F491328
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1182 | 614 | 1003 | 112 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2824653114|2824656974 |
| Length | 122 |
| Sequence | RCADPELSMTTSDTAVPEPTPEQAALFARVRRMMLIAGLTTALAICAVLIAVGYRLFKSEGRAVEAAGDVTATLPKGAKIVATGVAGDRLVVTLDVGGVIEIRTFDAHSLKPAGKLKFANEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 17 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 18 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 22 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 23 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 24 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 25 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 26 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 27 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 28 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 29 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 30 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 31 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 32 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 33 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 34 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 35 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 36 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 37 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 38 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 39 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 53 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 58 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 59 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 60 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 61 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 62 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 63 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 64 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 65 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 66 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 72 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 73 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 74 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 75 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 76 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 77 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 78 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 79 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 80 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 81 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 82 | 2922368715 | |||
| 83 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 84 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 85 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 86 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 87 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 88 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 89 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 90 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 91 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 92 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 93 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 94 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 95 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 96 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 97 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 98 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 99 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 100 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 101 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 102 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 103 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 104 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 105 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 106 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 107 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 108 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 109 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 110 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 111 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 112 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 113 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 114 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 115 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 116 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 117 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 118 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 119 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 120 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 121 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 122 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 123 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 124 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 125 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 126 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 127 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 128 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 129 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 130 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 131 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 132 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 133 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 134 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 135 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 136 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 137 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 138 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 139 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 140 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 141 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 142 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 143 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 144 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 145 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 146 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 147 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 148 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 149 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 150 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 151 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 152 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 153 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 154 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 155 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 156 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 157 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 159 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 161 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 163 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 165 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 166 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 167 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 169 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 176 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 178 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 179 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 183 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 184 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 188 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 191 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 196 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 198 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 199 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 200 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 202 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 203 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 204 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 205 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 206 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 207 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 208 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 209 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 210 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 211 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 212 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 214 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 215 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 216 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 217 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 221 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 222 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 223 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 225 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 226 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 227 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 228 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 229 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 231 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 232 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 233 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 234 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 246 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 249 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 259 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 262 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 264 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 265 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 266 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 267 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 268 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 269 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 270 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 271 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 274 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 278 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 280 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 330 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 333 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 337 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 340 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 341 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 342 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 343 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 344 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 345 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 346 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 347 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 348 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 349 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 350 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 351 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 352 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 353 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 354 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 355 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 356 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 357 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 358 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 359 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 360 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 361 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 362 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 363 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 364 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 365 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 366 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 367 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 368 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 369 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 370 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 371 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 372 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 373 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 374 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 375 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 376 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 377 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 378 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 379 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 380 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 381 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 382 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 383 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 384 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 385 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 386 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 387 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 388 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 389 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 390 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 391 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 392 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 393 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 394 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 395 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 467 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 468 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 469 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 470 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 471 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 472 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 475 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 476 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 477 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 478 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 479 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 480 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 481 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 482 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 483 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 484 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 485 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 486 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 487 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 488 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 489 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 490 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 491 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 497 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 512 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 513 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 523 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 524 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 525 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 526 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 527 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 529 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 532 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 535 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 536 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 537 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 538 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 539 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 540 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 541 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 542 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 543 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 544 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 545 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 546 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 547 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 548 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 549 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 550 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 551 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 552 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 553 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 554 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 555 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 556 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 557 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 558 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 559 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 560 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 561 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 562 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 563 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 564 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 565 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 566 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 567 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 568 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 569 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 570 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 571 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 572 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 574 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 575 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 576 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 577 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 578 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 579 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 580 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 581 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 582 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 584 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 585 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 586 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 587 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 588 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 589 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 590 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 591 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 592 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 593 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 594 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 595 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 596 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 597 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 598 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 599 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 600 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 601 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 602 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 603 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 604 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 605 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 606 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 607 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 608 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 609 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 610 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 611 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 612 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 613 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 614 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.67 |
| Metatranscriptomes | 0.25 |
| Isolates | 15.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.93 |
| Nodule | 12.1 |
| Rhizoplane | 4.82 |
| Rhizosphere | 61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1029370 | 3300001904 | Bacteria | 851 |
| 2 | JGI24738J21930_10064151 | 3300002075 | Bacteria | 756 |
| 3 | JGI25165J46597_1010336 | 3300003214 | Bacteria | 1365 |
