_100537833 110
149 3300009545 Ga0105237_10182076 Ga0105237_101820763 110
150 3300009545 Ga0105237_10314522 Ga0105237_103145222 110
151 3300009545 Ga0105237_10357531 Ga0105237_103575313 110
152 3300009545 Ga0105237_10775472 Ga0105237_107754722 110
153 3300009551 Ga0105238_10017279 Ga0105238_100172796 110
154 3300009551 Ga0105238_10071566 Ga0105238_100715663 110
155 3300009551 Ga0105238_10266889 Ga0105238_102668892 110
156 3300009551 Ga0105238_10826177 Ga0105238_108261772 110
157 3300009551 Ga0105238_11305842 Ga0105238_113058421 110
158 3300009551 Ga0105238_11799722 Ga0105238_117997221 110
159 3300009553 Ga0105249_12920968 Ga0105249_129209682 110
160 3300010159 Ga0099796_10008671 Ga0099796_100086712 110
161 3300010159 Ga0099796_10032297 Ga0099796_100322972 110
162 3300010159 Ga0099796_10134752 Ga0099796_101347522 110
163 3300010159 Ga0099796_10255034 Ga0099796_102550341 110
164 3300010375 Ga0105239_10010998 Ga0105239_100109984 110
165 3300010375 Ga0105239_10018870 Ga0105239_100188708 110
166 3300010375 Ga0105239_10055799 Ga0105239_100557993 110
167 3300010375 Ga0105239_10289336 Ga0105239_102893363 110
168 3300010375 Ga0105239_11886933 Ga0105239_118869332 110
169 3300013100 Ga0157373_10386352 Ga0157373_103863521 110
170 3300013102 Ga0157371_10163667 Ga0157371_101636673 110
171 3300013104 Ga0157370_10113453 Ga0157370_101134533 110
172 3300013104 Ga0157370_10208177 Ga0157370_102081774 110
173 3300013105 Ga0157369_10017915 Ga0157369_100179158 110
174 3300013105 Ga0157369_10076750 Ga0157369_100767502 110
175 3300013105 Ga0157369_10333113 Ga0157369_103331132 110
176 3300013297 Ga0157378_11066198 Ga0157378_110661981 110
177 3300013297 Ga0157378_11888699 Ga0157378_118886991 110
178 3300013297 Ga0157378_12140132 Ga0157378_121401321 110
179 3300013306 Ga0163162_11262114 Ga0163162_112621141 110
180 3300013306 Ga0163162_12733162 Ga0163162_127331622 110
181 3300013307 Ga0157372_10011343 Ga0157372_1001134310 110
182 3300013307 Ga0157372_10216613 Ga0157372_102166132 110
183 3300013308 Ga0157375_12953067 Ga0157375_129530672 110
184 3300014497 Ga0182008_10333335 Ga0182008_103333351 110
185 3300014968 Ga0157379_12114810 Ga0157379_121148102 110
186 3300020070 Ga0206356_11596629 Ga0206356_115966291 110
187 3300021377 Ga0213874_10064245 Ga0213874_100642452 110
188 3300021384 Ga0213876_10001030 Ga0213876_100010304 110
189 3300021384 Ga0213876_10058650 Ga0213876_100586502 110
190 3300025297 Ga0209758_1006913 Ga0209758_10069138 110
191 3300025321 Ga0207656_10063721 Ga0207656_100637212 110
192 3300025321 Ga0207656_10565558 Ga0207656_105655582 110
193 3300025898 Ga0207692_10014570 Ga0207692_100145702 110
194 3300025898 Ga0207692_10039490 Ga0207692_100394901 110
195 3300025898 Ga0207692_10042963 Ga0207692_100429633 110
196 3300025900 Ga0207710_10040294 Ga0207710_100402942 110
197 3300025901 Ga0207688_10270301 Ga0207688_102703012 110
198 3300025904 Ga0207647_10002364 Ga0207647_1000236415 110
199 3300025905 Ga0207685_10022592 Ga0207685_100225923 110
200 3300025905 Ga0207685_10023966 Ga0207685_100239663 110
201 3300025906 Ga0207699_10000504 Ga0207699_1000050411 110
202 3300025906 Ga0207699_10007966 Ga0207699_100079666 110
203 3300025906 Ga0207699_10539520 Ga0207699_105395202 110
204 3300025906 Ga0207699_10853068 Ga0207699_108530681 110
205 3300025909 Ga0207705_10212241 Ga0207705_102122412 110
206 3300025911 Ga0207654_10128056 Ga0207654_101280562 110
207 3300025912 Ga0207707_10001479 Ga0207707_100014794 110
208 3300025912 Ga0207707_10012648 Ga0207707_100126485 110
209 3300025912 Ga0207707_10053075 Ga0207707_100530752 110
210 3300025913 Ga0207695_10056577 Ga0207695_100565772 110
211 3300025914 Ga0207671_10143988 Ga0207671_101439882 110
212 3300025914 Ga0207671_10205510 Ga0207671_102055102 110
213 3300025914 Ga0207671_10380751 Ga0207671_103807512 110
214 3300025915 Ga0207693_10006678 Ga0207693_1000667810 110
215 3300025915 Ga0207693_10025530 Ga0207693_100255305 110
216 3300025915 Ga0207693_10170699 Ga0207693_101706991 110
217 3300025915 Ga0207693_10223631 Ga0207693_102236312 110
218 3300025915 Ga0207693_10399658 Ga0207693_103996582 110
219 3300025916 Ga0207663_10001118 Ga0207663_1000111815 110
220 3300025917 Ga0207660_10017029 Ga0207660_100170293 110
221 3300025917 Ga0207660_10196043 Ga0207660_101960432 110
222 3300025919 Ga0207657_10053480 Ga0207657_100534803 110
223 3300025919 Ga0207657_10598678 Ga0207657_105986782 110
224 3300025919 Ga0207657_10764977 Ga0207657_107649772 110
225 3300025920 Ga0207649_10603451 Ga0207649_106034512 110
226 3300025921 Ga0207652_10005915 Ga0207652_100059158 110
227 3300025921 Ga0207652_10519351 Ga0207652_105193512 110
228 3300025921 Ga0207652_10558208 Ga0207652_105582082 110
229 3300025924 Ga0207694_10280205 Ga0207694_102802052 110
230 3300025924 Ga0207694_10792917 Ga0207694_107929172 110
231 3300025927 Ga0207687_11083003 Ga0207687_110830031 110
232 3300025928 Ga0207700_10046865 Ga0207700_100468652 110
233 3300025928 Ga0207700_10066647 Ga0207700_100666472 110
234 3300025928 Ga0207700_10200060 Ga0207700_102000602 110
235 3300025928 Ga0207700_10394441 Ga0207700_103944412 110
236 3300025928 Ga0207700_10651051 Ga0207700_106510512 110
237 3300025929 Ga0207664_10019715 Ga0207664_100197154 110
238 3300025929 Ga0207664_10070113 Ga0207664_100701132 110
239 3300025931 Ga0207644_10554366 Ga0207644_105543661 110
240 3300025932 Ga0207690_10201877 Ga0207690_102018773 110
241 3300025932 Ga0207690_10320373 Ga0207690_103203732 110
242 3300025935 Ga0207709_11540464 Ga0207709_115404641 110
243 3300025937 Ga0207669_10369115 Ga0207669_103691152 110
244 3300025938 Ga0207704_11270574 Ga0207704_112705742 110
245 3300025939 Ga0207665_10004372 Ga0207665_1000437211 110
246 3300025939 Ga0207665_10074448 Ga0207665_100744483 110
247 3300025939 Ga0207665_10189654 Ga0207665_101896541 110
248 3300025939 Ga0207665_10670882 Ga0207665_106708822 110
249 3300025939 Ga0207665_11072513 Ga0207665_110725131 110
250 3300025944 Ga0207661_10033385 Ga0207661_100333854 110
251 3300025944 Ga0207661_10455642 Ga0207661_104556422 110
252 3300025949 Ga0207667_10207653 Ga0207667_102076532 110
253 3300025949 Ga0207667_11116168 Ga0207667_111161681 110
254 3300025981 Ga0207640_10038737 Ga0207640_100387372 110
255 3300025981 Ga0207640_10453615 Ga0207640_104536152 110
256 3300026023 Ga0207677_11316707 Ga0207677_113167072 110
257 3300026035 Ga0207703_10420600 Ga0207703_104206002 110
258 3300026035 Ga0207703_10585561 Ga0207703_105855612 110
259 3300026035 Ga0207703_11869909 Ga0207703_118699092 110
260 3300026041 Ga0207639_10068421 Ga0207639_100684213 110
261 3300026067 Ga0207678_10807829 Ga0207678_108078292 110
262 3300026067 Ga0207678_11132178 Ga0207678_111321781 110
263 3300026067 Ga0207678_11212483 Ga0207678_112124832 110
264 3300026116 Ga0207674_10002366 Ga0207674_1000236617 110
265 3300026116 Ga0207674_10739100 Ga0207674_107391002 110
266 3300026116 Ga0207674_11006404 Ga0207674_110064042 110
267 3300026121 Ga0207683_10692530 Ga0207683_106925302 110
268 3300026142 Ga0207698_10065719 Ga0207698_100657194 110
269 3300026142 Ga0207698_10103631 Ga0207698_101036312 110
270 3300027671 Ga0209588_1001138 Ga0209588_10011382 110
271 3300028381 Ga0268264_10000271 Ga0268264_100002713 110
272 3300028381 Ga0268264_10357532 Ga0268264_103575322 110
273 3300030521 Ga0307511_10138741 Ga0307511_101387412 110
274 3300030521 Ga0307511_10193517 Ga0307511_101935172 110
275 3300030760 Ga0265762_1188664 Ga0265762_11886641 110
276 3300031235 Ga0265330_10029779 Ga0265330_100297791 110
277 3300031249 Ga0265339_10106083 Ga0265339_101060832 110
278 3300031249 Ga0265339_10291540 Ga0265339_102915401 110
279 3300031250 Ga0265331_10047281 Ga0265331_100472813 110
280 3300031507 Ga0307509_10066441 Ga0307509_100664415 110
281 3300031507 Ga0307509_10147325 Ga0307509_101473253 110
282 3300031616 Ga0307508_10000541 Ga0307508_100005413 110
283 3300031616 Ga0307508_10652651 Ga0307508_106526511 110
284 3300031711 Ga0265314_10085107 Ga0265314_100851073 110
285 3300031712 Ga0265342_10034049 Ga0265342_100340492 110
286 3300031730 Ga0307516_10016567 Ga0307516_100165676 110
287 3300032126 Ga0307415_100313972 Ga0307415_1003139721 110
288 3300033179 Ga0307507_10180798 Ga0307507_101807982 110
289 3300033545 Ga0316214_1016739 Ga0316214_10167391 110
290 3300035083 Ga0373926_0008279 Ga0373926_0008279_926_1258 110
291 3300035083 Ga0373926_0102798 Ga0373926_0102798_283_615 110
292 3300035083 Ga0373926_0294854 Ga0373926_0294854_77_409 110
293 3300035111 Ga0373923_0044205 Ga0373923_0044205_165_497 110
294 3300035111 Ga0373923_0399400 Ga0373923_0399400_103_435 110
295 3300035113 Ga0373936_0046381 Ga0373936_0046381_548_880 110
296 3300035113 Ga0373936_0048109 Ga0373936_0048109_581_913 110
297 3300035116 Ga0373945_0026055 Ga0373945_0026055_276_608 110
298 3300035116 Ga0373945_0052796 Ga0373945_0052796_328_660 110
299 3300035116 Ga0373945_0481877 Ga0373945_0481877_18_350 110
300 3300035117 Ga0373953_0045173 Ga0373953_0045173_1281_1613 110
301 3300035117 Ga0373953_0131244 Ga0373953_0131244_476_808 110
302 3300035118 Ga0373954_0011541 Ga0373954_0011541_3410_3742 110
303 3300035118 Ga0373954_0067297 Ga0373954_0067297_868_1200 110
304 3300035118 Ga0373954_0166130 Ga0373954_0166130_49_381 110
305 3300035118 Ga0373954_0421341 Ga0373954_0421341_203_535 110
306 3300035119 Ga0373956_0170189 Ga0373956_0170189_132_464 110
307 3300035119 Ga0373956_0282485 Ga0373956_0282485_326_658 110
308 3300035120 Ga0373957_0019273 Ga0373957_0019273_611_943 110
309 3300035170 Ga0373943_0011684 Ga0373943_0011684_633_965 110
310 3300035170 Ga0373943_0024472 Ga0373943_0024472_892_1224 110
311 3300035170 Ga0373943_0284016 Ga0373943_0284016_439_771 110
312 3300035170 Ga0373943_0988811 Ga0373943_0988811_47_379 110
313 3300035171 Ga0373946_0100132 Ga0373946_0100132_917_1249 110
314 3300035172 Ga0373955_0362572 Ga0373955_0362572_235_567 110
315 3300035172 Ga0373955_0373130 Ga0373955_0373130_203_535 110
316 3300035172 Ga0373955_0569120 Ga0373955_0569120_235_567 110
317 3300035172 Ga0373955_1021243 Ga0373955_1021243_76_408 110
318 3300035410 Ga0373924_0141622 Ga0373924_0141622_651_983 110
319 3300035410 Ga0373924_0267719 Ga0373924_0267719_331_663 110
320 3300035692 Ga0373935_0012834 Ga0373935_0012834_927_1259 110
321 3300035692 Ga0373935_0040630 Ga0373935_0040630_927_1259 110
322 3300035692 Ga0373935_0044908 Ga0373935_0044908_915_1247 110
323 3300035692 Ga0373935_0107798 Ga0373935_0107798_1304_1636 110
324 3300035692 Ga0373935_0343294 Ga0373935_0343294_407_739 110
325 3300035692 Ga0373935_0504404 Ga0373935_0504404_285_617 110
326 3300035695 Ga0373927_0001230 Ga0373927_0001230_927_1259 110
327 3300035695 Ga0373927_0005221 Ga0373927_0005221_661_993 110
328 3300035695 Ga0373927_0011945 Ga0373927_0011945_5277_5609 110
329 3300035695 Ga0373927_0103934 Ga0373927_0103934_377_709 110
330 3300035695 Ga0373927_0214044 Ga0373927_0214044_747_1079 110
331 3300035695 Ga0373927_0246425 Ga0373927_0246425_646_978 110
332 3300035724 Ga0373933_0000127 Ga0373933_0000127_266_598 110
333 3300035724 Ga0373933_0235676 Ga0373933_0235676_227_559 110
334 3300035724 Ga0373933_0311888 Ga0373933_0311888_126_458 110
335 3300035724 Ga0373933_0480671 Ga0373933_0480671_449_781 110
336 3300035724 Ga0373933_0715247 Ga0373933_0715247_38_370 110
337 3300035725 Ga0373947_0006336 Ga0373947_0006336_868_1200 110
338 3300035725 Ga0373947_0093150 Ga0373947_0093150_722_1054 110
339 3300035725 Ga0373947_0139383 Ga0373947_0139383_1032_1364 110
340 3300035725 Ga0373947_0283339 Ga0373947_0283339_466_798 110
341 3300036401 Ga0373937_0051021 Ga0373937_0051021_2592_2924 110
342 3300036401 Ga0373937_0064183 Ga0373937_0064183_1638_1970 110
343 3300036401 Ga0373937_0085421 Ga0373937_0085421_145_477 110
344 3300036401 Ga0373937_0522338 Ga0373937_0522338_253_585 110
345 3300036459 Ga0372808_050709 Ga0372808_050709_241_573 110
346 3300037068 Ga0373925_0002121 Ga0373925_0002121_15049_15381 110
347 3300037068 Ga0373925_0082948 Ga0373925_0082948_214_546 110
348 3300037068 Ga0373925_0202744 Ga0373925_0202744_900_1232 110
349 3300037068 Ga0373925_0538975 Ga0373925_0538975_204_536 110
350 3300037418 Ga0395900_0832897 Ga0395900_0832897_447_779 110
351 3300039437 Ga0436365_0022683 Ga0436365_0022683_2170_2502 110
352 3300039437 Ga0436365_0365629 Ga0436365_0365629_2510_2842 110
353 3300039437 Ga0436365_0547188 Ga0436365_0547188_53_385 110
354 3300039438 Ga0436360_0536456 Ga0436360_0536456_988_1320 110
355 3300039438 Ga0436360_0546753 Ga0436360_0546753_167_499 110
356 3300039450 Ga0436363_0186306 Ga0436363_0186306_2070_2402 110
357 3300039450 Ga0436363_0714205 Ga0436363_0714205_243_575 110
358 3300039453 Ga0436362_0842663 Ga0436362_0842663_5279_5611 110
359 3300041452 Ga0451793_0761067 Ga0451793_0761067_299_631 110
360 3300041453 Ga0451797_1546518 Ga0451797_1546518_433_768 110
361 3300041505 Ga0451849_1115692 Ga0451849_1115692_234_569 110
362 3300041512 Ga0451853_2103161 Ga0451853_2103161_128_463 110
363 3300044694 Ga0466963_0106052 Ga0466963_0106052_31_363 110
364 3300044694 Ga0466963_0585322 Ga0466963_0585322_95_427 110
365 3300045976 Ga0466967_0349897 Ga0466967_0349897_1041_1373 110
366 3300046454 Ga0495592_0443558 Ga0495592_0443558_120_452 110
367 3300046454 Ga0495592_0957101 Ga0495592_0957101_104_436 110
368 3300046455 Ga0495603_0000667 Ga0495603_0000667_18200_18532 110
369 3300046455 Ga0495603_0108451 Ga0495603_0108451_1180_1512 110
370 3300046455 Ga0495603_0216295 Ga0495603_0216295_189_521 110
371 3300046459 Ga0495629_0000283 Ga0495629_0000283_21920_22252 110
372 3300046459 Ga0495629_0059945 Ga0495629_0059945_1089_1421 110
373 3300046460 Ga0495638_0556750 Ga0495638_0556750_11_343 110
374 3300046461 Ga0495641_0006447 Ga0495641_0006447_6423_6755 110
375 3300046462 Ga0495651_0066864 Ga0495651_0066864_1361_1693 110
376 3300046463 Ga0495653_0455846 Ga0495653_0455846_381_713 110
377 3300046472 Ga0495580_0002411 Ga0495580_0002411_15416_15748 110
378 3300046472 Ga0495580_0028511 Ga0495580_0028511_2837_3169 110
379 3300046473 Ga0495582_0032135 Ga0495582_0032135_1700_2032 110
380 3300046473 Ga0495582_0055453 Ga0495582_0055453_1831_2163 110
381 3300046475 Ga0495639_0000423 Ga0495639_0000423_18972_19304 110
382 3300046475 Ga0495639_0102827 Ga0495639_0102827_193_525 110
383 3300046475 Ga0495639_0104588 Ga0495639_0104588_887_1219 110
384 3300046476 Ga0495662_0000186 Ga0495662_0000186_23501_23833 110
385 3300046477 Ga0495664_0004204 Ga0495664_0004204_1079_1411 110
386 3300046477 Ga0495664_0058995 Ga0495664_0058995_899_1231 110
387 3300046477 Ga0495664_0829734 Ga0495664_0829734_55_387 110
388 3300046499 Ga0495594_0001986 Ga0495594_0001986_9448_9780 110
389 3300046499 Ga0495594_0291210 Ga0495594_0291210_142_474 110
390 3300046511 Ga0495608_0610130 Ga0495608_0610130_268_600 110
391 3300046514 Ga0495618_0040958 Ga0495618_0040958_309_641 110
392 3300046514 Ga0495618_0092687 Ga0495618_0092687_90_422 110
393 3300046516 Ga0495628_0012222 Ga0495628_0012222_1312_1644 110
394 3300046516 Ga0495628_0037593 Ga0495628_0037593_1175_1507 110
395 3300046516 Ga0495628_0235378 Ga0495628_0235378_635_967 110
396 3300046517 Ga0495630_0021544 Ga0495630_0021544_4291_4623 110
397 3300046517 Ga0495630_0025317 Ga0495630_0025317_3843_4175 110
398 3300046517 Ga0495630_0422188 Ga0495630_0422188_75_407 110
399 3300046524 Ga0495648_0001145 Ga0495648_0001145_785_1117 110
400 3300046526 Ga0495666_0169613 Ga0495666_0169613_153_485 110
401 3300046529 Ga0495652_0015775 Ga0495652_0015775_6265_6597 110
402 3300046529 Ga0495652_0143215 Ga0495652_0143215_1502_1834 110
403 3300046529 Ga0495652_0537655 Ga0495652_0537655_302_634 110
404 3300046531 Ga0495665_0001096 Ga0495665_0001096_864_1196 110
405 3300046531 Ga0495665_0105411 Ga0495665_0105411_224_556 110
406 3300046533 Ga0495640_0077705 Ga0495640_0077705_819_1151 110
407 3300046535 Ga0495586_0099069 Ga0495586_0099069_445_777 110