| 4 | JGI25165J46597_1010389 | 3300003214 | Bacteria | 1359 |
| 5 | JGI25153J46596_10003375 | 3300003215 | Bacteria | 8960 |
| 6 | JGI25153J46596_10011101 | 3300003215 | Bacteria | 4009 |
| 7 | JGI25153J46596_10030143 | 3300003215 | Bacteria | 1851 |
| 8 | rootH1_10110488 | 3300003323 | Bacteria | 1247 |
| 9 | JGI25160J50197_1000799 | 3300003354 | Bacteria | 16961 |
| 10 | JGI25160J50197_1014275 | 3300003354 | Bacteria | 2664 |
| 11 | JGI25160J50197_1059286 | 3300003354 | Bacteria | 772 |
| 12 | Ga0055539_1003625 | 3300003752 | Bacteria | 2136 |
| 13 | Ga0055542_1028475 | 3300003762 | Bacteria | 735 |
| 14 | Ga0055531_10008098 | 3300003794 | Bacteria | 5606 |
| 15 | Ga0055531_10077245 | 3300003794 | Bacteria | 746 |
| 16 | Ga0055543_1005956 | 3300004625 | Bacteria | 3029 |
| 17 | Ga0065165_1002396 | 3300005262 | Bacteria | 16025 |
| 18 | Ga0065165_1048792 | 3300005262 | Bacteria | 1213 |
| 19 | Ga0065165_1053054 | 3300005262 | Bacteria | 1142 |
| 20 | Ga0070658_10285892 | 3300005327 | Bacteria | 1404 |
| 21 | Ga0070658_10619279 | 3300005327 | Bacteria | 939 |
| 22 | Ga0070683_100419537 | 3300005329 | Bacteria | 1276 |
| 23 | Ga0070683_100579330 | 3300005329 | Bacteria | 1073 |
| 24 | Ga0070670_100736618 | 3300005331 | Bacteria | 888 |
| 25 | Ga0070670_101179362 | 3300005331 | Bacteria | 700 |
| 26 | Ga0070680_100057264 | 3300005336 | Bacteria | 3186 |
| 27 | Ga0070680_100115737 | 3300005336 | Bacteria | 2234 |
| 28 | Ga0070680_101094715 | 3300005336 | Bacteria | 689 |
| 29 | Ga0070682_100587075 | 3300005337 | Bacteria | 877 |
| 30 | Ga0068868_100433198 | 3300005338 | Bacteria | 1140 |
| 31 | Ga0070660_100154366 | 3300005339 | Bacteria | 1847 |
| 32 | Ga0070660_100196432 | 3300005339 | Bacteria | 1636 |
| 33 | Ga0070660_101177188 | 3300005339 | Bacteria | 650 |
| 34 | Ga0070691_10102109 | 3300005341 | Bacteria | 1426 |
| 35 | Ga0070661_100157560 | 3300005344 | Bacteria | 1718 |
| 36 | Ga0070661_100545210 | 3300005344 | Bacteria | 932 |
| 37 | Ga0070661_100737911 | 3300005344 | Bacteria | 804 |
| 38 | Ga0070692_11231595 | 3300005345 | Bacteria | 534 |
| 39 | Ga0070668_100740209 | 3300005347 | Bacteria | 869 |
| 40 | Ga0070671_100439394 | 3300005355 | Bacteria | 1119 |
| 41 | Ga0070674_100770028 | 3300005356 | Bacteria | 829 |
| 42 | Ga0070674_101691114 | 3300005356 | Bacteria | 572 |
| 43 | Ga0070674_101930053 | 3300005356 | Bacteria | 537 |
| 44 | Ga0070659_100224942 | 3300005366 | Bacteria | 1550 |
| 45 | Ga0070659_100729093 | 3300005366 | Bacteria | 859 |
| 46 | Ga0070709_10000143 | 3300005434 | Bacteria | 47770 |
| 47 | Ga0070709_10003192 | 3300005434 | Bacteria | 8797 |
| 48 | Ga0070709_10061173 | 3300005434 | Bacteria | 2396 |
| 49 | Ga0070709_10788805 | 3300005434 | Bacteria | 745 |
| 50 | Ga0070709_10896823 | 3300005434 | Bacteria | 701 |
| 51 | Ga0070714_100021066 | 3300005435 | Bacteria | 5330 |
| 52 | Ga0070714_100043580 | 3300005435 | Bacteria | 3795 |
| 53 | Ga0070714_100464531 | 3300005435 | Bacteria | 1203 |
| 54 | Ga0070714_101754616 | 3300005435 | Bacteria | 606 |
| 55 | Ga0070713_100002045 | 3300005436 | Bacteria | 13034 |
| 56 | Ga0070713_100009055 | 3300005436 | Bacteria | 7100 |
| 57 | Ga0070713_100039395 | 3300005436 | Bacteria | 3835 |
| 58 | Ga0070713_100151725 | 3300005436 | Bacteria | 2062 |
| 59 | Ga0070713_100168645 | 3300005436 | Bacteria | 1960 |
| 60 | Ga0070713_100204529 | 3300005436 | Bacteria | 1785 |
| 61 | Ga0070710_10003824 | 3300005437 | Bacteria | 7115 |
| 62 | Ga0070710_10127757 | 3300005437 | Bacteria | 1546 |
| 63 | Ga0070710_10801804 | 3300005437 | Bacteria | 673 |
| 64 | Ga0070710_11365781 | 3300005437 | Bacteria | 529 |
| 65 | Ga0070711_100107157 | 3300005439 | Bacteria | 2045 |
| 66 | Ga0070711_100127365 | 3300005439 | Bacteria | 1892 |
| 67 | Ga0070711_100230263 | 3300005439 | Bacteria | 1444 |
| 68 | Ga0070711_100415078 | 3300005439 | Bacteria | 1095 |
| 69 | Ga0070711_101764233 | 3300005439 | Bacteria | 543 |
| 70 | Ga0070663_100102169 | 3300005455 | Bacteria | 2141 |
| 71 | Ga0070663_100294724 | 3300005455 | Bacteria | 1296 |
| 72 | Ga0070663_100544314 | 3300005455 | Bacteria | 969 |
| 73 | Ga0070663_101188199 | 3300005455 | Bacteria | 670 |
| 74 | Ga0070678_100500507 | 3300005456 | Bacteria | 1072 |
| 75 | Ga0070678_100614595 | 3300005456 | Bacteria | 971 |
| 76 | Ga0070681_10189005 | 3300005458 | Bacteria | 1979 |
| 77 | Ga0070681_10319858 | 3300005458 | Bacteria | 1461 |
| 78 | Ga0070681_10543503 | 3300005458 | Bacteria | 1075 |
| 79 | Ga0070681_10607161 | 3300005458 | Bacteria | 1008 |
| 80 | Ga0070681_10897494 | 3300005458 | Bacteria | 805 |
| 81 | Ga0068867_100403919 | 3300005459 | Bacteria | 1153 |
| 82 | Ga0070685_10858470 | 3300005466 | Bacteria | 673 |
| 83 | Ga0070706_101333660 | 3300005467 | Bacteria | 658 |
| 84 | Ga0070706_101865351 | 3300005467 | Bacteria | 546 |
| 85 | Ga0070698_101352577 | 3300005471 | Bacteria | 663 |
| 86 | Ga0070679_100100050 | 3300005530 | Bacteria | 2886 |
| 87 | Ga0070679_100135371 | 3300005530 | Bacteria | 2445 |
| 88 | Ga0070679_100241550 | 3300005530 | Bacteria | 1763 |
| 89 | Ga0070684_100174595 | 3300005535 | Bacteria | 1952 |
| 90 | Ga0070684_100772185 | 3300005535 | Bacteria | 898 |
| 91 | Ga0070697_100143823 | 3300005536 | Bacteria | 2007 |
| 92 | Ga0068853_100597861 | 3300005539 | Bacteria | 1047 |
| 93 | Ga0068853_100806856 | 3300005539 | Bacteria | 899 |
| 94 | Ga0068853_101142511 | 3300005539 | Bacteria | 751 |
| 95 | Ga0070695_100789063 | 3300005545 | Bacteria | 760 |
| 96 | Ga0070696_101675678 | 3300005546 | Bacteria | 548 |
| 97 | Ga0070693_100036361 | 3300005547 | Bacteria | 2737 |
| 98 | Ga0070693_100789984 | 3300005547 | Bacteria | 703 |
| 99 | Ga0070693_100999916 | 3300005547 | Bacteria | 632 |
| 100 | Ga0070665_100097042 | 3300005548 | Bacteria | 2952 |
| 101 | Ga0070665_100170533 | 3300005548 | Bacteria | 2177 |
| 102 | Ga0070665_101277442 | 3300005548 | Bacteria | 744 |
| 103 | Ga0068855_100092442 | 3300005563 | Bacteria | 3489 |
| 104 | Ga0068855_100373210 | 3300005563 | Bacteria | 1567 |
| 105 | Ga0068855_100766770 | 3300005563 | Bacteria | 1027 |
| 106 | Ga0068855_100982715 | 3300005563 | Bacteria | 888 |
| 107 | Ga0068855_101990740 | 3300005563 | Bacteria | 587 |
| 108 | Ga0070664_101297307 | 3300005564 | Bacteria | 687 |
| 109 | Ga0068857_100007213 | 3300005577 | Bacteria | 9571 |
| 110 | Ga0068857_100456149 | 3300005577 | Bacteria | 1196 |
| 111 | Ga0068857_100491713 | 3300005577 | Bacteria | 1150 |
| 112 | Ga0068857_101519794 | 3300005577 | Bacteria | 653 |
| 113 | Ga0068854_100302366 | 3300005578 | Bacteria | 1295 |
| 114 | Ga0068854_101028884 | 3300005578 | Bacteria | 731 |
| 115 | Ga0068854_101275018 | 3300005578 | Bacteria | 661 |
| 116 | Ga0068856_100020597 | 3300005614 | Bacteria | 6407 |
| 117 | Ga0068856_100188639 | 3300005614 | Bacteria | 2075 |
| 118 | Ga0068856_102312137 | 3300005614 | Bacteria | 546 |
| 119 | Ga0070702_100898400 | 3300005615 | Bacteria | 693 |
| 120 | Ga0070702_100976847 | 3300005615 | Bacteria | 669 |
| 121 | Ga0068852_100115685 | 3300005616 | Bacteria | 2445 |
| 122 | Ga0068852_100115767 | 3300005616 | Bacteria | 2444 |
| 123 | Ga0068852_100650407 | 3300005616 | Bacteria | 1062 |
| 124 | Ga0068852_102516539 | 3300005616 | Bacteria | 535 |
| 125 | Ga0068859_100702615 | 3300005617 | Bacteria | 1102 |
| 126 | Ga0068864_100284359 | 3300005618 | Bacteria | 1545 |
| 127 | Ga0068864_100289255 | 3300005618 | Bacteria | 1532 |
| 128 | Ga0068861_100203197 | 3300005719 | Bacteria | 1664 |
| 129 | Ga0068851_10006319 | 3300005834 | Bacteria | 5405 |
| 130 | Ga0068851_10528203 | 3300005834 | Bacteria | 711 |
| 131 | Ga0068851_10548057 | 3300005834 | Bacteria | 699 |
| 132 | Ga0068863_100333957 | 3300005841 | Bacteria | 1474 |
| 133 | Ga0068858_100207113 | 3300005842 | Bacteria | 1855 |
| 134 | Ga0068858_100327572 | 3300005842 | Bacteria | 1465 |
| 135 | Ga0068858_100350618 | 3300005842 | Bacteria | 1414 |
| 136 | Ga0068858_100493513 | 3300005842 | Bacteria | 1182 |
| 137 | Ga0068858_100663562 | 3300005842 | Bacteria | 1014 |
| 138 | Ga0068860_100000217 | 3300005843 | Bacteria | 90245 |
| 139 | Ga0068860_100641480 | 3300005843 | Bacteria | 1070 |
| 140 | Ga0068860_100726539 | 3300005843 | Bacteria | 1004 |
| 141 | Ga0068862_100807042 | 3300005844 | Bacteria | 917 |
| 142 | Ga0081455_10001626 | 3300005937 | Bacteria | 27421 |
| 143 | Ga0081455_10113701 | 3300005937 | Bacteria | 2146 |
| 144 | Ga0081540_1209013 | 3300005983 | Bacteria | 703 |
| 145 | Ga0070717_10070944 | 3300006028 | Bacteria | 2904 |
| 146 | Ga0070717_10140806 | 3300006028 | Bacteria | 2080 |
| 147 | Ga0070717_10156821 | 3300006028 | Bacteria | 1972 |
| 148 | Ga0070717_11019647 | 3300006028 | Bacteria | 754 |
| 149 | Ga0070717_11045830 | 3300006028 | Bacteria | 744 |
| 150 | Ga0070717_11210540 | 3300006028 | Bacteria | 687 |
| 151 | Ga0075365_10198537 | 3300006038 | Bacteria | 1405 |
| 152 | Ga0075365_10245977 | 3300006038 | Bacteria | 1256 |
| 153 | Ga0075368_10020458 | 3300006042 | Bacteria | 2507 |
| 154 | Ga0075363_100044320 | 3300006048 | Bacteria | 2356 |
| 155 | Ga0075364_10183530 | 3300006051 | Bacteria | 1416 |
| 156 | Ga0075364_10524594 | 3300006051 | Bacteria | 810 |
| 157 | Ga0070715_10001767 | 3300006163 | Bacteria | 6432 |
| 158 | Ga0070715_10002320 | 3300006163 | Bacteria | 5809 |
| 159 | Ga0070716_100015839 | 3300006173 | Bacteria | 3883 |
| 160 | Ga0070716_100083540 | 3300006173 | Bacteria | 1913 |
| 161 | Ga0070716_100273398 | 3300006173 | Bacteria | 1162 |
| 162 | Ga0070712_100287940 | 3300006175 | Bacteria | 1325 |
| 163 | Ga0070712_100481674 | 3300006175 | Bacteria | 1037 |
| 164 | Ga0070712_100593392 | 3300006175 | Bacteria | 937 |
| 165 | Ga0070712_100705105 | 3300006175 | Bacteria | 861 |
| 166 | Ga0075362_10185477 | 3300006177 | Bacteria | 1009 |
| 167 | Ga0075369_10006412 | 3300006186 | Bacteria | 4445 |
| 168 | Ga0075369_10060642 | 3300006186 | Bacteria | 1650 |
| 169 | Ga0075369_10115845 | 3300006186 | Bacteria | 1210 |
| 170 | Ga0075366_10104549 | 3300006195 | Bacteria | 1701 |
| 171 | Ga0075366_10979134 | 3300006195 | Bacteria | 527 |
| 172 | Ga0097621_100100941 | 3300006237 | Bacteria | 2428 |
| 173 | Ga0097621_100510822 | 3300006237 | Bacteria | 1089 |
| 174 | Ga0097621_100816059 | 3300006237 | Bacteria | 865 |
| 175 | Ga0075370_10941610 | 3300006353 | Bacteria | 528 |
| 176 | Ga0068871_100590150 | 3300006358 | Bacteria | 1009 |
| 177 | Ga0068871_100814064 | 3300006358 | Bacteria | 862 |
| 178 | Ga0068871_101293409 | 3300006358 | Bacteria | 686 |
| 179 | Ga0075434_101573331 | 3300006871 | Bacteria | 666 |
| 180 | Ga0068865_100990364 | 3300006881 | Bacteria | 736 |
| 181 | Ga0075436_100579168 | 3300006914 | Bacteria | 826 |
| 182 | Ga0097620_100702529 | 3300006931 | Bacteria | 1102 |
| 183 | Ga0099824_1008631 | 3300006942 | Bacteria | 12955 |
| 184 | Ga0075435_100340144 | 3300007076 | Bacteria | 1286 |
| 185 | Ga0099794_10718968 | 3300007265 | Bacteria | 532 |
| 186 | Ga0099795_10005381 | 3300007788 | Bacteria | 3398 |
| 187 | Ga0099795_10025396 | 3300007788 | Bacteria | 1987 |
| 188 | Ga0099795_10177057 | 3300007788 | Bacteria | 889 |
| 189 | Ga0099795_10224741 | 3300007788 | Bacteria | 800 |
| 190 | Ga0105251_10170095 | 3300009011 | Bacteria | 982 |
| 191 | Ga0105240_10002281 | 3300009093 | Bacteria | 31075 |
| 192 | Ga0105240_10006402 | 3300009093 | Bacteria | 17307 |
| 193 | Ga0105240_10007359 | 3300009093 | Bacteria | 16017 |
| 194 | Ga0105240_10069586 | 3300009093 | Bacteria | 4355 |
| 195 | Ga0105240_10215009 | 3300009093 | Bacteria | 2243 |
| 196 | Ga0105240_10722385 | 3300009093 | Bacteria | 1085 |
| 197 | Ga0105245_10731922 | 3300009098 | Bacteria | 1024 |
| 198 | Ga0105245_11154132 | 3300009098 | Bacteria | 822 |
| 199 | Ga0105245_12288876 | 3300009098 | Bacteria | 594 |
| 200 | Ga0105247_10006054 | 3300009101 | Bacteria | 7524 |
| 201 | Ga0105247_10025451 | 3300009101 | Bacteria | 3569 |
| 202 | Ga0105247_10081822 | 3300009101 | Bacteria | 2037 |
| 203 | Ga0105247_11650762 | 3300009101 | Bacteria | 528 |
| 204 | Ga0105243_10078436 | 3300009148 | Bacteria | 2689 |
| 205 | Ga0105241_10000387 | 3300009174 | Bacteria | 33305 |
| 206 | Ga0105241_10029931 | 3300009174 | Bacteria | 4066 |
| 207 | Ga0105241_10357468 | 3300009174 | Bacteria | 1270 |
| 208 | Ga0105241_10363687 | 3300009174 | Bacteria | 1259 |
| 209 | Ga0105242_10925838 | 3300009176 | Bacteria | 874 |
| 210 | Ga0105248_10425987 | 3300009177 | Bacteria | 1494 |
| 211 | Ga0105248_11124666 | 3300009177 | Bacteria | 888 |
| 212 | Ga0105237_10032208 | 3300009545 | Bacteria | 5309 |
| 213 | Ga0105237_10036037 | 3300009545 | Bacteria | 5005 |
| 214 | Ga0105237_10045417 | 3300009545 | Bacteria | 4421 |
| 215 | Ga0105237_10053783 | 3300009545 | Bacteria | 4037 |
| 216 | Ga0105237_10182076 | 3300009545 | Bacteria | 2101 |
| 217 | Ga0105237_10225019 | 3300009545 | Bacteria | 1876 |
| 218 | Ga0105237_10314522 | 3300009545 | Bacteria | 1569 |
| 219 | Ga0105237_10357531 | 3300009545 | Bacteria | 1465 |
| 220 | Ga0105237_10775472 | 3300009545 | Bacteria | 965 |
| 221 | Ga0105238_10017279 | 3300009551 | Bacteria | 7329 |
| 222 | Ga0105238_10071566 | 3300009551 | Bacteria | 3465 |
| 223 | Ga0105238_10266889 | 3300009551 | Bacteria | 1692 |
| 224 | Ga0105238_10661043 | 3300009551 | Bacteria | 1055 |
| 225 | Ga0105238_10826177 | 3300009551 | Bacteria | 943 |
| 226 | Ga0105238_10830796 | 3300009551 | Bacteria | 940 |
| 227 | Ga0105238_11305842 | 3300009551 | Bacteria | 751 |
| 228 | Ga0105238_11799722 | 3300009551 | Bacteria | 644 |
| 229 | Ga0105249_12920968 | 3300009553 | Bacteria | 549 |
| 230 | Ga0099796_10008671 | 3300010159 | Bacteria | 2718 |
| 231 | Ga0099796_10032297 | 3300010159 | Bacteria | 1714 |
| 232 | Ga0099796_10134752 | 3300010159 | Bacteria | 961 |
| 233 | Ga0099796_10255034 | 3300010159 | Bacteria | 730 |
| 234 | Ga0105239_10010998 | 3300010375 | Bacteria | 10102 |
| 235 | Ga0105239_10018870 | 3300010375 | Bacteria | 7620 |
| 236 | Ga0105239_10053182 | 3300010375 | Bacteria | 4442 |
| 237 | Ga0105239_10055799 | 3300010375 | Bacteria | 4333 |
| 238 | Ga0105239_10277385 | 3300010375 | Bacteria | 1887 |
| 239 | Ga0105239_10289336 | 3300010375 | Bacteria | 1845 |
| 240 | Ga0105239_10612230 | 3300010375 | Bacteria | 1243 |
| 241 | Ga0105239_11532551 | 3300010375 | Bacteria | 770 |
| 242 | Ga0105239_11886933 | 3300010375 | Bacteria | 693 |
| 243 | Ga0105239_12631672 | 3300010375 | Bacteria | 587 |
| 244 | Ga0105246_10007034 | 3300011119 | Bacteria | 6886 |
| 245 | Ga0157313_1015514 | 3300012503 | Bacteria | 717 |
| 246 | Ga0157373_10386352 | 3300013100 | Bacteria | 1002 |
| 247 | Ga0157373_10758192 | 3300013100 | Bacteria | 714 |
| 248 | Ga0157371_10163667 | 3300013102 | Bacteria | 1589 |
| 249 | Ga0157370_10113453 | 3300013104 | Bacteria | 2533 |
| 250 | Ga0157370_10208177 | 3300013104 | Bacteria | 1813 |
| 251 | Ga0157370_10918416 | 3300013104 | Bacteria | 794 |
| 252 | Ga0157369_10017915 | 3300013105 | Bacteria | 7950 |
| 253 | Ga0157369_10076750 | 3300013105 | Bacteria | 3582 |
| 254 | Ga0157369_10333113 | 3300013105 | Bacteria | 1577 |
| 255 | Ga0157374_10199234 | 3300013296 | Bacteria | 1960 |
| 256 | Ga0157374_11659942 | 3300013296 | Bacteria | 663 |
| 257 | Ga0157378_11066198 | 3300013297 | Bacteria | 844 |
| 258 | Ga0157378_11179419 | 3300013297 | Bacteria | 805 |
| 259 | Ga0157378_11888699 | 3300013297 | Bacteria | 646 |
| 260 | Ga0157378_12140132 | 3300013297 | Bacteria | 610 |
| 261 | Ga0163162_11262114 | 3300013306 | Bacteria | 839 |
| 262 | Ga0163162_12733162 | 3300013306 | Bacteria | 568 |
| 263 | Ga0157372_10011343 | 3300013307 | Bacteria | 9478 |
| 264 | Ga0157372_10216613 | 3300013307 | Bacteria | 2219 |
| 265 | Ga0157372_12474379 | 3300013307 | Bacteria | 596 |
| 266 | Ga0157375_10241813 | 3300013308 | Bacteria | 1965 |
| 267 | Ga0157375_12953067 | 3300013308 | Bacteria | 568 |
| 268 | Ga0182008_10333335 | 3300014497 | Bacteria | 801 |
| 269 | Ga0157379_10625262 | 3300014968 | Bacteria | 1007 |
| 270 | Ga0157379_12114810 | 3300014968 | Bacteria | 558 |
| 271 | Ga0157376_10286400 | 3300014969 | Bacteria | 1554 |
| 272 | Ga0157376_11447165 | 3300014969 | Bacteria | 719 |
| 273 | Ga0182006_1315673 | 3300015261 | Bacteria | 513 |
| 274 | Ga0163161_10298666 | 3300017792 | Bacteria | 1268 |
| 275 | Ga0206356_11596629 | 3300020070 | Bacteria | 1315 |
| 276 | Ga0214544_1000163 | 3300021320 | Bacteria | 101631 |
| 277 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 278 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 279 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 280 | Ga0213874_10064245 | 3300021377 | Bacteria | 1157 |
| 281 | Ga0213876_10001030 | 3300021384 | Bacteria | 17995 |
| 282 | Ga0213876_10058650 | 3300021384 | Bacteria | 2032 |
| 283 | Ga0213875_10458362 | 3300021388 | Bacteria | 611 |
| 284 | Ga0209563_102445 | 3300025230 | Bacteria | 4204 |
| 285 | Ga0209677_102384 | 3300025253 | Bacteria | 7162 |
| 286 | Ga0209148_1000333 | 3300025254 | Bacteria | 64490 |
| 287 | Ga0209233_1000526 | 3300025261 | Bacteria | 22038 |
| 288 | Ga0209233_1046951 | 3300025261 | Bacteria | 900 |
| 289 | Ga0209455_1003625 | 3300025272 | Bacteria | 5373 |
| 290 | Ga0209673_1008762 | 3300025273 | Bacteria | 4463 |
| 291 | Ga0209564_1002609 | 3300025295 | Bacteria | 13780 |
| 292 | Ga0209564_1028827 | 3300025295 | Bacteria | 1763 |
| 293 | Ga0209758_1000109 | 3300025297 | Bacteria | 214759 |
| 294 | Ga0209758_1000416 | 3300025297 | Bacteria | 72312 |
| 295 | Ga0209758_1001062 | 3300025297 | Bacteria | 35786 |
| 296 | Ga0209758_1006263 | 3300025297 | Bacteria | 8660 |
| 297 | Ga0209758_1006913 | 3300025297 | Bacteria | 7921 |
| 298 | Ga0209758_1038250 | 3300025297 | Bacteria | 1842 |
| 299 | Ga0209758_1068444 | 3300025297 | Bacteria | 1130 |
| 300 | Ga0209256_1019931 | 3300025299 | Bacteria | 2114 |
| 301 | Ga0207426_1000522 | 3300025302 | Bacteria | 55802 |
| 302 | Ga0207426_1000971 | 3300025302 | Bacteria | 28287 |
| 303 | Ga0207426_1023477 | 3300025302 | Bacteria | 2103 |
| 304 | Ga0207426_1033892 | 3300025302 | Bacteria | 1642 |
| 305 | Ga0209051_1075097 | 3300025303 | Bacteria | 999 |
| 306 | Ga0209257_1011890 | 3300025304 | Bacteria | 4113 |
| 307 | Ga0209257_1035061 | 3300025304 | Bacteria | 1556 |
| 308 | Ga0209257_1053235 | 3300025304 | Bacteria | 1133 |
| 309 | Ga0207656_10063721 | 3300025321 | Bacteria | 1623 |
| 310 | Ga0207656_10565558 | 3300025321 | Bacteria | 580 |
| 311 | Ga0207692_10014570 | 3300025898 | Bacteria | 3439 |
| 312 | Ga0207692_10039490 | 3300025898 | Bacteria | 2322 |
| 313 | Ga0207692_10042963 | 3300025898 | Bacteria | 2246 |
| 314 | Ga0207710_10040294 | 3300025900 | Bacteria | 2070 |
| 315 | Ga0207710_10116804 | 3300025900 | Bacteria | 1271 |
| 316 | Ga0207688_10116819 | 3300025901 | Bacteria | 1554 |
| 317 | Ga0207688_10270301 | 3300025901 | Bacteria | 1034 |
| 318 | Ga0207647_10002364 | 3300025904 | Bacteria | 14329 |
| 319 | Ga0207647_10040764 | 3300025904 | Bacteria | 2923 |
| 320 | Ga0207685_10022592 | 3300025905 | Bacteria | 2129 |
| 321 | Ga0207685_10023966 | 3300025905 | Bacteria | 2085 |
| 322 | Ga0207685_10092948 | 3300025905 | Bacteria | 1274 |
| 323 | Ga0207699_10000504 | 3300025906 | Bacteria | 19475 |
| 324 | Ga0207699_10007966 | 3300025906 | Bacteria | 5201 |
| 325 | Ga0207699_10176325 | 3300025906 | Bacteria | 1434 |
| 326 | Ga0207699_10539520 | 3300025906 | Bacteria | 845 |
| 327 | Ga0207699_10853068 | 3300025906 | Bacteria | 671 |
| 328 | Ga0207705_10212241 | 3300025909 | Bacteria | 1468 |
| 329 | Ga0207654_10106045 | 3300025911 | Bacteria | 1740 |
| 330 | Ga0207654_10128056 | 3300025911 | Bacteria | 1603 |
| 331 | Ga0207707_10001479 | 3300025912 | Bacteria | 21748 |
| 332 | Ga0207707_10012648 | 3300025912 | Bacteria | 7334 |
| 333 | Ga0207707_10053075 | 3300025912 | Bacteria | 3528 |
| 334 | Ga0207695_10000378 | 3300025913 | Bacteria | 101352 |
| 335 | Ga0207695_10056577 | 3300025913 | Bacteria | 4080 |
| 336 | Ga0207695_10777583 | 3300025913 | Bacteria | 838 |
| 337 | Ga0207671_10014103 | 3300025914 | Bacteria | 6333 |
| 338 | Ga0207671_10143988 | 3300025914 | Bacteria | 1838 |
| 339 | Ga0207671_10205510 | 3300025914 | Bacteria | 1539 |
| 340 | Ga0207671_10380751 | 3300025914 | Bacteria | 1121 |
| 341 | Ga0207671_10402253 | 3300025914 | Bacteria | 1089 |
| 342 | Ga0207693_10006678 | 3300025915 | Bacteria | 9530 |
| 343 | Ga0207693_10025530 | 3300025915 | Bacteria | 4684 |
| 344 | Ga0207693_10170699 | 3300025915 | Bacteria | 1713 |
| 345 | Ga0207693_10223631 | 3300025915 | Bacteria | 1478 |
| 346 | Ga0207693_10399658 | 3300025915 | Bacteria | 1074 |
| 347 | Ga0207663_10001118 | 3300025916 | Bacteria | 12328 |
| 348 | Ga0207663_10985163 | 3300025916 | Bacteria | 676 |
| 349 | Ga0207660_10017029 | 3300025917 | Bacteria | 4821 |
| 350 | Ga0207660_10196043 | 3300025917 | Bacteria | 1575 |
| 351 | Ga0207657_10053480 | 3300025919 | Bacteria | 3498 |
| 352 | Ga0207657_10598678 | 3300025919 | Bacteria | 860 |
| 353 | Ga0207657_10764977 | 3300025919 | Bacteria | 748 |
| 354 | Ga0207649_10603451 | 3300025920 | Bacteria | 844 |
| 355 | Ga0207652_10005915 | 3300025921 | Bacteria | 9894 |
| 356 | Ga0207652_10519351 | 3300025921 | Bacteria | 1071 |
| 357 | Ga0207652_10558208 | 3300025921 | Bacteria | 1029 |
| 358 | Ga0207694_10280205 | 3300025924 | Bacteria | 1369 |
| 359 | Ga0207694_10792917 | 3300025924 | Bacteria | 800 |
| 360 | Ga0207687_11083003 | 3300025927 | Bacteria | 688 |
| 361 | Ga0207700_10046865 | 3300025928 | Bacteria | 3200 |
| 362 | Ga0207700_10066647 | 3300025928 | Bacteria | 2753 |
| 363 | Ga0207700_10200060 | 3300025928 | Bacteria | 1683 |
| 364 | Ga0207700_10394441 | 3300025928 | Bacteria | 1212 |
| 365 | Ga0207700_10651051 | 3300025928 | Bacteria | 939 |
| 366 | Ga0207664_10019715 | 3300025929 | Bacteria | 4990 |
| 367 | Ga0207664_10070113 | 3300025929 | Bacteria | 2820 |
| 368 | Ga0207644_10554366 | 3300025931 | Bacteria | 952 |
| 369 | Ga0207644_10572107 | 3300025931 | Bacteria | 936 |
| 370 | Ga0207690_10201877 | 3300025932 | Bacteria | 1510 |
| 371 | Ga0207690_10320373 | 3300025932 | Bacteria | 1219 |
| 372 | Ga0207706_10350008 | 3300025933 | Bacteria | 1285 |
| 373 | Ga0207709_11540464 | 3300025935 | Bacteria | 552 |
| 374 | Ga0207669_10369115 | 3300025937 | Bacteria | 1115 |
| 375 | Ga0207704_11270574 | 3300025938 | Bacteria | 629 |
| 376 | Ga0207665_10004372 | 3300025939 | Bacteria | 9383 |
| 377 | Ga0207665_10074448 | 3300025939 | Bacteria | 2324 |
| 378 | Ga0207665_10189654 | 3300025939 | Bacteria | 1493 |
| 379 | Ga0207665_10670882 | 3300025939 | Bacteria | 814 |
| 380 | Ga0207665_11072513 | 3300025939 | Bacteria | 642 |
| 381 | Ga0207691_10463611 | 3300025940 | Bacteria | 1078 |
| 382 | Ga0207711_10610019 | 3300025941 | Bacteria | 1018 |
| 383 | Ga0207661_10033385 | 3300025944 | Bacteria | 3993 |
| 384 | Ga0207661_10455642 | 3300025944 | Bacteria | 1165 |
| 385 | Ga0207667_10207653 | 3300025949 | Bacteria | 2008 |
| 386 | Ga0207667_10421394 | 3300025949 | Bacteria | 1358 |
| 387 | Ga0207667_11116168 | 3300025949 | Bacteria | 771 |
| 388 | Ga0207668_10241672 | 3300025972 | Bacteria | 1461 |
| 389 | Ga0207640_10038737 | 3300025981 | Bacteria | 3011 |
| 390 | Ga0207640_10123034 | 3300025981 | Bacteria | 1863 |
| 391 | Ga0207640_10453615 | 3300025981 | Bacteria | 1057 |
| 392 | Ga0207658_10131707 | 3300025986 | Bacteria | 2010 |
| 393 | Ga0207677_10722919 | 3300026023 | Bacteria | 885 |
| 394 | Ga0207677_11316707 | 3300026023 | Bacteria | 664 |
| 395 | Ga0207703_10268356 | 3300026035 | Bacteria | 1545 |
| 396 | Ga0207703_10420600 | 3300026035 | Bacteria | 1243 |
| 397 | Ga0207703_10585561 | 3300026035 | Bacteria | 1054 |
| 398 | Ga0207703_11869909 | 3300026035 | Bacteria | 576 |
| 399 | Ga0207639_10068421 | 3300026041 | Bacteria | 2767 |
| 400 | Ga0207639_10166179 | 3300026041 | Bacteria | 1864 |
| 401 | Ga0207678_10142121 | 3300026067 | Bacteria | 2048 |
| 402 | Ga0207678_10807829 | 3300026067 | Bacteria | 828 |
| 403 | Ga0207678_11132178 | 3300026067 | Bacteria | 693 |
| 404 | Ga0207678_11212483 | 3300026067 | Bacteria | 668 |
| 405 | Ga0207648_10413850 | 3300026089 | Bacteria | 1223 |
| 406 | Ga0207676_10172067 | 3300026095 | Bacteria | 1888 |
| 407 | Ga0207676_11364822 | 3300026095 | Bacteria | 704 |
| 408 | Ga0207674_10002366 | 3300026116 | Bacteria | 23835 |
| 409 | Ga0207674_10338042 | 3300026116 | Bacteria | 1456 |
| 410 | Ga0207674_10739100 | 3300026116 | Bacteria | 950 |
| 411 | Ga0207674_11006404 | 3300026116 | Bacteria | 803 |
| 412 | Ga0207675_100126349 | 3300026118 | Bacteria | 2422 |
| 413 | Ga0207675_101732921 | 3300026118 | Bacteria | 644 |
| 414 | Ga0207683_10338033 | 3300026121 | Bacteria | 1381 |
| 415 | Ga0207683_10692530 | 3300026121 | Bacteria | 945 |
| 416 | Ga0207698_10065719 | 3300026142 | Bacteria | 2850 |
| 417 | Ga0207698_10103631 | 3300026142 | Bacteria | 2365 |
| 418 | Ga0209389_1000230 | 3300027296 | Bacteria | 37484 |
| 419 | Ga0209389_1002940 | 3300027296 | Bacteria | 13400 |
| 420 | Ga0209589_1000897 | 3300027357 | Bacteria | 45637 |
| 421 | Ga0209489_100110 | 3300027361 | Bacteria | 117680 |
| 422 | Ga0209489_102489 | 3300027361 | Bacteria | 37484 |
| 423 | Ga0209700_102336 | 3300027363 | Bacteria | 38715 |
| 424 | Ga0209588_1001138 | 3300027671 | Bacteria | 6848 |
| 425 | Ga0268266_10055646 | 3300028379 | Bacteria | 3401 |
| 426 | Ga0268264_10000271 | 3300028381 | Bacteria | 90154 |
| 427 | Ga0268264_10357532 | 3300028381 | Bacteria | 1392 |
| 428 | Ga0307511_10138741 | 3300030521 | Bacteria | 1437 |
| 429 | Ga0307511_10193517 | 3300030521 | Bacteria | 1070 |
| 430 | Ga0265762_1188664 | 3300030760 | Bacteria | 511 |
| 431 | Ga0265330_10029779 | 3300031235 | Bacteria | 2453 |
| 432 | Ga0265339_10106083 | 3300031249 | Bacteria | 1458 |
| 433 | Ga0265339_10291540 | 3300031249 | Bacteria | 780 |
| 434 | Ga0265331_10047281 | 3300031250 | Bacteria | 2070 |
| 435 | Ga0307509_10066441 | 3300031507 | Bacteria | 3783 |
| 436 | Ga0307509_10147325 | 3300031507 | Bacteria | 2277 |
| 437 | Ga0307508_10000541 | 3300031616 | Bacteria | 44822 |
| 438 | Ga0307508_10652651 | 3300031616 | Bacteria | 657 |
| 439 | Ga0265314_10085107 | 3300031711 | Bacteria | 2074 |
| 440 | Ga0265342_10034049 | 3300031712 | Bacteria | 3127 |
| 441 | Ga0307516_10016567 | 3300031730 | Bacteria | 7706 |
| 442 | Ga0307415_100313972 | 3300032126 | Bacteria | 1304 |
| 443 | Ga0307507_10180798 | 3300033179 | Bacteria | 1508 |
| 444 | Ga0307510_10002289 | 3300033180 | Bacteria | 21616 |
| 445 | Ga0307510_10156570 | 3300033180 | Bacteria | 1884 |
| 446 | Ga0316214_1016739 | 3300033545 | Bacteria | 1015 |
| 447 | Ga0373926_0008279 | 3300035083 | Bacteria | 3459 |
| 448 | Ga0373926_0102798 | 3300035083 | Bacteria | 1069 |
| 449 | Ga0373926_0294854 | 3300035083 | Bacteria | 633 |
| 450 | Ga0373923_0044205 | 3300035111 | Bacteria | 1846 |
| 451 | Ga0373923_0399400 | 3300035111 | Bacteria | 661 |
| 452 | Ga0373936_0046381 | 3300035113 | Bacteria | 1752 |
| 453 | Ga0373936_0048109 | 3300035113 | Bacteria | 1721 |
| 454 | Ga0373945_0026055 | 3300035116 | Bacteria | 2035 |
| 455 | Ga0373945_0052796 | 3300035116 | Bacteria | 1499 |
| 456 | Ga0373945_0481877 | 3300035116 | Bacteria | 551 |
| 457 | Ga0373953_0045173 | 3300035117 | Bacteria | 1764 |
| 458 | Ga0373953_0131244 | 3300035117 | Bacteria | 1068 |
| 459 | Ga0373954_0011541 | 3300035118 | Bacteria | 3917 |
| 460 | Ga0373954_0067297 | 3300035118 | Bacteria | 1697 |
| 461 | Ga0373954_0166130 | 3300035118 | Bacteria | 1080 |
| 462 | Ga0373954_0421341 | 3300035118 | Bacteria | 660 |
| 463 | Ga0373956_0170189 | 3300035119 | Bacteria | 1028 |
| 464 | Ga0373956_0282485 | 3300035119 | Bacteria | 790 |
| 465 | Ga0373957_0019273 | 3300035120 | Bacteria | 2398 |
| 466 | Ga0373943_0011684 | 3300035170 | Bacteria | 3952 |
| 467 | Ga0373943_0024472 | 3300035170 | Bacteria | 2815 |
| 468 | Ga0373943_0284016 | 3300035170 | Bacteria | 936 |
| 469 | Ga0373943_0988811 | 3300035170 | Bacteria | 504 |
| 470 | Ga0373946_0100132 | 3300035171 | Bacteria | 1298 |
| 471 | Ga0373955_0362572 | 3300035172 | Bacteria | 878 |
| 472 | Ga0373955_0373130 | 3300035172 | Bacteria | 865 |
| 473 | Ga0373955_0569120 | 3300035172 | Bacteria | 693 |
| 474 | Ga0373955_1021243 | 3300035172 | Bacteria | 509 |
| 475 | Ga0373924_0141622 | 3300035410 | Bacteria | 1049 |
| 476 | Ga0373924_0267719 | 3300035410 | Bacteria | 757 |
| 477 | Ga0373935_0012834 | 3300035692 | Bacteria | 5046 |
| 478 | Ga0373935_0040630 | 3300035692 | Bacteria | 2919 |
| 479 | Ga0373935_0044908 | 3300035692 | Bacteria | 2786 |
| 480 | Ga0373935_0107798 | 3300035692 | Bacteria | 1845 |
| 481 | Ga0373935_0343294 | 3300035692 | Bacteria | 1063 |
| 482 | Ga0373935_0504404 | 3300035692 | Bacteria | 879 |
| 483 | Ga0373927_0001230 | 3300035695 | Bacteria | 19452 |
| 484 | Ga0373927_0005221 | 3300035695 | Bacteria | 8984 |
| 485 | Ga0373927_0011945 | 3300035695 | Bacteria | 5779 |
| 486 | Ga0373927_0103934 | 3300035695 | Bacteria | 1849 |
| 487 | Ga0373927_0214044 | 3300035695 | Bacteria | 1266 |
| 488 | Ga0373927_0246425 | 3300035695 | Bacteria | 1174 |
| 489 | Ga0373933_0000127 | 3300035724 | Bacteria | 48988 |
| 490 | Ga0373933_0235676 | 3300035724 | Bacteria | 1176 |
| 491 | Ga0373933_0311888 | 3300035724 | Bacteria | 1019 |
| 492 | Ga0373933_0480671 | 3300035724 | Bacteria | 813 |
| 493 | Ga0373933_0715247 | 3300035724 | Bacteria | 659 |
| 494 | Ga0373947_0006336 | 3300035725 | Bacteria | 6876 |
| 495 | Ga0373947_0093150 | 3300035725 | Bacteria | 1883 |
| 496 | Ga0373947_0139383 | 3300035725 | Bacteria | 1554 |
| 497 | Ga0373947_0283339 | 3300035725 | Bacteria | 1102 |
| 498 | Ga0373937_0051021 | 3300036401 | Bacteria | 3792 |
| 499 | Ga0373937_0064183 | 3300036401 | Bacteria | 3378 |
| 500 | Ga0373937_0085421 | 3300036401 | Bacteria | 2920 |
| 501 | Ga0373937_0522338 | 3300036401 | Bacteria | 1128 |
| 502 | Ga0372808_050709 | 3300036459 | Bacteria | 594 |
| 503 | Ga0373925_0002121 | 3300037068 | Bacteria | 16252 |
| 504 | Ga0373925_0082948 | 3300037068 | Bacteria | 2440 |
| 505 | Ga0373925_0202744 | 3300037068 | Bacteria | 1578 |
| 506 | Ga0373925_0538975 | 3300037068 | Bacteria | 959 |
| 507 | Ga0395900_0832897 | 3300037418 | Bacteria | 849 |
| 508 | Ga0395898_0251747 | 3300037466 | Bacteria | 1685 |
| 509 | Ga0395898_0822048 | 3300037466 | Bacteria | 869 |
| 510 | Ga0395905_0030447 | 3300037471 | Bacteria | 5085 |
| 511 | Ga0436364_0566534 | 3300037853 | Bacteria | 1785 |
| 512 | Ga0436365_0022683 | 3300039437 | Bacteria | 28266 |
| 513 | Ga0436365_0354924 | 3300039437 | Bacteria | 903 |
| 514 | Ga0436365_0365629 | 3300039437 | Bacteria | 4324 |
| 515 | Ga0436365_0547188 | 3300039437 | Bacteria | 805 |
| 516 | Ga0436365_0825888 | 3300039437 | Bacteria | 1030 |
| 517 | Ga0436360_0536456 | 3300039438 | Bacteria | 1491 |
| 518 | Ga0436360_0546753 | 3300039438 | Bacteria | 700 |
| 519 | Ga0436363_0186306 | 3300039450 | Bacteria | 4704 |
| 520 | Ga0436363_0714205 | 3300039450 | Bacteria | 714 |
| 521 | Ga0436362_0842663 | 3300039453 | Bacteria | 6079 |
| 522 | Ga0436362_0871182 | 3300039453 | Bacteria | 686 |
| 523 | Ga0451787_703960 | 3300041441 | Bacteria | 680 |
| 524 | Ga0451793_0761067 | 3300041452 | Bacteria | 752 |
| 525 | Ga0451793_1046715 | 3300041452 | Bacteria | 817 |
| 526 | Ga0451797_1546518 | 3300041453 | Bacteria | 903 |
| 527 | Ga0451795_1610771 | 3300041456 | Bacteria | 637 |
| 528 | Ga0451833_0979399 | 3300041491 | Bacteria | 923 |
| 529 | Ga0451849_1115692 | 3300041505 | Bacteria | 593 |
| 530 | Ga0451851_0230066 | 3300041507 | Bacteria | 608 |
| 531 | Ga0451853_2103161 | 3300041512 | Bacteria | 528 |
| 532 | Ga0451853_3411604 | 3300041512 | Bacteria | 615 |
| 533 | Ga0466969_0005173 | 3300044656 | Bacteria | 6936 |
| 534 | Ga0466972_0000115 | 3300044658 | Bacteria | 68073 |
| 535 | Ga0466972_0032818 | 3300044658 | Bacteria | 2548 |
| 536 | Ga0466972_0406312 | 3300044658 | Bacteria | 638 |
| 537 | Ga0466966_0025622 | 3300044684 | Bacteria | 3852 |
| 538 | Ga0466961_0000066 | 3300044693 | Bacteria | 63201 |
| 539 | Ga0466963_0029979 | 3300044694 | Bacteria | 3506 |
| 540 | Ga0466963_0106052 | 3300044694 | Bacteria | 1926 |
| 541 | Ga0466963_0585322 | 3300044694 | Bacteria | 788 |
| 542 | Ga0466968_0005163 | 3300044735 | Bacteria | 4885 |
| 543 | Ga0466968_0063005 | 3300044735 | Bacteria | 1602 |
| 544 | Ga0466968_0121163 | 3300044735 | Bacteria | 1183 |
| 545 | Ga0466970_0131669 | 3300044765 | Bacteria | 1374 |
| 546 | Ga0466960_0078634 | 3300044901 | Bacteria | 1656 |
| 547 | Ga0466960_0150967 | 3300044901 | Bacteria | 1241 |
| 548 | Ga0466960_0909638 | 3300044901 | Bacteria | 537 |
| 549 | Ga0451576_0796465 | 3300045051 | Bacteria | 992 |
| 550 | Ga0466967_0128644 | 3300045976 | Bacteria | 2348 |
| 551 | Ga0466967_0349897 | 3300045976 | Bacteria | 1430 |
| 552 | Ga0495617_164548 | 3300046452 | Bacteria | 702 |
| 553 | Ga0495592_0026498 | 3300046454 | Bacteria | 4395 |
| 554 | Ga0495592_0425717 | 3300046454 | Bacteria | 836 |
| 555 | Ga0495592_0443558 | 3300046454 | Bacteria | 814 |
| 556 | Ga0495592_0957101 | 3300046454 | Bacteria | 500 |
| 557 | Ga0495603_0000667 | 3300046455 | Bacteria | 19417 |
| 558 | Ga0495603_0108451 | 3300046455 | Bacteria | 1620 |
| 559 | Ga0495603_0216295 | 3300046455 | Bacteria | 1106 |
| 560 | Ga0495629_0000283 | 3300046459 | Bacteria | 43929 |
| 561 | Ga0495629_0025350 | 3300046459 | Bacteria | 4215 |
| 562 | Ga0495629_0059945 | 3300046459 | Bacteria | 2660 |
| 563 | Ga0495638_0011191 | 3300046460 | Bacteria | 6195 |
| 564 | Ga0495638_0556750 | 3300046460 | Bacteria | 569 |
| 565 | Ga0495641_0006447 | 3300046461 | Bacteria | 7606 |
| 566 | Ga0495651_0022916 | 3300046462 | Bacteria | 4856 |
| 567 | Ga0495651_0040170 | 3300046462 | Bacteria | 3640 |
| 568 | Ga0495651_0066864 | 3300046462 | Bacteria | 2742 |
| 569 | Ga0495653_0455846 | 3300046463 | Bacteria | 804 |
| 570 | Ga0495650_0127441 | 3300046471 | Bacteria | 932 |
| 571 | Ga0495580_0002411 | 3300046472 | Bacteria | 16335 |
| 572 | Ga0495580_0028511 | 3300046472 | Bacteria | 4058 |
| 573 | Ga0495582_0032135 | 3300046473 | Bacteria | 2887 |
| 574 | Ga0495582_0055453 | 3300046473 | Bacteria | 2184 |
| 575 | Ga0495605_0076546 | 3300046474 | Bacteria | 1571 |
| 576 | Ga0495605_0133725 | 3300046474 | Bacteria | 1116 |
| 577 | Ga0495639_0000423 | 3300046475 | Bacteria | 20176 |
| 578 | Ga0495639_0102827 | 3300046475 | Bacteria | 1350 |
| 579 | Ga0495639_0104588 | 3300046475 | Bacteria | 1339 |
| 580 | Ga0495662_0000186 | 3300046476 | Bacteria | 25137 |
| 581 | Ga0495664_0004204 | 3300046477 | Bacteria | 7858 |
| 582 | Ga0495664_0058995 | 3300046477 | Bacteria | 2284 |
| 583 | Ga0495664_0118980 | 3300046477 | Bacteria | 1597 |
| 584 | Ga0495664_0539502 | 3300046477 | Bacteria | 695 |
| 585 | Ga0495664_0829734 | 3300046477 | Bacteria | 543 |
| 586 | Ga0495585_0328902 | 3300046492 | Bacteria | 746 |
| 587 | Ga0495594_0001986 | 3300046499 | Bacteria | 10660 |
| 588 | Ga0495594_0291210 | 3300046499 | Bacteria | 930 |
| 589 | Ga0495607_0139837 | 3300046501 | Bacteria | 1250 |
| 590 | Ga0495583_0167219 | 3300046506 | Bacteria | 905 |
| 591 | Ga0495606_0001397 | 3300046507 | Bacteria | 32530 |
| 592 | Ga0495606_0038607 | 3300046507 | Bacteria | 3228 |
| 593 | Ga0495608_0143664 | 3300046511 | Bacteria | 1522 |
| 594 | Ga0495608_0610130 | 3300046511 | Bacteria | 654 |
| 595 | Ga0495610_0188039 | 3300046512 | Bacteria | 854 |
| 596 | Ga0495610_0369912 | 3300046512 | Bacteria | 535 |
| 597 | Ga0495616_0173399 | 3300046513 | Bacteria | 963 |
| 598 | Ga0495618_0023307 | 3300046514 | Bacteria | 3827 |
| 599 | Ga0495618_0040958 | 3300046514 | Bacteria | 2916 |
| 600 | Ga0495618_0092687 | 3300046514 | Bacteria | 1931 |
| 601 | Ga0495628_0012222 | 3300046516 | Bacteria | 7238 |
| 602 | Ga0495628_0025773 | 3300046516 | Bacteria | 4801 |
| 603 | Ga0495628_0037593 | 3300046516 | Bacteria | 3881 |
| 604 | Ga0495628_0235378 | 3300046516 | Bacteria | 1371 |
| 605 | Ga0495630_0021544 | 3300046517 | Bacteria | 4759 |
| 606 | Ga0495630_0025317 | 3300046517 | Bacteria | 4386 |
| 607 | Ga0495630_0422188 | 3300046517 | Bacteria | 1022 |
| 608 | Ga0495648_0001145 | 3300046524 | Bacteria | 26801 |
| 609 | Ga0495648_0057238 | 3300046524 | Bacteria | 2340 |
| 610 | Ga0495648_0153738 | 3300046524 | Bacteria | 1197 |
| 611 | Ga0495648_0410799 | 3300046524 | Bacteria | 602 |
| 612 | Ga0495666_0169613 | 3300046526 | Bacteria | 1010 |
| 613 | Ga0495652_0015775 | 3300046529 | Bacteria | 6763 |
| 614 | Ga0495652_0026046 | 3300046529 | Bacteria | 5168 |
| 615 | Ga0495652_0143000 | 3300046529 | Bacteria | 1879 |
| 616 | Ga0495652_0143215 | 3300046529 | Bacteria | 1877 |
| 617 | Ga0495652_0153554 | 3300046529 | Bacteria | 1795 |
| 618 | Ga0495652_0537655 | 3300046529 | Bacteria | 805 |
| 619 | Ga0495665_0001096 | 3300046531 | Bacteria | 14317 |
| 620 | Ga0495665_0105411 | 3300046531 | Bacteria | 1479 |
| 621 | Ga0495640_0030086 | 3300046533 | Bacteria | 3891 |
| 622 | Ga0495640_0065433 | 3300046533 | Bacteria | 2455 |
| 623 | Ga0495640_0077705 | 3300046533 | Bacteria | 2212 |
| 624 | Ga0495586_0099069 | 3300046535 | Bacteria | 1616 |
| 625 | Ga0495587_0058721 | 3300046536 | Bacteria | 2260 |
| 626 | Ga0495587_0653882 | 3300046536 | Bacteria | 577 |
| 627 | Ga0495597_0336347 | 3300046542 | Bacteria | 581 |
| 628 | Ga0495645_0063646 | 3300046543 | Bacteria | 2670 |
| 629 | Ga0495645_0148431 | 3300046543 | Bacteria | 1631 |
| 630 | Ga0495645_0541065 | 3300046543 | Bacteria | 723 |
| 631 | Ga0495645_0863905 | 3300046543 | Bacteria | 539 |
| 632 | Ga0495622_0013019 | 3300046557 | Bacteria | 3860 |
| 633 | Ga0495622_0013289 | 3300046557 | Bacteria | 3820 |
| 634 | Ga0495622_0017461 | 3300046557 | Bacteria | 3340 |
| 635 | Ga0495667_0010532 | 3300046559 | Bacteria | 6256 |
| 636 | Ga0495667_0063250 | 3300046559 | Bacteria | 2422 |
| 637 | Ga0495667_0090293 | 3300046559 | Bacteria | 1985 |
| 638 | Ga0495668_0128689 | 3300046616 | Bacteria | 1386 |
| 639 | Ga0495668_0715470 | 3300046616 | Bacteria | 554 |
| 640 | Ga0495634_0031856 | 3300046642 | Bacteria | 3630 |
| 641 | Ga0495634_0074401 | 3300046642 | Bacteria | 2232 |
| 642 | Ga0495634_0104953 | 3300046642 | Bacteria | 1822 |
| 643 | Ga0495634_0116335 | 3300046642 | Bacteria | 1715 |
| 644 | Ga0495611_0055368 | 3300046648 | Bacteria | 1794 |
| 645 | Ga0495625_0095197 | 3300046660 | Bacteria | 2053 |
| 646 | Ga0495625_0280052 | 3300046660 | Bacteria | 1073 |
| 647 | Ga0495635_0002530 | 3300046663 | Bacteria | 12506 |
| 648 | Ga0495635_0005323 | 3300046663 | Bacteria | 8957 |
| 649 | Ga0495635_0144414 | 3300046663 | Bacteria | 1620 |
| 650 | Ga0495635_0201842 | 3300046663 | Bacteria | 1348 |
| 651 | Ga0495588_0007115 | 3300046674 | Bacteria | 5074 |
| 652 | Ga0495588_0017451 | 3300046674 | Bacteria | 3487 |
| 653 | Ga0495588_0310257 | 3300046674 | Bacteria | 830 |
| 654 | Ga0495657_0015963 | 3300046675 | Bacteria | 5479 |
| 655 | Ga0495657_0049749 | 3300046675 | Bacteria | 2821 |
| 656 | Ga0495657_0057001 | 3300046675 | Bacteria | 2599 |
| 657 | Ga0495599_0029223 | 3300046678 | Bacteria | 3455 |
| 658 | Ga0495599_0115407 | 3300046678 | Bacteria | 1671 |
| 659 | Ga0495599_0117960 | 3300046678 | Bacteria | 1650 |
| 660 | Ga0495599_0142769 | 3300046678 | Bacteria | 1485 |
| 661 | Ga0495623_0026575 | 3300046679 | Bacteria | 3725 |
| 662 | Ga0495623_0211706 | 3300046679 | Bacteria | 1109 |
| 663 | Ga0495623_0217396 | 3300046679 | Bacteria | 1091 |
| 664 | Ga0495623_0477763 | 3300046679 | Bacteria | 660 |
| 665 | Ga0495646_0007232 | 3300046680 | Bacteria | 7052 |
| 666 | Ga0495646_0029944 | 3300046680 | Bacteria | 3400 |
| 667 | Ga0495647_0001483 | 3300046681 | Bacteria | 7279 |
| 668 | Ga0495658_0281842 | 3300046683 | Bacteria | 1049 |
| 669 | Ga0495658_0507566 | 3300046683 | Bacteria | 771 |
| 670 | Ga0495613_0001910 | 3300046689 | Bacteria | 15801 |
| 671 | Ga0495613_0021869 | 3300046689 | Bacteria | 4768 |
| 672 | Ga0495613_0099154 | 3300046689 | Bacteria | 2105 |
| 673 | Ga0495613_0104432 | 3300046689 | Bacteria | 2045 |
| 674 | Ga0495613_0565336 | 3300046689 | Bacteria | 760 |
| 675 | Ga0495624_0001800 | 3300046690 | Bacteria | 16366 |
| 676 | Ga0495624_0043889 | 3300046690 | Bacteria | 2850 |
| 677 | Ga0495624_0208994 | 3300046690 | Bacteria | 1184 |
| 678 | Ga0495624_0258095 | 3300046690 | Bacteria | 1053 |
| 679 | Ga0495670_0360309 | 3300046691 | Bacteria | 783 |
| 680 | Ga0495649_0178548 | 3300046694 | Bacteria | 1108 |
| 681 | Ga0495649_0197583 | 3300046694 | Bacteria | 1045 |
| 682 | Ga0495649_0391518 | 3300046694 | Bacteria | 698 |
| 683 | Ga0495589_0032117 | 3300046794 | Bacteria | 2641 |
| 684 | Ga0495600_0012830 | 3300046809 | Bacteria | 5248 |
| 685 | Ga0495600_0028095 | 3300046809 | Bacteria | 3638 |
| 686 | Ga0495600_0101770 | 3300046809 | Bacteria | 1872 |
| 687 | Ga0495600_0823894 | 3300046809 | Bacteria | 552 |
| 688 | Ga0495581_0000346 | 3300047315 | Bacteria | 23081 |
| 689 | Ga0495581_0094303 | 3300047315 | Bacteria | 1737 |
| 690 | Ga0495581_0096893 | 3300047315 | Bacteria | 1713 |
| 691 | Ga0495581_0200019 | 3300047315 | Bacteria | 1169 |
| 692 | Ga0495604_0007903 | 3300047317 | Bacteria | 8423 |
| 693 | Ga0495604_0013112 | 3300047317 | Bacteria | 6602 |
| 694 | Ga0495604_0165859 | 3300047317 | Bacteria | 1557 |
| 695 | Ga0495674_0024064 | 3300047319 | Bacteria | 5603 |
| 696 | Ga0495674_0025391 | 3300047319 | Bacteria | 5433 |
| 697 | Ga0495674_0089250 | 3300047319 | Bacteria | 2635 |
| 698 | Ga0495674_0272343 | 3300047319 | Bacteria | 1389 |
| 699 | Ga0495674_0656974 | 3300047319 | Bacteria | 826 |
| 700 | Ga0495674_1035960 | 3300047319 | Bacteria | 627 |
| 701 | Ga0495676_0049875 | 3300047321 | Bacteria | 3361 |