408 3300046536 Ga0495587_0653882 Ga0495587_0653882_43_375 110
409 3300046543 Ga0495645_0148431 Ga0495645_0148431_1196_1528 110
410 3300046543 Ga0495645_0541065 Ga0495645_0541065_255_587 110
411 3300046543 Ga0495645_0863905 Ga0495645_0863905_177_509 110
412 3300046557 Ga0495622_0017461 Ga0495622_0017461_896_1228 110
413 3300046559 Ga0495667_0063250 Ga0495667_0063250_467_799 110
414 3300046559 Ga0495667_0090293 Ga0495667_0090293_943_1275 110
415 3300046642 Ga0495634_0031856 Ga0495634_0031856_877_1209 110
416 3300046642 Ga0495634_0116335 Ga0495634_0116335_57_389 110
417 3300046663 Ga0495635_0002530 Ga0495635_0002530_11267_11599 110
418 3300046663 Ga0495635_0201842 Ga0495635_0201842_22_354 110
419 3300046674 Ga0495588_0017451 Ga0495588_0017451_2303_2635 110
420 3300046675 Ga0495657_0049749 Ga0495657_0049749_85_417 110
421 3300046678 Ga0495599_0115407 Ga0495599_0115407_347_679 110
422 3300046678 Ga0495599_0117960 Ga0495599_0117960_870_1202 110
423 3300046678 Ga0495599_0142769 Ga0495599_0142769_840_1172 110
424 3300046679 Ga0495623_0211706 Ga0495623_0211706_505_837 110
425 3300046679 Ga0495623_0217396 Ga0495623_0217396_461_793 110
426 3300046679 Ga0495623_0477763 Ga0495623_0477763_92_424 110
427 3300046680 Ga0495646_0007232 Ga0495646_0007232_350_682 110
428 3300046681 Ga0495647_0001483 Ga0495647_0001483_1745_2077 110
429 3300046683 Ga0495658_0281842 Ga0495658_0281842_276_608 110
430 3300046683 Ga0495658_0507566 Ga0495658_0507566_342_674 110
431 3300046689 Ga0495613_0001910 Ga0495613_0001910_846_1178 110
432 3300046689 Ga0495613_0104432 Ga0495613_0104432_96_428 110
433 3300046689 Ga0495613_0565336 Ga0495613_0565336_274_606 110
434 3300046690 Ga0495624_0001800 Ga0495624_0001800_912_1244 110
435 3300046690 Ga0495624_0208994 Ga0495624_0208994_662_994 110
436 3300046690 Ga0495624_0258095 Ga0495624_0258095_538_870 110
437 3300046809 Ga0495600_0028095 Ga0495600_0028095_2198_2530 110
438 3300046809 Ga0495600_0823894 Ga0495600_0823894_130_462 110
439 3300047315 Ga0495581_0000346 Ga0495581_0000346_877_1209 110
440 3300047315 Ga0495581_0096893 Ga0495581_0096893_294_626 110
441 3300047315 Ga0495581_0200019 Ga0495581_0200019_135_467 110
442 3300047317 Ga0495604_0165859 Ga0495604_0165859_527_859 110
443 3300047319 Ga0495674_0024064 Ga0495674_0024064_1398_1730 110
444 3300047319 Ga0495674_0025391 Ga0495674_0025391_829_1161 110
445 3300047319 Ga0495674_0656974 Ga0495674_0656974_44_376 110
446 3300047319 Ga0495674_1035960 Ga0495674_1035960_247_579 110
447 3300047321 Ga0495676_0049875 Ga0495676_0049875_2225_2557 110
448 3300047321 Ga0495676_0121149 Ga0495676_0121149_121_453 110
449 3300047321 Ga0495676_0243605 Ga0495676_0243605_125_457 110
450 3300047322 Ga0495680_0348673 Ga0495680_0348673_224_556 110
451 3300047322 Ga0495680_0360978 Ga0495680_0360978_82_414 110
452 3300047444 Ga0495675_0136140 Ga0495675_0136140_205_537 110
453 3300047469 Ga0495673_0067532 Ga0495673_0067532_379_711 110
454 3300047471 Ga0495684_0023592 Ga0495684_0023592_30_362 110
455 3300047471 Ga0495684_0330432 Ga0495684_0330432_524_856 110
456 3300047471 Ga0495684_0823378 Ga0495684_0823378_68_400 110
457 3300047472 Ga0495686_0426559 Ga0495686_0426559_197_529 110
458 3300047673 Ga0495593_0001297 Ga0495593_0001297_910_1242 110
459 3300048089 Ga0495614_0023670 Ga0495614_0023670_1487_1819 110
460 3300048089 Ga0495614_0513173 Ga0495614_0513173_42_374 110
461 3300048903 Ga0496100_0278761 Ga0496100_0278761_843_1175 110
462 3300048903 Ga0496100_0354848 Ga0496100_0354848_637_969 110
463 3300048905 Ga0496102_0873973 Ga0496102_0873973_297_629 110
464 3300048909 Ga0496106_0004187 Ga0496106_0004187_1740_2072 110
465 3300048909 Ga0496106_0234764 Ga0496106_0234764_507_845 110
466 3300048909 Ga0496106_0395328 Ga0496106_0395328_22_354 110
467 3300048911 Ga0496108_0118230 Ga0496108_0118230_543_875 110
468 3300048911 Ga0496108_1396351 Ga0496108_1396351_85_417 110
469 3300048914 Ga0496111_0479652 Ga0496111_0479652_551_883 110
470 3300048918 Ga0496115_0144172 Ga0496115_0144172_210_542 110
471 3300048918 Ga0496115_0241214 Ga0496115_0241214_761_1093 110
472 3300048919 Ga0496116_0381962 Ga0496116_0381962_248_580 110
473 3300048920 Ga0496117_0014725 Ga0496117_0014725_3360_3692 110
474 3300048920 Ga0496117_0435072 Ga0496117_0435072_209_541 110
475 3300048921 Ga0496118_0006821 Ga0496118_0006821_5086_5418 110
476 3300048922 Ga0496119_0180984 Ga0496119_0180984_430_762 110
477 3300048924 Ga0496121_0000218 Ga0496121_0000218_73649_73981 110
478 3300048924 Ga0496121_0002143 Ga0496121_0002143_26201_26533 110
479 3300048924 Ga0496121_0340818 Ga0496121_0340818_297_629 110
480 3300048924 Ga0496121_0880585 Ga0496121_0880585_122_454 110
481 3300048927 Ga0496124_0001333 Ga0496124_0001333_7432_7764 110
482 3300048927 Ga0496124_0369241 Ga0496124_0369241_564_896 110
483 3300048928 Ga0496125_0064474 Ga0496125_0064474_2045_2377 110
484 3300048929 Ga0496126_0001598 Ga0496126_0001598_32871_33203 110
485 3300048929 Ga0496126_0008691 Ga0496126_0008691_10217_10549 110
486 3300048929 Ga0496126_0085347 Ga0496126_0085347_908_1240 110
487 3300048929 Ga0496126_0097984 Ga0496126_0097984_1362_1694 110
488 3300048929 Ga0496126_0241475 Ga0496126_0241475_741_1073 110
489 3300048929 Ga0496126_0257554 Ga0496126_0257554_938_1270 110
490 3300048929 Ga0496126_0312868 Ga0496126_0312868_343_675 110
491 3300048929 Ga0496126_0659480 Ga0496126_0659480_70_402 110
492 3300049568 Ga0501031_0004410 Ga0501031_0004410_3694_4026 110
493 3300049568 Ga0501031_0021326 Ga0501031_0021326_150_482 110
494 3300049569 Ga0501032_0002147 Ga0501032_0002147_11159_11491 110
495 3300049569 Ga0501032_0130164 Ga0501032_0130164_310_642 110
496 3300049570 Ga0501033_0000060 Ga0501033_0000060_82900_83232 110
497 3300049570 Ga0501033_0021876 Ga0501033_0021876_3138_3470 110
498 3300049570 Ga0501033_0027600 Ga0501033_0027600_315_647 110
499 3300049571 Ga0501034_0000117 Ga0501034_0000117_117565_117897 110
500 3300049571 Ga0501034_0049060 Ga0501034_0049060_3014_3346 110
501 3300049571 Ga0501034_0100173 Ga0501034_0100173_2488_2820 110
502 3300049571 Ga0501034_0577466 Ga0501034_0577466_232_564 110
503 3300049572 Ga0501036_0000188 Ga0501036_0000188_29610_29942 110
504 3300049572 Ga0501036_0087493 Ga0501036_0087493_161_493 110
505 3300049572 Ga0501036_0857463 Ga0501036_0857463_90_422 110
506 3300049573 Ga0501037_0000402 Ga0501037_0000402_24970_25302 110
507 3300049573 Ga0501037_0003037 Ga0501037_0003037_10368_10700 110
508 3300049573 Ga0501037_0031760 Ga0501037_0031760_1436_1768 110
509 3300049573 Ga0501037_0190184 Ga0501037_0190184_129_461 110
510 3300049574 Ga0501038_0000540 Ga0501038_0000540_21797_22129 110
511 3300049574 Ga0501038_0051880 Ga0501038_0051880_1712_2044 110
512 3300049574 Ga0501038_0105274 Ga0501038_0105274_1863_2195 110
513 3300049574 Ga0501038_0218519 Ga0501038_0218519_47_379 110
514 3300049575 Ga0501039_0000431 Ga0501039_0000431_6603_6935 110
515 3300049575 Ga0501039_0016436 Ga0501039_0016436_4226_4558 110
516 3300049576 Ga0501040_0103606 Ga0501040_0103606_1120_1452 110
517 3300049577 Ga0501041_0483703 Ga0501041_0483703_83_415 110
518 3300049578 Ga0501042_0011425 Ga0501042_0011425_3410_3742 110
519 3300049578 Ga0501042_0070294 Ga0501042_0070294_143_475 110
520 3300049578 Ga0501042_0102846 Ga0501042_0102846_1589_1921 110
521 3300049579 Ga0501043_0002749 Ga0501043_0002749_11085_11417 110
522 3300049579 Ga0501043_0018739 Ga0501043_0018739_952_1284 110
523 3300049580 Ga0501046_0001915 Ga0501046_0001915_11897_12229 110
524 3300049580 Ga0501046_0014783 Ga0501046_0014783_329_661 110
525 3300049580 Ga0501046_0027066 Ga0501046_0027066_95_427 110
526 3300049580 Ga0501046_0069536 Ga0501046_0069536_1365_1697 110
527 3300049581 Ga0501047_0000246 Ga0501047_0000246_26896_27228 110
528 3300049581 Ga0501047_0079183 Ga0501047_0079183_373_705 110
529 3300049581 Ga0501047_0218672 Ga0501047_0218672_1301_1633 110
530 3300049582 Ga0501048_0000878 Ga0501048_0000878_16319_16651 110
531 3300049582 Ga0501048_0020139 Ga0501048_0020139_129_461 110
532 3300049582 Ga0501048_1291810 Ga0501048_1291810_124_456 110
533 3300049583 Ga0501067_0000320 Ga0501067_0000320_16476_16808 110
534 3300049583 Ga0501067_0382677 Ga0501067_0382677_290_622 110
535 3300049584 Ga0501068_0002924 Ga0501068_0002924_5046_5378 110
536 3300049584 Ga0501068_0017885 Ga0501068_0017885_1369_1701 110
537 3300049585 Ga0501069_0005134 Ga0501069_0005134_2239_2571 110
538 3300049586 Ga0501070_0000779 Ga0501070_0000779_13294_13626 110
539 3300049586 Ga0501070_0018706 Ga0501070_0018706_2477_2809 110
540 3300049586 Ga0501070_0765766 Ga0501070_0765766_114_446 110
541 3300049586 Ga0501070_1356414 Ga0501070_1356414_17_349 110
542 3300049587 Ga0501071_0174123 Ga0501071_0174123_136_468 110
543 3300049588 Ga0501072_0004819 Ga0501072_0004819_9762_10094 110
544 3300049588 Ga0501072_0108254 Ga0501072_0108254_1757_2089 110
545 3300049589 Ga0501073_0000093 Ga0501073_0000093_30437_30769 110
546 3300049589 Ga0501073_0144808 Ga0501073_0144808_15_347 110
547 3300049589 Ga0501073_0390209 Ga0501073_0390209_27_359 110
548 3300049590 Ga0501074_0000127 Ga0501074_0000127_10924_11256 110
549 3300049590 Ga0501074_0025558 Ga0501074_0025558_3796_4128 110
550 3300049593 Ga0501077_0239533 Ga0501077_0239533_625_957 110
551 3300049741 Ga0501079_0001174 Ga0501079_0001174_8803_9135 110
552 3300049741 Ga0501079_0598781 Ga0501079_0598781_178_510 110
553 3300049742 Ga0501080_0001845 Ga0501080_0001845_874_1206 110
554 3300049742 Ga0501080_0034825 Ga0501080_0034825_4056_4388 110
555 3300049744 Ga0501083_0008877 Ga0501083_0008877_5274_5606 110
556 3300049744 Ga0501083_0232920 Ga0501083_0232920_411_743 110
557 3300049822 Ga0501035_0000798 Ga0501035_0000798_5148_5480 110
558 3300049822 Ga0501035_0084415 Ga0501035_0084415_435_767 110
559 3300049822 Ga0501035_0116281 Ga0501035_0116281_163_495 110
560 3300049822 Ga0501035_0314792 Ga0501035_0314792_223_555 110
561 3300049822 Ga0501035_0710922 Ga0501035_0710922_163_495 110
562 3300049822 Ga0501035_1228109 Ga0501035_1228109_86_418 110
563 3300049823 Ga0501044_0005195 Ga0501044_0005195_2489_2821 110
564 3300049823 Ga0501044_0023777 Ga0501044_0023777_535_867 110
565 3300049823 Ga0501044_0729152 Ga0501044_0729152_174_506 110
566 3300049823 Ga0501044_1208904 Ga0501044_1208904_129_461 110
567 3300049824 Ga0501045_1043881 Ga0501045_1043881_173_505 110
568 3300050492 nmdc:mga0yw44_358288_c1 nmdc:mga0yw44_358288_c1_288_623 110
569 3300050512 nmdc:mga0n895_1900863_c1 nmdc:mga0n895_1900863_c1_207_539 110
570 3300050512 nmdc:mga0n895_203510_c1 nmdc:mga0n895_203510_c1_1113_1445 110
571 3300053077 Ga0495601_0127648 Ga0495601_0127648_944_1276 110
572 3300053077 Ga0495601_0161268 Ga0495601_0161268_926_1258 110
573 3300053078 Ga0495612_0007154 Ga0495612_0007154_2410_2742 110
574 3300053080 Ga0500635_0005826 Ga0500635_0005826_2001_2333 110
575 3300053080 Ga0500635_0052312 Ga0500635_0052312_437_769 110
576 3300053084 Ga0495595_0345974 Ga0495595_0345974_237_569 110
577 3300053085 Ga0495619_0084347 Ga0495619_0084347_661_993 110
578 3300053085 Ga0495619_0503838 Ga0495619_0503838_25_357 110
579 3300053086 Ga0500578_0525968 Ga0500578_0525968_267_599 110
580 3300053093 Ga0500651_0005693 Ga0500651_0005693_3007_3339 110
581 3300053094 Ga0500566_0488259 Ga0500566_0488259_74_406 110
582 3300053097 Ga0500648_056450 Ga0500648_056450_1683_2015 110
583 3300053098 Ga0500650_0071799 Ga0500650_0071799_183_515 110
584 3300053102 Ga0500554_002561 Ga0500554_002561_1081_1413 110
585 3300053118 Ga0500594_0016326 Ga0500594_0016326_1165_1497 110
586 3300053119 Ga0500595_027430 Ga0500595_027430_1560_1892 110
587 3300053136 Ga0500559_0039350 Ga0500559_0039350_1343_1675 110
588 3300053140 Ga0500573_0041160 Ga0500573_0041160_1795_2127 110
589 3300053146 Ga0500588_0268301 Ga0500588_0268301_299_631 110
590 3300053148 Ga0500590_108911 Ga0500590_108911_182_514 110
591 3300053150 Ga0500603_031587 Ga0500603_031587_207_539 110
592 3300053150 Ga0500603_132247 Ga0500603_132247_384_716 110
593 3300053150 Ga0500603_285611 Ga0500603_285611_76_408 110
594 3300053151 Ga0500604_0095532 Ga0500604_0095532_74_406 110
595 3300053154 Ga0500619_307169 Ga0500619_307169_36_368 110
596 3300053158 Ga0500627_0107403 Ga0500627_0107403_515_847 110
597 3300053163 Ga0500639_157090 Ga0500639_157090_602_934 110
598 3300053177 Ga0500636_0017280 Ga0500636_0017280_2760_3092 110
599 3300053177 Ga0500636_0124922 Ga0500636_0124922_263_595 110
600 3300053177 Ga0500636_0197630 Ga0500636_0197630_99_431 110
601 3300053177 Ga0500636_0209106 Ga0500636_0209106_575_907 110
602 3300053177 Ga0500636_0246599 Ga0500636_0246599_31_363 110
603 3300053178 Ga0500637_0509850 Ga0500637_0509850_11_343 110
604 3300053724 Ga0500570_080332 Ga0500570_080332_526_858 110
605 3300053730 Ga0500645_175617 Ga0500645_175617_74_406 110
606 3300054114 Ga0501084_0095316 Ga0501084_0095316_1342_1674 110
607 3300054114 Ga0501084_0144392 Ga0501084_0144392_1495_1827 110
608 3300060353 Ga0501082_0004139 Ga0501082_0004139_4809_5141 110
609 iso_pu_bacteria 2507262055 2507511797 110
610 iso_pu_bacteria 2508501009 2508545463 110
611 iso_pu_bacteria 2508501042 2508694278 110
612 iso_pu_bacteria 2511231028 2511396753 110
613 iso_pu_bacteria 2513237092 2513626757 110
614 iso_pu_bacteria 2513237094 2513643375 110
615 iso_pu_bacteria 2513237095 2513648227 110
616 iso_pu_bacteria 2513237102 2513701633 110
617 iso_pu_bacteria 2513237139 2513875219 110
618 iso_pu_bacteria 2513237161 2514014328 110
619 iso_pu_bacteria 2515154112 2515624796 110
620 iso_pu_bacteria 2528768022 2528853593 110
621 iso_pu_bacteria 2617270735 2617349550 110
622 iso_pu_bacteria 2617270741 2617376742 110
623 iso_pu_bacteria 2791355196 2793059715 110
624 iso_pu_bacteria 2802429603 2805919588 110
625 iso_pu_bacteria 2816332527 2818239805 110
626 iso_pu_bacteria 2824600985 2824605942 110
627 iso_pu_bacteria 2824609381 2824613390 110
628 iso_pu_bacteria 2824617872 2824623729 110
629 iso_pu_bacteria 2824626560 2824633369 110
630 iso_pu_bacteria 2824635225 2824640208 110
631 iso_pu_bacteria 2824644064 2824648909 110
632 iso_pu_bacteria 2824661429 2824670165 110
633 iso_pu_bacteria 2824671348 2824676401 110
634 iso_pu_bacteria 2824679649 2824685214 110
635 iso_pu_bacteria 2824687955 2824694440 110
636 iso_pu_bacteria 2824696289 2824702510 110
637 iso_pu_bacteria 2824704595 2824710625 110
638 iso_pu_bacteria 2824714736 2824722449 110
639 iso_pu_bacteria 2824723954 2824729205 110
640 iso_pu_bacteria 2824732956 2824739367 110
641 iso_pu_bacteria 2824746037 2824749745 110
642 iso_pu_bacteria 2824753945 2824760733 110
643 iso_pu_bacteria 2824763712 2824770450 110
644 iso_pu_bacteria 2824773399 2824777918 110
645 iso_pu_bacteria 2838122688 2838130518 110
646 iso_pu_bacteria 2841941048 2841942175 110
647 iso_pu_bacteria 2841949485 2841955365 110
648 iso_pu_bacteria 2841957949 2841963598 110
649 iso_pu_bacteria 2841966195 2841971302 110
650 iso_pu_bacteria 2841974524 2841981594 110
651 iso_pu_bacteria 2841983080 2841987098 110
652 iso_pu_bacteria 2842038055 2842042081 110
653 iso_pu_bacteria 2842045827 2842050124 110
654 iso_pu_bacteria 2844315083 2844321008 110
655 iso_pu_bacteria 2847939898 2847943621 110
656 iso_pu_bacteria 2849076700 2849077345 110
657 iso_pu_bacteria 2857509624 2857515050 110
658 iso_pu_bacteria 2874590934 2874593637 110
659 iso_pu_bacteria 2874612657 2874614072 110
660 iso_pu_bacteria 2874620515 2874624933 110
661 iso_pu_bacteria 2874628541 2874631066 110
662 iso_pu_bacteria 2874645413 2874648350 110
663 iso_pu_bacteria 2876771140 2876774698 110
664 iso_pu_bacteria 2876818435 2876821489 110
665 iso_pu_bacteria 2879074833 2879079266 110
666 iso_pu_bacteria 2879099564 2879102695 110
667 iso_pu_bacteria 2879127579 2879131269 110
668 iso_pu_bacteria 2879142872 2879144620 110
669 iso_pu_bacteria 2881364244 2881371209 110
670 iso_pu_bacteria 2881665667 2881668048 110