| 702 | Ga0495676_0121149 | 3300047321 | Bacteria | 1902 |
| 703 | Ga0495676_0138278 | 3300047321 | Bacteria | 1748 |
| 704 | Ga0495676_0243605 | 3300047321 | Bacteria | 1230 |
| 705 | Ga0495680_0001058 | 3300047322 | Bacteria | 30479 |
| 706 | Ga0495680_0348673 | 3300047322 | Bacteria | 1031 |
| 707 | Ga0495680_0360978 | 3300047322 | Bacteria | 1010 |
| 708 | Ga0495683_0245432 | 3300047323 | Bacteria | 788 |
| 709 | Ga0495687_004881 | 3300047443 | Bacteria | 8799 |
| 710 | Ga0495675_0008446 | 3300047444 | Bacteria | 6381 |
| 711 | Ga0495675_0136140 | 3300047444 | Bacteria | 1525 |
| 712 | Ga0495673_0043711 | 3300047469 | Bacteria | 2003 |
| 713 | Ga0495673_0067532 | 3300047469 | Bacteria | 1513 |
| 714 | Ga0495673_0287550 | 3300047469 | Bacteria | 592 |
| 715 | Ga0495684_0023592 | 3300047471 | Bacteria | 4730 |
| 716 | Ga0495684_0092904 | 3300047471 | Bacteria | 2285 |
| 717 | Ga0495684_0330432 | 3300047471 | Bacteria | 1087 |
| 718 | Ga0495684_0823378 | 3300047471 | Bacteria | 605 |
| 719 | Ga0495686_0426559 | 3300047472 | Bacteria | 708 |
| 720 | Ga0495593_0001297 | 3300047673 | Bacteria | 14662 |
| 721 | Ga0495593_0027280 | 3300047673 | Bacteria | 3144 |
| 722 | Ga0495602_0005801 | 3300048088 | Bacteria | 12957 |
| 723 | Ga0495602_0130086 | 3300048088 | Bacteria | 2009 |
| 724 | Ga0495602_0776588 | 3300048088 | Bacteria | 645 |
| 725 | Ga0495614_0023670 | 3300048089 | Bacteria | 2651 |
| 726 | Ga0495614_0055500 | 3300048089 | Bacteria | 1699 |
| 727 | Ga0495614_0141927 | 3300048089 | Bacteria | 1068 |
| 728 | Ga0495614_0513173 | 3300048089 | Bacteria | 571 |
| 729 | Ga0496100_0191229 | 3300048903 | Bacteria | 1486 |
| 730 | Ga0496100_0258693 | 3300048903 | Bacteria | 1290 |
| 731 | Ga0496100_0273342 | 3300048903 | Bacteria | 1257 |
| 732 | Ga0496100_0278761 | 3300048903 | Bacteria | 1246 |
| 733 | Ga0496100_0354848 | 3300048903 | Bacteria | 1108 |
| 734 | Ga0496100_1311317 | 3300048903 | Bacteria | 571 |
| 735 | Ga0496101_0299475 | 3300048904 | Bacteria | 1259 |
| 736 | Ga0496102_0134052 | 3300048905 | Bacteria | 2320 |
| 737 | Ga0496102_0237439 | 3300048905 | Bacteria | 1719 |
| 738 | Ga0496102_0344820 | 3300048905 | Bacteria | 1402 |
| 739 | Ga0496102_0873973 | 3300048905 | Bacteria | 821 |
| 740 | Ga0496102_1497719 | 3300048905 | Bacteria | 593 |
| 741 | Ga0496103_0007344 | 3300048906 | Bacteria | 6568 |
| 742 | Ga0496104_0190611 | 3300048907 | Bacteria | 1961 |
| 743 | Ga0496104_0196275 | 3300048907 | Bacteria | 1930 |
| 744 | Ga0496104_0299154 | 3300048907 | Bacteria | 1521 |
| 745 | Ga0496104_1481670 | 3300048907 | Bacteria | 581 |
| 746 | Ga0496105_0003004 | 3300048908 | Bacteria | 12398 |
| 747 | Ga0496105_0026626 | 3300048908 | Bacteria | 4720 |
| 748 | Ga0496105_0877426 | 3300048908 | Bacteria | 677 |
| 749 | Ga0496106_0004187 | 3300048909 | Bacteria | 10754 |
| 750 | Ga0496106_0011609 | 3300048909 | Bacteria | 6510 |
| 751 | Ga0496106_0225975 | 3300048909 | Bacteria | 1493 |
| 752 | Ga0496106_0234764 | 3300048909 | Bacteria | 1465 |
| 753 | Ga0496106_0332278 | 3300048909 | Bacteria | 1220 |
| 754 | Ga0496106_0395328 | 3300048909 | Bacteria | 1111 |
| 755 | Ga0496107_0048726 | 3300048910 | Bacteria | 3053 |
| 756 | Ga0496107_0732302 | 3300048910 | Bacteria | 726 |
| 757 | Ga0496108_0009483 | 3300048911 | Bacteria | 7881 |
| 758 | Ga0496108_0053316 | 3300048911 | Bacteria | 3391 |
| 759 | Ga0496108_0118230 | 3300048911 | Bacteria | 2272 |
| 760 | Ga0496108_1396351 | 3300048911 | Bacteria | 586 |
| 761 | Ga0496109_0012953 | 3300048912 | Bacteria | 7210 |
| 762 | Ga0496109_0267726 | 3300048912 | Bacteria | 1610 |
| 763 | Ga0496110_0031727 | 3300048913 | Bacteria | 4561 |
| 764 | Ga0496110_0135920 | 3300048913 | Bacteria | 2221 |
| 765 | Ga0496110_0402693 | 3300048913 | Bacteria | 1247 |
| 766 | Ga0496110_0888079 | 3300048913 | Bacteria | 797 |
| 767 | Ga0496111_0186422 | 3300048914 | Bacteria | 1542 |
| 768 | Ga0496111_0479652 | 3300048914 | Bacteria | 916 |
| 769 | Ga0496112_0000036 | 3300048915 | Bacteria | 106325 |
| 770 | Ga0496112_0149030 | 3300048915 | Bacteria | 2307 |
| 771 | Ga0496112_0397234 | 3300048915 | Bacteria | 1318 |
| 772 | Ga0496112_0788306 | 3300048915 | Bacteria | 875 |
| 773 | Ga0496113_0023104 | 3300048916 | Bacteria | 4406 |
| 774 | Ga0496113_0284613 | 3300048916 | Bacteria | 1322 |
| 775 | Ga0496114_0126394 | 3300048917 | Bacteria | 2204 |
| 776 | Ga0496114_0489371 | 3300048917 | Bacteria | 1088 |
| 777 | Ga0496114_0694584 | 3300048917 | Bacteria | 893 |
| 778 | Ga0496115_0022821 | 3300048918 | Bacteria | 4852 |
| 779 | Ga0496115_0144172 | 3300048918 | Bacteria | 1965 |
| 780 | Ga0496115_0241214 | 3300048918 | Bacteria | 1489 |
| 781 | Ga0496116_0038973 | 3300048919 | Bacteria | 3291 |
| 782 | Ga0496116_0381962 | 3300048919 | Bacteria | 631 |
| 783 | Ga0496117_0014725 | 3300048920 | Bacteria | 6717 |
| 784 | Ga0496117_0021587 | 3300048920 | Bacteria | 5202 |
| 785 | Ga0496117_0041129 | 3300048920 | Bacteria | 3391 |
| 786 | Ga0496117_0435072 | 3300048920 | Bacteria | 653 |
| 787 | Ga0496118_0006821 | 3300048921 | Bacteria | 12391 |
| 788 | Ga0496118_0030236 | 3300048921 | Bacteria | 4524 |
| 789 | Ga0496118_0071213 | 3300048921 | Bacteria | 2504 |
| 790 | Ga0496118_0095356 | 3300048921 | Bacteria | 2031 |
| 791 | Ga0496118_0102456 | 3300048921 | Bacteria | 1929 |
| 792 | Ga0496118_0469373 | 3300048921 | Bacteria | 634 |
| 793 | Ga0496119_0013006 | 3300048922 | Bacteria | 6685 |
| 794 | Ga0496119_0063130 | 3300048922 | Bacteria | 2204 |
| 795 | Ga0496119_0180984 | 3300048922 | Bacteria | 1105 |
| 796 | Ga0496119_0213474 | 3300048922 | Bacteria | 991 |
| 797 | Ga0496120_0019431 | 3300048923 | Bacteria | 4346 |
| 798 | Ga0496120_0095701 | 3300048923 | Bacteria | 1578 |
| 799 | Ga0496121_0000218 | 3300048924 | Bacteria | 126175 |
| 800 | Ga0496121_0002143 | 3300048924 | Bacteria | 30998 |
| 801 | Ga0496121_0024547 | 3300048924 | Bacteria | 5760 |
| 802 | Ga0496121_0093483 | 3300048924 | Bacteria | 2341 |
| 803 | Ga0496121_0194653 | 3300048924 | Bacteria | 1450 |
| 804 | Ga0496121_0340818 | 3300048924 | Bacteria | 1002 |
| 805 | Ga0496121_0551111 | 3300048924 | Bacteria | 721 |
| 806 | Ga0496121_0880585 | 3300048924 | Bacteria | 517 |
| 807 | Ga0496122_0028335 | 3300048925 | Bacteria | 4756 |
| 808 | Ga0496123_0140579 | 3300048926 | Bacteria | 1321 |
| 809 | Ga0496123_0163544 | 3300048926 | Bacteria | 1183 |
| 810 | Ga0496124_0001333 | 3300048927 | Bacteria | 37071 |
| 811 | Ga0496124_0089207 | 3300048927 | Bacteria | 2518 |
| 812 | Ga0496124_0100322 | 3300048927 | Bacteria | 2347 |
| 813 | Ga0496124_0369241 | 3300048927 | Bacteria | 1008 |
| 814 | Ga0496125_0030379 | 3300048928 | Bacteria | 4835 |
| 815 | Ga0496125_0064474 | 3300048928 | Bacteria | 2911 |
| 816 | Ga0496125_0203673 | 3300048928 | Bacteria | 1292 |
| 817 | Ga0496126_0001598 | 3300048929 | Bacteria | 34515 |
| 818 | Ga0496126_0008691 | 3300048929 | Bacteria | 10906 |
| 819 | Ga0496126_0085347 | 3300048929 | Bacteria | 2783 |
| 820 | Ga0496126_0097984 | 3300048929 | Bacteria | 2569 |
| 821 | Ga0496126_0241475 | 3300048929 | Bacteria | 1509 |
| 822 | Ga0496126_0257554 | 3300048929 | Bacteria | 1452 |
| 823 | Ga0496126_0312868 | 3300048929 | Bacteria | 1292 |
| 824 | Ga0496126_0659480 | 3300048929 | Bacteria | 818 |
| 825 | Ga0495682_0017747 | 3300049460 | Bacteria | 2682 |
| 826 | Ga0501031_0004410 | 3300049568 | Bacteria | 9122 |
| 827 | Ga0501031_0021326 | 3300049568 | Bacteria | 4223 |
| 828 | Ga0501032_0002147 | 3300049569 | Bacteria | 15526 |
| 829 | Ga0501032_0130164 | 3300049569 | Bacteria | 1660 |
| 830 | Ga0501033_0000060 | 3300049570 | Bacteria | 103159 |
| 831 | Ga0501033_0021876 | 3300049570 | Bacteria | 4825 |
| 832 | Ga0501033_0027600 | 3300049570 | Bacteria | 4268 |
| 833 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 834 | Ga0501034_0049060 | 3300049571 | Bacteria | 4260 |
| 835 | Ga0501034_0100173 | 3300049571 | Bacteria | 2891 |
| 836 | Ga0501034_0577466 | 3300049571 | Bacteria | 1031 |
| 837 | Ga0501036_0000188 | 3300049572 | Bacteria | 41101 |
| 838 | Ga0501036_0087493 | 3300049572 | Bacteria | 2633 |
| 839 | Ga0501036_0857463 | 3300049572 | Bacteria | 746 |
| 840 | Ga0501037_0000402 | 3300049573 | Bacteria | 36091 |
| 841 | Ga0501037_0003037 | 3300049573 | Bacteria | 12181 |
| 842 | Ga0501037_0031760 | 3300049573 | Bacteria | 3899 |
| 843 | Ga0501037_0190184 | 3300049573 | Bacteria | 1453 |
| 844 | Ga0501038_0000540 | 3300049574 | Bacteria | 33178 |
| 845 | Ga0501038_0051880 | 3300049574 | Bacteria | 3537 |
| 846 | Ga0501038_0105274 | 3300049574 | Bacteria | 2343 |
| 847 | Ga0501038_0218519 | 3300049574 | Bacteria | 1521 |
| 848 | Ga0501039_0000431 | 3300049575 | Bacteria | 30281 |
| 849 | Ga0501039_0016436 | 3300049575 | Bacteria | 5668 |
| 850 | Ga0501040_0103606 | 3300049576 | Bacteria | 1986 |
| 851 | Ga0501041_0483703 | 3300049577 | Bacteria | 787 |
| 852 | Ga0501042_0011425 | 3300049578 | Bacteria | 5992 |
| 853 | Ga0501042_0070294 | 3300049578 | Bacteria | 2504 |
| 854 | Ga0501042_0102846 | 3300049578 | Bacteria | 2055 |
| 855 | Ga0501043_0002749 | 3300049579 | Bacteria | 14715 |
| 856 | Ga0501043_0018739 | 3300049579 | Bacteria | 5430 |
| 857 | Ga0501046_0001915 | 3300049580 | Bacteria | 19766 |
| 858 | Ga0501046_0014783 | 3300049580 | Bacteria | 6571 |
| 859 | Ga0501046_0027066 | 3300049580 | Bacteria | 4681 |
| 860 | Ga0501046_0069536 | 3300049580 | Bacteria | 2739 |
| 861 | Ga0501047_0000246 | 3300049581 | Bacteria | 64361 |
| 862 | Ga0501047_0079183 | 3300049581 | Bacteria | 3160 |
| 863 | Ga0501047_0218672 | 3300049581 | Bacteria | 1761 |
| 864 | Ga0501048_0000878 | 3300049582 | Bacteria | 22207 |
| 865 | Ga0501048_0020139 | 3300049582 | Bacteria | 4892 |
| 866 | Ga0501048_1291810 | 3300049582 | Bacteria | 525 |
| 867 | Ga0501067_0000320 | 3300049583 | Bacteria | 26233 |
| 868 | Ga0501067_0382677 | 3300049583 | Bacteria | 784 |
| 869 | Ga0501068_0002924 | 3300049584 | Bacteria | 9095 |
| 870 | Ga0501068_0017885 | 3300049584 | Bacteria | 4103 |
| 871 | Ga0501069_0005134 | 3300049585 | Bacteria | 6798 |
| 872 | Ga0501070_0000779 | 3300049586 | Bacteria | 28961 |
| 873 | Ga0501070_0018706 | 3300049586 | Bacteria | 5812 |
| 874 | Ga0501070_0765766 | 3300049586 | Bacteria | 760 |
| 875 | Ga0501070_1356414 | 3300049586 | Bacteria | 541 |
| 876 | Ga0501071_0174123 | 3300049587 | Bacteria | 1611 |
| 877 | Ga0501072_0004819 | 3300049588 | Bacteria | 10273 |
| 878 | Ga0501072_0108254 | 3300049588 | Bacteria | 2211 |
| 879 | Ga0501073_0000093 | 3300049589 | Bacteria | 56882 |
| 880 | Ga0501073_0144808 | 3300049589 | Bacteria | 1646 |
| 881 | Ga0501073_0390209 | 3300049589 | Bacteria | 962 |
| 882 | Ga0501074_0000127 | 3300049590 | Bacteria | 38795 |
| 883 | Ga0501074_0025558 | 3300049590 | Bacteria | 4286 |
| 884 | Ga0501077_0239533 | 3300049593 | Bacteria | 1153 |
| 885 | Ga0501079_0001174 | 3300049741 | Bacteria | 18341 |
| 886 | Ga0501079_0598781 | 3300049741 | Bacteria | 867 |
| 887 | Ga0501080_0001845 | 3300049742 | Bacteria | 18181 |
| 888 | Ga0501080_0034825 | 3300049742 | Bacteria | 4702 |
| 889 | Ga0501083_0008877 | 3300049744 | Bacteria | 7098 |
| 890 | Ga0501083_0232920 | 3300049744 | Bacteria | 1199 |
| 891 | Ga0501035_0000798 | 3300049822 | Bacteria | 33520 |
| 892 | Ga0501035_0084415 | 3300049822 | Bacteria | 2801 |
| 893 | Ga0501035_0116281 | 3300049822 | Bacteria | 2340 |
| 894 | Ga0501035_0314792 | 3300049822 | Bacteria | 1316 |
| 895 | Ga0501035_0710922 | 3300049822 | Bacteria | 809 |
| 896 | Ga0501035_1228109 | 3300049822 | Bacteria | 580 |
| 897 | Ga0501044_0005195 | 3300049823 | Bacteria | 14487 |
| 898 | Ga0501044_0023777 | 3300049823 | Bacteria | 6516 |
| 899 | Ga0501044_0729152 | 3300049823 | Bacteria | 875 |
| 900 | Ga0501044_1208904 | 3300049823 | Bacteria | 623 |
| 901 | Ga0501045_1043881 | 3300049824 | Bacteria | 599 |
| 902 | nmdc:mga00v17_202500_c1 | 3300050491 | Bacteria | 1283 |
| 903 | nmdc:mga00v17_30000_c1 | 3300050491 | Bacteria | 3195 |
| 904 | nmdc:mga00v17_49354_c1 | 3300050491 | Bacteria | 2553 |
| 905 | nmdc:mga0yw44_207786_c1 | 3300050492 | Bacteria | 1294 |
| 906 | nmdc:mga0yw44_358288_c1 | 3300050492 | Bacteria | 983 |
| 907 | nmdc:mga0yw44_882248_c1 | 3300050492 | Bacteria | 607 |
| 908 | nmdc:mga0k408_209215_c1 | 3300050493 | Bacteria | 1165 |
| 909 | nmdc:mga06z11_97715_c1 | 3300050494 | Bacteria | 1606 |
| 910 | nmdc:mga07m45_18827_c1 | 3300050496 | Bacteria | 3734 |
| 911 | nmdc:mga07m45_55859_c1 | 3300050496 | Bacteria | 2232 |
| 912 | nmdc:mga0n895_1900863_c1 | 3300050512 | Bacteria | 554 |
| 913 | nmdc:mga0n895_203510_c1 | 3300050512 | Bacteria | 2010 |
| 914 | nmdc:mga0sz30_372005_c1 | 3300050516 | Bacteria | 639 |
| 915 | nmdc:mga0sz30_58617_c1 | 3300050516 | Bacteria | 1642 |
| 916 | Ga0495601_0127648 | 3300053077 | Bacteria | 1655 |
| 917 | Ga0495601_0161268 | 3300053077 | Bacteria | 1465 |
| 918 | Ga0495601_0299334 | 3300053077 | Bacteria | 1048 |
| 919 | Ga0495601_1084072 | 3300053077 | Bacteria | 502 |
| 920 | Ga0495612_0007154 | 3300053078 | Bacteria | 4565 |
| 921 | Ga0500635_0005826 | 3300053080 | Bacteria | 3260 |
| 922 | Ga0500635_0052312 | 3300053080 | Bacteria | 1402 |
| 923 | Ga0495595_0099694 | 3300053084 | Bacteria | 1401 |
| 924 | Ga0495595_0345974 | 3300053084 | Bacteria | 750 |
| 925 | Ga0495619_0084347 | 3300053085 | Bacteria | 2144 |
| 926 | Ga0495619_0090441 | 3300053085 | Bacteria | 2072 |
| 927 | Ga0495619_0503838 | 3300053085 | Bacteria | 832 |
| 928 | Ga0500578_0195237 | 3300053086 | Bacteria | 1241 |
| 929 | Ga0500578_0414710 | 3300053086 | Bacteria | 773 |
| 930 | Ga0500578_0525968 | 3300053086 | Bacteria | 661 |
| 931 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 932 | Ga0500646_0195593 | 3300053090 | Bacteria | 691 |
| 933 | Ga0500647_0063581 | 3300053091 | Bacteria | 1775 |
| 934 | Ga0500651_0005693 | 3300053093 | Bacteria | 7135 |
| 935 | Ga0500651_0131518 | 3300053093 | Bacteria | 1513 |
| 936 | Ga0500651_0457679 | 3300053093 | Bacteria | 709 |
| 937 | Ga0500566_0059465 | 3300053094 | Bacteria | 2166 |
| 938 | Ga0500566_0323904 | 3300053094 | Bacteria | 716 |
| 939 | Ga0500566_0488259 | 3300053094 | Bacteria | 532 |
| 940 | Ga0500640_133320 | 3300053095 | Bacteria | 976 |
| 941 | Ga0500648_056450 | 3300053097 | Bacteria | 2227 |
| 942 | Ga0500650_0071799 | 3300053098 | Bacteria | 1618 |
| 943 | Ga0500650_0275510 | 3300053098 | Bacteria | 749 |
| 944 | Ga0500554_002561 | 3300053102 | Bacteria | 3593 |
| 945 | Ga0500555_001072 | 3300053103 | Bacteria | 9178 |
| 946 | Ga0500556_0069527 | 3300053104 | Bacteria | 1312 |
| 947 | Ga0500562_021204 | 3300053108 | Bacteria | 1689 |
| 948 | Ga0500569_011527 | 3300053109 | Bacteria | 2114 |
| 949 | Ga0500592_002866 | 3300053116 | Bacteria | 2772 |
| 950 | Ga0500594_0016326 | 3300053118 | Bacteria | 1803 |
| 951 | Ga0500595_008262 | 3300053119 | Bacteria | 4261 |
| 952 | Ga0500595_027430 | 3300053119 | Bacteria | 1950 |
| 953 | Ga0500597_410958 | 3300053120 | Bacteria | 512 |
| 954 | Ga0500607_071125 | 3300053121 | Bacteria | 1796 |
| 955 | Ga0500614_010829 | 3300053123 | Bacteria | 1963 |
| 956 | Ga0500642_0000376 | 3300053130 | Bacteria | 15008 |
| 957 | Ga0500642_0313319 | 3300053130 | Bacteria | 705 |
| 958 | Ga0500652_091010 | 3300053131 | Bacteria | 1274 |
| 959 | Ga0500559_0006437 | 3300053136 | Bacteria | 5304 |
| 960 | Ga0500559_0039350 | 3300053136 | Bacteria | 2056 |
| 961 | Ga0500559_0569048 | 3300053136 | Bacteria | 515 |
| 962 | Ga0500564_098383 | 3300053138 | Bacteria | 1295 |
| 963 | Ga0500568_0018290 | 3300053139 | Bacteria | 3070 |
| 964 | Ga0500573_0041160 | 3300053140 | Bacteria | 2667 |
| 965 | Ga0500577_0131556 | 3300053142 | Bacteria | 1049 |
| 966 | Ga0500588_0268301 | 3300053146 | Bacteria | 643 |
| 967 | Ga0500590_108911 | 3300053148 | Bacteria | 1318 |
| 968 | Ga0500590_241043 | 3300053148 | Bacteria | 727 |
| 969 | Ga0500603_031587 | 3300053150 | Bacteria | 1370 |
| 970 | Ga0500603_132247 | 3300053150 | Bacteria | 763 |
| 971 | Ga0500603_285611 | 3300053150 | Bacteria | 533 |
| 972 | Ga0500604_0095532 | 3300053151 | Bacteria | 975 |
| 973 | Ga0500604_0167933 | 3300053151 | Bacteria | 749 |
| 974 | Ga0500616_0015406 | 3300053153 | Bacteria | 4373 |
| 975 | Ga0500619_162176 | 3300053154 | Bacteria | 758 |
| 976 | Ga0500619_307169 | 3300053154 | Bacteria | 510 |
| 977 | Ga0500620_016205 | 3300053155 | Bacteria | 2125 |
| 978 | Ga0500622_0001687 | 3300053156 | Bacteria | 17213 |
| 979 | Ga0500627_0078272 | 3300053158 | Bacteria | 1471 |
| 980 | Ga0500627_0107403 | 3300053158 | Bacteria | 1255 |
| 981 | Ga0500633_0150997 | 3300053160 | Bacteria | 871 |
| 982 | Ga0500639_157090 | 3300053163 | Bacteria | 1040 |
| 983 | Ga0500639_297888 | 3300053163 | Bacteria | 608 |
| 984 | Ga0500636_0003998 | 3300053177 | Bacteria | 8311 |
| 985 | Ga0500636_0017280 | 3300053177 | Bacteria | 4258 |
| 986 | Ga0500636_0124922 | 3300053177 | Bacteria | 1439 |
| 987 | Ga0500636_0197630 | 3300053177 | Bacteria | 1066 |
| 988 | Ga0500636_0209106 | 3300053177 | Bacteria | 1025 |
| 989 | Ga0500636_0246599 | 3300053177 | Bacteria | 913 |
| 990 | Ga0500637_0509850 | 3300053178 | Bacteria | 593 |
| 991 | Ga0500649_100608 | 3300053722 | Bacteria | 1142 |
| 992 | Ga0500570_080332 | 3300053724 | Bacteria | 1473 |
| 993 | Ga0500611_083046 | 3300053727 | Bacteria | 803 |
| 994 | Ga0500625_041142 | 3300053729 | Bacteria | 2172 |
| 995 | Ga0500645_099808 | 3300053730 | Bacteria | 819 |
| 996 | Ga0500645_175617 | 3300053730 | Bacteria | 584 |
| 997 | Ga0500609_003821 | 3300053731 | Bacteria | 2101 |
| 998 | Ga0500599_000090 | 3300053736 | Bacteria | 8469 |
| 999 | Ga0500601_000297 | 3300053737 | Bacteria | 9335 |
| 1000 | Ga0501084_0095316 | 3300054114 | Bacteria | 2499 |
| 1001 | Ga0501084_0144392 | 3300054114 | Bacteria | 2004 |
| 1002 | Ga0500661_012063 | 3300055283 | Bacteria | 1562 |
| 1003 | Ga0501082_0004139 | 3300060353 | Bacteria | 12672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053091 | Ga0500647_0063581 | Ga0500647_0063581_220_564 | 100 |
| 2 | iso_pu_bacteria | 2513237087 | 2513591301 | 102 |
| 3 | 3300044735 | Ga0466968_0005163 | Ga0466968_0005163_3169_3483 | 104 |
| 4 | 3300045051 | Ga0451576_0796465 | Ga0451576_0796465_115_465 | 105 |
| 5 | 3300005937 | Ga0081455_10113701 | Ga0081455_101137011 | 107 |
| 6 | 3300005262 | Ga0065165_1048792 | Ga0065165_10487921 | 109 |
| 7 | 3300005937 | Ga0081455_10001626 | Ga0081455_1000162620 | 109 |
| 8 | 3300006051 | Ga0075364_10524594 | Ga0075364_105245942 | 109 |
| 9 | 3300048921 | Ga0496118_0469373 | Ga0496118_0469373_13_351 | 109 |
| 10 | 3300048924 | Ga0496121_0551111 | Ga0496121_0551111_337_675 | 109 |
| 11 | 3300048925 | Ga0496122_0028335 | Ga0496122_0028335_1797_2135 | 109 |
| 12 | 3300048926 | Ga0496123_0163544 | Ga0496123_0163544_503_841 | 109 |
| 13 | 3300048927 | Ga0496124_0100322 | Ga0496124_0100322_1701_2039 | 109 |
| 14 | 3300050491 | nmdc:mga00v17_202500_c1 | nmdc:mga00v17_202500_c1_843_1181 | 109 |
| 15 | iso_pu_bacteria | 2513237104 | 2513720483 | 109 |
| 16 | iso_pu_bacteria | 2517093001 | 2517106139 | 109 |
| 17 | iso_pu_bacteria | 2524023205 | 2524438233 | 109 |
| 18 | iso_pu_bacteria | 2744054633 | 2745077336 | 109 |
| 19 | 3300002075 | JGI24738J21930_10064151 | JGI24738J21930_100641512 | 110 |
| 20 | 3300003323 | rootH1_10110488 | rootH1_101104882 | 110 |
| 21 | 3300005327 | Ga0070658_10619279 | Ga0070658_106192793 | 110 |
| 22 | 3300005329 | Ga0070683_100419537 | Ga0070683_1004195372 | 110 |
| 23 | 3300005329 | Ga0070683_100579330 | Ga0070683_1005793302 | 110 |
| 24 | 3300005331 | Ga0070670_100736618 | Ga0070670_1007366183 | 110 |
| 25 | 3300005336 | Ga0070680_100057264 | Ga0070680_1000572643 | 110 |
| 26 | 3300005336 | Ga0070680_100115737 | Ga0070680_1001157371 | 110 |
| 27 | 3300005336 | Ga0070680_101094715 | Ga0070680_1010947151 | 110 |
| 28 | 3300005339 | Ga0070660_100154366 | Ga0070660_1001543662 | 110 |
| 29 | 3300005339 | Ga0070660_100196432 | Ga0070660_1001964322 | 110 |
| 30 | 3300005341 | Ga0070691_10102109 | Ga0070691_101021091 | 110 |
| 31 | 3300005344 | Ga0070661_100157560 | Ga0070661_1001575603 | 110 |
| 32 | 3300005345 | Ga0070692_11231595 | Ga0070692_112315951 | 110 |
| 33 | 3300005356 | Ga0070674_100770028 | Ga0070674_1007700281 | 110 |
| 34 | 3300005366 | Ga0070659_100224942 | Ga0070659_1002249422 | 110 |
| 35 | 3300005366 | Ga0070659_100729093 | Ga0070659_1007290932 | 110 |
| 36 | 3300005434 | Ga0070709_10000143 | Ga0070709_1000014339 | 110 |
| 37 | 3300005434 | Ga0070709_10003192 | Ga0070709_100031929 | 110 |
| 38 | 3300005434 | Ga0070709_10061173 | Ga0070709_100611731 | 110 |
| 39 | 3300005434 | Ga0070709_10788805 | Ga0070709_107888052 | 110 |
| 40 | 3300005434 | Ga0070709_10896823 | Ga0070709_108968232 | 110 |
| 41 | 3300005435 | Ga0070714_100021066 | Ga0070714_1000210666 | 110 |
| 42 | 3300005435 | Ga0070714_100043580 | Ga0070714_1000435804 | 110 |
| 43 | 3300005435 | Ga0070714_100464531 | Ga0070714_1004645313 | 110 |
| 44 | 3300005435 | Ga0070714_101754616 | Ga0070714_1017546162 | 110 |
| 45 | 3300005436 | Ga0070713_100002045 | Ga0070713_1000020453 | 110 |
| 46 | 3300005436 | Ga0070713_100009055 | Ga0070713_1000090558 | 110 |
| 47 | 3300005436 | Ga0070713_100039395 | Ga0070713_1000393952 | 110 |
| 48 | 3300005436 | Ga0070713_100151725 | Ga0070713_1001517252 | 110 |
| 49 | 3300005436 | Ga0070713_100168645 | Ga0070713_1001686452 | 110 |
| 50 | 3300005436 | Ga0070713_100204529 | Ga0070713_1002045292 | 110 |
| 51 | 3300005437 | Ga0070710_10003824 | Ga0070710_100038241 | 110 |
| 52 | 3300005437 | Ga0070710_10127757 | Ga0070710_101277572 | 110 |
| 53 | 3300005437 | Ga0070710_10801804 | Ga0070710_108018041 | 110 |
| 54 | 3300005437 | Ga0070710_11365781 | Ga0070710_113657811 | 110 |
| 55 | 3300005439 | Ga0070711_100127365 | Ga0070711_1001273653 | 110 |
| 56 | 3300005439 | Ga0070711_100230263 | Ga0070711_1002302632 | 110 |
| 57 | 3300005439 | Ga0070711_100415078 | Ga0070711_1004150783 | 110 |
| 58 | 3300005439 | Ga0070711_101764233 | Ga0070711_1017642331 | 110 |
| 59 | 3300005455 | Ga0070663_101188199 | Ga0070663_1011881992 | 110 |
| 60 | 3300005456 | Ga0070678_100500507 | Ga0070678_1005005072 | 110 |
| 61 | 3300005458 | Ga0070681_10189005 | Ga0070681_101890051 | 110 |
| 62 | 3300005458 | Ga0070681_10319858 | Ga0070681_103198582 | 110 |
| 63 | 3300005458 | Ga0070681_10543503 | Ga0070681_105435031 | 110 |
| 64 | 3300005458 | Ga0070681_10607161 | Ga0070681_106071613 | 110 |
| 65 | 3300005458 | Ga0070681_10897494 | Ga0070681_108974942 | 110 |
| 66 | 3300005466 | Ga0070685_10858470 | Ga0070685_108584702 | 110 |
| 67 | 3300005467 | Ga0070706_101333660 | Ga0070706_1013336602 | 110 |
| 68 | 3300005467 | Ga0070706_101865351 | Ga0070706_1018653512 | 110 |
| 69 | 3300005471 | Ga0070698_101352577 | Ga0070698_1013525772 | 110 |
| 70 | 3300005530 | Ga0070679_100100050 | Ga0070679_1001000503 | 110 |
| 71 | 3300005530 | Ga0070679_100135371 | Ga0070679_1001353713 | 110 |
| 72 | 3300005530 | Ga0070679_100241550 | Ga0070679_1002415502 | 110 |
| 73 | 3300005535 | Ga0070684_100174595 | Ga0070684_1001745956 | 110 |
| 74 | 3300005535 | Ga0070684_100772185 | Ga0070684_1007721852 | 110 |
| 75 | 3300005536 | Ga0070697_100143823 | Ga0070697_1001438232 | 110 |
| 76 | 3300005539 | Ga0068853_100806856 | Ga0068853_1008068562 | 110 |
| 77 | 3300005539 | Ga0068853_101142511 | Ga0068853_1011425111 | 110 |
| 78 | 3300005545 | Ga0070695_100789063 | Ga0070695_1007890632 | 110 |
| 79 | 3300005546 | Ga0070696_101675678 | Ga0070696_1016756782 | 110 |
| 80 | 3300005547 | Ga0070693_100036361 | Ga0070693_1000363613 | 110 |
| 81 | 3300005547 | Ga0070693_100999916 | Ga0070693_1009999162 | 110 |
| 82 | 3300005548 | Ga0070665_101277442 | Ga0070665_1012774422 | 110 |
| 83 | 3300005563 | Ga0068855_100092442 | Ga0068855_1000924422 | 110 |
| 84 | 3300005563 | Ga0068855_100766770 | Ga0068855_1007667703 | 110 |
| 85 | 3300005563 | Ga0068855_100982715 | Ga0068855_1009827152 | 110 |
| 86 | 3300005563 | Ga0068855_101990740 | Ga0068855_1019907401 | 110 |
| 87 | 3300005577 | Ga0068857_100007213 | Ga0068857_1000072133 | 110 |
| 88 | 3300005577 | Ga0068857_100456149 | Ga0068857_1004561491 | 110 |
| 89 | 3300005577 | Ga0068857_101519794 | Ga0068857_1015197942 | 110 |
| 90 | 3300005578 | Ga0068854_100302366 | Ga0068854_1003023662 | 110 |
| 91 | 3300005578 | Ga0068854_101028884 | Ga0068854_1010288842 | 110 |
| 92 | 3300005614 | Ga0068856_100020597 | Ga0068856_1000205978 | 110 |
| 93 | 3300005614 | Ga0068856_102312137 | Ga0068856_1023121372 | 110 |
| 94 | 3300005615 | Ga0070702_100898400 | Ga0070702_1008984002 | 110 |
| 95 | 3300005616 | Ga0068852_100115767 | Ga0068852_1001157674 | 110 |
| 96 | 3300005616 | Ga0068852_100650407 | Ga0068852_1006504072 | 110 |
| 97 | 3300005616 | Ga0068852_102516539 | Ga0068852_1025165392 | 110 |
| 98 | 3300005834 | Ga0068851_10006319 | Ga0068851_100063195 | 110 |
| 99 | 3300005834 | Ga0068851_10528203 | Ga0068851_105282032 | 110 |
| 100 | 3300005841 | Ga0068863_100333957 | Ga0068863_1003339573 | 110 |
| 101 | 3300005842 | Ga0068858_100207113 | Ga0068858_1002071132 | 110 |
| 102 | 3300005842 | Ga0068858_100327572 | Ga0068858_1003275722 | 110 |
| 103 | 3300005842 | Ga0068858_100350618 | Ga0068858_1003506182 | 110 |
| 104 | 3300005843 | Ga0068860_100000217 | Ga0068860_1000002173 | 110 |
| 105 | 3300005843 | Ga0068860_100726539 | Ga0068860_1007265392 | 110 |
| 106 | 3300005983 | Ga0081540_1209013 | Ga0081540_12090131 | 110 |
| 107 | 3300006028 | Ga0070717_10070944 | Ga0070717_100709444 | 110 |
| 108 | 3300006028 | Ga0070717_10140806 | Ga0070717_101408063 | 110 |
| 109 | 3300006028 | Ga0070717_10156821 | Ga0070717_101568213 | 110 |
| 110 | 3300006028 | Ga0070717_11019647 | Ga0070717_110196472 | 110 |
| 111 | 3300006028 | Ga0070717_11045830 | Ga0070717_110458302 | 110 |
| 112 | 3300006028 | Ga0070717_11210540 | Ga0070717_112105401 | 110 |
| 113 | 3300006038 | Ga0075365_10198537 | Ga0075365_101985372 | 110 |
| 114 | 3300006163 | Ga0070715_10001767 | Ga0070715_100017672 | 110 |
| 115 | 3300006163 | Ga0070715_10002320 | Ga0070715_100023206 | 110 |
| 116 | 3300006173 | Ga0070716_100015839 | Ga0070716_1000158392 | 110 |
| 117 | 3300006173 | Ga0070716_100083540 | Ga0070716_1000835403 | 110 |
| 118 | 3300006173 | Ga0070716_100273398 | Ga0070716_1002733982 | 110 |
| 119 | 3300006175 | Ga0070712_100287940 | Ga0070712_1002879402 | 110 |
| 120 | 3300006175 | Ga0070712_100481674 | Ga0070712_1004816742 | 110 |
| 121 | 3300006175 | Ga0070712_100593392 | Ga0070712_1005933922 | 110 |
| 122 | 3300006175 | Ga0070712_100705105 | Ga0070712_1007051053 | 110 |
| 123 | 3300006177 | Ga0075362_10185477 | Ga0075362_101854772 | 110 |
| 124 | 3300006237 | Ga0097621_100100941 | Ga0097621_1001009414 | 110 |
| 125 | 3300006237 | Ga0097621_100816059 | Ga0097621_1008160592 | 110 |
| 126 | 3300006358 | Ga0068871_100590150 | Ga0068871_1005901502 | 110 |
| 127 | 3300006358 | Ga0068871_101293409 | Ga0068871_1012934091 | 110 |
| 128 | 3300006871 | Ga0075434_101573331 | Ga0075434_1015733311 | 110 |
| 129 | 3300006914 | Ga0075436_100579168 | Ga0075436_1005791682 | 110 |
| 130 | 3300007076 | Ga0075435_100340144 | Ga0075435_1003401442 | 110 |
| 131 | 3300007265 | Ga0099794_10718968 | Ga0099794_107189681 | 110 |
| 132 | 3300007788 | Ga0099795_10005381 | Ga0099795_100053813 | 110 |
| 133 | 3300007788 | Ga0099795_10025396 | Ga0099795_100253964 | 110 |
| 134 | 3300007788 | Ga0099795_10177057 | Ga0099795_101770572 | 110 |
| 135 | 3300007788 | Ga0099795_10224741 | Ga0099795_102247412 | 110 |
| 136 | 3300009093 | Ga0105240_10002281 | Ga0105240_100022817 | 110 |
| 137 | 3300009093 | Ga0105240_10006402 | Ga0105240_100064024 | 110 |
| 138 | 3300009093 | Ga0105240_10069586 | Ga0105240_100695862 | 110 |
| 139 | 3300009093 | Ga0105240_10722385 | Ga0105240_107223851 | 110 |
| 140 | 3300009098 | Ga0105245_11154132 | Ga0105245_111541322 | 110 |
| 141 | 3300009101 | Ga0105247_10006054 | Ga0105247_100060548 | 110 |
| 142 | 3300009101 | Ga0105247_11650762 | Ga0105247_116507621 | 110 |
| 143 | 3300009174 | Ga0105241_10000387 | Ga0105241_1000038730 | 110 |
| 144 | 3300009174 | Ga0105241_10357468 | Ga0105241_103574682 | 110 |
| 145 | 3300009177 | Ga0105248_11124666 | Ga0105248_111246662 | 110 |
| 146 | 3300009545 | Ga0105237_10032208 | Ga0105237_100322085 | 110 |
| 147 | 3300009545 | Ga0105237_10045417 | Ga0105237_100454175 | 110 |
| 148 | 3300009545 | Ga0105237_10053783 | Ga0105237_100537833 | 110 |
| 149 | 3300009545 | Ga0105237_10182076 | Ga0105237_101820763 | 110 |
| 150 | 3300009545 | Ga0105237_10314522 | Ga0105237_103145222 | 110 |
| 151 | 3300009545 | Ga0105237_10357531 | Ga0105237_103575313 | 110 |
| 152 | 3300009545 | Ga0105237_10775472 | Ga0105237_107754722 | 110 |
| 153 | 3300009551 | Ga0105238_10017279 | Ga0105238_100172796 | 110 |
| 154 | 3300009551 | Ga0105238_10071566 | Ga0105238_100715663 | 110 |
| 155 | 3300009551 | Ga0105238_10266889 | Ga0105238_102668892 | 110 |
| 156 | 3300009551 | Ga0105238_10826177 | Ga0105238_108261772 | 110 |
| 157 | 3300009551 | Ga0105238_11305842 | Ga0105238_113058421 | 110 |
| 158 | 3300009551 | Ga0105238_11799722 | Ga0105238_117997221 | 110 |
| 159 | 3300009553 | Ga0105249_12920968 | Ga0105249_129209682 | 110 |
| 160 | 3300010159 | Ga0099796_10008671 | Ga0099796_100086712 | 110 |
| 161 | 3300010159 | Ga0099796_10032297 | Ga0099796_100322972 | 110 |
| 162 | 3300010159 | Ga0099796_10134752 | Ga0099796_101347522 | 110 |
| 163 | 3300010159 | Ga0099796_10255034 | Ga0099796_102550341 | 110 |
| 164 | 3300010375 | Ga0105239_10010998 | Ga0105239_100109984 | 110 |
| 165 | 3300010375 | Ga0105239_10018870 | Ga0105239_100188708 | 110 |
| 166 | 3300010375 | Ga0105239_10055799 | Ga0105239_100557993 | 110 |
| 167 | 3300010375 | Ga0105239_10289336 | Ga0105239_102893363 | 110 |
| 168 | 3300010375 | Ga0105239_11886933 | Ga0105239_118869332 | 110 |
| 169 | 3300013100 | Ga0157373_10386352 | Ga0157373_103863521 | 110 |
| 170 | 3300013102 | Ga0157371_10163667 | Ga0157371_101636673 | 110 |
| 171 | 3300013104 | Ga0157370_10113453 | Ga0157370_101134533 | 110 |
| 172 | 3300013104 | Ga0157370_10208177 | Ga0157370_102081774 | 110 |
| 173 | 3300013105 | Ga0157369_10017915 | Ga0157369_100179158 | 110 |
| 174 | 3300013105 | Ga0157369_10076750 | Ga0157369_100767502 | 110 |
| 175 | 3300013105 | Ga0157369_10333113 | Ga0157369_103331132 | 110 |
| 176 | 3300013297 | Ga0157378_11066198 | Ga0157378_110661981 | 110 |
| 177 | 3300013297 | Ga0157378_11888699 | Ga0157378_118886991 | 110 |
| 178 | 3300013297 | Ga0157378_12140132 | Ga0157378_121401321 | 110 |
| 179 | 3300013306 | Ga0163162_11262114 | Ga0163162_112621141 | 110 |
| 180 | 3300013306 | Ga0163162_12733162 | Ga0163162_127331622 | 110 |
| 181 | 3300013307 | Ga0157372_10011343 | Ga0157372_1001134310 | 110 |
| 182 | 3300013307 | Ga0157372_10216613 | Ga0157372_102166132 | 110 |
| 183 | 3300013308 | Ga0157375_12953067 | Ga0157375_129530672 | 110 |
| 184 | 3300014497 | Ga0182008_10333335 | Ga0182008_103333351 | 110 |
| 185 | 3300014968 | Ga0157379_12114810 | Ga0157379_121148102 | 110 |
| 186 | 3300020070 | Ga0206356_11596629 | Ga0206356_115966291 | 110 |
| 187 | 3300021377 | Ga0213874_10064245 | Ga0213874_100642452 | 110 |
| 188 | 3300021384 | Ga0213876_10001030 | Ga0213876_100010304 | 110 |
| 189 | 3300021384 | Ga0213876_10058650 | Ga0213876_100586502 | 110 |
| 190 | 3300025297 | Ga0209758_1006913 | Ga0209758_10069138 | 110 |
| 191 | 3300025321 | Ga0207656_10063721 | Ga0207656_100637212 | 110 |
| 192 | 3300025321 | Ga0207656_10565558 | Ga0207656_105655582 | 110 |
| 193 | 3300025898 | Ga0207692_10014570 | Ga0207692_100145702 | 110 |
| 194 | 3300025898 | Ga0207692_10039490 | Ga0207692_100394901 | 110 |
| 195 | 3300025898 | Ga0207692_10042963 | Ga0207692_100429633 | 110 |
| 196 | 3300025900 | Ga0207710_10040294 | Ga0207710_100402942 | 110 |
| 197 | 3300025901 | Ga0207688_10270301 | Ga0207688_102703012 | 110 |
| 198 | 3300025904 | Ga0207647_10002364 | Ga0207647_1000236415 | 110 |
| 199 | 3300025905 | Ga0207685_10022592 | Ga0207685_100225923 | 110 |
| 200 | 3300025905 | Ga0207685_10023966 | Ga0207685_100239663 | 110 |
| 201 | 3300025906 | Ga0207699_10000504 | Ga0207699_1000050411 | 110 |
| 202 | 3300025906 | Ga0207699_10007966 | Ga0207699_100079666 | 110 |
| 203 | 3300025906 | Ga0207699_10539520 | Ga0207699_105395202 | 110 |
| 204 | 3300025906 | Ga0207699_10853068 | Ga0207699_108530681 | 110 |
| 205 | 3300025909 | Ga0207705_10212241 | Ga0207705_102122412 | 110 |
| 206 | 3300025911 | Ga0207654_10128056 | Ga0207654_101280562 | 110 |
| 207 | 3300025912 | Ga0207707_10001479 | Ga0207707_100014794 | 110 |
| 208 | 3300025912 | Ga0207707_10012648 | Ga0207707_100126485 | 110 |
| 209 | 3300025912 | Ga0207707_10053075 | Ga0207707_100530752 | 110 |
| 210 | 3300025913 | Ga0207695_10056577 | Ga0207695_100565772 | 110 |
| 211 | 3300025914 | Ga0207671_10143988 | Ga0207671_101439882 | 110 |
| 212 | 3300025914 | Ga0207671_10205510 | Ga0207671_102055102 | 110 |
| 213 | 3300025914 | Ga0207671_10380751 | Ga0207671_103807512 | 110 |
| 214 | 3300025915 | Ga0207693_10006678 | Ga0207693_1000667810 | 110 |
| 215 | 3300025915 | Ga0207693_10025530 | Ga0207693_100255305 | 110 |
| 216 | 3300025915 | Ga0207693_10170699 | Ga0207693_101706991 | 110 |
| 217 | 3300025915 | Ga0207693_10223631 | Ga0207693_102236312 | 110 |
| 218 | 3300025915 | Ga0207693_10399658 | Ga0207693_103996582 | 110 |
| 219 | 3300025916 | Ga0207663_10001118 | Ga0207663_1000111815 | 110 |
| 220 | 3300025917 | Ga0207660_10017029 | Ga0207660_100170293 | 110 |
| 221 | 3300025917 | Ga0207660_10196043 | Ga0207660_101960432 | 110 |
| 222 | 3300025919 | Ga0207657_10053480 | Ga0207657_100534803 | 110 |
| 223 | 3300025919 | Ga0207657_10598678 | Ga0207657_105986782 | 110 |
| 224 | 3300025919 | Ga0207657_10764977 | Ga0207657_107649772 | 110 |
| 225 | 3300025920 | Ga0207649_10603451 | Ga0207649_106034512 | 110 |
| 226 | 3300025921 | Ga0207652_10005915 | Ga0207652_100059158 | 110 |
| 227 | 3300025921 | Ga0207652_10519351 | Ga0207652_105193512 | 110 |
| 228 | 3300025921 | Ga0207652_10558208 | Ga0207652_105582082 | 110 |
| 229 | 3300025924 | Ga0207694_10280205 | Ga0207694_102802052 | 110 |
| 230 | 3300025924 | Ga0207694_10792917 | Ga0207694_107929172 | 110 |
| 231 | 3300025927 | Ga0207687_11083003 | Ga0207687_110830031 | 110 |
| 232 | 3300025928 | Ga0207700_10046865 | Ga0207700_100468652 | 110 |
| 233 | 3300025928 | Ga0207700_10066647 | Ga0207700_100666472 | 110 |
| 234 | 3300025928 | Ga0207700_10200060 | Ga0207700_102000602 | 110 |
| 235 | 3300025928 | Ga0207700_10394441 | Ga0207700_103944412 | 110 |
| 236 | 3300025928 | Ga0207700_10651051 | Ga0207700_106510512 | 110 |
| 237 | 3300025929 | Ga0207664_10019715 | Ga0207664_100197154 | 110 |
| 238 | 3300025929 | Ga0207664_10070113 | Ga0207664_100701132 | 110 |
| 239 | 3300025931 | Ga0207644_10554366 | Ga0207644_105543661 | 110 |
| 240 | 3300025932 | Ga0207690_10201877 | Ga0207690_102018773 | 110 |
| 241 | 3300025932 | Ga0207690_10320373 | Ga0207690_103203732 | 110 |
| 242 | 3300025935 | Ga0207709_11540464 | Ga0207709_115404641 | 110 |
| 243 | 3300025937 | Ga0207669_10369115 | Ga0207669_103691152 | 110 |
| 244 | 3300025938 | Ga0207704_11270574 | Ga0207704_112705742 | 110 |
| 245 | 3300025939 | Ga0207665_10004372 | Ga0207665_1000437211 | 110 |
| 246 | 3300025939 | Ga0207665_10074448 | Ga0207665_100744483 | 110 |
| 247 | 3300025939 | Ga0207665_10189654 | Ga0207665_101896541 | 110 |
| 248 | 3300025939 | Ga0207665_10670882 | Ga0207665_106708822 | 110 |
| 249 | 3300025939 | Ga0207665_11072513 | Ga0207665_110725131 | 110 |
| 250 | 3300025944 | Ga0207661_10033385 | Ga0207661_100333854 | 110 |
| 251 | 3300025944 | Ga0207661_10455642 | Ga0207661_104556422 | 110 |
| 252 | 3300025949 | Ga0207667_10207653 | Ga0207667_102076532 | 110 |
| 253 | 3300025949 | Ga0207667_11116168 | Ga0207667_111161681 | 110 |
| 254 | 3300025981 | Ga0207640_10038737 | Ga0207640_100387372 | 110 |
| 255 | 3300025981 | Ga0207640_10453615 | Ga0207640_104536152 | 110 |
| 256 | 3300026023 | Ga0207677_11316707 | Ga0207677_113167072 | 110 |
| 257 | 3300026035 | Ga0207703_10420600 | Ga0207703_104206002 | 110 |
| 258 | 3300026035 | Ga0207703_10585561 | Ga0207703_105855612 | 110 |
| 259 | 3300026035 | Ga0207703_11869909 | Ga0207703_118699092 | 110 |
| 260 | 3300026041 | Ga0207639_10068421 | Ga0207639_100684213 | 110 |
| 261 | 3300026067 | Ga0207678_10807829 | Ga0207678_108078292 | 110 |
| 262 | 3300026067 | Ga0207678_11132178 | Ga0207678_111321781 | 110 |
| 263 | 3300026067 | Ga0207678_11212483 | Ga0207678_112124832 | 110 |
| 264 | 3300026116 | Ga0207674_10002366 | Ga0207674_1000236617 | 110 |
| 265 | 3300026116 | Ga0207674_10739100 | Ga0207674_107391002 | 110 |
| 266 | 3300026116 | Ga0207674_11006404 | Ga0207674_110064042 | 110 |
| 267 | 3300026121 | Ga0207683_10692530 | Ga0207683_106925302 | 110 |
| 268 | 3300026142 | Ga0207698_10065719 | Ga0207698_100657194 | 110 |
| 269 | 3300026142 | Ga0207698_10103631 | Ga0207698_101036312 | 110 |
| 270 | 3300027671 | Ga0209588_1001138 | Ga0209588_10011382 | 110 |
| 271 | 3300028381 | Ga0268264_10000271 | Ga0268264_100002713 | 110 |
| 272 | 3300028381 | Ga0268264_10357532 | Ga0268264_103575322 | 110 |
| 273 | 3300030521 | Ga0307511_10138741 | Ga0307511_101387412 | 110 |
| 274 | 3300030521 | Ga0307511_10193517 | Ga0307511_101935172 | 110 |
| 275 | 3300030760 | Ga0265762_1188664 | Ga0265762_11886641 | 110 |
| 276 | 3300031235 | Ga0265330_10029779 | Ga0265330_100297791 | 110 |
| 277 | 3300031249 | Ga0265339_10106083 | Ga0265339_101060832 | 110 |
| 278 | 3300031249 | Ga0265339_10291540 | Ga0265339_102915401 | 110 |
| 279 | 3300031250 | Ga0265331_10047281 | Ga0265331_100472813 | 110 |
| 280 | 3300031507 | Ga0307509_10066441 | Ga0307509_100664415 | 110 |
| 281 | 3300031507 | Ga0307509_10147325 | Ga0307509_101473253 | 110 |
| 282 | 3300031616 | Ga0307508_10000541 | Ga0307508_100005413 | 110 |
| 283 | 3300031616 | Ga0307508_10652651 | Ga0307508_106526511 | 110 |
| 284 | 3300031711 | Ga0265314_10085107 | Ga0265314_100851073 | 110 |
| 285 | 3300031712 | Ga0265342_10034049 | Ga0265342_100340492 | 110 |
| 286 | 3300031730 | Ga0307516_10016567 | Ga0307516_100165676 | 110 |
| 287 | 3300032126 | Ga0307415_100313972 | Ga0307415_1003139721 | 110 |
| 288 | 3300033179 | Ga0307507_10180798 | Ga0307507_101807982 | 110 |
| 289 | 3300033545 | Ga0316214_1016739 | Ga0316214_10167391 | 110 |
| 290 | 3300035083 | Ga0373926_0008279 | Ga0373926_0008279_926_1258 | 110 |
| 291 | 3300035083 | Ga0373926_0102798 | Ga0373926_0102798_283_615 | 110 |
| 292 | 3300035083 | Ga0373926_0294854 | Ga0373926_0294854_77_409 | 110 |
| 293 | 3300035111 | Ga0373923_0044205 | Ga0373923_0044205_165_497 | 110 |
| 294 | 3300035111 | Ga0373923_0399400 | Ga0373923_0399400_103_435 | 110 |
| 295 | 3300035113 | Ga0373936_0046381 | Ga0373936_0046381_548_880 | 110 |
| 296 | 3300035113 | Ga0373936_0048109 | Ga0373936_0048109_581_913 | 110 |
| 297 | 3300035116 | Ga0373945_0026055 | Ga0373945_0026055_276_608 | 110 |
| 298 | 3300035116 | Ga0373945_0052796 | Ga0373945_0052796_328_660 | 110 |
| 299 | 3300035116 | Ga0373945_0481877 | Ga0373945_0481877_18_350 | 110 |
| 300 | 3300035117 | Ga0373953_0045173 | Ga0373953_0045173_1281_1613 | 110 |
| 301 | 3300035117 | Ga0373953_0131244 | Ga0373953_0131244_476_808 | 110 |
| 302 | 3300035118 | Ga0373954_0011541 | Ga0373954_0011541_3410_3742 | 110 |
| 303 | 3300035118 | Ga0373954_0067297 | Ga0373954_0067297_868_1200 | 110 |
| 304 | 3300035118 | Ga0373954_0166130 | Ga0373954_0166130_49_381 | 110 |
| 305 | 3300035118 | Ga0373954_0421341 | Ga0373954_0421341_203_535 | 110 |
| 306 | 3300035119 | Ga0373956_0170189 | Ga0373956_0170189_132_464 | 110 |
| 307 | 3300035119 | Ga0373956_0282485 | Ga0373956_0282485_326_658 | 110 |
| 308 | 3300035120 | Ga0373957_0019273 | Ga0373957_0019273_611_943 | 110 |
| 309 | 3300035170 | Ga0373943_0011684 | Ga0373943_0011684_633_965 | 110 |
| 310 | 3300035170 | Ga0373943_0024472 | Ga0373943_0024472_892_1224 | 110 |
| 311 | 3300035170 | Ga0373943_0284016 | Ga0373943_0284016_439_771 | 110 |
| 312 | 3300035170 | Ga0373943_0988811 | Ga0373943_0988811_47_379 | 110 |
| 313 | 3300035171 | Ga0373946_0100132 | Ga0373946_0100132_917_1249 | 110 |
| 314 | 3300035172 | Ga0373955_0362572 | Ga0373955_0362572_235_567 | 110 |
| 315 | 3300035172 | Ga0373955_0373130 | Ga0373955_0373130_203_535 | 110 |
| 316 | 3300035172 | Ga0373955_0569120 | Ga0373955_0569120_235_567 | 110 |
| 317 | 3300035172 | Ga0373955_1021243 | Ga0373955_1021243_76_408 | 110 |
| 318 | 3300035410 | Ga0373924_0141622 | Ga0373924_0141622_651_983 | 110 |
| 319 | 3300035410 | Ga0373924_0267719 | Ga0373924_0267719_331_663 | 110 |
| 320 | 3300035692 | Ga0373935_0012834 | Ga0373935_0012834_927_1259 | 110 |
| 321 | 3300035692 | Ga0373935_0040630 | Ga0373935_0040630_927_1259 | 110 |
| 322 | 3300035692 | Ga0373935_0044908 | Ga0373935_0044908_915_1247 | 110 |
| 323 | 3300035692 | Ga0373935_0107798 | Ga0373935_0107798_1304_1636 | 110 |
| 324 | 3300035692 | Ga0373935_0343294 | Ga0373935_0343294_407_739 | 110 |
| 325 | 3300035692 | Ga0373935_0504404 | Ga0373935_0504404_285_617 | 110 |
| 326 | 3300035695 | Ga0373927_0001230 | Ga0373927_0001230_927_1259 | 110 |
| 327 | 3300035695 | Ga0373927_0005221 | Ga0373927_0005221_661_993 | 110 |
| 328 | 3300035695 | Ga0373927_0011945 | Ga0373927_0011945_5277_5609 | 110 |
| 329 | 3300035695 | Ga0373927_0103934 | Ga0373927_0103934_377_709 | 110 |
| 330 | 3300035695 | Ga0373927_0214044 | Ga0373927_0214044_747_1079 | 110 |
| 331 | 3300035695 | Ga0373927_0246425 | Ga0373927_0246425_646_978 | 110 |
| 332 | 3300035724 | Ga0373933_0000127 | Ga0373933_0000127_266_598 | 110 |
| 333 | 3300035724 | Ga0373933_0235676 | Ga0373933_0235676_227_559 | 110 |