671 iso_pu_bacteria 2885366525 2885374130 110
672 iso_pu_bacteria 2885409591 2885414867 110
673 iso_pu_bacteria 2888378607 2888386417 110
674 iso_pu_bacteria 2888419890 2888426536 110
675 iso_pu_bacteria 2903727486 2903734215 110
676 iso_pu_bacteria 2904666416 2904669092 110
677 iso_pu_bacteria 2904711408 2904715596 110
678 iso_pu_bacteria 2906602504 2906605295 110
679 iso_pu_bacteria 2906626472 2906634582 110
680 iso_pu_bacteria 2908775508 2908782636 110
681 iso_pu_bacteria 2922368715 2922370647 110
682 iso_pu_bacteria 2922393267 2922396787 110
683 iso_pu_bacteria 2929615660 2929620216 110
684 iso_pu_bacteria 2929624759 2929629529 110
685 iso_pu_bacteria 2932784394 2932791573 110
686 iso_pu_bacteria 2932794094 2932799352 110
687 iso_pu_bacteria 2932801729 2932802251 110
688 iso_pu_bacteria 2932809354 2932816837 110
689 iso_pu_bacteria 2932818245 2932823986 110
690 iso_pu_bacteria 2932828146 2932835476 110
691 iso_pu_bacteria 2933577622 2933582133 110
692 iso_pu_bacteria 2935608549 2935613566 110
693 iso_pu_bacteria 2935616580 2935621218 110
694 iso_pu_bacteria 2935638405 2935643462 110
695 iso_pu_bacteria 2935648319 2935650557 110
696 iso_pu_bacteria 2935656913 2935662999 110
697 iso_pu_bacteria 2935665750 2935671215 110
698 iso_pu_bacteria 2935675223 2935681182 110
699 iso_pu_bacteria 2935684952 2935689480 110
700 iso_pu_bacteria 2935694250 2935700054 110
701 iso_pu_bacteria 2935703347 2935710737 110
702 iso_pu_bacteria 2935713505 2935720731 110
703 iso_pu_bacteria 2935722832 2935727958 110
704 iso_pu_bacteria 2935732158 2935737446 110
705 iso_pu_bacteria 2935741537 2935746493 110
706 iso_pu_bacteria 2935750917 2935757460 110
707 iso_pu_bacteria 2935760218 2935763836 110
708 iso_pu_bacteria 2935769743 2935776620 110
709 iso_pu_bacteria 2935777560 2935781395 110
710 iso_pu_bacteria 2935785616 2935792491 110
711 iso_pu_bacteria 2935793552 2935797960 110
712 iso_pu_bacteria 2935801545 2935807816 110
713 iso_pu_bacteria 2935810662 2935818281 110
714 iso_pu_bacteria 2935819856 2935824581 110
715 iso_pu_bacteria 2935827899 2935832979 110
716 iso_pu_bacteria 2935837841 2935844349 110
717 iso_pu_bacteria 2935847175 2935851801 110
718 iso_pu_bacteria 2935855204 2935859589 110
719 iso_pu_bacteria 2935864058 2935871346 110
720 iso_pu_bacteria 2935873716 2935879089 110
721 iso_pu_bacteria 2935883170 2935889510 110
722 iso_pu_bacteria 2935908558 2935911154 110
723 iso_pu_bacteria 2935916978 2935920686 110
724 iso_pu_bacteria 2935926038 2935928183 110
725 iso_pu_bacteria 2935934488 2935937828 110
726 iso_pu_bacteria 2935942939 2935945110 110
727 iso_pu_bacteria 2935951376 2935954385 110
728 iso_pu_bacteria 2935959822 2935965552 110
729 iso_pu_bacteria 2935967501 2935971348 110
730 iso_pu_bacteria 2935975950 2935981954 110
731 iso_pu_bacteria 2935984226 2935990770 110
732 iso_pu_bacteria 2935992306 2935996732 110
733 iso_pu_bacteria 2936002035 2936008608 110
734 iso_pu_bacteria 2936011229 2936017087 110
735 iso_pu_bacteria 2936019824 2936027471 110
736 iso_pu_bacteria 2936028420 2936036295 110
737 iso_pu_bacteria 2936037263 2936044901 110
738 iso_pu_bacteria 2936046547 2936050780 110
739 iso_pu_bacteria 2936055302 2936062745 110
740 iso_pu_bacteria 2940556831 2940563716 110
741 iso_pu_bacteria 2941531003 2941537777 110
742 iso_pu_bacteria 2941538514 2941542681 110
743 iso_pu_bacteria 3005483717 3005490120 110
744 iso_pu_bacteria 3005506211 3005506981 110
745 iso_pu_bacteria 3005587118 3005591389 110
746 iso_pu_bacteria 3005594810 3005601345 110
747 iso_pu_bacteria 3005710791 3005716785 110
748 iso_pu_bacteria 3005718088 3005724041 110
749 iso_pu_bacteria 8016511872 8016519580 110
750 iso_pu_bacteria 8016522445 8016524783 110
751 iso_pu_bacteria 8016530956 8016538351 110
752 iso_pu_bacteria 8016539877 8016542631 110
753 iso_pu_bacteria 8016548790 8016550643 110
754 iso_pu_bacteria 8016557553 8016559063 110
755 iso_pu_bacteria 8016566248 8016568014 110
756 iso_pu_bacteria 8016575299 8016580698 110
757 iso_pu_bacteria 8016583857 8016588010 110
758 iso_pu_bacteria 8016595262 8016597022 110
759 iso_pu_bacteria 8016603502 8016607927 110
760 iso_pu_bacteria 8016613128 8016619708 110
761 iso_pu_bacteria 8016622563 8016629903 110
762 iso_pu_bacteria 8016630954 8016637294 110
763 iso_pu_bacteria 8017057580 8017065947 110
764 iso_pu_bacteria 8019530166 8019538022 110
765 iso_pu_bacteria 8019538911 8019541960 110
766 iso_pu_bacteria 8019547302 8019548840 110
767 iso_pu_bacteria 8019576017 8019578703 110
768 iso_pu_bacteria 8019597564 8019604944 110
769 iso_pu_bacteria 8019608314 8019613585 110
770 iso_pu_bacteria 8019619141 8019624242 110
771 iso_pu_bacteria 8019638758 8019641845 110
772 iso_pu_bacteria 8019648815 8019653771 110
773 iso_pu_bacteria 8019659431 8019665698 110
774 iso_pu_bacteria 8019668869 8019675234 110
775 iso_pu_bacteria 8019678201 8019680873 110
776 iso_pu_bacteria 8019687851 8019694906 110
777 iso_pu_bacteria 8055742211 8055750031 110
778 iso_pu_bacteria 8056967851 8056969747 110
779 3300046507 Ga0495606_0001397 Ga0495606_0001397_1838_2173 111
780 3300046512 Ga0495610_0188039 Ga0495610_0188039_509_844 111
781 3300048915 Ga0496112_0000036 Ga0496112_0000036_3291_3626 111
782 3300005356 Ga0070674_101691114 Ga0070674_1016911141 112
783 3300005439 Ga0070711_100107157 Ga0070711_1001071572 112
784 3300005564 Ga0070664_101297307 Ga0070664_1012973072 112
785 3300013296 Ga0157374_11659942 Ga0157374_116599421 112
786 3300021388 Ga0213875_10458362 Ga0213875_104583621 112
787 3300048903 Ga0496100_0191229 Ga0496100_0191229_426_839 112
788 3300048904 Ga0496101_0299475 Ga0496101_0299475_401_814 112
789 3300048905 Ga0496102_1497719 Ga0496102_1497719_58_396 112
790 3300048907 Ga0496104_0299154 Ga0496104_0299154_984_1397 112
791 3300048909 Ga0496106_0011609 Ga0496106_0011609_456_869 112
792 3300048910 Ga0496107_0048726 Ga0496107_0048726_1066_1479 112
793 3300048911 Ga0496108_0009483 Ga0496108_0009483_7101_7514 112
794 3300048912 Ga0496109_0012953 Ga0496109_0012953_6339_6752 112
795 3300048913 Ga0496110_0031727 Ga0496110_0031727_204_617 112
796 3300048914 Ga0496111_0186422 Ga0496111_0186422_912_1325 112
797 3300048915 Ga0496112_0149030 Ga0496112_0149030_1518_1931 112
798 3300048917 Ga0496114_0694584 Ga0496114_0694584_266_679 112
799 3300053077 Ga0495601_1084072 Ga0495601_1084072_98_436 112
800 iso_pu_bacteria 2847930680 2847932374 112
801 iso_pu_bacteria 2879083081 2879089319 112
802 iso_pu_bacteria 2906643746 2906650772 112
803 3300005719 Ga0068861_100203197 Ga0068861_1002031974 113
804 3300012503 Ga0157313_1015514 Ga0157313_10155141 113
805 3300044658 Ga0466972_0000115 Ga0466972_0000115_15982_16323 113
806 3300044765 Ga0466970_0131669 Ga0466970_0131669_932_1273 113
807 3300050516 nmdc:mga0sz30_372005_c1 nmdc:mga0sz30_372005_c1_147_488 113
808 3300053095 Ga0500640_133320 Ga0500640_133320_542_883 113
809 3300053123 Ga0500614_010829 Ga0500614_010829_570_911 113
810 3300053136 Ga0500559_0006437 Ga0500559_0006437_4521_4862 113
811 3300053138 Ga0500564_098383 Ga0500564_098383_371_712 113
812 3300053148 Ga0500590_241043 Ga0500590_241043_206_547 113
813 3300053154 Ga0500619_162176 Ga0500619_162176_252_593 113
814 3300053155 Ga0500620_016205 Ga0500620_016205_1474_1815 113
815 3300053163 Ga0500639_297888 Ga0500639_297888_159_500 113
816 3300053177 Ga0500636_0003998 Ga0500636_0003998_7813_8154 113
817 3300001904 JGI24736J21556_1029370 JGI24736J21556_10293702 114
818 3300003214 JGI25165J46597_1010336 JGI25165J46597_10103362 114
819 3300003214 JGI25165J46597_1010389 JGI25165J46597_10103892 114
820 3300003215 JGI25153J46596_10003375 JGI25153J46596_100033752 114
821 3300003215 JGI25153J46596_10011101 JGI25153J46596_100111015 114
822 3300003215 JGI25153J46596_10030143 JGI25153J46596_100301432 114
823 3300003354 JGI25160J50197_1000799 JGI25160J50197_10007994 114
824 3300003354 JGI25160J50197_1014275 JGI25160J50197_10142753 114
825 3300003354 JGI25160J50197_1059286 JGI25160J50197_10592862 114
826 3300003752 Ga0055539_1003625 Ga0055539_10036252 114
827 3300003762 Ga0055542_1028475 Ga0055542_10284751 114
828 3300003794 Ga0055531_10008098 Ga0055531_100080983 114
829 3300003794 Ga0055531_10077245 Ga0055531_100772452 114
830 3300004625 Ga0055543_1005956 Ga0055543_10059563 114
831 3300005262 Ga0065165_1002396 Ga0065165_100239612 114
832 3300005262 Ga0065165_1053054 Ga0065165_10530542 114
833 3300005327 Ga0070658_10285892 Ga0070658_102858922 114
834 3300005331 Ga0070670_101179362 Ga0070670_1011793622 114
835 3300005337 Ga0070682_100587075 Ga0070682_1005870751 114
836 3300005338 Ga0068868_100433198 Ga0068868_1004331982 114
837 3300005339 Ga0070660_101177188 Ga0070660_1011771881 114
838 3300005344 Ga0070661_100545210 Ga0070661_1005452101 114
839 3300005344 Ga0070661_100737911 Ga0070661_1007379112 114
840 3300005347 Ga0070668_100740209 Ga0070668_1007402092 114
841 3300005355 Ga0070671_100439394 Ga0070671_1004393942 114
842 3300005356 Ga0070674_101930053 Ga0070674_1019300531 114
843 3300005455 Ga0070663_100102169 Ga0070663_1001021693 114
844 3300005455 Ga0070663_100294724 Ga0070663_1002947242 114
845 3300005455 Ga0070663_100544314 Ga0070663_1005443142 114
846 3300005456 Ga0070678_100614595 Ga0070678_1006145952 114
847 3300005459 Ga0068867_100403919 Ga0068867_1004039192 114
848 3300005539 Ga0068853_100597861 Ga0068853_1005978611 114
849 3300005547 Ga0070693_100789984 Ga0070693_1007899841 114
850 3300005548 Ga0070665_100097042 Ga0070665_1000970423 114
851 3300005548 Ga0070665_100170533 Ga0070665_1001705332 114
852 3300005563 Ga0068855_100373210 Ga0068855_1003732101 114
853 3300005577 Ga0068857_100491713 Ga0068857_1004917132 114
854 3300005578 Ga0068854_101275018 Ga0068854_1012750181 114
855 3300005614 Ga0068856_100188639 Ga0068856_1001886393 114
856 3300005615 Ga0070702_100976847 Ga0070702_1009768471 114
857 3300005616 Ga0068852_100115685 Ga0068852_1001156853 114
858 3300005617 Ga0068859_100702615 Ga0068859_1007026152 114
859 3300005618 Ga0068864_100284359 Ga0068864_1002843592 114
860 3300005618 Ga0068864_100289255 Ga0068864_1002892552 114
861 3300005834 Ga0068851_10548057 Ga0068851_105480572 114
862 3300005842 Ga0068858_100493513 Ga0068858_1004935132 114
863 3300005842 Ga0068858_100663562 Ga0068858_1006635622 114
864 3300005843 Ga0068860_100641480 Ga0068860_1006414802 114
865 3300005844 Ga0068862_100807042 Ga0068862_1008070422 114
866 3300006038 Ga0075365_10245977 Ga0075365_102459772 114
867 3300006042 Ga0075368_10020458 Ga0075368_100204583 114
868 3300006048 Ga0075363_100044320 Ga0075363_1000443203 114
869 3300006051 Ga0075364_10183530 Ga0075364_101835302 114
870 3300006186 Ga0075369_10006412 Ga0075369_100064124 114
871 3300006186 Ga0075369_10060642 Ga0075369_100606422 114
872 3300006186 Ga0075369_10115845 Ga0075369_101158452 114
873 3300006195 Ga0075366_10104549 Ga0075366_101045492 114
874 3300006195 Ga0075366_10979134 Ga0075366_109791342 114
875 3300006237 Ga0097621_100510822 Ga0097621_1005108222 114
876 3300006353 Ga0075370_10941610 Ga0075370_109416102 114
877 3300006358 Ga0068871_100814064 Ga0068871_1008140642 114
878 3300006881 Ga0068865_100990364 Ga0068865_1009903642 114
879 3300006931 Ga0097620_100702529 Ga0097620_1007025292 114
880 3300006942 Ga0099824_1008631 Ga0099824_10086319 114
881 3300009011 Ga0105251_10170095 Ga0105251_101700952 114
882 3300009093 Ga0105240_10007359 Ga0105240_100073593 114
883 3300009093 Ga0105240_10215009 Ga0105240_102150092 114
884 3300009098 Ga0105245_10731922 Ga0105245_107319222 114
885 3300009098 Ga0105245_12288876 Ga0105245_122888761 114
886 3300009101 Ga0105247_10025451 Ga0105247_100254515 114
887 3300009101 Ga0105247_10081822 Ga0105247_100818223 114
888 3300009148 Ga0105243_10078436 Ga0105243_100784362 114
889 3300009174 Ga0105241_10029931 Ga0105241_100299314 114
890 3300009174 Ga0105241_10363687 Ga0105241_103636873 114
891 3300009176 Ga0105242_10925838 Ga0105242_109258382 114
892 3300009177 Ga0105248_10425987 Ga0105248_104259872 114
893 3300009545 Ga0105237_10036037 Ga0105237_100360372 114
894 3300009545 Ga0105237_10225019 Ga0105237_102250193 114
895 3300009551 Ga0105238_10661043 Ga0105238_106610432 114
896 3300009551 Ga0105238_10830796 Ga0105238_108307961 114
897 3300010375 Ga0105239_10053182 Ga0105239_100531825 114
898 3300010375 Ga0105239_10277385 Ga0105239_102773852 114
899 3300010375 Ga0105239_10612230 Ga0105239_106122301 114
900 3300010375 Ga0105239_11532551 Ga0105239_115325512 114
901 3300010375 Ga0105239_12631672 Ga0105239_126316722 114
902 3300011119 Ga0105246_10007034 Ga0105246_100070343 114
903 3300013100 Ga0157373_10758192 Ga0157373_107581921 114
904 3300013104 Ga0157370_10918416 Ga0157370_109184162 114
905 3300013296 Ga0157374_10199234 Ga0157374_101992343 114
906 3300013297 Ga0157378_11179419 Ga0157378_111794191 114
907 3300013307 Ga0157372_12474379 Ga0157372_124743792 114
908 3300013308 Ga0157375_10241813 Ga0157375_102418132 114
909 3300014968 Ga0157379_10625262 Ga0157379_106252621 114
910 3300014969 Ga0157376_10286400 Ga0157376_102864001 114
911 3300014969 Ga0157376_11447165 Ga0157376_114471651 114
912 3300015261 Ga0182006_1315673 Ga0182006_13156732 114
913 3300017792 Ga0163161_10298666 Ga0163161_102986661 114
914 3300021320 Ga0214544_1000163 Ga0214544_10001634 114
915 3300021321 Ga0214542_1000156 Ga0214542_1000156106 114
916 3300021324 Ga0214545_1000078 Ga0214545_10000784 114
917 3300021327 Ga0214543_1000136 Ga0214543_10001364 114
918 3300025230 Ga0209563_102445 Ga0209563_1024453 114
919 3300025253 Ga0209677_102384 Ga0209677_1023845 114
920 3300025254 Ga0209148_1000333 Ga0209148_100033362 114
921 3300025261 Ga0209233_1000526 Ga0209233_100052620 114
922 3300025261 Ga0209233_1046951 Ga0209233_10469511 114
923 3300025272 Ga0209455_1003625 Ga0209455_10036255 114
924 3300025273 Ga0209673_1008762 Ga0209673_10087623 114
925 3300025295 Ga0209564_1002609 Ga0209564_100260911 114
926 3300025295 Ga0209564_1028827 Ga0209564_10288273 114
927 3300025297 Ga0209758_1000109 Ga0209758_1000109161 114
928 3300025297 Ga0209758_1000416 Ga0209758_100041615 114
929 3300025297 Ga0209758_1001062 Ga0209758_100106221 114
930 3300025297 Ga0209758_1006263 Ga0209758_100626311 114
931 3300025297 Ga0209758_1038250 Ga0209758_10382502 114
932 3300025297 Ga0209758_1068444 Ga0209758_10684442 114
933 3300025299 Ga0209256_1019931 Ga0209256_10199312 114
934 3300025302 Ga0207426_1000522 Ga0207426_100052246 114
935 3300025302 Ga0207426_1000971 Ga0207426_100097127 114
936 3300025302 Ga0207426_1023477 Ga0207426_10234772 114
937 3300025302 Ga0207426_1033892 Ga0207426_10338922 114
938 3300025303 Ga0209051_1075097 Ga0209051_10750972 114
939 3300025304 Ga0209257_1011890 Ga0209257_10118905 114
940 3300025304 Ga0209257_1035061 Ga0209257_10350611 114
941 3300025304 Ga0209257_1053235 Ga0209257_10532352 114
942 3300025900 Ga0207710_10116804 Ga0207710_101168042 114
943 3300025901 Ga0207688_10116819 Ga0207688_101168192 114
944 3300025904 Ga0207647_10040764 Ga0207647_100407642 114
945 3300025905 Ga0207685_10092948 Ga0207685_100929481 114
946 3300025906 Ga0207699_10176325 Ga0207699_101763252 114
947 3300025911 Ga0207654_10106045 Ga0207654_101060453 114
948 3300025913 Ga0207695_10000378 Ga0207695_1000037865 114
949 3300025913 Ga0207695_10777583 Ga0207695_107775832 114
950 3300025914 Ga0207671_10014103 Ga0207671_100141035 114
951 3300025914 Ga0207671_10402253 Ga0207671_104022532 114
952 3300025916 Ga0207663_10985163 Ga0207663_109851631 114
953 3300025931 Ga0207644_10572107 Ga0207644_105721072 114
954 3300025933 Ga0207706_10350008 Ga0207706_103500082 114
955 3300025940 Ga0207691_10463611 Ga0207691_104636112 114
956 3300025941 Ga0207711_10610019 Ga0207711_106100192 114
957 3300025949 Ga0207667_10421394 Ga0207667_104213942 114
958 3300025972 Ga0207668_10241672 Ga0207668_102416721 114
959 3300025981 Ga0207640_10123034 Ga0207640_101230343 114
960 3300025986 Ga0207658_10131707 Ga0207658_101317072 114
961 3300026023 Ga0207677_10722919 Ga0207677_107229192 114
962 3300026035 Ga0207703_10268356 Ga0207703_102683563 114
963 3300026041 Ga0207639_10166179 Ga0207639_101661792 114
964 3300026067 Ga0207678_10142121 Ga0207678_101421213 114
965 3300026089 Ga0207648_10413850 Ga0207648_104138502 114
966 3300026095 Ga0207676_10172067 Ga0207676_101720672 114
967 3300026095 Ga0207676_11364822 Ga0207676_113648222 114
968 3300026116 Ga0207674_10338042 Ga0207674_103380422 114
969 3300026118 Ga0207675_100126349 Ga0207675_1001263493 114
970 3300026118 Ga0207675_101732921 Ga0207675_1017329212 114
971 3300026121 Ga0207683_10338033 Ga0207683_103380332 114
972 3300027296 Ga0209389_1000230 Ga0209389_10002307 114
973 3300027296 Ga0209389_1002940 Ga0209389_100294013 114
974 3300027357 Ga0209589_1000897 Ga0209589_10008972 114
975 3300027361 Ga0209489_100110 Ga0209489_10011070 114
976 3300027361 Ga0209489_102489 Ga0209489_10248943 114
977 3300027363 Ga0209700_102336 Ga0209700_10233645 114
978 3300028379 Ga0268266_10055646 Ga0268266_100556463 114
979 3300033180 Ga0307510_10002289 Ga0307510_1000228914 114
980 3300033180 Ga0307510_10156570 Ga0307510_101565703 114
981 3300037466 Ga0395898_0251747 Ga0395898_0251747_108_452 114
982 3300037466 Ga0395898_0822048 Ga0395898_0822048_199_543 114
983 3300037471 Ga0395905_0030447 Ga0395905_0030447_1454_1798 114
984 3300037853 Ga0436364_0566534 Ga0436364_0566534_1116_1460 114
985 3300039437 Ga0436365_0354924 Ga0436365_0354924_245_589 114
986 3300039437 Ga0436365_0825888 Ga0436365_0825888_199_543 114
987 3300039453 Ga0436362_0871182 Ga0436362_0871182_289_633 114
988 3300041441 Ga0451787_703960 Ga0451787_703960_273_617 114
989 3300041452 Ga0451793_1046715 Ga0451793_1046715_411_755 114
990 3300041456 Ga0451795_1610771 Ga0451795_1610771_246_590 114
991 3300041491 Ga0451833_0979399 Ga0451833_0979399_326_670 114
992 3300041507 Ga0451851_0230066 Ga0451851_0230066_38_382 114
993 3300041512 Ga0451853_3411604 Ga0451853_3411604_106_450 114
994 3300044656 Ga0466969_0005173 Ga0466969_0005173_1675_2019 114
995 3300044658 Ga0466972_0032818 Ga0466972_0032818_1837_2181 114
996 3300044658 Ga0466972_0406312 Ga0466972_0406312_222_566 114
997 3300044684 Ga0466966_0025622 Ga0466966_0025622_1708_2052 114
998 3300044693 Ga0466961_0000066 Ga0466961_0000066_46782_47126 114
999 3300044694 Ga0466963_0029979 Ga0466963_0029979_2222_2566 114
1000 3300044735 Ga0466968_0063005 Ga0466968_0063005_213_557 114
1001 3300044735 Ga0466968_0121163 Ga0466968_0121163_78_422 114
1002 3300044901 Ga0466960_0078634 Ga0466960_0078634_1259_1603 114
1003 3300044901 Ga0466960_0150967 Ga0466960_0150967_186_530 114
1004 3300044901 Ga0466960_0909638 Ga0466960_0909638_83_427 114
1005 3300045976 Ga0466967_0128644 Ga0466967_0128644_978_1322 114
1006 3300046452 Ga0495617_164548 Ga0495617_164548_305_649 114
1007 3300046454 Ga0495592_0026498 Ga0495592_0026498_1848_2192 114
1008 3300046454 Ga0495592_0425717 Ga0495592_0425717_350_694 114
1009 3300046459 Ga0495629_0025350 Ga0495629_0025350_1208_1552 114
1010 3300046460 Ga0495638_0011191 Ga0495638_0011191_3942_4286 114
1011 3300046462 Ga0495651_0022916 Ga0495651_0022916_1321_1665 114
1012 3300046462 Ga0495651_0040170 Ga0495651_0040170_2053_2397 114
1013 3300046471 Ga0495650_0127441 Ga0495650_0127441_461_805 114
1014 3300046474 Ga0495605_0076546 Ga0495605_0076546_703_1047 114
1015 3300046474 Ga0495605_0133725 Ga0495605_0133725_340_684 114
1016 3300046477 Ga0495664_0118980 Ga0495664_0118980_96_440 114
1017 3300046477 Ga0495664_0539502 Ga0495664_0539502_308_652 114
1018 3300046492 Ga0495585_0328902 Ga0495585_0328902_175_519 114
1019 3300046501 Ga0495607_0139837 Ga0495607_0139837_482_826 114
1020 3300046506 Ga0495583_0167219 Ga0495583_0167219_365_709 114
1021 3300046507 Ga0495606_0038607 Ga0495606_0038607_2371_2715 114
1022 3300046511 Ga0495608_0143664 Ga0495608_0143664_463_807 114
1023 3300046512 Ga0495610_0369912 Ga0495610_0369912_172_516 114
1024 3300046513 Ga0495616_0173399 Ga0495616_0173399_97_441 114
1025 3300046514 Ga0495618_0023307 Ga0495618_0023307_676_1020 114
1026 3300046516 Ga0495628_0025773 Ga0495628_0025773_3172_3516 114
1027 3300046524 Ga0495648_0057238 Ga0495648_0057238_1782_2126 114
1028 3300046524 Ga0495648_0153738 Ga0495648_0153738_833_1177 114
1029 3300046524 Ga0495648_0410799 Ga0495648_0410799_209_553 114
1030 3300046529 Ga0495652_0026046 Ga0495652_0026046_1637_1981 114
1031 3300046529 Ga0495652_0143000 Ga0495652_0143000_332_676 114
1032 3300046529 Ga0495652_0153554 Ga0495652_0153554_202_546 114
1033 3300046533 Ga0495640_0030086 Ga0495640_0030086_1283_1627 114
1034 3300046533 Ga0495640_0065433 Ga0495640_0065433_1241_1585 114
1035 3300046536 Ga0495587_0058721 Ga0495587_0058721_225_569 114
1036 3300046542 Ga0495597_0336347 Ga0495597_0336347_108_452 114
1037 3300046543 Ga0495645_0063646 Ga0495645_0063646_2141_2485 114
1038 3300046557 Ga0495622_0013019 Ga0495622_0013019_2547_2891 114
1039 3300046557 Ga0495622_0013289 Ga0495622_0013289_2854_3198 114
1040 3300046559 Ga0495667_0010532 Ga0495667_0010532_4350_4694 114
1041 3300046616 Ga0495668_0128689 Ga0495668_0128689_605_949 114
1042 3300046616 Ga0495668_0715470 Ga0495668_0715470_93_437 114
1043 3300046642 Ga0495634_0074401 Ga0495634_0074401_1417_1761 114
1044 3300046642 Ga0495634_0104953 Ga0495634_0104953_1322_1666 114
1045 3300046648 Ga0495611_0055368 Ga0495611_0055368_474_818 114
1046 3300046660 Ga0495625_0095197 Ga0495625_0095197_675_1019 114
1047 3300046660 Ga0495625_0280052 Ga0495625_0280052_97_441 114
1048 3300046663 Ga0495635_0005323 Ga0495635_0005323_8181_8525 114
1049 3300046663 Ga0495635_0144414 Ga0495635_0144414_1168_1512 114
1050 3300046674 Ga0495588_0007115 Ga0495588_0007115_3816_4160 114
1051 3300046674 Ga0495588_0310257 Ga0495588_0310257_284_628 114
1052 3300046675 Ga0495657_0015963 Ga0495657_0015963_23_367 114
1053 3300046675 Ga0495657_0057001 Ga0495657_0057001_1051_1395 114
1054 3300046678 Ga0495599_0029223 Ga0495599_0029223_2969_3313 114
1055 3300046679 Ga0495623_0026575 Ga0495623_0026575_31_375 114
1056 3300046680 Ga0495646_0029944 Ga0495646_0029944_85_429 114
1057 3300046689 Ga0495613_0021869 Ga0495613_0021869_2806_3150 114
1058 3300046689 Ga0495613_0099154 Ga0495613_0099154_781_1125 114
1059 3300046690 Ga0495624_0043889 Ga0495624_0043889_1107_1451 114
1060 3300046691 Ga0495670_0360309 Ga0495670_0360309_393_737 114
1061 3300046694 Ga0495649_0178548 Ga0495649_0178548_741_1085 114
1062 3300046694 Ga0495649_0197583 Ga0495649_0197583_400_744 114
1063 3300046694 Ga0495649_0391518 Ga0495649_0391518_273_617 114
1064 3300046794 Ga0495589_0032117 Ga0495589_0032117_1415_1759 114
1065 3300046809 Ga0495600_0012830 Ga0495600_0012830_1722_2066 114
1066 3300046809 Ga0495600_0101770 Ga0495600_0101770_1097_1441 114
1067 3300047315 Ga0495581_0094303 Ga0495581_0094303_189_533 114
1068 3300047317 Ga0495604_0007903 Ga0495604_0007903_6233_6577 114
1069 3300047317 Ga0495604_0013112 Ga0495604_0013112_3086_3430 114
1070 3300047319 Ga0495674_0089250 Ga0495674_0089250_752_1096 114
1071 3300047319 Ga0495674_0272343 Ga0495674_0272343_935_1279 114
1072 3300047321 Ga0495676_0138278 Ga0495676_0138278_1275_1619 114
1073 3300047322 Ga0495680_0001058 Ga0495680_0001058_3348_3692 114
1074 3300047323 Ga0495683_0245432 Ga0495683_0245432_300_644 114
1075 3300047443 Ga0495687_004881 Ga0495687_004881_286_630 114
1076 3300047444 Ga0495675_0008446 Ga0495675_0008446_2812_3156 114
1077 3300047469 Ga0495673_0043711 Ga0495673_0043711_1412_1756 114
1078 3300047469 Ga0495673_0287550 Ga0495673_0287550_188_532 114
1079 3300047471 Ga0495684_0092904 Ga0495684_0092904_714_1058 114
1080 3300047673 Ga0495593_0027280 Ga0495593_0027280_542_886 114
1081 3300048088 Ga0495602_0005801 Ga0495602_0005801_7287_7631 114
1082 3300048088 Ga0495602_0130086 Ga0495602_0130086_1274_1618 114
1083 3300048088 Ga0495602_0776588 Ga0495602_0776588_237_581 114
1084 3300048089 Ga0495614_0055500 Ga0495614_0055500_166_510 114
1085 3300048089 Ga0495614_0141927 Ga0495614_0141927_182_526 114
1086 3300048903 Ga0496100_0258693 Ga0496100_0258693_137_481 114
1087 3300048903 Ga0496100_0273342 Ga0496100_0273342_800_1144 114
1088 3300048903 Ga0496100_1311317 Ga0496100_1311317_182_526 114
1089 3300048905 Ga0496102_0134052 Ga0496102_0134052_823_1167 114
1090 3300048905 Ga0496102_0237439 Ga0496102_0237439_1255_1599 114
1091 3300048905 Ga0496102_0344820 Ga0496102_0344820_936_1280 114
1092 3300048906 Ga0496103_0007344 Ga0496103_0007344_5096_5440 114
1093 3300048907 Ga0496104_0190611 Ga0496104_0190611_107_451 114
1094 3300048907 Ga0496104_0196275 Ga0496104_0196275_1512_1856 114
1095 3300048907 Ga0496104_1481670 Ga0496104_1481670_23_367 114
1096 3300048908 Ga0496105_0003004 Ga0496105_0003004_11074_11418 114
1097 3300048908 Ga0496105_0026626 Ga0496105_0026626_1477_1821 114
1098 3300048908 Ga0496105_0877426 Ga0496105_0877426_53_397 114
1099 3300048909 Ga0496106_0225975 Ga0496106_0225975_1080_1424 114
1100 3300048909 Ga0496106_0332278 Ga0496106_0332278_657_1001 114
1101 3300048910 Ga0496107_0732302 Ga0496107_0732302_191_535 114
1102 3300048911 Ga0496108_0053316 Ga0496108_0053316_1947_2291 114
1103 3300048912 Ga0496109_0267726 Ga0496109_0267726_165_509 114
1104 3300048913 Ga0496110_0135920 Ga0496110_0135920_177_521 114
1105 3300048913 Ga0496110_0402693 Ga0496110_0402693_811_1155 114
1106 3300048913 Ga0496110_0888079 Ga0496110_0888079_408_752 114
1107 3300048915 Ga0496112_0397234 Ga0496112_0397234_837_1181 114
1108 3300048915 Ga0496112_0788306 Ga0496112_0788306_446_790 114
1109 3300048916 Ga0496113_0023104 Ga0496113_0023104_2396_2740 114
1110 3300048916 Ga0496113_0284613 Ga0496113_0284613_330_674 114
1111 3300048917 Ga0496114_0126394 Ga0496114_0126394_1543_1887 114
1112 3300048917 Ga0496114_0489371 Ga0496114_0489371_171_515 114
1113 3300048918 Ga0496115_0022821 Ga0496115_0022821_1559_1903 114
1114 3300048919 Ga0496116_0038973 Ga0496116_0038973_1114_1458 114
1115 3300048920 Ga0496117_0021587 Ga0496117_0021587_3446_3790 114
1116 3300048920 Ga0496117_0041129 Ga0496117_0041129_1475_1819 114
1117 3300048921 Ga0496118_0030236 Ga0496118_0030236_2540_2884 114
1118 3300048921 Ga0496118_0071213 Ga0496118_0071213_1179_1523 114
1119 3300048921 Ga0496118_0095356 Ga0496118_0095356_321_665 114
1120 3300048921 Ga0496118_0102456 Ga0496118_0102456_1449_1793 114
1121 3300048922 Ga0496119_0013006 Ga0496119_0013006_3839_4183 114
1122 3300048922 Ga0496119_0063130 Ga0496119_0063130_480_824 114
1123 3300048922 Ga0496119_0213474 Ga0496119_0213474_627_971 114
1124 3300048923 Ga0496120_0019431 Ga0496120_0019431_1740_2084 114
1125 3300048923 Ga0496120_0095701 Ga0496120_0095701_1102_1446 114
1126 3300048924 Ga0496121_0024547 Ga0496121_0024547_781_1125 114
1127 3300048924 Ga0496121_0093483 Ga0496121_0093483_1611_1955 114
1128 3300048924 Ga0496121_0194653 Ga0496121_0194653_142_486 114
1129 3300048926 Ga0496123_0140579 Ga0496123_0140579_181_525 114
1130 3300048927 Ga0496124_0089207 Ga0496124_0089207_1102_1446 114
1131 3300048928 Ga0496125_0030379 Ga0496125_0030379_3508_3852 114
1132 3300048928 Ga0496125_0203673 Ga0496125_0203673_742_1086 114
1133 3300049460 Ga0495682_0017747 Ga0495682_0017747_963_1307 114
1134 3300050491 nmdc:mga00v17_30000_c1 nmdc:mga00v17_30000_c1_2394_2738 114
1135 3300050491 nmdc:mga00v17_49354_c1 nmdc:mga00v17_49354_c1_2047_2391 114
1136 3300050492 nmdc:mga0yw44_207786_c1 nmdc:mga0yw44_207786_c1_921_1265 114
1137 3300050492 nmdc:mga0yw44_882248_c1 nmdc:mga0yw44_882248_c1_251_595 114
1138 3300050493 nmdc:mga0k408_209215_c1 nmdc:mga0k408_209215_c1_179_523 114
1139 3300050494 nmdc:mga06z11_97715_c1 nmdc:mga06z11_97715_c1_134_478 114
1140 3300050496 nmdc:mga07m45_18827_c1 nmdc:mga07m45_18827_c1_3358_3702 114
1141 3300050496 nmdc:mga07m45_55859_c1 nmdc:mga07m45_55859_c1_1401_1745 114
1142 3300050516 nmdc:mga0sz30_58617_c1 nmdc:mga0sz30_58617_c1_720_1064 114
1143 3300053077 Ga0495601_0299334 Ga0495601_0299334_611_955 114
1144 3300053084 Ga0495595_0099694 Ga0495595_0099694_95_439 114
1145 3300053085 Ga0495619_0090441 Ga0495619_0090441_47_391 114
1146 3300053086 Ga0500578_0195237 Ga0500578_0195237_331_675 114
1147 3300053086 Ga0500578_0414710 Ga0500578_0414710_294_638 114
1148 3300053087 Ga0500643_000013 Ga0500643_000013_118250_118594 114
1149 3300053090 Ga0500646_0195593 Ga0500646_0195593_17_361 114
1150 3300053093 Ga0500651_0131518 Ga0500651_0131518_68_412 114
1151 3300053093 Ga0500651_0457679 Ga0500651_0457679_63_407 114
1152 3300053094 Ga0500566_0059465 Ga0500566_0059465_159_503 114
1153 3300053094 Ga0500566_0323904 Ga0500566_0323904_127_471 114
1154 3300053098 Ga0500650_0275510 Ga0500650_0275510_91_435 114
1155 3300053103 Ga0500555_001072 Ga0500555_001072_2501_2845 114
1156 3300053104 Ga0500556_0069527 Ga0500556_0069527_590_934 114
1157 3300053108 Ga0500562_021204 Ga0500562_021204_868_1212 114
1158 3300053109 Ga0500569_011527 Ga0500569_011527_372_716 114
1159 3300053116 Ga0500592_002866 Ga0500592_002866_133_477 114
1160 3300053119 Ga0500595_008262 Ga0500595_008262_3788_4132 114
1161 3300053120 Ga0500597_410958 Ga0500597_410958_48_392 114
1162 3300053121 Ga0500607_071125 Ga0500607_071125_1143_1487 114
1163 3300053130 Ga0500642_0000376 Ga0500642_0000376_13164_13508 114
1164 3300053130 Ga0500642_0313319 Ga0500642_0313319_181_525 114
1165 3300053131 Ga0500652_091010 Ga0500652_091010_17_361 114
1166 3300053136 Ga0500559_0569048 Ga0500559_0569048_158_502 114
1167 3300053139 Ga0500568_0018290 Ga0500568_0018290_2401_2745 114
1168 3300053142 Ga0500577_0131556 Ga0500577_0131556_485_829 114
1169 3300053151 Ga0500604_0167933 Ga0500604_0167933_135_479 114
1170 3300053153 Ga0500616_0015406 Ga0500616_0015406_628_972 114
1171 3300053156 Ga0500622_0001687 Ga0500622_0001687_324_668 114
1172 3300053158 Ga0500627_0078272 Ga0500627_0078272_136_480 114
1173 3300053160 Ga0500633_0150997 Ga0500633_0150997_395_739 114
1174 3300053722 Ga0500649_100608 Ga0500649_100608_505_849 114
1175 3300053727 Ga0500611_083046 Ga0500611_083046_162_506 114
1176 3300053729 Ga0500625_041142 Ga0500625_041142_314_658 114
1177 3300053730 Ga0500645_099808 Ga0500645_099808_69_413 114
1178 3300053731 Ga0500609_003821 Ga0500609_003821_293_637 114
1179 3300053736 Ga0500599_000090 Ga0500599_000090_2795_3139 114
1180 3300053737 Ga0500601_000297 Ga0500601_000297_5594_5938 114
1181 3300055283 Ga0500661_012063 Ga0500661_012063_949_1293 114
1182 iso_pu_bacteria 2824653114 2824656974 114

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exr-assembly1.cif.gz_A-2 crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution 0.9181 81 110
7zb2-assembly4.cif.gz_DDD apo macrocyclase ophp 0.8921 70 108
7zaz-assembly1.cif.gz_AAA macrocyclase ophp with zpp 0.8908 70 108
7zb2-assembly1.cif.gz_AAA apo macrocyclase ophp 0.8885 70 108
7zb2-assembly5.cif.gz_EEE apo macrocyclase ophp 0.8881 70 108
ID Description Score Start End Superfamily
af_Q60282_78_297_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.898 72 110 2.130.10.10
af_Q63132_1148_1443_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8915 62 109 2.120.10.30
4exrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8884 68 110 3.10.450.40
af_A0A1D6FQU9_38_279_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8866 70 111 2.130.10.10
af_Q9N489_8_129_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8834 82 110 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A172TZZ0-F1-model_v4 ABM domain-containing protein 0.955 70 110
AF-A0A414ATF8-F1-model_v4 PepSY domain-containing protein 0.9502 70 110
AF-A0A7D3X3L1-F1-model_v4 Uncharacterized protein 0.9443 70 110
AF-A0A085W8D4-F1-model_v4 Uncharacterized protein 0.9411 72 110
AF-A0A1Q5P4W7-F1-model_v4 PepSY domain-containing protein 0.9397 70 109

Feature Viewer

pLDDT pTM Quality
86.87 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map