| 334 | 3300035724 | Ga0373933_0311888 | Ga0373933_0311888_126_458 | 110 |
| 335 | 3300035724 | Ga0373933_0480671 | Ga0373933_0480671_449_781 | 110 |
| 336 | 3300035724 | Ga0373933_0715247 | Ga0373933_0715247_38_370 | 110 |
| 337 | 3300035725 | Ga0373947_0006336 | Ga0373947_0006336_868_1200 | 110 |
| 338 | 3300035725 | Ga0373947_0093150 | Ga0373947_0093150_722_1054 | 110 |
| 339 | 3300035725 | Ga0373947_0139383 | Ga0373947_0139383_1032_1364 | 110 |
| 340 | 3300035725 | Ga0373947_0283339 | Ga0373947_0283339_466_798 | 110 |
| 341 | 3300036401 | Ga0373937_0051021 | Ga0373937_0051021_2592_2924 | 110 |
| 342 | 3300036401 | Ga0373937_0064183 | Ga0373937_0064183_1638_1970 | 110 |
| 343 | 3300036401 | Ga0373937_0085421 | Ga0373937_0085421_145_477 | 110 |
| 344 | 3300036401 | Ga0373937_0522338 | Ga0373937_0522338_253_585 | 110 |
| 345 | 3300036459 | Ga0372808_050709 | Ga0372808_050709_241_573 | 110 |
| 346 | 3300037068 | Ga0373925_0002121 | Ga0373925_0002121_15049_15381 | 110 |
| 347 | 3300037068 | Ga0373925_0082948 | Ga0373925_0082948_214_546 | 110 |
| 348 | 3300037068 | Ga0373925_0202744 | Ga0373925_0202744_900_1232 | 110 |
| 349 | 3300037068 | Ga0373925_0538975 | Ga0373925_0538975_204_536 | 110 |
| 350 | 3300037418 | Ga0395900_0832897 | Ga0395900_0832897_447_779 | 110 |
| 351 | 3300039437 | Ga0436365_0022683 | Ga0436365_0022683_2170_2502 | 110 |
| 352 | 3300039437 | Ga0436365_0365629 | Ga0436365_0365629_2510_2842 | 110 |
| 353 | 3300039437 | Ga0436365_0547188 | Ga0436365_0547188_53_385 | 110 |
| 354 | 3300039438 | Ga0436360_0536456 | Ga0436360_0536456_988_1320 | 110 |
| 355 | 3300039438 | Ga0436360_0546753 | Ga0436360_0546753_167_499 | 110 |
| 356 | 3300039450 | Ga0436363_0186306 | Ga0436363_0186306_2070_2402 | 110 |
| 357 | 3300039450 | Ga0436363_0714205 | Ga0436363_0714205_243_575 | 110 |
| 358 | 3300039453 | Ga0436362_0842663 | Ga0436362_0842663_5279_5611 | 110 |
| 359 | 3300041452 | Ga0451793_0761067 | Ga0451793_0761067_299_631 | 110 |
| 360 | 3300041453 | Ga0451797_1546518 | Ga0451797_1546518_433_768 | 110 |
| 361 | 3300041505 | Ga0451849_1115692 | Ga0451849_1115692_234_569 | 110 |
| 362 | 3300041512 | Ga0451853_2103161 | Ga0451853_2103161_128_463 | 110 |
| 363 | 3300044694 | Ga0466963_0106052 | Ga0466963_0106052_31_363 | 110 |
| 364 | 3300044694 | Ga0466963_0585322 | Ga0466963_0585322_95_427 | 110 |
| 365 | 3300045976 | Ga0466967_0349897 | Ga0466967_0349897_1041_1373 | 110 |
| 366 | 3300046454 | Ga0495592_0443558 | Ga0495592_0443558_120_452 | 110 |
| 367 | 3300046454 | Ga0495592_0957101 | Ga0495592_0957101_104_436 | 110 |
| 368 | 3300046455 | Ga0495603_0000667 | Ga0495603_0000667_18200_18532 | 110 |
| 369 | 3300046455 | Ga0495603_0108451 | Ga0495603_0108451_1180_1512 | 110 |
| 370 | 3300046455 | Ga0495603_0216295 | Ga0495603_0216295_189_521 | 110 |
| 371 | 3300046459 | Ga0495629_0000283 | Ga0495629_0000283_21920_22252 | 110 |
| 372 | 3300046459 | Ga0495629_0059945 | Ga0495629_0059945_1089_1421 | 110 |
| 373 | 3300046460 | Ga0495638_0556750 | Ga0495638_0556750_11_343 | 110 |
| 374 | 3300046461 | Ga0495641_0006447 | Ga0495641_0006447_6423_6755 | 110 |
| 375 | 3300046462 | Ga0495651_0066864 | Ga0495651_0066864_1361_1693 | 110 |
| 376 | 3300046463 | Ga0495653_0455846 | Ga0495653_0455846_381_713 | 110 |
| 377 | 3300046472 | Ga0495580_0002411 | Ga0495580_0002411_15416_15748 | 110 |
| 378 | 3300046472 | Ga0495580_0028511 | Ga0495580_0028511_2837_3169 | 110 |
| 379 | 3300046473 | Ga0495582_0032135 | Ga0495582_0032135_1700_2032 | 110 |
| 380 | 3300046473 | Ga0495582_0055453 | Ga0495582_0055453_1831_2163 | 110 |
| 381 | 3300046475 | Ga0495639_0000423 | Ga0495639_0000423_18972_19304 | 110 |
| 382 | 3300046475 | Ga0495639_0102827 | Ga0495639_0102827_193_525 | 110 |
| 383 | 3300046475 | Ga0495639_0104588 | Ga0495639_0104588_887_1219 | 110 |
| 384 | 3300046476 | Ga0495662_0000186 | Ga0495662_0000186_23501_23833 | 110 |
| 385 | 3300046477 | Ga0495664_0004204 | Ga0495664_0004204_1079_1411 | 110 |
| 386 | 3300046477 | Ga0495664_0058995 | Ga0495664_0058995_899_1231 | 110 |
| 387 | 3300046477 | Ga0495664_0829734 | Ga0495664_0829734_55_387 | 110 |
| 388 | 3300046499 | Ga0495594_0001986 | Ga0495594_0001986_9448_9780 | 110 |
| 389 | 3300046499 | Ga0495594_0291210 | Ga0495594_0291210_142_474 | 110 |
| 390 | 3300046511 | Ga0495608_0610130 | Ga0495608_0610130_268_600 | 110 |
| 391 | 3300046514 | Ga0495618_0040958 | Ga0495618_0040958_309_641 | 110 |
| 392 | 3300046514 | Ga0495618_0092687 | Ga0495618_0092687_90_422 | 110 |
| 393 | 3300046516 | Ga0495628_0012222 | Ga0495628_0012222_1312_1644 | 110 |
| 394 | 3300046516 | Ga0495628_0037593 | Ga0495628_0037593_1175_1507 | 110 |
| 395 | 3300046516 | Ga0495628_0235378 | Ga0495628_0235378_635_967 | 110 |
| 396 | 3300046517 | Ga0495630_0021544 | Ga0495630_0021544_4291_4623 | 110 |
| 397 | 3300046517 | Ga0495630_0025317 | Ga0495630_0025317_3843_4175 | 110 |
| 398 | 3300046517 | Ga0495630_0422188 | Ga0495630_0422188_75_407 | 110 |
| 399 | 3300046524 | Ga0495648_0001145 | Ga0495648_0001145_785_1117 | 110 |
| 400 | 3300046526 | Ga0495666_0169613 | Ga0495666_0169613_153_485 | 110 |
| 401 | 3300046529 | Ga0495652_0015775 | Ga0495652_0015775_6265_6597 | 110 |
| 402 | 3300046529 | Ga0495652_0143215 | Ga0495652_0143215_1502_1834 | 110 |
| 403 | 3300046529 | Ga0495652_0537655 | Ga0495652_0537655_302_634 | 110 |
| 404 | 3300046531 | Ga0495665_0001096 | Ga0495665_0001096_864_1196 | 110 |
| 405 | 3300046531 | Ga0495665_0105411 | Ga0495665_0105411_224_556 | 110 |
| 406 | 3300046533 | Ga0495640_0077705 | Ga0495640_0077705_819_1151 | 110 |
| 407 | 3300046535 | Ga0495586_0099069 | Ga0495586_0099069_445_777 | 110 |
| 408 | 3300046536 | Ga0495587_0653882 | Ga0495587_0653882_43_375 | 110 |
| 409 | 3300046543 | Ga0495645_0148431 | Ga0495645_0148431_1196_1528 | 110 |
| 410 | 3300046543 | Ga0495645_0541065 | Ga0495645_0541065_255_587 | 110 |
| 411 | 3300046543 | Ga0495645_0863905 | Ga0495645_0863905_177_509 | 110 |
| 412 | 3300046557 | Ga0495622_0017461 | Ga0495622_0017461_896_1228 | 110 |
| 413 | 3300046559 | Ga0495667_0063250 | Ga0495667_0063250_467_799 | 110 |
| 414 | 3300046559 | Ga0495667_0090293 | Ga0495667_0090293_943_1275 | 110 |
| 415 | 3300046642 | Ga0495634_0031856 | Ga0495634_0031856_877_1209 | 110 |
| 416 | 3300046642 | Ga0495634_0116335 | Ga0495634_0116335_57_389 | 110 |
| 417 | 3300046663 | Ga0495635_0002530 | Ga0495635_0002530_11267_11599 | 110 |
| 418 | 3300046663 | Ga0495635_0201842 | Ga0495635_0201842_22_354 | 110 |
| 419 | 3300046674 | Ga0495588_0017451 | Ga0495588_0017451_2303_2635 | 110 |
| 420 | 3300046675 | Ga0495657_0049749 | Ga0495657_0049749_85_417 | 110 |
| 421 | 3300046678 | Ga0495599_0115407 | Ga0495599_0115407_347_679 | 110 |
| 422 | 3300046678 | Ga0495599_0117960 | Ga0495599_0117960_870_1202 | 110 |
| 423 | 3300046678 | Ga0495599_0142769 | Ga0495599_0142769_840_1172 | 110 |
| 424 | 3300046679 | Ga0495623_0211706 | Ga0495623_0211706_505_837 | 110 |
| 425 | 3300046679 | Ga0495623_0217396 | Ga0495623_0217396_461_793 | 110 |
| 426 | 3300046679 | Ga0495623_0477763 | Ga0495623_0477763_92_424 | 110 |
| 427 | 3300046680 | Ga0495646_0007232 | Ga0495646_0007232_350_682 | 110 |
| 428 | 3300046681 | Ga0495647_0001483 | Ga0495647_0001483_1745_2077 | 110 |
| 429 | 3300046683 | Ga0495658_0281842 | Ga0495658_0281842_276_608 | 110 |
| 430 | 3300046683 | Ga0495658_0507566 | Ga0495658_0507566_342_674 | 110 |
| 431 | 3300046689 | Ga0495613_0001910 | Ga0495613_0001910_846_1178 | 110 |
| 432 | 3300046689 | Ga0495613_0104432 | Ga0495613_0104432_96_428 | 110 |
| 433 | 3300046689 | Ga0495613_0565336 | Ga0495613_0565336_274_606 | 110 |
| 434 | 3300046690 | Ga0495624_0001800 | Ga0495624_0001800_912_1244 | 110 |
| 435 | 3300046690 | Ga0495624_0208994 | Ga0495624_0208994_662_994 | 110 |
| 436 | 3300046690 | Ga0495624_0258095 | Ga0495624_0258095_538_870 | 110 |
| 437 | 3300046809 | Ga0495600_0028095 | Ga0495600_0028095_2198_2530 | 110 |
| 438 | 3300046809 | Ga0495600_0823894 | Ga0495600_0823894_130_462 | 110 |
| 439 | 3300047315 | Ga0495581_0000346 | Ga0495581_0000346_877_1209 | 110 |
| 440 | 3300047315 | Ga0495581_0096893 | Ga0495581_0096893_294_626 | 110 |
| 441 | 3300047315 | Ga0495581_0200019 | Ga0495581_0200019_135_467 | 110 |
| 442 | 3300047317 | Ga0495604_0165859 | Ga0495604_0165859_527_859 | 110 |
| 443 | 3300047319 | Ga0495674_0024064 | Ga0495674_0024064_1398_1730 | 110 |
| 444 | 3300047319 | Ga0495674_0025391 | Ga0495674_0025391_829_1161 | 110 |
| 445 | 3300047319 | Ga0495674_0656974 | Ga0495674_0656974_44_376 | 110 |
| 446 | 3300047319 | Ga0495674_1035960 | Ga0495674_1035960_247_579 | 110 |
| 447 | 3300047321 | Ga0495676_0049875 | Ga0495676_0049875_2225_2557 | 110 |
| 448 | 3300047321 | Ga0495676_0121149 | Ga0495676_0121149_121_453 | 110 |
| 449 | 3300047321 | Ga0495676_0243605 | Ga0495676_0243605_125_457 | 110 |
| 450 | 3300047322 | Ga0495680_0348673 | Ga0495680_0348673_224_556 | 110 |
| 451 | 3300047322 | Ga0495680_0360978 | Ga0495680_0360978_82_414 | 110 |
| 452 | 3300047444 | Ga0495675_0136140 | Ga0495675_0136140_205_537 | 110 |
| 453 | 3300047469 | Ga0495673_0067532 | Ga0495673_0067532_379_711 | 110 |
| 454 | 3300047471 | Ga0495684_0023592 | Ga0495684_0023592_30_362 | 110 |
| 455 | 3300047471 | Ga0495684_0330432 | Ga0495684_0330432_524_856 | 110 |
| 456 | 3300047471 | Ga0495684_0823378 | Ga0495684_0823378_68_400 | 110 |
| 457 | 3300047472 | Ga0495686_0426559 | Ga0495686_0426559_197_529 | 110 |
| 458 | 3300047673 | Ga0495593_0001297 | Ga0495593_0001297_910_1242 | 110 |
| 459 | 3300048089 | Ga0495614_0023670 | Ga0495614_0023670_1487_1819 | 110 |
| 460 | 3300048089 | Ga0495614_0513173 | Ga0495614_0513173_42_374 | 110 |
| 461 | 3300048903 | Ga0496100_0278761 | Ga0496100_0278761_843_1175 | 110 |
| 462 | 3300048903 | Ga0496100_0354848 | Ga0496100_0354848_637_969 | 110 |
| 463 | 3300048905 | Ga0496102_0873973 | Ga0496102_0873973_297_629 | 110 |
| 464 | 3300048909 | Ga0496106_0004187 | Ga0496106_0004187_1740_2072 | 110 |
| 465 | 3300048909 | Ga0496106_0234764 | Ga0496106_0234764_507_845 | 110 |
| 466 | 3300048909 | Ga0496106_0395328 | Ga0496106_0395328_22_354 | 110 |
| 467 | 3300048911 | Ga0496108_0118230 | Ga0496108_0118230_543_875 | 110 |
| 468 | 3300048911 | Ga0496108_1396351 | Ga0496108_1396351_85_417 | 110 |
| 469 | 3300048914 | Ga0496111_0479652 | Ga0496111_0479652_551_883 | 110 |
| 470 | 3300048918 | Ga0496115_0144172 | Ga0496115_0144172_210_542 | 110 |
| 471 | 3300048918 | Ga0496115_0241214 | Ga0496115_0241214_761_1093 | 110 |
| 472 | 3300048919 | Ga0496116_0381962 | Ga0496116_0381962_248_580 | 110 |
| 473 | 3300048920 | Ga0496117_0014725 | Ga0496117_0014725_3360_3692 | 110 |
| 474 | 3300048920 | Ga0496117_0435072 | Ga0496117_0435072_209_541 | 110 |
| 475 | 3300048921 | Ga0496118_0006821 | Ga0496118_0006821_5086_5418 | 110 |
| 476 | 3300048922 | Ga0496119_0180984 | Ga0496119_0180984_430_762 | 110 |
| 477 | 3300048924 | Ga0496121_0000218 | Ga0496121_0000218_73649_73981 | 110 |
| 478 | 3300048924 | Ga0496121_0002143 | Ga0496121_0002143_26201_26533 | 110 |
| 479 | 3300048924 | Ga0496121_0340818 | Ga0496121_0340818_297_629 | 110 |
| 480 | 3300048924 | Ga0496121_0880585 | Ga0496121_0880585_122_454 | 110 |
| 481 | 3300048927 | Ga0496124_0001333 | Ga0496124_0001333_7432_7764 | 110 |
| 482 | 3300048927 | Ga0496124_0369241 | Ga0496124_0369241_564_896 | 110 |
| 483 | 3300048928 | Ga0496125_0064474 | Ga0496125_0064474_2045_2377 | 110 |
| 484 | 3300048929 | Ga0496126_0001598 | Ga0496126_0001598_32871_33203 | 110 |
| 485 | 3300048929 | Ga0496126_0008691 | Ga0496126_0008691_10217_10549 | 110 |
| 486 | 3300048929 | Ga0496126_0085347 | Ga0496126_0085347_908_1240 | 110 |
| 487 | 3300048929 | Ga0496126_0097984 | Ga0496126_0097984_1362_1694 | 110 |
| 488 | 3300048929 | Ga0496126_0241475 | Ga0496126_0241475_741_1073 | 110 |
| 489 | 3300048929 | Ga0496126_0257554 | Ga0496126_0257554_938_1270 | 110 |
| 490 | 3300048929 | Ga0496126_0312868 | Ga0496126_0312868_343_675 | 110 |
| 491 | 3300048929 | Ga0496126_0659480 | Ga0496126_0659480_70_402 | 110 |
| 492 | 3300049568 | Ga0501031_0004410 | Ga0501031_0004410_3694_4026 | 110 |
| 493 | 3300049568 | Ga0501031_0021326 | Ga0501031_0021326_150_482 | 110 |
| 494 | 3300049569 | Ga0501032_0002147 | Ga0501032_0002147_11159_11491 | 110 |
| 495 | 3300049569 | Ga0501032_0130164 | Ga0501032_0130164_310_642 | 110 |
| 496 | 3300049570 | Ga0501033_0000060 | Ga0501033_0000060_82900_83232 | 110 |
| 497 | 3300049570 | Ga0501033_0021876 | Ga0501033_0021876_3138_3470 | 110 |
| 498 | 3300049570 | Ga0501033_0027600 | Ga0501033_0027600_315_647 | 110 |
| 499 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_117565_117897 | 110 |
| 500 | 3300049571 | Ga0501034_0049060 | Ga0501034_0049060_3014_3346 | 110 |
| 501 | 3300049571 | Ga0501034_0100173 | Ga0501034_0100173_2488_2820 | 110 |
| 502 | 3300049571 | Ga0501034_0577466 | Ga0501034_0577466_232_564 | 110 |
| 503 | 3300049572 | Ga0501036_0000188 | Ga0501036_0000188_29610_29942 | 110 |
| 504 | 3300049572 | Ga0501036_0087493 | Ga0501036_0087493_161_493 | 110 |
| 505 | 3300049572 | Ga0501036_0857463 | Ga0501036_0857463_90_422 | 110 |
| 506 | 3300049573 | Ga0501037_0000402 | Ga0501037_0000402_24970_25302 | 110 |
| 507 | 3300049573 | Ga0501037_0003037 | Ga0501037_0003037_10368_10700 | 110 |
| 508 | 3300049573 | Ga0501037_0031760 | Ga0501037_0031760_1436_1768 | 110 |
| 509 | 3300049573 | Ga0501037_0190184 | Ga0501037_0190184_129_461 | 110 |
| 510 | 3300049574 | Ga0501038_0000540 | Ga0501038_0000540_21797_22129 | 110 |
| 511 | 3300049574 | Ga0501038_0051880 | Ga0501038_0051880_1712_2044 | 110 |
| 512 | 3300049574 | Ga0501038_0105274 | Ga0501038_0105274_1863_2195 | 110 |
| 513 | 3300049574 | Ga0501038_0218519 | Ga0501038_0218519_47_379 | 110 |
| 514 | 3300049575 | Ga0501039_0000431 | Ga0501039_0000431_6603_6935 | 110 |
| 515 | 3300049575 | Ga0501039_0016436 | Ga0501039_0016436_4226_4558 | 110 |
| 516 | 3300049576 | Ga0501040_0103606 | Ga0501040_0103606_1120_1452 | 110 |
| 517 | 3300049577 | Ga0501041_0483703 | Ga0501041_0483703_83_415 | 110 |
| 518 | 3300049578 | Ga0501042_0011425 | Ga0501042_0011425_3410_3742 | 110 |
| 519 | 3300049578 | Ga0501042_0070294 | Ga0501042_0070294_143_475 | 110 |
| 520 | 3300049578 | Ga0501042_0102846 | Ga0501042_0102846_1589_1921 | 110 |
| 521 | 3300049579 | Ga0501043_0002749 | Ga0501043_0002749_11085_11417 | 110 |
| 522 | 3300049579 | Ga0501043_0018739 | Ga0501043_0018739_952_1284 | 110 |
| 523 | 3300049580 | Ga0501046_0001915 | Ga0501046_0001915_11897_12229 | 110 |
| 524 | 3300049580 | Ga0501046_0014783 | Ga0501046_0014783_329_661 | 110 |
| 525 | 3300049580 | Ga0501046_0027066 | Ga0501046_0027066_95_427 | 110 |
| 526 | 3300049580 | Ga0501046_0069536 | Ga0501046_0069536_1365_1697 | 110 |
| 527 | 3300049581 | Ga0501047_0000246 | Ga0501047_0000246_26896_27228 | 110 |
| 528 | 3300049581 | Ga0501047_0079183 | Ga0501047_0079183_373_705 | 110 |
| 529 | 3300049581 | Ga0501047_0218672 | Ga0501047_0218672_1301_1633 | 110 |
| 530 | 3300049582 | Ga0501048_0000878 | Ga0501048_0000878_16319_16651 | 110 |
| 531 | 3300049582 | Ga0501048_0020139 | Ga0501048_0020139_129_461 | 110 |
| 532 | 3300049582 | Ga0501048_1291810 | Ga0501048_1291810_124_456 | 110 |
| 533 | 3300049583 | Ga0501067_0000320 | Ga0501067_0000320_16476_16808 | 110 |
| 534 | 3300049583 | Ga0501067_0382677 | Ga0501067_0382677_290_622 | 110 |
| 535 | 3300049584 | Ga0501068_0002924 | Ga0501068_0002924_5046_5378 | 110 |
| 536 | 3300049584 | Ga0501068_0017885 | Ga0501068_0017885_1369_1701 | 110 |
| 537 | 3300049585 | Ga0501069_0005134 | Ga0501069_0005134_2239_2571 | 110 |
| 538 | 3300049586 | Ga0501070_0000779 | Ga0501070_0000779_13294_13626 | 110 |
| 539 | 3300049586 | Ga0501070_0018706 | Ga0501070_0018706_2477_2809 | 110 |
| 540 | 3300049586 | Ga0501070_0765766 | Ga0501070_0765766_114_446 | 110 |
| 541 | 3300049586 | Ga0501070_1356414 | Ga0501070_1356414_17_349 | 110 |
| 542 | 3300049587 | Ga0501071_0174123 | Ga0501071_0174123_136_468 | 110 |
| 543 | 3300049588 | Ga0501072_0004819 | Ga0501072_0004819_9762_10094 | 110 |
| 544 | 3300049588 | Ga0501072_0108254 | Ga0501072_0108254_1757_2089 | 110 |
| 545 | 3300049589 | Ga0501073_0000093 | Ga0501073_0000093_30437_30769 | 110 |
| 546 | 3300049589 | Ga0501073_0144808 | Ga0501073_0144808_15_347 | 110 |
| 547 | 3300049589 | Ga0501073_0390209 | Ga0501073_0390209_27_359 | 110 |
| 548 | 3300049590 | Ga0501074_0000127 | Ga0501074_0000127_10924_11256 | 110 |
| 549 | 3300049590 | Ga0501074_0025558 | Ga0501074_0025558_3796_4128 | 110 |
| 550 | 3300049593 | Ga0501077_0239533 | Ga0501077_0239533_625_957 | 110 |
| 551 | 3300049741 | Ga0501079_0001174 | Ga0501079_0001174_8803_9135 | 110 |
| 552 | 3300049741 | Ga0501079_0598781 | Ga0501079_0598781_178_510 | 110 |
| 553 | 3300049742 | Ga0501080_0001845 | Ga0501080_0001845_874_1206 | 110 |
| 554 | 3300049742 | Ga0501080_0034825 | Ga0501080_0034825_4056_4388 | 110 |
| 555 | 3300049744 | Ga0501083_0008877 | Ga0501083_0008877_5274_5606 | 110 |
| 556 | 3300049744 | Ga0501083_0232920 | Ga0501083_0232920_411_743 | 110 |
| 557 | 3300049822 | Ga0501035_0000798 | Ga0501035_0000798_5148_5480 | 110 |
| 558 | 3300049822 | Ga0501035_0084415 | Ga0501035_0084415_435_767 | 110 |
| 559 | 3300049822 | Ga0501035_0116281 | Ga0501035_0116281_163_495 | 110 |
| 560 | 3300049822 | Ga0501035_0314792 | Ga0501035_0314792_223_555 | 110 |
| 561 | 3300049822 | Ga0501035_0710922 | Ga0501035_0710922_163_495 | 110 |
| 562 | 3300049822 | Ga0501035_1228109 | Ga0501035_1228109_86_418 | 110 |
| 563 | 3300049823 | Ga0501044_0005195 | Ga0501044_0005195_2489_2821 | 110 |
| 564 | 3300049823 | Ga0501044_0023777 | Ga0501044_0023777_535_867 | 110 |
| 565 | 3300049823 | Ga0501044_0729152 | Ga0501044_0729152_174_506 | 110 |
| 566 | 3300049823 | Ga0501044_1208904 | Ga0501044_1208904_129_461 | 110 |
| 567 | 3300049824 | Ga0501045_1043881 | Ga0501045_1043881_173_505 | 110 |
| 568 | 3300050492 | nmdc:mga0yw44_358288_c1 | nmdc:mga0yw44_358288_c1_288_623 | 110 |
| 569 | 3300050512 | nmdc:mga0n895_1900863_c1 | nmdc:mga0n895_1900863_c1_207_539 | 110 |
| 570 | 3300050512 | nmdc:mga0n895_203510_c1 | nmdc:mga0n895_203510_c1_1113_1445 | 110 |
| 571 | 3300053077 | Ga0495601_0127648 | Ga0495601_0127648_944_1276 | 110 |
| 572 | 3300053077 | Ga0495601_0161268 | Ga0495601_0161268_926_1258 | 110 |
| 573 | 3300053078 | Ga0495612_0007154 | Ga0495612_0007154_2410_2742 | 110 |
| 574 | 3300053080 | Ga0500635_0005826 | Ga0500635_0005826_2001_2333 | 110 |
| 575 | 3300053080 | Ga0500635_0052312 | Ga0500635_0052312_437_769 | 110 |
| 576 | 3300053084 | Ga0495595_0345974 | Ga0495595_0345974_237_569 | 110 |
| 577 | 3300053085 | Ga0495619_0084347 | Ga0495619_0084347_661_993 | 110 |
| 578 | 3300053085 | Ga0495619_0503838 | Ga0495619_0503838_25_357 | 110 |
| 579 | 3300053086 | Ga0500578_0525968 | Ga0500578_0525968_267_599 | 110 |
| 580 | 3300053093 | Ga0500651_0005693 | Ga0500651_0005693_3007_3339 | 110 |
| 581 | 3300053094 | Ga0500566_0488259 | Ga0500566_0488259_74_406 | 110 |
| 582 | 3300053097 | Ga0500648_056450 | Ga0500648_056450_1683_2015 | 110 |
| 583 | 3300053098 | Ga0500650_0071799 | Ga0500650_0071799_183_515 | 110 |
| 584 | 3300053102 | Ga0500554_002561 | Ga0500554_002561_1081_1413 | 110 |
| 585 | 3300053118 | Ga0500594_0016326 | Ga0500594_0016326_1165_1497 | 110 |
| 586 | 3300053119 | Ga0500595_027430 | Ga0500595_027430_1560_1892 | 110 |
| 587 | 3300053136 | Ga0500559_0039350 | Ga0500559_0039350_1343_1675 | 110 |
| 588 | 3300053140 | Ga0500573_0041160 | Ga0500573_0041160_1795_2127 | 110 |
| 589 | 3300053146 | Ga0500588_0268301 | Ga0500588_0268301_299_631 | 110 |
| 590 | 3300053148 | Ga0500590_108911 | Ga0500590_108911_182_514 | 110 |
| 591 | 3300053150 | Ga0500603_031587 | Ga0500603_031587_207_539 | 110 |
| 592 | 3300053150 | Ga0500603_132247 | Ga0500603_132247_384_716 | 110 |
| 593 | 3300053150 | Ga0500603_285611 | Ga0500603_285611_76_408 | 110 |
| 594 | 3300053151 | Ga0500604_0095532 | Ga0500604_0095532_74_406 | 110 |
| 595 | 3300053154 | Ga0500619_307169 | Ga0500619_307169_36_368 | 110 |
| 596 | 3300053158 | Ga0500627_0107403 | Ga0500627_0107403_515_847 | 110 |
| 597 | 3300053163 | Ga0500639_157090 | Ga0500639_157090_602_934 | 110 |
| 598 | 3300053177 | Ga0500636_0017280 | Ga0500636_0017280_2760_3092 | 110 |
| 599 | 3300053177 | Ga0500636_0124922 | Ga0500636_0124922_263_595 | 110 |
| 600 | 3300053177 | Ga0500636_0197630 | Ga0500636_0197630_99_431 | 110 |
| 601 | 3300053177 | Ga0500636_0209106 | Ga0500636_0209106_575_907 | 110 |
| 602 | 3300053177 | Ga0500636_0246599 | Ga0500636_0246599_31_363 | 110 |
| 603 | 3300053178 | Ga0500637_0509850 | Ga0500637_0509850_11_343 | 110 |
| 604 | 3300053724 | Ga0500570_080332 | Ga0500570_080332_526_858 | 110 |
| 605 | 3300053730 | Ga0500645_175617 | Ga0500645_175617_74_406 | 110 |
| 606 | 3300054114 | Ga0501084_0095316 | Ga0501084_0095316_1342_1674 | 110 |
| 607 | 3300054114 | Ga0501084_0144392 | Ga0501084_0144392_1495_1827 | 110 |
| 608 | 3300060353 | Ga0501082_0004139 | Ga0501082_0004139_4809_5141 | 110 |
| 609 | iso_pu_bacteria | 2507262055 | 2507511797 | 110 |
| 610 | iso_pu_bacteria | 2508501009 | 2508545463 | 110 |
| 611 | iso_pu_bacteria | 2508501042 | 2508694278 | 110 |
| 612 | iso_pu_bacteria | 2511231028 | 2511396753 | 110 |
| 613 | iso_pu_bacteria | 2513237092 | 2513626757 | 110 |
| 614 | iso_pu_bacteria | 2513237094 | 2513643375 | 110 |
| 615 | iso_pu_bacteria | 2513237095 | 2513648227 | 110 |
| 616 | iso_pu_bacteria | 2513237102 | 2513701633 | 110 |
| 617 | iso_pu_bacteria | 2513237139 | 2513875219 | 110 |
| 618 | iso_pu_bacteria | 2513237161 | 2514014328 | 110 |
| 619 | iso_pu_bacteria | 2515154112 | 2515624796 | 110 |
| 620 | iso_pu_bacteria | 2528768022 | 2528853593 | 110 |
| 621 | iso_pu_bacteria | 2617270735 | 2617349550 | 110 |
| 622 | iso_pu_bacteria | 2617270741 | 2617376742 | 110 |
| 623 | iso_pu_bacteria | 2791355196 | 2793059715 | 110 |
| 624 | iso_pu_bacteria | 2802429603 | 2805919588 | 110 |
| 625 | iso_pu_bacteria | 2816332527 | 2818239805 | 110 |
| 626 | iso_pu_bacteria | 2824600985 | 2824605942 | 110 |
| 627 | iso_pu_bacteria | 2824609381 | 2824613390 | 110 |
| 628 | iso_pu_bacteria | 2824617872 | 2824623729 | 110 |
| 629 | iso_pu_bacteria | 2824626560 | 2824633369 | 110 |
| 630 | iso_pu_bacteria | 2824635225 | 2824640208 | 110 |
| 631 | iso_pu_bacteria | 2824644064 | 2824648909 | 110 |
| 632 | iso_pu_bacteria | 2824661429 | 2824670165 | 110 |
| 633 | iso_pu_bacteria | 2824671348 | 2824676401 | 110 |
| 634 | iso_pu_bacteria | 2824679649 | 2824685214 | 110 |
| 635 | iso_pu_bacteria | 2824687955 | 2824694440 | 110 |
| 636 | iso_pu_bacteria | 2824696289 | 2824702510 | 110 |
| 637 | iso_pu_bacteria | 2824704595 | 2824710625 | 110 |
| 638 | iso_pu_bacteria | 2824714736 | 2824722449 | 110 |
| 639 | iso_pu_bacteria | 2824723954 | 2824729205 | 110 |
| 640 | iso_pu_bacteria | 2824732956 | 2824739367 | 110 |
| 641 | iso_pu_bacteria | 2824746037 | 2824749745 | 110 |
| 642 | iso_pu_bacteria | 2824753945 | 2824760733 | 110 |
| 643 | iso_pu_bacteria | 2824763712 | 2824770450 | 110 |
| 644 | iso_pu_bacteria | 2824773399 | 2824777918 | 110 |
| 645 | iso_pu_bacteria | 2838122688 | 2838130518 | 110 |
| 646 | iso_pu_bacteria | 2841941048 | 2841942175 | 110 |
| 647 | iso_pu_bacteria | 2841949485 | 2841955365 | 110 |
| 648 | iso_pu_bacteria | 2841957949 | 2841963598 | 110 |
| 649 | iso_pu_bacteria | 2841966195 | 2841971302 | 110 |
| 650 | iso_pu_bacteria | 2841974524 | 2841981594 | 110 |
| 651 | iso_pu_bacteria | 2841983080 | 2841987098 | 110 |
| 652 | iso_pu_bacteria | 2842038055 | 2842042081 | 110 |
| 653 | iso_pu_bacteria | 2842045827 | 2842050124 | 110 |
| 654 | iso_pu_bacteria | 2844315083 | 2844321008 | 110 |
| 655 | iso_pu_bacteria | 2847939898 | 2847943621 | 110 |
| 656 | iso_pu_bacteria | 2849076700 | 2849077345 | 110 |
| 657 | iso_pu_bacteria | 2857509624 | 2857515050 | 110 |
| 658 | iso_pu_bacteria | 2874590934 | 2874593637 | 110 |
| 659 | iso_pu_bacteria | 2874612657 | 2874614072 | 110 |
| 660 | iso_pu_bacteria | 2874620515 | 2874624933 | 110 |
| 661 | iso_pu_bacteria | 2874628541 | 2874631066 | 110 |
| 662 | iso_pu_bacteria | 2874645413 | 2874648350 | 110 |
| 663 | iso_pu_bacteria | 2876771140 | 2876774698 | 110 |
| 664 | iso_pu_bacteria | 2876818435 | 2876821489 | 110 |
| 665 | iso_pu_bacteria | 2879074833 | 2879079266 | 110 |
| 666 | iso_pu_bacteria | 2879099564 | 2879102695 | 110 |
| 667 | iso_pu_bacteria | 2879127579 | 2879131269 | 110 |
| 668 | iso_pu_bacteria | 2879142872 | 2879144620 | 110 |
| 669 | iso_pu_bacteria | 2881364244 | 2881371209 | 110 |
| 670 | iso_pu_bacteria | 2881665667 | 2881668048 | 110 |
| 671 | iso_pu_bacteria | 2885366525 | 2885374130 | 110 |
| 672 | iso_pu_bacteria | 2885409591 | 2885414867 | 110 |
| 673 | iso_pu_bacteria | 2888378607 | 2888386417 | 110 |
| 674 | iso_pu_bacteria | 2888419890 | 2888426536 | 110 |
| 675 | iso_pu_bacteria | 2903727486 | 2903734215 | 110 |
| 676 | iso_pu_bacteria | 2904666416 | 2904669092 | 110 |
| 677 | iso_pu_bacteria | 2904711408 | 2904715596 | 110 |
| 678 | iso_pu_bacteria | 2906602504 | 2906605295 | 110 |
| 679 | iso_pu_bacteria | 2906626472 | 2906634582 | 110 |
| 680 | iso_pu_bacteria | 2908775508 | 2908782636 | 110 |
| 681 | iso_pu_bacteria | 2922368715 | 2922370647 | 110 |
| 682 | iso_pu_bacteria | 2922393267 | 2922396787 | 110 |
| 683 | iso_pu_bacteria | 2929615660 | 2929620216 | 110 |
| 684 | iso_pu_bacteria | 2929624759 | 2929629529 | 110 |
| 685 | iso_pu_bacteria | 2932784394 | 2932791573 | 110 |
| 686 | iso_pu_bacteria | 2932794094 | 2932799352 | 110 |
| 687 | iso_pu_bacteria | 2932801729 | 2932802251 | 110 |
| 688 | iso_pu_bacteria | 2932809354 | 2932816837 | 110 |
| 689 | iso_pu_bacteria | 2932818245 | 2932823986 | 110 |
| 690 | iso_pu_bacteria | 2932828146 | 2932835476 | 110 |
| 691 | iso_pu_bacteria | 2933577622 | 2933582133 | 110 |
| 692 | iso_pu_bacteria | 2935608549 | 2935613566 | 110 |
| 693 | iso_pu_bacteria | 2935616580 | 2935621218 | 110 |
| 694 | iso_pu_bacteria | 2935638405 | 2935643462 | 110 |
| 695 | iso_pu_bacteria | 2935648319 | 2935650557 | 110 |
| 696 | iso_pu_bacteria | 2935656913 | 2935662999 | 110 |
| 697 | iso_pu_bacteria | 2935665750 | 2935671215 | 110 |
| 698 | iso_pu_bacteria | 2935675223 | 2935681182 | 110 |
| 699 | iso_pu_bacteria | 2935684952 | 2935689480 | 110 |
| 700 | iso_pu_bacteria | 2935694250 | 2935700054 | 110 |
| 701 | iso_pu_bacteria | 2935703347 | 2935710737 | 110 |
| 702 | iso_pu_bacteria | 2935713505 | 2935720731 | 110 |
| 703 | iso_pu_bacteria | 2935722832 | 2935727958 | 110 |
| 704 | iso_pu_bacteria | 2935732158 | 2935737446 | 110 |
| 705 | iso_pu_bacteria | 2935741537 | 2935746493 | 110 |
| 706 | iso_pu_bacteria | 2935750917 | 2935757460 | 110 |
| 707 | iso_pu_bacteria | 2935760218 | 2935763836 | 110 |
| 708 | iso_pu_bacteria | 2935769743 | 2935776620 | 110 |
| 709 | iso_pu_bacteria | 2935777560 | 2935781395 | 110 |
| 710 | iso_pu_bacteria | 2935785616 | 2935792491 | 110 |
| 711 | iso_pu_bacteria | 2935793552 | 2935797960 | 110 |
| 712 | iso_pu_bacteria | 2935801545 | 2935807816 | 110 |
| 713 | iso_pu_bacteria | 2935810662 | 2935818281 | 110 |
| 714 | iso_pu_bacteria | 2935819856 | 2935824581 | 110 |
| 715 | iso_pu_bacteria | 2935827899 | 2935832979 | 110 |
| 716 | iso_pu_bacteria | 2935837841 | 2935844349 | 110 |
| 717 | iso_pu_bacteria | 2935847175 | 2935851801 | 110 |
| 718 | iso_pu_bacteria | 2935855204 | 2935859589 | 110 |
| 719 | iso_pu_bacteria | 2935864058 | 2935871346 | 110 |
| 720 | iso_pu_bacteria | 2935873716 | 2935879089 | 110 |
| 721 | iso_pu_bacteria | 2935883170 | 2935889510 | 110 |
| 722 | iso_pu_bacteria | 2935908558 | 2935911154 | 110 |
| 723 | iso_pu_bacteria | 2935916978 | 2935920686 | 110 |
| 724 | iso_pu_bacteria | 2935926038 | 2935928183 | 110 |
| 725 | iso_pu_bacteria | 2935934488 | 2935937828 | 110 |
| 726 | iso_pu_bacteria | 2935942939 | 2935945110 | 110 |
| 727 | iso_pu_bacteria | 2935951376 | 2935954385 | 110 |
| 728 | iso_pu_bacteria | 2935959822 | 2935965552 | 110 |
| 729 | iso_pu_bacteria | 2935967501 | 2935971348 | 110 |
| 730 | iso_pu_bacteria | 2935975950 | 2935981954 | 110 |
| 731 | iso_pu_bacteria | 2935984226 | 2935990770 | 110 |
| 732 | iso_pu_bacteria | 2935992306 | 2935996732 | 110 |
| 733 | iso_pu_bacteria | 2936002035 | 2936008608 | 110 |
| 734 | iso_pu_bacteria | 2936011229 | 2936017087 | 110 |
| 735 | iso_pu_bacteria | 2936019824 | 2936027471 | 110 |
| 736 | iso_pu_bacteria | 2936028420 | 2936036295 | 110 |
| 737 | iso_pu_bacteria | 2936037263 | 2936044901 | 110 |
| 738 | iso_pu_bacteria | 2936046547 | 2936050780 | 110 |
| 739 | iso_pu_bacteria | 2936055302 | 2936062745 | 110 |
| 740 | iso_pu_bacteria | 2940556831 | 2940563716 | 110 |
| 741 | iso_pu_bacteria | 2941531003 | 2941537777 | 110 |
| 742 | iso_pu_bacteria | 2941538514 | 2941542681 | 110 |
| 743 | iso_pu_bacteria | 3005483717 | 3005490120 | 110 |
| 744 | iso_pu_bacteria | 3005506211 | 3005506981 | 110 |
| 745 | iso_pu_bacteria | 3005587118 | 3005591389 | 110 |
| 746 | iso_pu_bacteria | 3005594810 | 3005601345 | 110 |
| 747 | iso_pu_bacteria | 3005710791 | 3005716785 | 110 |
| 748 | iso_pu_bacteria | 3005718088 | 3005724041 | 110 |
| 749 | iso_pu_bacteria | 8016511872 | 8016519580 | 110 |
| 750 | iso_pu_bacteria | 8016522445 | 8016524783 | 110 |
| 751 | iso_pu_bacteria | 8016530956 | 8016538351 | 110 |
| 752 | iso_pu_bacteria | 8016539877 | 8016542631 | 110 |
| 753 | iso_pu_bacteria | 8016548790 | 8016550643 | 110 |
| 754 | iso_pu_bacteria | 8016557553 | 8016559063 | 110 |
| 755 | iso_pu_bacteria | 8016566248 | 8016568014 | 110 |
| 756 | iso_pu_bacteria | 8016575299 | 8016580698 | 110 |
| 757 | iso_pu_bacteria | 8016583857 | 8016588010 | 110 |
| 758 | iso_pu_bacteria | 8016595262 | 8016597022 | 110 |
| 759 | iso_pu_bacteria | 8016603502 | 8016607927 | 110 |
| 760 | iso_pu_bacteria | 8016613128 | 8016619708 | 110 |
| 761 | iso_pu_bacteria | 8016622563 | 8016629903 | 110 |
| 762 | iso_pu_bacteria | 8016630954 | 8016637294 | 110 |
| 763 | iso_pu_bacteria | 8017057580 | 8017065947 | 110 |
| 764 | iso_pu_bacteria | 8019530166 | 8019538022 | 110 |
| 765 | iso_pu_bacteria | 8019538911 | 8019541960 | 110 |
| 766 | iso_pu_bacteria | 8019547302 | 8019548840 | 110 |
| 767 | iso_pu_bacteria | 8019576017 | 8019578703 | 110 |
| 768 | iso_pu_bacteria | 8019597564 | 8019604944 | 110 |
| 769 | iso_pu_bacteria | 8019608314 | 8019613585 | 110 |
| 770 | iso_pu_bacteria | 8019619141 | 8019624242 | 110 |
| 771 | iso_pu_bacteria | 8019638758 | 8019641845 | 110 |
| 772 | iso_pu_bacteria | 8019648815 | 8019653771 | 110 |
| 773 | iso_pu_bacteria | 8019659431 | 8019665698 | 110 |
| 774 | iso_pu_bacteria | 8019668869 | 8019675234 | 110 |
| 775 | iso_pu_bacteria | 8019678201 | 8019680873 | 110 |
| 776 | iso_pu_bacteria | 8019687851 | 8019694906 | 110 |
| 777 | iso_pu_bacteria | 8055742211 | 8055750031 | 110 |
| 778 | iso_pu_bacteria | 8056967851 | 8056969747 | 110 |
| 779 | 3300046507 | Ga0495606_0001397 | Ga0495606_0001397_1838_2173 | 111 |
| 780 | 3300046512 | Ga0495610_0188039 | Ga0495610_0188039_509_844 | 111 |
| 781 | 3300048915 | Ga0496112_0000036 | Ga0496112_0000036_3291_3626 | 111 |
| 782 | 3300005356 | Ga0070674_101691114 | Ga0070674_1016911141 | 112 |
| 783 | 3300005439 | Ga0070711_100107157 | Ga0070711_1001071572 | 112 |
| 784 | 3300005564 | Ga0070664_101297307 | Ga0070664_1012973072 | 112 |
| 785 | 3300013296 | Ga0157374_11659942 | Ga0157374_116599421 | 112 |
| 786 | 3300021388 | Ga0213875_10458362 | Ga0213875_104583621 | 112 |
| 787 | 3300048903 | Ga0496100_0191229 | Ga0496100_0191229_426_839 | 112 |
| 788 | 3300048904 | Ga0496101_0299475 | Ga0496101_0299475_401_814 | 112 |
| 789 | 3300048905 | Ga0496102_1497719 | Ga0496102_1497719_58_396 | 112 |
| 790 | 3300048907 | Ga0496104_0299154 | Ga0496104_0299154_984_1397 | 112 |
| 791 | 3300048909 | Ga0496106_0011609 | Ga0496106_0011609_456_869 | 112 |
| 792 | 3300048910 | Ga0496107_0048726 | Ga0496107_0048726_1066_1479 | 112 |
| 793 | 3300048911 | Ga0496108_0009483 | Ga0496108_0009483_7101_7514 | 112 |
| 794 | 3300048912 | Ga0496109_0012953 | Ga0496109_0012953_6339_6752 | 112 |
| 795 | 3300048913 | Ga0496110_0031727 | Ga0496110_0031727_204_617 | 112 |
| 796 | 3300048914 | Ga0496111_0186422 | Ga0496111_0186422_912_1325 | 112 |
| 797 | 3300048915 | Ga0496112_0149030 | Ga0496112_0149030_1518_1931 | 112 |
| 798 | 3300048917 | Ga0496114_0694584 | Ga0496114_0694584_266_679 | 112 |
| 799 | 3300053077 | Ga0495601_1084072 | Ga0495601_1084072_98_436 | 112 |
| 800 | iso_pu_bacteria | 2847930680 | 2847932374 | 112 |
| 801 | iso_pu_bacteria | 2879083081 | 2879089319 | 112 |
| 802 | iso_pu_bacteria | 2906643746 | 2906650772 | 112 |
| 803 | 3300005719 | Ga0068861_100203197 | Ga0068861_1002031974 | 113 |
| 804 | 3300012503 | Ga0157313_1015514 | Ga0157313_10155141 | 113 |
| 805 | 3300044658 | Ga0466972_0000115 | Ga0466972_0000115_15982_16323 | 113 |
| 806 | 3300044765 | Ga0466970_0131669 | Ga0466970_0131669_932_1273 | 113 |
| 807 | 3300050516 | nmdc:mga0sz30_372005_c1 | nmdc:mga0sz30_372005_c1_147_488 | 113 |
| 808 | 3300053095 | Ga0500640_133320 | Ga0500640_133320_542_883 | 113 |
| 809 | 3300053123 | Ga0500614_010829 | Ga0500614_010829_570_911 | 113 |
| 810 | 3300053136 | Ga0500559_0006437 | Ga0500559_0006437_4521_4862 | 113 |
| 811 | 3300053138 | Ga0500564_098383 | Ga0500564_098383_371_712 | 113 |
| 812 | 3300053148 | Ga0500590_241043 | Ga0500590_241043_206_547 | 113 |
| 813 | 3300053154 | Ga0500619_162176 | Ga0500619_162176_252_593 | 113 |
| 814 | 3300053155 | Ga0500620_016205 | Ga0500620_016205_1474_1815 | 113 |
| 815 | 3300053163 | Ga0500639_297888 | Ga0500639_297888_159_500 | 113 |
| 816 | 3300053177 | Ga0500636_0003998 | Ga0500636_0003998_7813_8154 | 113 |
| 817 | 3300001904 | JGI24736J21556_1029370 | JGI24736J21556_10293702 | 114 |
| 818 | 3300003214 | JGI25165J46597_1010336 | JGI25165J46597_10103362 | 114 |
| 819 | 3300003214 | JGI25165J46597_1010389 | JGI25165J46597_10103892 | 114 |
| 820 | 3300003215 | JGI25153J46596_10003375 | JGI25153J46596_100033752 | 114 |
| 821 | 3300003215 | JGI25153J46596_10011101 | JGI25153J46596_100111015 | 114 |
| 822 | 3300003215 | JGI25153J46596_10030143 | JGI25153J46596_100301432 | 114 |
| 823 | 3300003354 | JGI25160J50197_1000799 | JGI25160J50197_10007994 | 114 |
| 824 | 3300003354 | JGI25160J50197_1014275 | JGI25160J50197_10142753 | 114 |
| 825 | 3300003354 | JGI25160J50197_1059286 | JGI25160J50197_10592862 | 114 |
| 826 | 3300003752 | Ga0055539_1003625 | Ga0055539_10036252 | 114 |
| 827 | 3300003762 | Ga0055542_1028475 | Ga0055542_10284751 | 114 |
| 828 | 3300003794 | Ga0055531_10008098 | Ga0055531_100080983 | 114 |
| 829 | 3300003794 | Ga0055531_10077245 | Ga0055531_100772452 | 114 |
| 830 | 3300004625 | Ga0055543_1005956 | Ga0055543_10059563 | 114 |
| 831 | 3300005262 | Ga0065165_1002396 | Ga0065165_100239612 | 114 |
| 832 | 3300005262 | Ga0065165_1053054 | Ga0065165_10530542 | 114 |
| 833 | 3300005327 | Ga0070658_10285892 | Ga0070658_102858922 | 114 |
| 834 | 3300005331 | Ga0070670_101179362 | Ga0070670_1011793622 | 114 |
| 835 | 3300005337 | Ga0070682_100587075 | Ga0070682_1005870751 | 114 |
| 836 | 3300005338 | Ga0068868_100433198 | Ga0068868_1004331982 | 114 |
| 837 | 3300005339 | Ga0070660_101177188 | Ga0070660_1011771881 | 114 |
| 838 | 3300005344 | Ga0070661_100545210 | Ga0070661_1005452101 | 114 |
| 839 | 3300005344 | Ga0070661_100737911 | Ga0070661_1007379112 | 114 |
| 840 | 3300005347 | Ga0070668_100740209 | Ga0070668_1007402092 | 114 |
| 841 | 3300005355 | Ga0070671_100439394 | Ga0070671_1004393942 | 114 |
| 842 | 3300005356 | Ga0070674_101930053 | Ga0070674_1019300531 | 114 |
| 843 | 3300005455 | Ga0070663_100102169 | Ga0070663_1001021693 | 114 |
| 844 | 3300005455 | Ga0070663_100294724 | Ga0070663_1002947242 | 114 |
| 845 | 3300005455 | Ga0070663_100544314 | Ga0070663_1005443142 | 114 |
| 846 | 3300005456 | Ga0070678_100614595 | Ga0070678_1006145952 | 114 |
| 847 | 3300005459 | Ga0068867_100403919 | Ga0068867_1004039192 | 114 |
| 848 | 3300005539 | Ga0068853_100597861 | Ga0068853_1005978611 | 114 |
| 849 | 3300005547 | Ga0070693_100789984 | Ga0070693_1007899841 | 114 |
| 850 | 3300005548 | Ga0070665_100097042 | Ga0070665_1000970423 | 114 |
| 851 | 3300005548 | Ga0070665_100170533 | Ga0070665_1001705332 | 114 |
| 852 | 3300005563 | Ga0068855_100373210 | Ga0068855_1003732101 | 114 |
| 853 | 3300005577 | Ga0068857_100491713 | Ga0068857_1004917132 | 114 |
| 854 | 3300005578 | Ga0068854_101275018 | Ga0068854_1012750181 | 114 |
| 855 | 3300005614 | Ga0068856_100188639 | Ga0068856_1001886393 | 114 |
| 856 | 3300005615 | Ga0070702_100976847 | Ga0070702_1009768471 | 114 |
| 857 | 3300005616 | Ga0068852_100115685 | Ga0068852_1001156853 | 114 |
| 858 | 3300005617 | Ga0068859_100702615 | Ga0068859_1007026152 | 114 |
| 859 | 3300005618 | Ga0068864_100284359 | Ga0068864_1002843592 | 114 |
| 860 | 3300005618 | Ga0068864_100289255 | Ga0068864_1002892552 | 114 |
| 861 | 3300005834 | Ga0068851_10548057 | Ga0068851_105480572 | 114 |
| 862 | 3300005842 | Ga0068858_100493513 | Ga0068858_1004935132 | 114 |
| 863 | 3300005842 | Ga0068858_100663562 | Ga0068858_1006635622 | 114 |
| 864 | 3300005843 | Ga0068860_100641480 | Ga0068860_1006414802 | 114 |
| 865 | 3300005844 | Ga0068862_100807042 | Ga0068862_1008070422 | 114 |
| 866 | 3300006038 | Ga0075365_10245977 | Ga0075365_102459772 | 114 |
| 867 | 3300006042 | Ga0075368_10020458 | Ga0075368_100204583 | 114 |
| 868 | 3300006048 | Ga0075363_100044320 | Ga0075363_1000443203 | 114 |
| 869 | 3300006051 | Ga0075364_10183530 | Ga0075364_101835302 | 114 |
| 870 | 3300006186 | Ga0075369_10006412 | Ga0075369_100064124 | 114 |
| 871 | 3300006186 | Ga0075369_10060642 | Ga0075369_100606422 | 114 |
| 872 | 3300006186 | Ga0075369_10115845 | Ga0075369_101158452 | 114 |
| 873 | 3300006195 | Ga0075366_10104549 | Ga0075366_101045492 | 114 |
| 874 | 3300006195 | Ga0075366_10979134 | Ga0075366_109791342 | 114 |
| 875 | 3300006237 | Ga0097621_100510822 | Ga0097621_1005108222 | 114 |
| 876 | 3300006353 | Ga0075370_10941610 | Ga0075370_109416102 | 114 |
| 877 | 3300006358 | Ga0068871_100814064 | Ga0068871_1008140642 | 114 |
| 878 | 3300006881 | Ga0068865_100990364 | Ga0068865_1009903642 | 114 |
| 879 | 3300006931 | Ga0097620_100702529 | Ga0097620_1007025292 | 114 |
| 880 | 3300006942 | Ga0099824_1008631 | Ga0099824_10086319 | 114 |
| 881 | 3300009011 | Ga0105251_10170095 | Ga0105251_101700952 | 114 |
| 882 | 3300009093 | Ga0105240_10007359 | Ga0105240_100073593 | 114 |
| 883 | 3300009093 | Ga0105240_10215009 | Ga0105240_102150092 | 114 |
| 884 | 3300009098 | Ga0105245_10731922 | Ga0105245_107319222 | 114 |
| 885 | 3300009098 | Ga0105245_12288876 | Ga0105245_122888761 | 114 |
| 886 | 3300009101 | Ga0105247_10025451 | Ga0105247_100254515 | 114 |
| 887 | 3300009101 | Ga0105247_10081822 | Ga0105247_100818223 | 114 |
| 888 | 3300009148 | Ga0105243_10078436 | Ga0105243_100784362 | 114 |
| 889 | 3300009174 | Ga0105241_10029931 | Ga0105241_100299314 | 114 |
| 890 | 3300009174 | Ga0105241_10363687 | Ga0105241_103636873 | 114 |
| 891 | 3300009176 | Ga0105242_10925838 | Ga0105242_109258382 | 114 |
| 892 | 3300009177 | Ga0105248_10425987 | Ga0105248_104259872 | 114 |
| 893 | 3300009545 | Ga0105237_10036037 | Ga0105237_100360372 | 114 |
| 894 | 3300009545 | Ga0105237_10225019 | Ga0105237_102250193 | 114 |
| 895 | 3300009551 | Ga0105238_10661043 | Ga0105238_106610432 | 114 |
| 896 | 3300009551 | Ga0105238_10830796 | Ga0105238_108307961 | 114 |
| 897 | 3300010375 | Ga0105239_10053182 | Ga0105239_100531825 | 114 |
| 898 | 3300010375 | Ga0105239_10277385 | Ga0105239_102773852 | 114 |
| 899 | 3300010375 | Ga0105239_10612230 | Ga0105239_106122301 | 114 |
| 900 | 3300010375 | Ga0105239_11532551 | Ga0105239_115325512 | 114 |
| 901 | 3300010375 | Ga0105239_12631672 | Ga0105239_126316722 | 114 |
| 902 | 3300011119 | Ga0105246_10007034 | Ga0105246_100070343 | 114 |
| 903 | 3300013100 | Ga0157373_10758192 | Ga0157373_107581921 | 114 |
| 904 | 3300013104 | Ga0157370_10918416 | Ga0157370_109184162 | 114 |
| 905 | 3300013296 | Ga0157374_10199234 | Ga0157374_101992343 | 114 |
| 906 | 3300013297 | Ga0157378_11179419 | Ga0157378_111794191 | 114 |
| 907 | 3300013307 | Ga0157372_12474379 | Ga0157372_124743792 | 114 |
| 908 | 3300013308 | Ga0157375_10241813 | Ga0157375_102418132 | 114 |
| 909 | 3300014968 | Ga0157379_10625262 | Ga0157379_106252621 | 114 |
| 910 | 3300014969 | Ga0157376_10286400 | Ga0157376_102864001 | 114 |
| 911 | 3300014969 | Ga0157376_11447165 | Ga0157376_114471651 | 114 |
| 912 | 3300015261 | Ga0182006_1315673 | Ga0182006_13156732 | 114 |
| 913 | 3300017792 | Ga0163161_10298666 | Ga0163161_102986661 | 114 |
| 914 | 3300021320 | Ga0214544_1000163 | Ga0214544_10001634 | 114 |
| 915 | 3300021321 | Ga0214542_1000156 | Ga0214542_1000156106 | 114 |
| 916 | 3300021324 | Ga0214545_1000078 | Ga0214545_10000784 | 114 |
| 917 | 3300021327 | Ga0214543_1000136 | Ga0214543_10001364 | 114 |
| 918 | 3300025230 | Ga0209563_102445 | Ga0209563_1024453 | 114 |
| 919 | 3300025253 | Ga0209677_102384 | Ga0209677_1023845 | 114 |
| 920 | 3300025254 | Ga0209148_1000333 | Ga0209148_100033362 | 114 |
| 921 | 3300025261 | Ga0209233_1000526 | Ga0209233_100052620 | 114 |
| 922 | 3300025261 | Ga0209233_1046951 | Ga0209233_10469511 | 114 |
| 923 | 3300025272 | Ga0209455_1003625 | Ga0209455_10036255 | 114 |
| 924 | 3300025273 | Ga0209673_1008762 | Ga0209673_10087623 | 114 |
| 925 | 3300025295 | Ga0209564_1002609 | Ga0209564_100260911 | 114 |
| 926 | 3300025295 | Ga0209564_1028827 | Ga0209564_10288273 | 114 |
| 927 | 3300025297 | Ga0209758_1000109 | Ga0209758_1000109161 | 114 |
| 928 | 3300025297 | Ga0209758_1000416 | Ga0209758_100041615 | 114 |
| 929 | 3300025297 | Ga0209758_1001062 | Ga0209758_100106221 | 114 |
| 930 | 3300025297 | Ga0209758_1006263 | Ga0209758_100626311 | 114 |
| 931 | 3300025297 | Ga0209758_1038250 | Ga0209758_10382502 | 114 |
| 932 | 3300025297 | Ga0209758_1068444 | Ga0209758_10684442 | 114 |
| 933 | 3300025299 | Ga0209256_1019931 | Ga0209256_10199312 | 114 |
| 934 | 3300025302 | Ga0207426_1000522 | Ga0207426_100052246 | 114 |
| 935 | 3300025302 | Ga0207426_1000971 | Ga0207426_100097127 | 114 |
| 936 | 3300025302 | Ga0207426_1023477 | Ga0207426_10234772 | 114 |
| 937 | 3300025302 | Ga0207426_1033892 | Ga0207426_10338922 | 114 |
| 938 | 3300025303 | Ga0209051_1075097 | Ga0209051_10750972 | 114 |
| 939 | 3300025304 | Ga0209257_1011890 | Ga0209257_10118905 | 114 |
| 940 | 3300025304 | Ga0209257_1035061 | Ga0209257_10350611 | 114 |
| 941 | 3300025304 | Ga0209257_1053235 | Ga0209257_10532352 | 114 |
| 942 | 3300025900 | Ga0207710_10116804 | Ga0207710_101168042 | 114 |
| 943 | 3300025901 | Ga0207688_10116819 | Ga0207688_101168192 | 114 |
| 944 | 3300025904 | Ga0207647_10040764 | Ga0207647_100407642 | 114 |
| 945 | 3300025905 | Ga0207685_10092948 | Ga0207685_100929481 | 114 |
| 946 | 3300025906 | Ga0207699_10176325 | Ga0207699_101763252 | 114 |
| 947 | 3300025911 | Ga0207654_10106045 | Ga0207654_101060453 | 114 |
| 948 | 3300025913 | Ga0207695_10000378 | Ga0207695_1000037865 | 114 |
| 949 | 3300025913 | Ga0207695_10777583 | Ga0207695_107775832 | 114 |
| 950 | 3300025914 | Ga0207671_10014103 | Ga0207671_100141035 | 114 |
| 951 | 3300025914 | Ga0207671_10402253 | Ga0207671_104022532 | 114 |
| 952 | 3300025916 | Ga0207663_10985163 | Ga0207663_109851631 | 114 |
| 953 | 3300025931 | Ga0207644_10572107 | Ga0207644_105721072 | 114 |
| 954 | 3300025933 | Ga0207706_10350008 | Ga0207706_103500082 | 114 |
| 955 | 3300025940 | Ga0207691_10463611 | Ga0207691_104636112 | 114 |
| 956 | 3300025941 | Ga0207711_10610019 | Ga0207711_106100192 | 114 |
| 957 | 3300025949 | Ga0207667_10421394 | Ga0207667_104213942 | 114 |
| 958 | 3300025972 | Ga0207668_10241672 | Ga0207668_102416721 | 114 |
| 959 | 3300025981 | Ga0207640_10123034 | Ga0207640_101230343 | 114 |
| 960 | 3300025986 | Ga0207658_10131707 | Ga0207658_101317072 | 114 |
| 961 | 3300026023 | Ga0207677_10722919 | Ga0207677_107229192 | 114 |
| 962 | 3300026035 | Ga0207703_10268356 | Ga0207703_102683563 | 114 |
| 963 | 3300026041 | Ga0207639_10166179 | Ga0207639_101661792 | 114 |
| 964 | 3300026067 | Ga0207678_10142121 | Ga0207678_101421213 | 114 |
| 965 | 3300026089 | Ga0207648_10413850 | Ga0207648_104138502 | 114 |
| 966 | 3300026095 | Ga0207676_10172067 | Ga0207676_101720672 | 114 |
| 967 | 3300026095 | Ga0207676_11364822 | Ga0207676_113648222 | 114 |
| 968 | 3300026116 | Ga0207674_10338042 | Ga0207674_103380422 | 114 |
| 969 | 3300026118 | Ga0207675_100126349 | Ga0207675_1001263493 | 114 |
| 970 | 3300026118 | Ga0207675_101732921 | Ga0207675_1017329212 | 114 |
| 971 | 3300026121 | Ga0207683_10338033 | Ga0207683_103380332 | 114 |
| 972 | 3300027296 | Ga0209389_1000230 | Ga0209389_10002307 | 114 |
| 973 | 3300027296 | Ga0209389_1002940 | Ga0209389_100294013 | 114 |
| 974 | 3300027357 | Ga0209589_1000897 | Ga0209589_10008972 | 114 |
| 975 | 3300027361 | Ga0209489_100110 | Ga0209489_10011070 | 114 |
| 976 | 3300027361 | Ga0209489_102489 | Ga0209489_10248943 | 114 |
| 977 | 3300027363 | Ga0209700_102336 | Ga0209700_10233645 | 114 |
| 978 | 3300028379 | Ga0268266_10055646 | Ga0268266_100556463 | 114 |
| 979 | 3300033180 | Ga0307510_10002289 | Ga0307510_1000228914 | 114 |
| 980 | 3300033180 | Ga0307510_10156570 | Ga0307510_101565703 | 114 |
| 981 | 3300037466 | Ga0395898_0251747 | Ga0395898_0251747_108_452 | 114 |
| 982 | 3300037466 | Ga0395898_0822048 | Ga0395898_0822048_199_543 | 114 |
| 983 | 3300037471 | Ga0395905_0030447 | Ga0395905_0030447_1454_1798 | 114 |
| 984 | 3300037853 | Ga0436364_0566534 | Ga0436364_0566534_1116_1460 | 114 |
| 985 | 3300039437 | Ga0436365_0354924 | Ga0436365_0354924_245_589 | 114 |
| 986 | 3300039437 | Ga0436365_0825888 | Ga0436365_0825888_199_543 | 114 |
| 987 | 3300039453 | Ga0436362_0871182 | Ga0436362_0871182_289_633 | 114 |
| 988 | 3300041441 | Ga0451787_703960 | Ga0451787_703960_273_617 | 114 |
| 989 | 3300041452 | Ga0451793_1046715 | Ga0451793_1046715_411_755 | 114 |
| 990 | 3300041456 | Ga0451795_1610771 | Ga0451795_1610771_246_590 | 114 |
| 991 | 3300041491 | Ga0451833_0979399 | Ga0451833_0979399_326_670 | 114 |
| 992 | 3300041507 | Ga0451851_0230066 | Ga0451851_0230066_38_382 | 114 |
| 993 | 3300041512 | Ga0451853_3411604 | Ga0451853_3411604_106_450 | 114 |
| 994 | 3300044656 | Ga0466969_0005173 | Ga0466969_0005173_1675_2019 | 114 |
| 995 | 3300044658 | Ga0466972_0032818 | Ga0466972_0032818_1837_2181 | 114 |
| 996 | 3300044658 | Ga0466972_0406312 | Ga0466972_0406312_222_566 | 114 |
| 997 | 3300044684 | Ga0466966_0025622 | Ga0466966_0025622_1708_2052 | 114 |
| 998 | 3300044693 | Ga0466961_0000066 | Ga0466961_0000066_46782_47126 | 114 |
| 999 | 3300044694 | Ga0466963_0029979 | Ga0466963_0029979_2222_2566 | 114 |
| 1000 | 3300044735 | Ga0466968_0063005 | Ga0466968_0063005_213_557 | 114 |
| 1001 | 3300044735 | Ga0466968_0121163 | Ga0466968_0121163_78_422 | 114 |
| 1002 | 3300044901 | Ga0466960_0078634 | Ga0466960_0078634_1259_1603 | 114 |
| 1003 | 3300044901 | Ga0466960_0150967 | Ga0466960_0150967_186_530 | 114 |
| 1004 | 3300044901 | Ga0466960_0909638 | Ga0466960_0909638_83_427 | 114 |
| 1005 | 3300045976 | Ga0466967_0128644 | Ga0466967_0128644_978_1322 | 114 |
| 1006 | 3300046452 | Ga0495617_164548 | Ga0495617_164548_305_649 | 114 |
| 1007 | 3300046454 | Ga0495592_0026498 | Ga0495592_0026498_1848_2192 | 114 |
| 1008 | 3300046454 | Ga0495592_0425717 | Ga0495592_0425717_350_694 | 114 |
| 1009 | 3300046459 | Ga0495629_0025350 | Ga0495629_0025350_1208_1552 | 114 |
| 1010 | 3300046460 | Ga0495638_0011191 | Ga0495638_0011191_3942_4286 | 114 |
| 1011 | 3300046462 | Ga0495651_0022916 | Ga0495651_0022916_1321_1665 | 114 |
| 1012 | 3300046462 | Ga0495651_0040170 | Ga0495651_0040170_2053_2397 | 114 |
| 1013 | 3300046471 | Ga0495650_0127441 | Ga0495650_0127441_461_805 | 114 |
| 1014 | 3300046474 | Ga0495605_0076546 | Ga0495605_0076546_703_1047 | 114 |
| 1015 | 3300046474 | Ga0495605_0133725 | Ga0495605_0133725_340_684 | 114 |
| 1016 | 3300046477 | Ga0495664_0118980 | Ga0495664_0118980_96_440 | 114 |
| 1017 | 3300046477 | Ga0495664_0539502 | Ga0495664_0539502_308_652 | 114 |
| 1018 | 3300046492 | Ga0495585_0328902 | Ga0495585_0328902_175_519 | 114 |
| 1019 | 3300046501 | Ga0495607_0139837 | Ga0495607_0139837_482_826 | 114 |
| 1020 | 3300046506 | Ga0495583_0167219 | Ga0495583_0167219_365_709 | 114 |
| 1021 | 3300046507 | Ga0495606_0038607 | Ga0495606_0038607_2371_2715 | 114 |
| 1022 | 3300046511 | Ga0495608_0143664 | Ga0495608_0143664_463_807 | 114 |
| 1023 | 3300046512 | Ga0495610_0369912 | Ga0495610_0369912_172_516 | 114 |
| 1024 | 3300046513 | Ga0495616_0173399 | Ga0495616_0173399_97_441 | 114 |
| 1025 | 3300046514 | Ga0495618_0023307 | Ga0495618_0023307_676_1020 | 114 |
| 1026 | 3300046516 | Ga0495628_0025773 | Ga0495628_0025773_3172_3516 | 114 |
| 1027 | 3300046524 | Ga0495648_0057238 | Ga0495648_0057238_1782_2126 | 114 |
| 1028 | 3300046524 | Ga0495648_0153738 | Ga0495648_0153738_833_1177 | 114 |
| 1029 | 3300046524 | Ga0495648_0410799 | Ga0495648_0410799_209_553 | 114 |
| 1030 | 3300046529 | Ga0495652_0026046 | Ga0495652_0026046_1637_1981 | 114 |
| 1031 | 3300046529 | Ga0495652_0143000 | Ga0495652_0143000_332_676 | 114 |
| 1032 | 3300046529 | Ga0495652_0153554 | Ga0495652_0153554_202_546 | 114 |
| 1033 | 3300046533 | Ga0495640_0030086 | Ga0495640_0030086_1283_1627 | 114 |
| 1034 | 3300046533 | Ga0495640_0065433 | Ga0495640_0065433_1241_1585 | 114 |
| 1035 | 3300046536 | Ga0495587_0058721 | Ga0495587_0058721_225_569 | 114 |
| 1036 | 3300046542 | Ga0495597_0336347 | Ga0495597_0336347_108_452 | 114 |
| 1037 | 3300046543 | Ga0495645_0063646 | Ga0495645_0063646_2141_2485 | 114 |
| 1038 | 3300046557 | Ga0495622_0013019 | Ga0495622_0013019_2547_2891 | 114 |
| 1039 | 3300046557 | Ga0495622_0013289 | Ga0495622_0013289_2854_3198 | 114 |
| 1040 | 3300046559 | Ga0495667_0010532 | Ga0495667_0010532_4350_4694 | 114 |
| 1041 | 3300046616 | Ga0495668_0128689 | Ga0495668_0128689_605_949 | 114 |
| 1042 | 3300046616 | Ga0495668_0715470 | Ga0495668_0715470_93_437 | 114 |
| 1043 | 3300046642 | Ga0495634_0074401 | Ga0495634_0074401_1417_1761 | 114 |
| 1044 | 3300046642 | Ga0495634_0104953 | Ga0495634_0104953_1322_1666 | 114 |
| 1045 | 3300046648 | Ga0495611_0055368 | Ga0495611_0055368_474_818 | 114 |
| 1046 | 3300046660 | Ga0495625_0095197 | Ga0495625_0095197_675_1019 | 114 |
| 1047 | 3300046660 | Ga0495625_0280052 | Ga0495625_0280052_97_441 | 114 |
| 1048 | 3300046663 | Ga0495635_0005323 | Ga0495635_0005323_8181_8525 | 114 |
| 1049 | 3300046663 | Ga0495635_0144414 | Ga0495635_0144414_1168_1512 | 114 |
| 1050 | 3300046674 | Ga0495588_0007115 | Ga0495588_0007115_3816_4160 | 114 |
| 1051 | 3300046674 | Ga0495588_0310257 | Ga0495588_0310257_284_628 | 114 |
| 1052 | 3300046675 | Ga0495657_0015963 | Ga0495657_0015963_23_367 | 114 |
| 1053 | 3300046675 | Ga0495657_0057001 | Ga0495657_0057001_1051_1395 | 114 |
| 1054 | 3300046678 | Ga0495599_0029223 | Ga0495599_0029223_2969_3313 | 114 |
| 1055 | 3300046679 | Ga0495623_0026575 | Ga0495623_0026575_31_375 | 114 |
| 1056 | 3300046680 | Ga0495646_0029944 | Ga0495646_0029944_85_429 | 114 |
| 1057 | 3300046689 | Ga0495613_0021869 | Ga0495613_0021869_2806_3150 | 114 |
| 1058 | 3300046689 | Ga0495613_0099154 | Ga0495613_0099154_781_1125 | 114 |
| 1059 | 3300046690 | Ga0495624_0043889 | Ga0495624_0043889_1107_1451 | 114 |
| 1060 | 3300046691 | Ga0495670_0360309 | Ga0495670_0360309_393_737 | 114 |
| 1061 | 3300046694 | Ga0495649_0178548 | Ga0495649_0178548_741_1085 | 114 |
| 1062 | 3300046694 | Ga0495649_0197583 | Ga0495649_0197583_400_744 | 114 |
| 1063 | 3300046694 | Ga0495649_0391518 | Ga0495649_0391518_273_617 | 114 |
| 1064 | 3300046794 | Ga0495589_0032117 | Ga0495589_0032117_1415_1759 | 114 |
| 1065 | 3300046809 | Ga0495600_0012830 | Ga0495600_0012830_1722_2066 | 114 |
| 1066 | 3300046809 | Ga0495600_0101770 | Ga0495600_0101770_1097_1441 | 114 |
| 1067 | 3300047315 | Ga0495581_0094303 | Ga0495581_0094303_189_533 | 114 |
| 1068 | 3300047317 | Ga0495604_0007903 | Ga0495604_0007903_6233_6577 | 114 |
| 1069 | 3300047317 | Ga0495604_0013112 | Ga0495604_0013112_3086_3430 | 114 |
| 1070 | 3300047319 | Ga0495674_0089250 | Ga0495674_0089250_752_1096 | 114 |
| 1071 | 3300047319 | Ga0495674_0272343 | Ga0495674_0272343_935_1279 | 114 |
| 1072 | 3300047321 | Ga0495676_0138278 | Ga0495676_0138278_1275_1619 | 114 |
| 1073 | 3300047322 | Ga0495680_0001058 | Ga0495680_0001058_3348_3692 | 114 |
| 1074 | 3300047323 | Ga0495683_0245432 | Ga0495683_0245432_300_644 | 114 |
| 1075 | 3300047443 | Ga0495687_004881 | Ga0495687_004881_286_630 | 114 |
| 1076 | 3300047444 | Ga0495675_0008446 | Ga0495675_0008446_2812_3156 | 114 |
| 1077 | 3300047469 | Ga0495673_0043711 | Ga0495673_0043711_1412_1756 | 114 |
| 1078 | 3300047469 | Ga0495673_0287550 | Ga0495673_0287550_188_532 | 114 |
| 1079 | 3300047471 | Ga0495684_0092904 | Ga0495684_0092904_714_1058 | 114 |
| 1080 | 3300047673 | Ga0495593_0027280 | Ga0495593_0027280_542_886 | 114 |
| 1081 | 3300048088 | Ga0495602_0005801 | Ga0495602_0005801_7287_7631 | 114 |
| 1082 | 3300048088 | Ga0495602_0130086 | Ga0495602_0130086_1274_1618 | 114 |
| 1083 | 3300048088 | Ga0495602_0776588 | Ga0495602_0776588_237_581 | 114 |
| 1084 | 3300048089 | Ga0495614_0055500 | Ga0495614_0055500_166_510 | 114 |
| 1085 | 3300048089 | Ga0495614_0141927 | Ga0495614_0141927_182_526 | 114 |
| 1086 | 3300048903 | Ga0496100_0258693 | Ga0496100_0258693_137_481 | 114 |
| 1087 | 3300048903 | Ga0496100_0273342 | Ga0496100_0273342_800_1144 | 114 |
| 1088 | 3300048903 | Ga0496100_1311317 | Ga0496100_1311317_182_526 | 114 |
| 1089 | 3300048905 | Ga0496102_0134052 | Ga0496102_0134052_823_1167 | 114 |
| 1090 | 3300048905 | Ga0496102_0237439 | Ga0496102_0237439_1255_1599 | 114 |
| 1091 | 3300048905 | Ga0496102_0344820 | Ga0496102_0344820_936_1280 | 114 |
| 1092 | 3300048906 | Ga0496103_0007344 | Ga0496103_0007344_5096_5440 | 114 |
| 1093 | 3300048907 | Ga0496104_0190611 | Ga0496104_0190611_107_451 | 114 |
| 1094 | 3300048907 | Ga0496104_0196275 | Ga0496104_0196275_1512_1856 | 114 |
| 1095 | 3300048907 | Ga0496104_1481670 | Ga0496104_1481670_23_367 | 114 |
| 1096 | 3300048908 | Ga0496105_0003004 | Ga0496105_0003004_11074_11418 | 114 |
| 1097 | 3300048908 | Ga0496105_0026626 | Ga0496105_0026626_1477_1821 | 114 |
| 1098 | 3300048908 | Ga0496105_0877426 | Ga0496105_0877426_53_397 | 114 |
| 1099 | 3300048909 | Ga0496106_0225975 | Ga0496106_0225975_1080_1424 | 114 |
| 1100 | 3300048909 | Ga0496106_0332278 | Ga0496106_0332278_657_1001 | 114 |
| 1101 | 3300048910 | Ga0496107_0732302 | Ga0496107_0732302_191_535 | 114 |
| 1102 | 3300048911 | Ga0496108_0053316 | Ga0496108_0053316_1947_2291 | 114 |
| 1103 | 3300048912 | Ga0496109_0267726 | Ga0496109_0267726_165_509 | 114 |
| 1104 | 3300048913 | Ga0496110_0135920 | Ga0496110_0135920_177_521 | 114 |
| 1105 | 3300048913 | Ga0496110_0402693 | Ga0496110_0402693_811_1155 | 114 |
| 1106 | 3300048913 | Ga0496110_0888079 | Ga0496110_0888079_408_752 | 114 |
| 1107 | 3300048915 | Ga0496112_0397234 | Ga0496112_0397234_837_1181 | 114 |
| 1108 | 3300048915 | Ga0496112_0788306 | Ga0496112_0788306_446_790 | 114 |
| 1109 | 3300048916 | Ga0496113_0023104 | Ga0496113_0023104_2396_2740 | 114 |
| 1110 | 3300048916 | Ga0496113_0284613 | Ga0496113_0284613_330_674 | 114 |
| 1111 | 3300048917 | Ga0496114_0126394 | Ga0496114_0126394_1543_1887 | 114 |
| 1112 | 3300048917 | Ga0496114_0489371 | Ga0496114_0489371_171_515 | 114 |
| 1113 | 3300048918 | Ga0496115_0022821 | Ga0496115_0022821_1559_1903 | 114 |
| 1114 | 3300048919 | Ga0496116_0038973 | Ga0496116_0038973_1114_1458 | 114 |
| 1115 | 3300048920 | Ga0496117_0021587 | Ga0496117_0021587_3446_3790 | 114 |
| 1116 | 3300048920 | Ga0496117_0041129 | Ga0496117_0041129_1475_1819 | 114 |
| 1117 | 3300048921 | Ga0496118_0030236 | Ga0496118_0030236_2540_2884 | 114 |
| 1118 | 3300048921 | Ga0496118_0071213 | Ga0496118_0071213_1179_1523 | 114 |
| 1119 | 3300048921 | Ga0496118_0095356 | Ga0496118_0095356_321_665 | 114 |
| 1120 | 3300048921 | Ga0496118_0102456 | Ga0496118_0102456_1449_1793 | 114 |
| 1121 | 3300048922 | Ga0496119_0013006 | Ga0496119_0013006_3839_4183 | 114 |
| 1122 | 3300048922 | Ga0496119_0063130 | Ga0496119_0063130_480_824 | 114 |
| 1123 | 3300048922 | Ga0496119_0213474 | Ga0496119_0213474_627_971 | 114 |
| 1124 | 3300048923 | Ga0496120_0019431 | Ga0496120_0019431_1740_2084 | 114 |
| 1125 | 3300048923 | Ga0496120_0095701 | Ga0496120_0095701_1102_1446 | 114 |
| 1126 | 3300048924 | Ga0496121_0024547 | Ga0496121_0024547_781_1125 | 114 |
| 1127 | 3300048924 | Ga0496121_0093483 | Ga0496121_0093483_1611_1955 | 114 |
| 1128 | 3300048924 | Ga0496121_0194653 | Ga0496121_0194653_142_486 | 114 |
| 1129 | 3300048926 | Ga0496123_0140579 | Ga0496123_0140579_181_525 | 114 |
| 1130 | 3300048927 | Ga0496124_0089207 | Ga0496124_0089207_1102_1446 | 114 |
| 1131 | 3300048928 | Ga0496125_0030379 | Ga0496125_0030379_3508_3852 | 114 |
| 1132 | 3300048928 | Ga0496125_0203673 | Ga0496125_0203673_742_1086 | 114 |
| 1133 | 3300049460 | Ga0495682_0017747 | Ga0495682_0017747_963_1307 | 114 |
| 1134 | 3300050491 | nmdc:mga00v17_30000_c1 | nmdc:mga00v17_30000_c1_2394_2738 | 114 |
| 1135 | 3300050491 | nmdc:mga00v17_49354_c1 | nmdc:mga00v17_49354_c1_2047_2391 | 114 |
| 1136 | 3300050492 | nmdc:mga0yw44_207786_c1 | nmdc:mga0yw44_207786_c1_921_1265 | 114 |
| 1137 | 3300050492 | nmdc:mga0yw44_882248_c1 | nmdc:mga0yw44_882248_c1_251_595 | 114 |
| 1138 | 3300050493 | nmdc:mga0k408_209215_c1 | nmdc:mga0k408_209215_c1_179_523 | 114 |
| 1139 | 3300050494 | nmdc:mga06z11_97715_c1 | nmdc:mga06z11_97715_c1_134_478 | 114 |
| 1140 | 3300050496 | nmdc:mga07m45_18827_c1 | nmdc:mga07m45_18827_c1_3358_3702 | 114 |
| 1141 | 3300050496 | nmdc:mga07m45_55859_c1 | nmdc:mga07m45_55859_c1_1401_1745 | 114 |
| 1142 | 3300050516 | nmdc:mga0sz30_58617_c1 | nmdc:mga0sz30_58617_c1_720_1064 | 114 |
| 1143 | 3300053077 | Ga0495601_0299334 | Ga0495601_0299334_611_955 | 114 |
| 1144 | 3300053084 | Ga0495595_0099694 | Ga0495595_0099694_95_439 | 114 |
| 1145 | 3300053085 | Ga0495619_0090441 | Ga0495619_0090441_47_391 | 114 |
| 1146 | 3300053086 | Ga0500578_0195237 | Ga0500578_0195237_331_675 | 114 |
| 1147 | 3300053086 | Ga0500578_0414710 | Ga0500578_0414710_294_638 | 114 |
| 1148 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_118250_118594 | 114 |
| 1149 | 3300053090 | Ga0500646_0195593 | Ga0500646_0195593_17_361 | 114 |
| 1150 | 3300053093 | Ga0500651_0131518 | Ga0500651_0131518_68_412 | 114 |
| 1151 | 3300053093 | Ga0500651_0457679 | Ga0500651_0457679_63_407 | 114 |
| 1152 | 3300053094 | Ga0500566_0059465 | Ga0500566_0059465_159_503 | 114 |
| 1153 | 3300053094 | Ga0500566_0323904 | Ga0500566_0323904_127_471 | 114 |
| 1154 | 3300053098 | Ga0500650_0275510 | Ga0500650_0275510_91_435 | 114 |
| 1155 | 3300053103 | Ga0500555_001072 | Ga0500555_001072_2501_2845 | 114 |
| 1156 | 3300053104 | Ga0500556_0069527 | Ga0500556_0069527_590_934 | 114 |
| 1157 | 3300053108 | Ga0500562_021204 | Ga0500562_021204_868_1212 | 114 |
| 1158 | 3300053109 | Ga0500569_011527 | Ga0500569_011527_372_716 | 114 |
| 1159 | 3300053116 | Ga0500592_002866 | Ga0500592_002866_133_477 | 114 |
| 1160 | 3300053119 | Ga0500595_008262 | Ga0500595_008262_3788_4132 | 114 |
| 1161 | 3300053120 | Ga0500597_410958 | Ga0500597_410958_48_392 | 114 |
| 1162 | 3300053121 | Ga0500607_071125 | Ga0500607_071125_1143_1487 | 114 |
| 1163 | 3300053130 | Ga0500642_0000376 | Ga0500642_0000376_13164_13508 | 114 |
| 1164 | 3300053130 | Ga0500642_0313319 | Ga0500642_0313319_181_525 | 114 |
| 1165 | 3300053131 | Ga0500652_091010 | Ga0500652_091010_17_361 | 114 |
| 1166 | 3300053136 | Ga0500559_0569048 | Ga0500559_0569048_158_502 | 114 |
| 1167 | 3300053139 | Ga0500568_0018290 | Ga0500568_0018290_2401_2745 | 114 |
| 1168 | 3300053142 | Ga0500577_0131556 | Ga0500577_0131556_485_829 | 114 |
| 1169 | 3300053151 | Ga0500604_0167933 | Ga0500604_0167933_135_479 | 114 |
| 1170 | 3300053153 | Ga0500616_0015406 | Ga0500616_0015406_628_972 | 114 |
| 1171 | 3300053156 | Ga0500622_0001687 | Ga0500622_0001687_324_668 | 114 |
| 1172 | 3300053158 | Ga0500627_0078272 | Ga0500627_0078272_136_480 | 114 |
| 1173 | 3300053160 | Ga0500633_0150997 | Ga0500633_0150997_395_739 | 114 |
| 1174 | 3300053722 | Ga0500649_100608 | Ga0500649_100608_505_849 | 114 |
| 1175 | 3300053727 | Ga0500611_083046 | Ga0500611_083046_162_506 | 114 |
| 1176 | 3300053729 | Ga0500625_041142 | Ga0500625_041142_314_658 | 114 |
| 1177 | 3300053730 | Ga0500645_099808 | Ga0500645_099808_69_413 | 114 |
| 1178 | 3300053731 | Ga0500609_003821 | Ga0500609_003821_293_637 | 114 |
| 1179 | 3300053736 | Ga0500599_000090 | Ga0500599_000090_2795_3139 | 114 |
| 1180 | 3300053737 | Ga0500601_000297 | Ga0500601_000297_5594_5938 | 114 |
| 1181 | 3300055283 | Ga0500661_012063 | Ga0500661_012063_949_1293 | 114 |
| 1182 | iso_pu_bacteria | 2824653114 | 2824656974 | 114 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4exr-assembly1.cif.gz_A-2 | crystal structure of a putative lipoprotein (cd1622) from clostridium difficile 630 at 1.85 a resolution | 0.9181 | 81 | 110 |
| 7zb2-assembly4.cif.gz_DDD | apo macrocyclase ophp | 0.8921 | 70 | 108 |
| 7zaz-assembly1.cif.gz_AAA | macrocyclase ophp with zpp | 0.8908 | 70 | 108 |
| 7zb2-assembly1.cif.gz_AAA | apo macrocyclase ophp | 0.8885 | 70 | 108 |
| 7zb2-assembly5.cif.gz_EEE | apo macrocyclase ophp | 0.8881 | 70 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60282_78_297_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.898 | 72 | 110 | 2.130.10.10 |
| af_Q63132_1148_1443_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8915 | 62 | 109 | 2.120.10.30 |
| 4exrA02 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8884 | 68 | 110 | 3.10.450.40 |
| af_A0A1D6FQU9_38_279_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8866 | 70 | 111 | 2.130.10.10 |
| af_Q9N489_8_129_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8834 | 82 | 110 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A172TZZ0-F1-model_v4 | ABM domain-containing protein | 0.955 | 70 | 110 |
|
| AF-A0A414ATF8-F1-model_v4 | PepSY domain-containing protein | 0.9502 | 70 | 110 |
|
| AF-A0A7D3X3L1-F1-model_v4 | Uncharacterized protein | 0.9443 | 70 | 110 |
|
| AF-A0A085W8D4-F1-model_v4 | Uncharacterized protein | 0.9411 | 72 | 110 |
|
| AF-A0A1Q5P4W7-F1-model_v4 | PepSY domain-containing protein | 0.9397 | 70 | 109 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar