F491238

General Info

Members Datasets Scaffolds Average Seq Length
1175 491 1121 331

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10012256|Ga0081455_100122564
Length 386
Sequence VLYNERLGKRQPGARNGLGAPPEAIDNGTAGWLLLSRLLGEGPRKAQESVPMRVLVTGAAGFIGYHTAARLLERGHAVIGFDNLSPYYDVSLKEARLKRLTEQERFSFIKGDLADRAVVEATFAEERPDRVIHLAAQAGVRYSLDHPHAYISSNVTGFLHVLEGCRHHGVEHLVYASTSAVYGANQKLPFAVSDNVDHPVSLYGATKKANELMAHSYAHLFGIPVSGLRFFTVYGPWGRPDMSLFLFTRSILAGEPIKVFNYGQHSRDFTYIDDAVEGVLRTLDVVATPDPSWNPANPDPETSSAPYRLYNIGNHSPVALLDYVAAIEKALGQKAKIELLPQQPGDVVATYADVDALKEATGFQPATPLEEGIKRFVAWYRDYYRA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231010 Pseudomonas sp. GM25 Isolate Nodule
4 2511231012 Pseudomonas sp. GM33 Isolate Nodule
5 2511231014 Pseudomonas sp. GM48 Isolate Nodule
6 2511231015 Pseudomonas sp. GM49 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231017 Pseudomonas sp. GM55 Isolate Nodule
9 2511231018 Pseudomonas sp. GM60 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231021 Pseudomonas sp. GM78 Isolate Nodule
13 2511231022 Pseudomonas sp. GM79 Isolate Nodule
14 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
15 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
16 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
17 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
18 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
19 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
20 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
21 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
22 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
23 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
24 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
25 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
26 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
27 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
28 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
29 2773857670 Pseudomonas sp. 478 Isolate Unclassified
30 2784132072 Pseudomonas sp. 460 Isolate Unclassified
31 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
32 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
33 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
34 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
35 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
36 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
37 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
38 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
39 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
40 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
41 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
42 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
43 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
44 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
45 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
46 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
47 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
48 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
49 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
52 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
53 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
54 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
55 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
60 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
61 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
62 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
63 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
69 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
72 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
81 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
82 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
98 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
99 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
102 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
112 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
113 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
114 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
115 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
116 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
129 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
130 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
131 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
132 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
133 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
136 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
137 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
138 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
139 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
140 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
141 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
142 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
143 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
144 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
149 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
150 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
165 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
166 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
175 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
176 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
177 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
181 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
182 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
183 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
184 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
185 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
186 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
187 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
190 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
194 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
266 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
267 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
268 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
269 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
270 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
271 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
272 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
275 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
276 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
277 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
298 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
299 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
300 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
301 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
302 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
305 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
306 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
307 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
308 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
309 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
310 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
311 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
312 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
313 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
314 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
315 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
316 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
317 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
324 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
325 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
326 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
327 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
328 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
329 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
330 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
331 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
337 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
338 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
339 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
342 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
346 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
347 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
348 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
349 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
359 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
360 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
396 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
397 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
412 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
415 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
416 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
430 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
447 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
458 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
479 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
480 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
481 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
486 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
487 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
488 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
489 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
490 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
491 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0.09
Isolates 4.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 1.45
Rhizoplane 3.83
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_240 2124908027 Bacteria 22649
2 JGI24743J22301_10001386 3300001991 Bacteria 3337
3 JGI24738J21930_10007302 3300002075 Bacteria 2557
4 JGI25156J39149_1010418 3300002705 Bacteria 2187
5 JGI25162J39368_1000345 3300002737 Bacteria 40115
6 JGI25157J39369_1000317 3300002741 Bacteria 34756
7 JGI25163J39215_1000267 3300002771 Bacteria 18439
8 JGI25164J39214_1000187 3300002772 Bacteria 54560
9 JGI25151J46595_10000090 3300003187 Bacteria 123141
10 JGI25151J46595_10000168 3300003187 Bacteria 85167
11 JGI25165J46597_1000338 3300003214 Bacteria 54560
12 rootH2_10013714 3300003320 Bacteria 2600
13 Ga0006562J51391_1027629 3300003578 Bacteria 2372
14 Ga0055538_1001452 3300003751 Bacteria 4542
15 Ga0055535_1000417 3300003761 Bacteria 40115
16 Ga0055542_1000435 3300003762 Bacteria 40115
17 Ga0055529_1000110 3300003763 Bacteria 120255
18 Ga0055530_10001311 3300003791 Bacteria 18707
19 Ga0055540_1000006 3300003792 Bacteria 372018
20 Ga0055531_10000075 3300003794 Bacteria 107839
21 Ga0065714_10000217 3300005288 Bacteria 11234
22 Ga0065714_10002341 3300005288 Bacteria 31600
23 Ga0065714_10005790 3300005288 Bacteria 8444
24 Ga0065714_10007718 3300005288 Bacteria 3038
25 Ga0065714_10013859 3300005288 Bacteria 1865
26 Ga0065714_10028341 3300005288 Bacteria 1863
27 Ga0065714_10032459 3300005288 Bacteria 1796
28 Ga0065714_10065710 3300005288 Bacteria 8765
29 Ga0065714_10089418 3300005288 Bacteria 1980
30 Ga0065712_10004708 3300005290 Bacteria 3736
31 Ga0065715_10003156 3300005293 Bacteria 6646
32 Ga0070658_10338498 3300005327 Bacteria 1287
33 Ga0070676_10000327 3300005328 Bacteria 21588
34 Ga0070683_100013389 3300005329 Bacteria 7153
35 Ga0070690_100000389 3300005330 Bacteria 22358
36 Ga0070670_100004526 3300005331 Bacteria 11650
37 Ga0068869_100006435 3300005334 Bacteria 7450
38 Ga0068869_100030812 3300005334 Bacteria 3769
39 Ga0068869_100211294 3300005334 Bacteria 1534
40 Ga0070666_10001559 3300005335 Bacteria 13905
41 Ga0070680_100002843 3300005336 Bacteria 12870
42 Ga0070682_100001357 3300005337 Bacteria 13814
43 Ga0068868_100000816 3300005338 Bacteria 21142
44 Ga0070689_100000375 3300005340 Bacteria 26301
45 Ga0070691_10003065 3300005341 Bacteria 7485
46 Ga0070691_10021676 3300005341 Bacteria 2974
47 Ga0070687_100153394 3300005343 Bacteria 1354
48 Ga0070661_100000807 3300005344 Bacteria 22516
49 Ga0070661_100172691 3300005344 Bacteria 1642
50 Ga0070692_10014899 3300005345 Bacteria 3664
51 Ga0070668_100002040 3300005347 Bacteria 14776
52 Ga0070668_100059780 3300005347 Bacteria 2950
53 Ga0070668_100373350 3300005347 Bacteria 1212
54 Ga0070669_100001534 3300005353 Bacteria 16689
55 Ga0070669_100028425 3300005353 Bacteria 4027
56 Ga0070675_100001502 3300005354 Bacteria 17224
57 Ga0070675_100002753 3300005354 Bacteria 13213
58 Ga0070671_100000406 3300005355 Bacteria 29740
59 Ga0070674_100003779 3300005356 Bacteria 8552
60 Ga0070673_100000480 3300005364 Bacteria 21257
61 Ga0070688_100001668 3300005365 Bacteria 11110
62 Ga0070688_100110694 3300005365 Bacteria 1826
63 Ga0070659_100004405 3300005366 Bacteria 10059
64 Ga0070667_100001184 3300005367 Bacteria 23726
65 Ga0070703_10010576 3300005406 Bacteria 2603
66 Ga0070709_10001752 3300005434 Bacteria 11800
67 Ga0070714_100069438 3300005435 Bacteria 3043
68 Ga0070713_100001031 3300005436 Bacteria 17809
69 Ga0070710_10000732 3300005437 Bacteria 15631
70 Ga0070701_10002551 3300005438 Bacteria 7048
71 Ga0070701_10151450 3300005438 Bacteria 1336
72 Ga0070711_100000095 3300005439 Bacteria 47489
73 Ga0070700_100003085 3300005441 Bacteria 8546
74 Ga0070700_100095217 3300005441 Bacteria 1951
75 Ga0070694_100001906 3300005444 Bacteria 12345
76 Ga0070694_100337870 3300005444 Bacteria 1163
77 Ga0070663_100001429 3300005455 Bacteria 13074
78 Ga0070678_100001684 3300005456 Bacteria 11858
79 Ga0070662_100001283 3300005457 Bacteria 15448
80 Ga0070681_10015543 3300005458 Bacteria 7580
81 Ga0070681_10021843 3300005458 Bacteria 6419
82 Ga0070681_10217786 3300005458 Bacteria 1825
83 Ga0068867_100042414 3300005459 Bacteria 3328
84 Ga0070698_100249091 3300005471 Bacteria 1709
85 Ga0070699_100204166 3300005518 Bacteria 1758
86 Ga0070699_100274329 3300005518 Bacteria 1510
87 Ga0070679_100269611 3300005530 Bacteria 1656
88 Ga0070684_100007419 3300005535 Bacteria 8522
89 Ga0070697_100000955 3300005536 Bacteria 21790
90 Ga0068853_100000714 3300005539 Bacteria 22983
91 Ga0068853_100308666 3300005539 Bacteria 1464
92 Ga0070672_100035688 3300005543 Bacteria 3780
93 Ga0070672_100054576 3300005543 Bacteria 3129
94 Ga0070686_100008934 3300005544 Bacteria 5616
95 Ga0070695_100000122 3300005545 Bacteria 34844
96 Ga0070695_100007567 3300005545 Bacteria 6435
97 Ga0070696_100000993 3300005546 Bacteria 18392
98 Ga0070665_100005234 3300005548 Bacteria 13420
99 Ga0070665_100119645 3300005548 Bacteria 2635
100 Ga0070665_100204312 3300005548 Bacteria 1976
101 Ga0070704_100000417 3300005549 Bacteria 19773
102 Ga0070704_100010793 3300005549 Bacteria 5570
103 Ga0068855_100001459 3300005563 Bacteria 29520
104 Ga0070664_100002837 3300005564 Bacteria 14017
105 Ga0068857_100004107 3300005577 Bacteria 12269
106 Ga0068854_100000660 3300005578 Bacteria 20555
107 Ga0068854_100175668 3300005578 Bacteria 1669
108 Ga0068856_100065201 3300005614 Bacteria 3599
109 Ga0070702_100000010 3300005615 Bacteria 60028
110 Ga0070702_100057928 3300005615 Bacteria 2242
111 Ga0070702_100175762 3300005615 Bacteria 1397
112 Ga0068852_100213226 3300005616 Bacteria 1833
113 Ga0068859_100003130 3300005617 Bacteria 16813
114 Ga0068859_100168273 3300005617 Bacteria 2272
115 Ga0068864_100022833 3300005618 Bacteria 5247
116 Ga0068866_10002702 3300005718 Bacteria 7322
117 Ga0068866_10160783 3300005718 Bacteria 1309
118 Ga0068861_100396562 3300005719 Bacteria 1223
119 Ga0068863_100006477 3300005841 Bacteria 11480
120 Ga0068858_100144860 3300005842 Bacteria 2231
121 Ga0068860_100000961 3300005843 Bacteria 31889
122 Ga0068860_100162785 3300005843 Bacteria 2152
123 Ga0068862_100004110 3300005844 Bacteria 12337
124 Ga0068862_100008421 3300005844 Bacteria 8535
125 Ga0068862_100026667 3300005844 Bacteria 4858
126 Ga0081455_10011835 3300005937 Bacteria 8734
127 Ga0081455_10012256 3300005937 Bacteria 8558
128 Ga0081455_10012725 3300005937 Bacteria 8372
129 Ga0081540_1000343 3300005983 Bacteria 47660
130 Ga0081539_10001147 3300005985 Bacteria 47975
131 Ga0075365_10168820 3300006038 Bacteria 1527
132 Ga0075432_10000121 3300006058 Bacteria 17497
133 Ga0075432_10001542 3300006058 Bacteria 7560
134 Ga0075432_10013480 3300006058 Bacteria 2777
135 Ga0075432_10046801 3300006058 Bacteria 1519
136 Ga0070715_10000194 3300006163 Bacteria 14221
137 Ga0070716_100039387 3300006173 Bacteria 2623
138 Ga0070712_100002679 3300006175 Bacteria 10989
139 Ga0070712_100099553 3300006175 Bacteria 2146
140 Ga0075362_10005204 3300006177 Bacteria 4742
141 Ga0075369_10008171 3300006186 Bacteria 4017
142 Ga0097621_100049901 3300006237 Bacteria 3402
143 Ga0097621_100127468 3300006237 Bacteria 2163
144 Ga0075370_10022187 3300006353 Bacteria 3484
145 Ga0068871_100007258 3300006358 Bacteria 7905
146 Ga0068871_100046243 3300006358 Bacteria 3505
147 Ga0075428_100008638 3300006844 Bacteria 11296
148 Ga0075431_100071595 3300006847 Bacteria 3577
149 Ga0075431_100094192 3300006847 Bacteria 3091
150 Ga0075433_10037746 3300006852 Bacteria 4169
151 Ga0068865_100000479 3300006881 Bacteria 22339
152 Ga0068865_100011741 3300006881 Bacteria 5487
153 Ga0068865_100100478 3300006881 Bacteria 2117
154 Ga0075436_100001650 3300006914 Bacteria 15248
155 Ga0097620_100003130 3300006931 Bacteria 16813
156 Ga0097620_100168269 3300006931 Bacteria 2272
157 Ga0079104_1000426 3300006946 Bacteria 48184
158 Ga0079104_1001612 3300006946 Bacteria 14701
159 Ga0075435_100110025 3300007076 Bacteria 2291
160 Ga0105251_10005118 3300009011 Bacteria 8679
161 Ga0105244_10002982 3300009036 Bacteria 12459
162 Ga0105244_10046797 3300009036 Bacteria 2221
163 Ga0105244_10052420 3300009036 Bacteria 2077
164 Ga0105244_10054541 3300009036 Bacteria 2027
165 Ga0105250_10006501 3300009092 Bacteria 5106
166 Ga0105250_10006990 3300009092 Bacteria 4877
167 Ga0105250_10008590 3300009092 Bacteria 4330
168 Ga0105250_10020227 3300009092 Bacteria 2691
169 Ga0105250_10061091 3300009092 Bacteria 1515
170 Ga0105240_10006881 3300009093 Bacteria 16617
171 Ga0105240_10019958 3300009093 Bacteria 8949
172 Ga0111539_10136940 3300009094 Bacteria 2867
173 Ga0111539_10137378 3300009094 Bacteria 2862
174 Ga0111539_10409874 3300009094 Bacteria 1578
175 Ga0105245_10018071 3300009098 Bacteria 6161
176 Ga0105245_10475574 3300009098 Bacteria 1262
177 Ga0105247_10001227 3300009101 Bacteria 19035
178 Ga0105247_10033489 3300009101 Bacteria 3125
179 Ga0105247_10052939 3300009101 Bacteria 2503
180 Ga0114129_10007650 3300009147 Bacteria 15381
181 Ga0114129_10026262 3300009147 Bacteria 8248
182 Ga0114129_10029155 3300009147 Bacteria 7818
183 Ga0114129_10045234 3300009147 Bacteria 6188
184 Ga0114129_10203420 3300009147 Bacteria 2680
185 Ga0114129_10248653 3300009147 Bacteria 2388
186 Ga0105243_10000233 3300009148 Bacteria 64046
187 Ga0105243_10271465 3300009148 Bacteria 1523
188 Ga0105241_10004813 3300009174 Bacteria 9946
189 Ga0105241_10445593 3300009174 Bacteria 1144
190 Ga0105242_10000625 3300009176 Bacteria 27767
191 Ga0105242_10112177 3300009176 Bacteria 2326
192 Ga0105248_10005964 3300009177 Bacteria 13384
193 Ga0105248_10048062 3300009177 Bacteria 4786
194 Ga0105248_10085514 3300009177 Bacteria 3549
195 Ga0105237_10006537 3300009545 Bacteria 12896
196 Ga0105238_10023129 3300009551 Bacteria 6338
197 Ga0105249_10021566 3300009553 Bacteria 5768
198 Ga0105249_10235053 3300009553 Bacteria 1809
199 Ga0105249_10527786 3300009553 Bacteria 1229
200 Ga0105239_10000033 3300010375 Bacteria 223933
201 Ga0105239_10040808 3300010375 Bacteria 5085
202 Ga0105239_10130345 3300010375 Bacteria 2796
203 Ga0105246_10000058 3300011119 Bacteria 44703
204 Ga0105246_10033505 3300011119 Bacteria 3416
205 Ga0105246_10042754 3300011119 Bacteria 3070
206 Ga0157373_10002561 3300013100 Bacteria 13817
207 Ga0157373_10006435 3300013100 Bacteria 8774
208 Ga0157373_10243016 3300013100 Bacteria 1273
209 Ga0157371_10002421 3300013102 Bacteria 17840
210 Ga0157371_10009277 3300013102 Bacteria 7760
211 Ga0157371_10172191 3300013102 Bacteria 1547
212 Ga0157370_10004153 3300013104 Bacteria 16762
213 Ga0157370_10004666 3300013104 Bacteria 15646
214 Ga0157370_10014316 3300013104 Bacteria 8117
215 Ga0157370_10057498 3300013104 Bacteria 3698
216 Ga0157370_10074868 3300013104 Bacteria 3193
217 Ga0157370_10078142 3300013104 Bacteria 3116
218 Ga0157370_10118740 3300013104 Bacteria 2470
219 Ga0157370_10162596 3300013104 Bacteria 2077
220 Ga0157369_10007040 3300013105 Bacteria 12967
221 Ga0157369_10013364 3300013105 Bacteria 9288
222 Ga0157378_10024775 3300013297 Bacteria 5283
223 Ga0163162_10012818 3300013306 Bacteria 8189
224 Ga0163162_10043764 3300013306 Bacteria 4483
225 Ga0163162_10123219 3300013306 Bacteria 2697
226 Ga0163162_10128911 3300013306 Bacteria 2638
227 Ga0163162_10201771 3300013306 Bacteria 2118
228 Ga0163162_10275575 3300013306 Bacteria 1814
229 Ga0157375_10000904 3300013308 Bacteria 25826
230 Ga0157375_10002641 3300013308 Bacteria 15519
231 Ga0157375_10006942 3300013308 Bacteria 9884
232 Ga0157375_10159839 3300013308 Bacteria 2394
233 Ga0157380_10001119 3300014326 Bacteria 17292
234 Ga0157380_10129955 3300014326 Bacteria 2147
235 Ga0157380_10176449 3300014326 Bacteria 1873
236 Ga0182008_10002677 3300014497 Bacteria 11060
237 Ga0182008_10004190 3300014497 Bacteria 8479
238 Ga0182008_10006903 3300014497 Bacteria 6307
239 Ga0182008_10013085 3300014497 Bacteria 4365
240 Ga0182008_10015667 3300014497 Bacteria 3952
241 Ga0182008_10134174 3300014497 Bacteria 1236
242 Ga0182008_10190314 3300014497 Bacteria 1041
243 Ga0157377_10002624 3300014745 Bacteria 7977
244 Ga0157377_10030559 3300014745 Bacteria 2919
245 Ga0157379_10001136 3300014968 Bacteria 21783
246 Ga0157376_10000941 3300014969 Bacteria 18932
247 Ga0157376_10014199 3300014969 Bacteria 5969
248 Ga0157376_10051877 3300014969 Bacteria 3408
249 Ga0182006_1000083 3300015261 Bacteria 118727
250 Ga0182006_1000634 3300015261 Bacteria 24973
251 Ga0182006_1002021 3300015261 Bacteria 11395
252 Ga0182006_1018107 3300015261 Bacteria 2981
253 Ga0182006_1022438 3300015261 Bacteria 2624
254 Ga0182007_10000086 3300015262 Bacteria 69920
255 Ga0182007_10035409 3300015262 Bacteria 1682
256 Ga0182005_1000675 3300015265 Bacteria 16002
257 Ga0182005_1003472 3300015265 Bacteria 5331
258 Ga0182005_1005936 3300015265 Bacteria 3779
259 Ga0182005_1009503 3300015265 Bacteria 2829
260 Ga0182005_1009968 3300015265 Bacteria 2744
261 Ga0182005_1022603 3300015265 Bacteria 1722
262 Ga0163161_10002612 3300017792 Bacteria 12822
263 Ga0163161_10004580 3300017792 Bacteria 9625
264 Ga0163161_10011584 3300017792 Bacteria 6121
265 Ga0163161_10021506 3300017792 Bacteria 4533
266 Ga0163161_10134852 3300017792 Bacteria 1865
267 Ga0213874_10002783 3300021377 Bacteria 3806
268 Ga0209760_100405 3300025207 Bacteria 10640
269 Ga0209784_100026 3300025224 Bacteria 371540
270 Ga0207427_100023 3300025231 Bacteria 439725
271 Ga0209437_100015 3300025233 Bacteria 713457
272 Ga0209258_100043 3300025242 Bacteria 380685
273 Ga0209026_1000047 3300025250 Bacteria 261867
274 Ga0209148_1000010 3300025254 Bacteria 1265567
275 Ga0209759_1000715 3300025256 Bacteria 29291
276 Ga0209233_1000009 3300025261 Bacteria 1265567
277 Ga0209455_1000020 3300025272 Bacteria 702259
278 Ga0209675_1002396 3300025291 Bacteria 9670
279 Ga0209676_1000002 3300025292 Bacteria 1732948
280 Ga0209676_1003788 3300025292 Bacteria 8956
281 Ga0209025_1000010 3300025294 Bacteria 986612
282 Ga0209050_1000006 3300025298 Bacteria 1359702
283 Ga0209050_1005631 3300025298 Bacteria 7768
284 Ga0209051_1000001 3300025303 Bacteria 1732974
285 Ga0209051_1012244 3300025303 Bacteria 4160
286 Ga0209257_1000029 3300025304 Bacteria 695617
287 Ga0207696_1000405 3300025711 Bacteria 40190
288 Ga0207696_1003824 3300025711 Bacteria 6695
289 Ga0207655_1000481 3300025728 Bacteria 51474
290 Ga0207655_1002986 3300025728 Bacteria 12972
291 Ga0207655_1004462 3300025728 Bacteria 9922
292 Ga0207655_1016216 3300025728 Bacteria 4089
293 Ga0207713_1000893 3300025735 Bacteria 27043
294 Ga0207713_1002558 3300025735 Bacteria 13140
295 Ga0207713_1011856 3300025735 Bacteria 4703
296 Ga0207692_10034656 3300025898 Bacteria 2445
297 Ga0207642_10131051 3300025899 Bacteria 1309
298 Ga0207710_10008378 3300025900 Bacteria 4361
299 Ga0207710_10013949 3300025900 Bacteria 3384
300 Ga0207688_10001350 3300025901 Bacteria 12748
301 Ga0207680_10002690 3300025903 Bacteria 8305
302 Ga0207647_10001011 3300025904 Bacteria 21846
303 Ga0207685_10005233 3300025905 Bacteria 3402
304 Ga0207645_10002031 3300025907 Bacteria 16251
305 Ga0207705_10225365 3300025909 Bacteria 1425
306 Ga0207654_10013888 3300025911 Bacteria 4150
307 Ga0207707_10023111 3300025912 Bacteria 5441
308 Ga0207707_10282464 3300025912 Bacteria 1438
309 Ga0207695_10005620 3300025913 Bacteria 16569
310 Ga0207693_10000062 3300025915 Bacteria 92689
311 Ga0207663_10001357 3300025916 Bacteria 11339
312 Ga0207660_10006479 3300025917 Bacteria 7592
313 Ga0207662_10242107 3300025918 Bacteria 1181
314 Ga0207657_10000023 3300025919 Bacteria 152701
315 Ga0207649_10002977 3300025920 Bacteria 9330
316 Ga0207649_10288529 3300025920 Bacteria 1196
317 Ga0207681_10004374 3300025923 Bacteria 8708
318 Ga0207681_10092779 3300025923 Bacteria 2159
319 Ga0207650_10003802 3300025925 Bacteria 10322
320 Ga0207659_10010335 3300025926 Bacteria 5862
321 Ga0207687_10003089 3300025927 Bacteria 11289
322 Ga0207664_10071628 3300025929 Bacteria 2793
323 Ga0207690_10000718 3300025932 Bacteria 21331
324 Ga0207706_10000019 3300025933 Bacteria 167592
325 Ga0207706_10125161 3300025933 Bacteria 2261
326 Ga0207709_10002908 3300025935 Bacteria 10453
327 Ga0207709_10183391 3300025935 Bacteria 1480
328 Ga0207709_10382458 3300025935 Bacteria 1071
329 Ga0207670_10007526 3300025936 Bacteria 6082
330 Ga0207670_10355450 3300025936 Bacteria 1161
331 Ga0207669_10008631 3300025937 Bacteria 4796
332 Ga0207669_10307788 3300025937 Bacteria 1207
333 Ga0207704_10060146 3300025938 Bacteria 2349
334 Ga0207665_10000161 3300025939 Bacteria 45172
335 Ga0207691_10002469 3300025940 Bacteria 18087
336 Ga0207689_10006185 3300025942 Bacteria 10599
337 Ga0207689_10390617 3300025942 Bacteria 1159
338 Ga0207661_10006687 3300025944 Bacteria 8157
339 Ga0207667_10048216 3300025949 Bacteria 4505
340 Ga0207651_10011625 3300025960 Bacteria 4935
341 Ga0207651_10317025 3300025960 Bacteria 1302
342 Ga0207712_10007216 3300025961 Bacteria 7011
343 Ga0207668_10002748 3300025972 Bacteria 10281
344 Ga0207668_10105038 3300025972 Bacteria 2107
345 Ga0207640_10144135 3300025981 Bacteria 1741
346 Ga0207658_10069788 3300025986 Bacteria 2656
347 Ga0207658_10353570 3300025986 Bacteria 1280
348 Ga0207677_10023036 3300026023 Bacteria 3838
349 Ga0207703_10027778 3300026035 Bacteria 4456
350 Ga0207639_10002698 3300026041 Bacteria 11913
351 Ga0207639_10252117 3300026041 Bacteria 1539
352 Ga0207678_10000017 3300026067 Bacteria 135871
353 Ga0207678_10097106 3300026067 Bacteria 2518
354 Ga0207678_10128460 3300026067 Bacteria 2162
355 Ga0207708_10000315 3300026075 Bacteria 38170
356 Ga0207708_10024104 3300026075 Bacteria 4601
357 Ga0207708_10054070 3300026075 Bacteria 3060
358 Ga0207702_10273898 3300026078 Bacteria 1593
359 Ga0207641_10025704 3300026088 Bacteria 4854
360 Ga0207648_10014325 3300026089 Bacteria 7329
361 Ga0207648_10342553 3300026089 Bacteria 1346
362 Ga0207648_10450826 3300026089 Bacteria 1171
363 Ga0207676_10024347 3300026095 Bacteria 4478
364 Ga0207675_100000439 3300026118 Bacteria 40472
365 Ga0207675_100524412 3300026118 Bacteria 1181
366 Ga0207683_10000030 3300026121 Bacteria 109087
367 Ga0207698_10104671 3300026142 Bacteria 2355
368 Ga0209281_1000534 3300027111 Bacteria 48198
369 Ga0209281_1010564 3300027111 Bacteria 2107
370 Ga0207428_10013069 3300027907 Bacteria 7270
371 Ga0207428_10063830 3300027907 Bacteria 2909
372 Ga0207428_10212828 3300027907 Bacteria 1452
373 Ga0268266_10367654 3300028379 Bacteria 1354
374 Ga0268265_10048382 3300028380 Bacteria 3192
375 Ga0268265_10168506 3300028380 Bacteria 1869
376 Ga0268265_10265606 3300028380 Bacteria 1528
377 Ga0268264_10007754 3300028381 Bacteria 8937
378 Ga0268264_10063714 3300028381 Bacteria 3100
379 Ga0268264_10518161 3300028381 Bacteria 1165
380 Ga0265337_1009926 3300028556 Bacteria 3364
381 Ga0265337_1014581 3300028556 Bacteria 2602
382 Ga0265319_1001000 3300028563 Bacteria 17721
383 Ga0265319_1018833 3300028563 Bacteria 2591
384 Ga0265323_10000409 3300028653 Bacteria 24593
385 Ga0265336_10000099 3300028666 Bacteria 66151
386 Ga0265338_10000207 3300028800 Bacteria 110193
387 Ga0265338_10085517 3300028800 Bacteria 2628
388 Ga0265324_10017130 3300029957 Bacteria 2636
389 Ga0265330_10040844 3300031235 Bacteria 2059
390 Ga0265320_10005248 3300031240 Bacteria 8349
391 Ga0265325_10033605 3300031241 Bacteria 2734
392 Ga0265331_10062684 3300031250 Bacteria 1753
393 Ga0265327_10007921 3300031251 Bacteria 8047
394 Ga0265313_10000291 3300031595 Bacteria 54688
395 Ga0265314_10011272 3300031711 Bacteria 7394
396 Ga0307412_10032254 3300031911 Bacteria 3317
397 Ga0373940_0065170 3300035088 Bacteria 1050
398 Ga0373939_0017207 3300035114 Bacteria 1918
399 Ga0373943_0088480 3300035170 Bacteria 1600
400 Ga0373955_0129711 3300035172 Bacteria 1471
401 Ga0373962_0003078 3300035242 Bacteria 3996
402 Ga0373931_0000691 3300035691 Bacteria 13957
403 Ga0373931_0147111 3300035691 Bacteria 1370
404 Ga0373935_0082940 3300035692 Bacteria 2086
405 Ga0373927_0001084 3300035695 Bacteria 20711
406 Ga0373947_0001088 3300035725 Bacteria 16660
407 Ga0373937_0115504 3300036401 Bacteria 2499
408 Ga0373937_0216024 3300036401 Bacteria 1805
409 Ga0373925_0009820 3300037068 Bacteria 6950
410 Ga0395900_0021026 3300037418 Bacteria 6669
411 Ga0395898_0053977 3300037466 Bacteria 3923
412 Ga0395898_0129439 3300037466 Bacteria 2418
413 Ga0395905_0001187 3300037471 Bacteria 32583
414 Ga0395905_0073920 3300037471 Bacteria 3195
415 Ga0436364_1293474 3300037853 Bacteria 4076
416 Ga0436364_1408706 3300037853 Bacteria 2344
417 Ga0395901_0001359 3300038443 Bacteria 25608
418 Ga0400483_108990 3300039062 Bacteria 4667
419 Ga0436365_0384831 3300039437 Bacteria 21866
420 Ga0436365_1633568 3300039437 Bacteria 6619
421 Ga0436363_0075424 3300039450 Bacteria 36209
422 Ga0436363_1071452 3300039450 Bacteria 10612
423 Ga0436362_0348730 3300039453 Bacteria 10345
424 Ga0439436_0017063 3300041404 Bacteria 2173
425 Ga0439438_000048 3300041405 Bacteria 58674
426 Ga0439438_000153 3300041405 Bacteria 31443
427 Ga0439438_006718 3300041405 Bacteria 4015
428 Ga0439438_008693 3300041405 Bacteria 3343
429 Ga0439447_000014 3300041407 Bacteria 72178
430 Ga0439447_000414 3300041407 Bacteria 15820
431 Ga0439447_010099 3300041407 Bacteria 2818
432 Ga0439466_0000659 3300041411 Bacteria 12989
433 Ga0439466_0002820 3300041411 Bacteria 6802
434 Ga0439466_0013376 3300041411 Bacteria 3005
435 Ga0439466_0022364 3300041411 Bacteria 2232
436 Ga0451853_0192445 3300041512 Bacteria 1073
437 Ga0439445_0014397 3300042004 Bacteria 1925
438 Ga0439449_0036597 3300042007 Bacteria 1826
439 Ga0439451_010941 3300042009 Bacteria 1829
440 Ga0439451_012870 3300042009 Bacteria 1690
441 Ga0439452_000137 3300042010 Bacteria 55736
442 Ga0439452_012445 3300042010 Bacteria 2420
443 Ga0439452_018141 3300042010 Bacteria 1879
444 Ga0439456_006194 3300042013 Bacteria 2438
445 Ga0439456_006458 3300042013 Bacteria 2396
446 Ga0439463_017211 3300042016 Bacteria 1791
447 Ga0450911_002279 3300042115 Bacteria 3850
448 Ga0450911_009615 3300042115 Bacteria 1352
449 Ga0450902_004943 3300042137 Bacteria 2000
450 Ga0450902_007410 3300042137 Bacteria 1698
451 Ga0450903_000548 3300042138 Bacteria 7789
452 Ga0450903_002041 3300042138 Bacteria 3634
453 Ga0450903_009088 3300042138 Bacteria 1622
454 Ga0450904_004910 3300042139 Bacteria 1373
455 Ga0450905_003625 3300042142 Bacteria 2031
456 Ga0450906_013666 3300042145 Bacteria 1494
457 Ga0450907_001628 3300042146 Bacteria 4705
458 Ga0450910_000637 3300042147 Bacteria 4170
459 Ga0439460_0002902 3300042461 Bacteria 4131
460 Ga0439460_0030465 3300042461 Bacteria 1534
461 Ga0453684_0080701 3300044712 Bacteria 4061
462 Ga0495617_000106 3300046452 Bacteria 61107
463 Ga0495617_000201 3300046452 Bacteria 37750
464 Ga0495617_003527 3300046452 Bacteria 5857
465 Ga0495617_004861 3300046452 Bacteria 4836
466 Ga0495617_006482 3300046452 Bacteria 4099
467 Ga0495617_013983 3300046452 Bacteria 2728
468 Ga0495617_025287 3300046452 Bacteria 2002
469 Ga0495617_028601 3300046452 Bacteria 1873
470 Ga0495617_035448 3300046452 Bacteria 1675
471 Ga0495627_002130 3300046453 Bacteria 9974
472 Ga0495627_011247 3300046453 Bacteria 3217
473 Ga0495627_041568 3300046453 Bacteria 1411
474 Ga0495603_0000238 3300046455 Bacteria 28693
475 Ga0495603_0003168 3300046455 Bacteria 9778
476 Ga0495603_0026485 3300046455 Bacteria 3503
477 Ga0495603_0042054 3300046455 Bacteria 2732
478 Ga0495603_0073397 3300046455 Bacteria 2010
479 Ga0495603_0179507 3300046455 Bacteria 1225
480 Ga0495590_0000226 3300046457 Bacteria 30856
481 Ga0495590_0001776 3300046457 Bacteria 9162
482 Ga0495590_0002415 3300046457 Bacteria 7733
483 Ga0495590_0002968 3300046457 Bacteria 6966
484 Ga0495590_0008979 3300046457 Bacteria 3798
485 Ga0495590_0024121 3300046457 Bacteria 2144
486 Ga0495591_000138 3300046458 Bacteria 78836
487 Ga0495591_000139 3300046458 Bacteria 78636
488 Ga0495591_003357 3300046458 Bacteria 8317
489 Ga0495591_004318 3300046458 Bacteria 7006
490 Ga0495591_005080 3300046458 Bacteria 6178
491 Ga0495591_006752 3300046458 Bacteria 5000
492 Ga0495591_008966 3300046458 Bacteria 4033
493 Ga0495591_018119 3300046458 Bacteria 2395
494 Ga0495591_021457 3300046458 Bacteria 2106
495 Ga0495591_043537 3300046458 Bacteria 1262
496 Ga0495629_0000781 3300046459 Bacteria 25685
497 Ga0495629_0009940 3300046459 Bacteria 6943
498 Ga0495629_0286209 3300046459 Bacteria 1130
499 Ga0495638_0000117 3300046460 Bacteria 127788
500 Ga0495638_0001251 3300046460 Bacteria 23897
501 Ga0495638_0002925 3300046460 Bacteria 13642
502 Ga0495638_0003030 3300046460 Bacteria 13383
503 Ga0495638_0006658 3300046460 Bacteria 8384
504 Ga0495638_0008506 3300046460 Bacteria 7271
505 Ga0495638_0015837 3300046460 Bacteria 5052
506 Ga0495638_0021001 3300046460 Bacteria 4309
507 Ga0495638_0022381 3300046460 Bacteria 4149
508 Ga0495638_0024211 3300046460 Bacteria 3961
509 Ga0495638_0038404 3300046460 Bacteria 3042
510 Ga0495638_0078104 3300046460 Bacteria 2014
511 Ga0495653_0001441 3300046463 Bacteria 18559
512 Ga0495653_0007024 3300046463 Bacteria 9241
513 Ga0495653_0016699 3300046463 Bacteria 5974
514 Ga0495653_0073281 3300046463 Bacteria 2555
515 Ga0495650_0001886 3300046471 Bacteria 18639
516 Ga0495650_0002593 3300046471 Bacteria 14217
517 Ga0495650_0003727 3300046471 Bacteria 10899
518 Ga0495650_0007809 3300046471 Bacteria 6362
519 Ga0495650_0008937 3300046471 Bacteria 5768
520 Ga0495650_0020294 3300046471 Bacteria 3243
521 Ga0495650_0038164 3300046471 Bacteria 2083
522 Ga0495650_0095781 3300046471 Bacteria 1121
523 Ga0495580_0000522 3300046472 Bacteria 32417
524 Ga0495582_0000670 3300046473 Bacteria 18834
525 Ga0495582_0009450 3300046473 Bacteria 5370
526 Ga0495605_0000114 3300046474 Bacteria 103834
527 Ga0495605_0000557 3300046474 Bacteria 30487
528 Ga0495605_0002643 3300046474 Bacteria 10978
529 Ga0495605_0005058 3300046474 Bacteria 7696
530 Ga0495605_0007050 3300046474 Bacteria 6407
531 Ga0495605_0007746 3300046474 Bacteria 6086
532 Ga0495605_0008069 3300046474 Bacteria 5959
533 Ga0495605_0010101 3300046474 Bacteria 5288
534 Ga0495605_0015923 3300046474 Bacteria 4080
535 Ga0495605_0034356 3300046474 Bacteria 2567
536 Ga0495605_0037372 3300046474 Bacteria 2443
537 Ga0495605_0040574 3300046474 Bacteria 2322
538 Ga0495639_0000001 3300046475 Bacteria 204442
539 Ga0495639_0006700 3300046475 Bacteria 4957
540 Ga0495639_0013989 3300046475 Bacteria 3472
541 Ga0495639_0015494 3300046475 Bacteria 3306
542 Ga0495639_0026285 3300046475 Bacteria 2572
543 Ga0495639_0031314 3300046475 Bacteria 2367
544 Ga0495584_0000140 3300046491 Bacteria 50112
545 Ga0495584_0000469 3300046491 Bacteria 27780
546 Ga0495584_0001357 3300046491 Bacteria 14807
547 Ga0495584_0010763 3300046491 Bacteria 4697
548 Ga0495584_0017629 3300046491 Bacteria 3633
549 Ga0495584_0019149 3300046491 Bacteria 3476
550 Ga0495584_0020466 3300046491 Bacteria 3361
551 Ga0495584_0028990 3300046491 Bacteria 2805
552 Ga0495584_0040341 3300046491 Bacteria 2357
553 Ga0495585_0000605 3300046492 Bacteria 33591
554 Ga0495585_0003016 3300046492 Bacteria 11604
555 Ga0495585_0003480 3300046492 Bacteria 10628
556 Ga0495585_0006756 3300046492 Bacteria 7079
557 Ga0495585_0009789 3300046492 Bacteria 5734
558 Ga0495585_0016584 3300046492 Bacteria 4268
559 Ga0495585_0018499 3300046492 Bacteria 4018
560 Ga0495585_0026259 3300046492 Bacteria 3327
561 Ga0495585_0060336 3300046492 Bacteria 2087
562 Ga0495594_0000025 3300046499 Bacteria 69403
563 Ga0495594_0001211 3300046499 Bacteria 13483
564 Ga0495594_0013051 3300046499 Bacteria 4332
565 Ga0495594_0015740 3300046499 Bacteria 3977
566 Ga0495596_0000049 3300046500 Bacteria 87906
567 Ga0495596_0025824 3300046500 Bacteria 2372
568 Ga0495607_0000188 3300046501 Bacteria 66018
569 Ga0495607_0000709 3300046501 Bacteria 32137
570 Ga0495607_0001305 3300046501 Bacteria 22209
571 Ga0495607_0003254 3300046501 Bacteria 12507
572 Ga0495607_0013223 3300046501 Bacteria 5419
573 Ga0495607_0020829 3300046501 Bacteria 4136
574 Ga0495607_0036444 3300046501 Bacteria 2963
575 Ga0495607_0041815 3300046501 Bacteria 2720
576 Ga0495607_0085422 3300046501 Bacteria 1723
577 Ga0495607_0085595 3300046501 Bacteria 1721
578 Ga0495607_0183724 3300046501 Bacteria 1046
579 Ga0495583_0003084 3300046506 Bacteria 13195
580 Ga0495583_0004168 3300046506 Bacteria 10536
581 Ga0495583_0006113 3300046506 Bacteria 7942
582 Ga0495606_0001909 3300046507 Bacteria 25955
583 Ga0495606_0003137 3300046507 Bacteria 17919
584 Ga0495606_0003315 3300046507 Bacteria 17184
585 Ga0495606_0005520 3300046507 Bacteria 12075
586 Ga0495606_0011709 3300046507 Bacteria 7119
587 Ga0495606_0071619 3300046507 Bacteria 2181
588 Ga0495610_0000577 3300046512 Bacteria 36435
589 Ga0495610_0002921 3300046512 Bacteria 13810
590 Ga0495610_0005314 3300046512 Bacteria 9204
591 Ga0495610_0015560 3300046512 Bacteria 4414
592 Ga0495610_0022499 3300046512 Bacteria 3446
593 Ga0495610_0025009 3300046512 Bacteria 3214
594 Ga0495610_0097142 3300046512 Bacteria 1325
595 Ga0495616_0000101 3300046513 Bacteria 73493
596 Ga0495616_0002771 3300046513 Bacteria 11450
597 Ga0495616_0004149 3300046513 Bacteria 9182
598 Ga0495616_0004349 3300046513 Bacteria 8939
599 Ga0495616_0006099 3300046513 Bacteria 7343
600 Ga0495616_0027320 3300046513 Bacteria 3029
601 Ga0495616_0027440 3300046513 Bacteria 3021
602 Ga0495616_0030587 3300046513 Bacteria 2827
603 Ga0495620_0003671 3300046515 Bacteria 8764
604 Ga0495620_0004593 3300046515 Bacteria 7765
605 Ga0495620_0004634 3300046515 Bacteria 7727
606 Ga0495620_0006538 3300046515 Bacteria 6393
607 Ga0495620_0013985 3300046515 Bacteria 4092
608 Ga0495620_0021167 3300046515 Bacteria 3162
609 Ga0495620_0026770 3300046515 Bacteria 2707
610 Ga0495628_0066143 3300046516 Bacteria 2826
611 Ga0495630_0000706 3300046517 Bacteria 23762
612 Ga0495630_0006789 3300046517 Bacteria 8157
613 Ga0495630_0025835 3300046517 Bacteria 4344
614 Ga0495630_0026071 3300046517 Bacteria 4326
615 Ga0495631_0000002 3300046518 Bacteria 178694
616 Ga0495631_0000005 3300046518 Bacteria 159179
617 Ga0495631_0009196 3300046518 Bacteria 4949
618 Ga0495631_0021330 3300046518 Bacteria 3016
619 Ga0495631_0021622 3300046518 Bacteria 2995
620 Ga0495632_0000322 3300046519 Bacteria 46210
621 Ga0495632_0001664 3300046519 Bacteria 18204
622 Ga0495632_0003128 3300046519 Bacteria 11977
623 Ga0495632_0006053 3300046519 Bacteria 7852
624 Ga0495632_0009894 3300046519 Bacteria 5701
625 Ga0495632_0013189 3300046519 Bacteria 4727
626 Ga0495632_0015296 3300046519 Bacteria 4309
627 Ga0495632_0015974 3300046519 Bacteria 4189
628 Ga0495632_0077760 3300046519 Bacteria 1586
629 Ga0495632_0097640 3300046519 Bacteria 1386
630 Ga0495632_0107873 3300046519 Bacteria 1309
631 Ga0495637_0000044 3300046520 Bacteria 111531
632 Ga0495637_0000681 3300046520 Bacteria 23563
633 Ga0495637_0004891 3300046520 Bacteria 6896
634 Ga0495637_0007731 3300046520 Bacteria 5315
635 Ga0495637_0008150 3300046520 Bacteria 5155
636 Ga0495637_0010618 3300046520 Bacteria 4448
637 Ga0495637_0012047 3300046520 Bacteria 4145
638 Ga0495637_0023014 3300046520 Bacteria 2836
639 Ga0495637_0027239 3300046520 Bacteria 2559
640 Ga0495637_0087599 3300046520 Bacteria 1232
641 Ga0495643_0015564 3300046522 Bacteria 4492
642 Ga0495643_0019946 3300046522 Bacteria 3874
643 Ga0495643_0020086 3300046522 Bacteria 3858
644 Ga0495643_0053579 3300046522 Bacteria 2162
645 Ga0495643_0053632 3300046522 Bacteria 2161
646 Ga0495644_0000731 3300046523 Bacteria 13631
647 Ga0495644_0001290 3300046523 Bacteria 10285
648 Ga0495644_0055584 3300046523 Bacteria 1487
649 Ga0495648_0003121 3300046524 Bacteria 14779
650 Ga0495648_0004989 3300046524 Bacteria 11147
651 Ga0495648_0007416 3300046524 Bacteria 8775
652 Ga0495648_0016666 3300046524 Bacteria 5288
653 Ga0495648_0019606 3300046524 Bacteria 4748
654 Ga0495648_0064662 3300046524 Bacteria 2154
655 Ga0495648_0171466 3300046524 Bacteria 1111
656 Ga0495663_0031541 3300046525 Bacteria 1575
657 Ga0495666_0000043 3300046526 Bacteria 46931
658 Ga0495666_0001238 3300046526 Bacteria 12361
659 Ga0495666_0005337 3300046526 Bacteria 6481
660 Ga0495666_0022824 3300046526 Bacteria 3097
661 Ga0495666_0063680 3300046526 Bacteria 1760
662 Ga0495642_0000019 3300046528 Bacteria 106141
663 Ga0495642_0000130 3300046528 Bacteria 43443
664 Ga0495642_0000221 3300046528 Bacteria 32689
665 Ga0495654_0000088 3300046530 Bacteria 104763
666 Ga0495654_0000145 3300046530 Bacteria 73703
667 Ga0495654_0001307 3300046530 Bacteria 17424
668 Ga0495654_0004399 3300046530 Bacteria 8374
669 Ga0495654_0008378 3300046530 Bacteria 5715
670 Ga0495654_0010718 3300046530 Bacteria 4978
671 Ga0495654_0012190 3300046530 Bacteria 4625
672 Ga0495654_0012471 3300046530 Bacteria 4562
673 Ga0495654_0013597 3300046530 Bacteria 4352
674 Ga0495654_0014729 3300046530 Bacteria 4157
675 Ga0495654_0017179 3300046530 Bacteria 3808
676 Ga0495654_0018864 3300046530 Bacteria 3609
677 Ga0495654_0018940 3300046530 Bacteria 3601
678 Ga0495654_0021708 3300046530 Bacteria 3338
679 Ga0495654_0030618 3300046530 Bacteria 2736
680 Ga0495654_0035971 3300046530 Bacteria 2490
681 Ga0495665_0002289 3300046531 Bacteria 10344
682 Ga0495586_0007464 3300046535 Bacteria 5834
683 Ga0495587_0006912 3300046536 Bacteria 7377
684 Ga0495587_0053762 3300046536 Bacteria 2373
685 Ga0495598_0063608 3300046537 Bacteria 1145
686 Ga0495609_0001246 3300046538 Bacteria 17513
687 Ga0495609_0001924 3300046538 Bacteria 13212
688 Ga0495609_0002918 3300046538 Bacteria 10176
689 Ga0495609_0006052 3300046538 Bacteria 6232
690 Ga0495609_0008107 3300046538 Bacteria 5171
691 Ga0495609_0013487 3300046538 Bacteria 3856
692 Ga0495609_0018581 3300046538 Bacteria 3220
693 Ga0495609_0054110 3300046538 Bacteria 1783
694 Ga0495597_0005702 3300046542 Bacteria 6550
695 Ga0495597_0007011 3300046542 Bacteria 5775
696 Ga0495597_0007149 3300046542 Bacteria 5704
697 Ga0495597_0011444 3300046542 Bacteria 4301
698 Ga0495597_0012278 3300046542 Bacteria 4133
699 Ga0495597_0014156 3300046542 Bacteria 3801
700 Ga0495597_0041379 3300046542 Bacteria 2058
701 Ga0495597_0062137 3300046542 Bacteria 1625
702 Ga0495597_0085661 3300046542 Bacteria 1342
703 Ga0495645_0037872 3300046543 Bacteria 3516
704 Ga0495622_0000347 3300046557 Bacteria 33186
705 Ga0495622_0000784 3300046557 Bacteria 17691
706 Ga0495622_0014420 3300046557 Bacteria 3669
707 Ga0495622_0024060 3300046557 Bacteria 2842
708 Ga0495633_0000412 3300046558 Bacteria 44548
709 Ga0495633_0001574 3300046558 Bacteria 17471
710 Ga0495633_0007856 3300046558 Bacteria 6088
711 Ga0495633_0050633 3300046558 Bacteria 1958
712 Ga0495656_0005448 3300046615 Bacteria 4395
713 Ga0495656_0020605 3300046615 Bacteria 2558
714 Ga0495656_0054045 3300046615 Bacteria 1727
715 Ga0495656_0059756 3300046615 Bacteria 1659
716 Ga0495668_0000732 3300046616 Bacteria 39331
717 Ga0495668_0031160 3300046616 Bacteria 3006
718 Ga0495668_0033454 3300046616 Bacteria 2888
719 Ga0495668_0204165 3300046616 Bacteria 1082
720 Ga0495634_0003589 3300046642 Bacteria 12402
721 Ga0495634_0031362 3300046642 Bacteria 3661
722 Ga0495611_0000612 3300046648 Bacteria 20591
723 Ga0495611_0005091 3300046648 Bacteria 5632
724 Ga0495611_0005145 3300046648 Bacteria 5606
725 Ga0495625_0001435 3300046660 Bacteria 29011
726 Ga0495625_0001805 3300046660 Bacteria 24590
727 Ga0495625_0003496 3300046660 Bacteria 15579
728 Ga0495625_0005136 3300046660 Bacteria 12086
729 Ga0495625_0005271 3300046660 Bacteria 11870
730 Ga0495625_0006297 3300046660 Bacteria 10612
731 Ga0495625_0006992 3300046660 Bacteria 9944
732 Ga0495625_0036878 3300046660 Bacteria 3589
733 Ga0495625_0047511 3300046660 Bacteria 3094
734 Ga0495625_0121169 3300046660 Bacteria 1779
735 Ga0495625_0263251 3300046660 Bacteria 1115
736 Ga0495635_0005441 3300046663 Bacteria 8855
737 Ga0495659_0000002 3300046664 Bacteria 176698
738 Ga0495659_0003290 3300046664 Bacteria 5182
739 Ga0495661_0000036 3300046665 Bacteria 164694
740 Ga0495661_0018807 3300046665 Bacteria 4535
741 Ga0495661_0020356 3300046665 Bacteria 4333
742 Ga0495661_0029068 3300046665 Bacteria 3531
743 Ga0495661_0070299 3300046665 Bacteria 2049
744 Ga0495661_0080891 3300046665 Bacteria 1874
745 Ga0495588_0004882 3300046674 Bacteria 5944
746 Ga0495588_0013375 3300046674 Bacteria 3910
747 Ga0495588_0018651 3300046674 Bacteria 3387
748 Ga0495588_0024295 3300046674 Bacteria 3009
749 Ga0495588_0047393 3300046674 Bacteria 2206
750 Ga0495588_0047943 3300046674 Bacteria 2194
751 Ga0495623_0005212 3300046679 Bacteria 8524
752 Ga0495623_0006880 3300046679 Bacteria 7398
753 Ga0495646_0006459 3300046680 Bacteria 7437
754 Ga0495647_0007179 3300046681 Bacteria 3723
755 Ga0495658_0001055 3300046683 Bacteria 14545
756 Ga0495669_0013407 3300046684 Bacteria 3492
757 Ga0495613_0000236 3300046689 Bacteria 52791
758 Ga0495613_0027231 3300046689 Bacteria 4253
759 Ga0495613_0051427 3300046689 Bacteria 3036
760 Ga0495670_0000596 3300046691 Bacteria 17241
761 Ga0495670_0001315 3300046691 Bacteria 12114
762 Ga0495670_0001962 3300046691 Bacteria 10108
763 Ga0495670_0003569 3300046691 Bacteria 7636
764 Ga0495670_0010342 3300046691 Bacteria 4583
765 Ga0495670_0022689 3300046691 Bacteria 3100
766 Ga0495670_0024323 3300046691 Bacteria 2993
767 Ga0495670_0025300 3300046691 Bacteria 2936
768 Ga0495670_0087280 3300046691 Bacteria 1594
769 Ga0495670_0114449 3300046691 Bacteria 1398
770 Ga0495671_0000567 3300046692 Bacteria 27640
771 Ga0495671_0000807 3300046692 Bacteria 22388
772 Ga0495671_0005047 3300046692 Bacteria 7776
773 Ga0495671_0008889 3300046692 Bacteria 5640
774 Ga0495671_0016906 3300046692 Bacteria 3888
775 Ga0495671_0021233 3300046692 Bacteria 3412
776 Ga0495671_0025357 3300046692 Bacteria 3082
777 Ga0495671_0031820 3300046692 Bacteria 2695
778 Ga0495671_0048874 3300046692 Bacteria 2109
779 Ga0495671_0082008 3300046692 Bacteria 1580
780 Ga0495649_0000013 3300046694 Bacteria 316013
781 Ga0495649_0001103 3300046694 Bacteria 21058
782 Ga0495649_0003185 3300046694 Bacteria 11216
783 Ga0495649_0004259 3300046694 Bacteria 9385
784 Ga0495649_0004478 3300046694 Bacteria 9122
785 Ga0495649_0005254 3300046694 Bacteria 8275
786 Ga0495649_0019444 3300046694 Bacteria 3816
787 Ga0495649_0027772 3300046694 Bacteria 3138
788 Ga0495649_0031137 3300046694 Bacteria 2942
789 Ga0495649_0044517 3300046694 Bacteria 2423
790 Ga0495589_0000123 3300046794 Bacteria 72582
791 Ga0495589_0000487 3300046794 Bacteria 28372
792 Ga0495589_0000650 3300046794 Bacteria 22768
793 Ga0495589_0004463 3300046794 Bacteria 7440
794 Ga0495589_0007473 3300046794 Bacteria 5727
795 Ga0495589_0008079 3300046794 Bacteria 5499
796 Ga0495589_0026177 3300046794 Bacteria 2956
797 Ga0495589_0075597 3300046794 Bacteria 1642
798 Ga0495589_0080729 3300046794 Bacteria 1582
799 Ga0495589_0128884 3300046794 Bacteria 1216
800 Ga0495600_0019987 3300046809 Bacteria 4281
801 Ga0495600_0155638 3300046809 Bacteria 1478
802 Ga0495660_0002985 3300046810 Bacteria 10556
803 Ga0495660_0007274 3300046810 Bacteria 6511
804 Ga0495660_0012170 3300046810 Bacteria 4992
805 Ga0495660_0017347 3300046810 Bacteria 4145
806 Ga0495660_0018155 3300046810 Bacteria 4044
807 Ga0495660_0026725 3300046810 Bacteria 3269
808 Ga0495660_0051817 3300046810 Bacteria 2232
809 Ga0495660_0085492 3300046810 Bacteria 1647
810 Ga0495660_0092293 3300046810 Bacteria 1571
811 Ga0495581_0002739 3300047315 Bacteria 10051
812 Ga0495581_0003500 3300047315 Bacteria 9011
813 Ga0495581_0057407 3300047315 Bacteria 2247
814 Ga0495604_0001667 3300047317 Bacteria 18283
815 Ga0495604_0019410 3300047317 Bacteria 5440
816 Ga0495604_0086223 3300047317 Bacteria 2341
817 Ga0495604_0233306 3300047317 Bacteria 1261
818 Ga0495636_0000844 3300047318 Bacteria 11305
819 Ga0495636_0004395 3300047318 Bacteria 5525
820 Ga0495636_0025461 3300047318 Bacteria 2402
821 Ga0495674_0006549 3300047319 Bacteria 11173
822 Ga0495672_0000773 3300047320 Bacteria 34808
823 Ga0495672_0001311 3300047320 Bacteria 24758
824 Ga0495672_0001830 3300047320 Bacteria 20344
825 Ga0495672_0002044 3300047320 Bacteria 18957
826 Ga0495672_0003350 3300047320 Bacteria 13804
827 Ga0495672_0006601 3300047320 Bacteria 8932
828 Ga0495672_0008255 3300047320 Bacteria 7712
829 Ga0495672_0012327 3300047320 Bacteria 5973
830 Ga0495672_0017001 3300047320 Bacteria 4874
831 Ga0495672_0019829 3300047320 Bacteria 4423
832 Ga0495672_0076972 3300047320 Bacteria 1871
833 Ga0495672_0099858 3300047320 Bacteria 1576
834 Ga0495672_0127192 3300047320 Bacteria 1346
835 Ga0495680_0001808 3300047322 Bacteria 22585
836 Ga0495680_0005161 3300047322 Bacteria 12319
837 Ga0495680_0005410 3300047322 Bacteria 12025
838 Ga0495680_0031379 3300047322 Bacteria 4326
839 Ga0495680_0036454 3300047322 Bacteria 3947
840 Ga0495680_0152958 3300047322 Bacteria 1681
841 Ga0495683_0000010 3300047323 Bacteria 223494
842 Ga0495683_0000037 3300047323 Bacteria 140632
843 Ga0495683_0000139 3300047323 Bacteria 71403
844 Ga0495683_0002618 3300047323 Bacteria 10766
845 Ga0495683_0002622 3300047323 Bacteria 10755
846 Ga0495683_0009568 3300047323 Bacteria 5161
847 Ga0495683_0010235 3300047323 Bacteria 4965
848 Ga0495683_0013424 3300047323 Bacteria 4283
849 Ga0495683_0016449 3300047323 Bacteria 3841
850 Ga0495683_0019719 3300047323 Bacteria 3480
851 Ga0495683_0031822 3300047323 Bacteria 2687
852 Ga0495683_0032697 3300047323 Bacteria 2649
853 Ga0495683_0036020 3300047323 Bacteria 2514
854 Ga0495683_0074429 3300047323 Bacteria 1664
855 Ga0495683_0110572 3300047323 Bacteria 1312
856 Ga0495687_001399 3300047443 Bacteria 22271
857 Ga0495687_021012 3300047443 Bacteria 3170
858 Ga0495687_084809 3300047443 Bacteria 1230
859 Ga0495675_0026843 3300047444 Bacteria 3671
860 Ga0495675_0051226 3300047444 Bacteria 2622
861 Ga0495677_0075961 3300047445 Bacteria 1255
862 Ga0495679_002402 3300047446 Bacteria 9565
863 Ga0495679_004407 3300047446 Bacteria 6515
864 Ga0495679_005202 3300047446 Bacteria 5814
865 Ga0495679_006403 3300047446 Bacteria 5076
866 Ga0495679_045246 3300047446 Bacteria 1345
867 Ga0495685_004423 3300047447 Bacteria 4541
868 Ga0495685_024352 3300047447 Bacteria 2083
869 Ga0495673_0000084 3300047469 Bacteria 193599
870 Ga0495673_0000093 3300047469 Bacteria 185841
871 Ga0495673_0000434 3300047469 Bacteria 46894
872 Ga0495673_0001021 3300047469 Bacteria 24677
873 Ga0495673_0001694 3300047469 Bacteria 16897
874 Ga0495673_0003443 3300047469 Bacteria 10421
875 Ga0495673_0003466 3300047469 Bacteria 10382
876 Ga0495673_0005152 3300047469 Bacteria 7967
877 Ga0495673_0010917 3300047469 Bacteria 4915
878 Ga0495673_0014710 3300047469 Bacteria 4060
879 Ga0495673_0024507 3300047469 Bacteria 2914
880 Ga0495673_0025370 3300047469 Bacteria 2848
881 Ga0495673_0034996 3300047469 Bacteria 2318
882 Ga0495681_0000370 3300047470 Bacteria 35144
883 Ga0495681_0001251 3300047470 Bacteria 19278
884 Ga0495681_0001487 3300047470 Bacteria 17508
885 Ga0495681_0001828 3300047470 Bacteria 15639
886 Ga0495681_0003228 3300047470 Bacteria 11369
887 Ga0495681_0004803 3300047470 Bacteria 9156
888 Ga0495681_0007652 3300047470 Bacteria 6868
889 Ga0495681_0016633 3300047470 Bacteria 4112
890 Ga0495681_0065108 3300047470 Bacteria 1667
891 Ga0495684_0018688 3300047471 Bacteria 5339
892 Ga0495686_0000291 3300047472 Bacteria 88142
893 Ga0495686_0084186 3300047472 Bacteria 1938
894 Ga0495593_0000510 3300047673 Bacteria 21940
895 Ga0495593_0001007 3300047673 Bacteria 16531
896 Ga0495593_0003372 3300047673 Bacteria 9568
897 Ga0495593_0034317 3300047673 Bacteria 2760
898 Ga0495626_0000031 3300048091 Bacteria 197930
899 Ga0495626_0000326 3300048091 Bacteria 50232
900 Ga0495626_0000340 3300048091 Bacteria 49123
901 Ga0495626_0000373 3300048091 Bacteria 46792
902 Ga0495626_0000631 3300048091 Bacteria 34169
903 Ga0495626_0000651 3300048091 Bacteria 33467
904 Ga0495626_0000671 3300048091 Bacteria 32949
905 Ga0495626_0002579 3300048091 Bacteria 12394
906 Ga0495626_0003819 3300048091 Bacteria 9458
907 Ga0495626_0004207 3300048091 Bacteria 8910
908 Ga0495626_0025179 3300048091 Bacteria 2911
909 Ga0496100_0000632 3300048903 Bacteria 16686
910 Ga0496101_0003736 3300048904 Bacteria 9500
911 Ga0496102_0000052 3300048905 Bacteria 177388
912 Ga0496102_0005098 3300048905 Bacteria 11127
913 Ga0496102_0009276 3300048905 Bacteria 8443
914 Ga0496102_0182413 3300048905 Bacteria 1978
915 Ga0496102_0198595 3300048905 Bacteria 1890
916 Ga0496103_0003881 3300048906 Bacteria 9094
917 Ga0496103_0009805 3300048906 Bacteria 5672
918 Ga0496104_0009987 3300048907 Bacteria 8475
919 Ga0496104_0013732 3300048907 Bacteria 7305
920 Ga0496104_0044933 3300048907 Bacteria 4152
921 Ga0496105_0004032 3300048908 Bacteria 10989
922 Ga0496105_0067673 3300048908 Bacteria 2949
923 Ga0496105_0096306 3300048908 Bacteria 2444
924 Ga0496106_0222824 3300048909 Bacteria 1504
925 Ga0496107_0000431 3300048910 Bacteria 22701
926 Ga0496107_0021707 3300048910 Bacteria 4536
927 Ga0496107_0037617 3300048910 Bacteria 3472
928 Ga0496107_0049341 3300048910 Bacteria 3033
929 Ga0496107_0201487 3300048910 Bacteria 1479
930 Ga0496108_0058039 3300048911 Bacteria 3252
931 Ga0496108_0097493 3300048911 Bacteria 2505
932 Ga0496108_0281780 3300048911 Bacteria 1447
933 Ga0496109_0045278 3300048912 Bacteria 3991
934 Ga0496109_0072402 3300048912 Bacteria 3166
935 Ga0496109_0448740 3300048912 Bacteria 1218
936 Ga0496110_0004935 3300048913 Bacteria 10418
937 Ga0496110_0230232 3300048913 Bacteria 1685
938 Ga0496111_0008007 3300048914 Bacteria 6972
939 Ga0496111_0166751 3300048914 Bacteria 1636
940 Ga0496112_0026077 3300048915 Bacteria 5619
941 Ga0496112_0060333 3300048915 Bacteria 3738
942 Ga0496114_0003041 3300048917 Bacteria 12849
943 Ga0496114_0004340 3300048917 Bacteria 10977
944 Ga0496114_0290109 3300048917 Bacteria 1443
945 Ga0496114_0464991 3300048917 Bacteria 1120
946 Ga0496115_0002227 3300048918 Bacteria 13912
947 Ga0496115_0055709 3300048918 Bacteria 3176
948 Ga0496115_0083452 3300048918 Bacteria 2604
949 Ga0496115_0123213 3300048918 Bacteria 2134
950 Ga0496115_0219732 3300048918 Bacteria 1568
951 Ga0496116_0000475 3300048919 Bacteria 55484
952 Ga0496116_0011151 3300048919 Bacteria 7470
953 Ga0496117_0011375 3300048920 Bacteria 7975
954 Ga0496117_0048512 3300048920 Bacteria 3032
955 Ga0496117_0051342 3300048920 Bacteria 2916
956 Ga0496117_0065215 3300048920 Bacteria 2477
957 Ga0496117_0087895 3300048920 Bacteria 2012
958 Ga0496117_0219865 3300048920 Bacteria 1058
959 Ga0496118_0004037 3300048921 Bacteria 17839
960 Ga0496118_0009946 3300048921 Bacteria 9496
961 Ga0496118_0064052 3300048921 Bacteria 2700
962 Ga0496118_0096553 3300048921 Bacteria 2014
963 Ga0496119_0000018 3300048922 Bacteria 306476
964 Ga0496119_0085359 3300048922 Bacteria 1807
965 Ga0496120_0000002 3300048923 Bacteria 547999
966 Ga0496121_0005286 3300048924 Bacteria 16631
967 Ga0496121_0030892 3300048924 Bacteria 4910
968 Ga0496121_0032500 3300048924 Bacteria 4742
969 Ga0496121_0051984 3300048924 Bacteria 3445
970 Ga0496121_0179013 3300048924 Bacteria 1532
971 Ga0496122_0002729 3300048925 Bacteria 24434
972 Ga0496122_0157125 3300048925 Bacteria 1393
973 Ga0496123_0015383 3300048926 Bacteria 6277
974 Ga0496124_0000047 3300048927 Bacteria 285554
975 Ga0496124_0007451 3300048927 Bacteria 11623
976 Ga0496124_0012073 3300048927 Bacteria 8574
977 Ga0496124_0029049 3300048927 Bacteria 4933
978 Ga0496124_0043807 3300048927 Bacteria 3844
979 Ga0496124_0048559 3300048927 Bacteria 3626
980 Ga0496124_0091321 3300048927 Bacteria 2482
981 Ga0496125_0004944 3300048928 Bacteria 15081
982 Ga0496125_0009232 3300048928 Bacteria 10188
983 Ga0496125_0038439 3300048928 Bacteria 4142
984 Ga0496125_0072216 3300048928 Bacteria 2691
985 Ga0496126_0000160 3300048929 Bacteria 155144
986 Ga0496126_0075946 3300048929 Bacteria 2981
987 Ga0496126_0099647 3300048929 Bacteria 2544
988 Ga0496126_0270542 3300048929 Bacteria 1410
989 Ga0495678_000420 3300049459 Bacteria 42717
990 Ga0495678_001193 3300049459 Bacteria 21367
991 Ga0495678_004789 3300049459 Bacteria 7702
992 Ga0495678_008151 3300049459 Bacteria 5330
993 Ga0495678_019168 3300049459 Bacteria 3058
994 Ga0495678_041226 3300049459 Bacteria 1849
995 Ga0495678_063834 3300049459 Bacteria 1374
996 Ga0495682_0004619 3300049460 Bacteria 5850
997 Ga0495682_0010190 3300049460 Bacteria 3651
998 Ga0495682_0010720 3300049460 Bacteria 3540
999 Ga0495682_0035001 3300049460 Bacteria 1850
1000 Ga0495682_0041039 3300049460 Bacteria 1696
1001 Ga0501031_0022726 3300049568 Bacteria 4088
1002 Ga0501031_0067538 3300049568 Bacteria 2329
1003 Ga0501032_0055078 3300049569 Bacteria 2676
1004 Ga0501032_0110489 3300049569 Bacteria 1819
1005 Ga0501033_0009352 3300049570 Bacteria 7545
1006 Ga0501034_0000625 3300049571 Bacteria 55247
1007 Ga0501036_0020608 3300049572 Bacteria 5538
1008 Ga0501036_0074660 3300049572 Bacteria 2868
1009 Ga0501036_0082793 3300049572 Bacteria 2712
1010 Ga0501036_0103320 3300049572 Bacteria 2410
1011 Ga0501036_0341208 3300049572 Bacteria 1251
1012 Ga0501038_0023928 3300049574 Bacteria 5454
1013 Ga0501038_0035894 3300049574 Bacteria 4351
1014 Ga0501038_0099837 3300049574 Bacteria 2419
1015 Ga0501038_0132179 3300049574 Bacteria 2048
1016 Ga0501039_0013549 3300049575 Bacteria 6235
1017 Ga0501039_0036029 3300049575 Bacteria 3817
1018 Ga0501039_0081884 3300049575 Bacteria 2513
1019 Ga0501039_0243905 3300049575 Bacteria 1413
1020 Ga0501040_0036124 3300049576 Bacteria 3352
1021 Ga0501040_0066010 3300049576 Bacteria 2493
1022 Ga0501040_0091306 3300049576 Bacteria 2117
1023 Ga0501040_0105448 3300049576 Bacteria 1969
1024 Ga0501041_0006968 3300049577 Bacteria 6629
1025 Ga0501041_0054670 3300049577 Bacteria 2436
1026 Ga0501041_0129490 3300049577 Bacteria 1572
1027 Ga0501042_0045261 3300049578 Bacteria 3136
1028 Ga0501042_0071986 3300049578 Bacteria 2473
1029 Ga0501043_0044829 3300049579 Bacteria 3478
1030 Ga0501046_0019335 3300049580 Bacteria 5651
1031 Ga0501046_0058686 3300049580 Bacteria 3016
1032 Ga0501047_0012382 3300049581 Bacteria 8075
1033 Ga0501047_0126148 3300049581 Bacteria 2440
1034 Ga0501048_0022275 3300049582 Bacteria 4636
1035 Ga0501048_0066266 3300049582 Bacteria 2553
1036 Ga0501070_0008224 3300049586 Bacteria 8823
1037 Ga0501071_0004660 3300049587 Bacteria 8712
1038 Ga0501071_0021688 3300049587 Bacteria 4477
1039 Ga0501071_0022166 3300049587 Bacteria 4427
1040 Ga0501071_0062720 3300049587 Bacteria 2693
1041 Ga0501071_0115800 3300049587 Bacteria 1984
1042 Ga0501071_0122273 3300049587 Bacteria 1930
1043 Ga0501072_0005876 3300049588 Bacteria 9345
1044 Ga0501072_0012869 3300049588 Bacteria 6399
1045 Ga0501072_0070658 3300049588 Bacteria 2757
1046 Ga0501072_0159163 3300049588 Bacteria 1801
1047 Ga0501074_0071296 3300049590 Bacteria 2498
1048 Ga0501074_0081873 3300049590 Bacteria 2315
1049 Ga0501074_0288038 3300049590 Bacteria 1167
1050 Ga0501075_0022895 3300049591 Bacteria 4569
1051 Ga0501075_0047310 3300049591 Bacteria 3233
1052 Ga0501075_0075481 3300049591 Bacteria 2549
1053 Ga0501075_0220559 3300049591 Bacteria 1446
1054 Ga0501075_0238452 3300049591 Bacteria 1386
1055 Ga0501076_0024551 3300049592 Bacteria 4660
1056 Ga0501076_0025793 3300049592 Bacteria 4551
1057 Ga0501076_0081163 3300049592 Bacteria 2603
1058 Ga0501077_0018855 3300049593 Bacteria 4366
1059 Ga0501077_0193708 3300049593 Bacteria 1291
1060 Ga0501217_009414 3300049661 Bacteria 2125
1061 Ga0501079_0013491 3300049741 Bacteria 6230
1062 Ga0501079_0037890 3300049741 Bacteria 3717
1063 Ga0501079_0039754 3300049741 Bacteria 3628
1064 Ga0501079_0167682 3300049741 Bacteria 1712
1065 Ga0501080_0109673 3300049742 Bacteria 2558
1066 Ga0501080_0165041 3300049742 Bacteria 2044
1067 Ga0501080_0230764 3300049742 Bacteria 1692
1068 Ga0501081_0018089 3300049743 Bacteria 4676
1069 Ga0501081_0036980 3300049743 Bacteria 3330
1070 Ga0501081_0191991 3300049743 Bacteria 1479
1071 Ga0501081_0200414 3300049743 Bacteria 1447
1072 Ga0501081_0230238 3300049743 Bacteria 1349
1073 Ga0501083_0071373 3300049744 Bacteria 2309
1074 Ga0501083_0212830 3300049744 Bacteria 1260
1075 Ga0501241_000047 3300049758 Bacteria 35882
1076 Ga0501269_000742 3300049766 Bacteria 5257
1077 Ga0501035_0056359 3300049822 Bacteria 3507
1078 Ga0501035_0104892 3300049822 Bacteria 2479
1079 Ga0501044_0000106 3300049823 Bacteria 101709
1080 Ga0501044_0050741 3300049823 Bacteria 4279
1081 Ga0501044_0231263 3300049823 Bacteria 1796
1082 Ga0501045_0017591 3300049824 Bacteria 5076
1083 Ga0501045_0123072 3300049824 Bacteria 1926
1084 Ga0501045_0353652 3300049824 Bacteria 1093
1085 nmdc:mga03683_53567_c1 3300050489 Bacteria 1689
1086 nmdc:mga00v17_36197_c1 3300050491 Bacteria 2941
1087 nmdc:mga00v17_58477_c1 3300050491 Bacteria 2362
1088 nmdc:mga0yw44_134823_c1 3300050492 Bacteria 1601
1089 nmdc:mga0yw44_293096_c1 3300050492 Bacteria 1089
1090 nmdc:mga06z11_160883_c1 3300050494 Bacteria 1283
1091 nmdc:mga05p37_114181_c1 3300050507 Bacteria 3320
1092 nmdc:mga05p37_15089_c1 3300050507 Bacteria 9276
1093 nmdc:mga05p37_78729_c1 3300050507 Bacteria 4059
1094 nmdc:mga09592_65524_c1 3300050508 Bacteria 3078
1095 nmdc:mga06r32_54035_c1 3300050510 Bacteria 3851
1096 nmdc:mga06r32_6675_c1 3300050510 Bacteria 10371
1097 nmdc:mga08y16_44676_c1 3300050511 Bacteria 4643
1098 nmdc:mga0n895_10036_c1 3300050512 Bacteria 8334
1099 nmdc:mga0rr50_8552_c1 3300050513 Bacteria 6378
1100 nmdc:mga0a205_78623_c1 3300050515 Bacteria 3187
1101 nmdc:mga0a205_93022_c1 3300050515 Bacteria 2913
1102 nmdc:mga0sz30_7158_c2 3300050516 Bacteria 3875
1103 Ga0495601_0000744 3300053077 Bacteria 17523
1104 Ga0495612_0032116 3300053078 Bacteria 2120
1105 Ga0495655_0001249 3300053083 Bacteria 3927
1106 Ga0495619_0006422 3300053085 Bacteria 7449
1107 Ga0500643_000731 3300053087 Bacteria 21473
1108 Ga0500647_0008936 3300053091 Bacteria 4373
1109 Ga0500641_0000096 3300053096 Bacteria 34208
1110 Ga0500568_0023689 3300053139 Bacteria 2609
1111 Ga0500636_0059721 3300053177 Bacteria 2228
1112 Ga0501084_0013266 3300054114 Bacteria 6819
1113 Ga0501084_0025016 3300054114 Bacteria 4982
1114 Ga0501084_0139314 3300054114 Bacteria 2042
1115 Ga0501082_0000007 3300060353 Bacteria 126506
1116 Ga0501082_0035720 3300060353 Bacteria 4283
1117 Ga0501082_0185998 3300060353 Bacteria 1807
1118 Ga0530510_0011063 3300061734 Bacteria 6329
1119 Ga0530510_0014173 3300061734 Bacteria 5619
1120 Ga0530510_0115302 3300061734 Bacteria 1969
1121 Ga0530510_0142524 3300061734 Bacteria 1766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_0192445 Ga0451853_0192445_165_1061 275
2 3300046522 Ga0495643_0053632 Ga0495643_0053632_1281_2144 287
3 3300046471 Ga0495650_0020294 Ga0495650_0020294_2274_3167 288
4 3300046474 Ga0495605_0007746 Ga0495605_0007746_2215_3108 288
5 3300046513 Ga0495616_0000101 Ga0495616_0000101_65705_66598 288
6 3300046519 Ga0495632_0015974 Ga0495632_0015974_3145_4038 288
7 3300046530 Ga0495654_0000145 Ga0495654_0000145_7134_8027 288
8 3300046538 Ga0495609_0008107 Ga0495609_0008107_1940_2833 288
9 3300046660 Ga0495625_0005136 Ga0495625_0005136_5143_6036 288
10 3300047323 Ga0495683_0019719 Ga0495683_0019719_117_1010 288
11 3300047469 Ga0495673_0003466 Ga0495673_0003466_2938_3831 288
12 3300048091 Ga0495626_0000671 Ga0495626_0000671_27895_28788 288
13 3300049459 Ga0495678_008151 Ga0495678_008151_2008_2901 288
14 3300046518 Ga0495631_0009196 Ga0495631_0009196_4001_4906 301
15 3300039062 Ga0400483_108990 Ga0400483_108990_1902_2909 305
16 3300046501 Ga0495607_0183724 Ga0495607_0183724_108_1028 306
17 3300046522 Ga0495643_0020086 Ga0495643_0020086_36_956 306
18 3300005334 Ga0068869_100030812 Ga0068869_1000308124 310
19 3300005343 Ga0070687_100153394 Ga0070687_1001533942 310
20 3300005444 Ga0070694_100337870 Ga0070694_1003378701 310
21 3300005549 Ga0070704_100010793 Ga0070704_1000107936 310
22 3300005718 Ga0068866_10160783 Ga0068866_101607832 310
23 3300005719 Ga0068861_100396562 Ga0068861_1003965622 310
24 3300005844 Ga0068862_100004110 Ga0068862_1000041103 310
25 3300006881 Ga0068865_100011741 Ga0068865_1000117413 310
26 3300009098 Ga0105245_10475574 Ga0105245_104755742 310
27 3300009553 Ga0105249_10527786 Ga0105249_105277862 310
28 3300025899 Ga0207642_10131051 Ga0207642_101310512 310
29 3300025918 Ga0207662_10242107 Ga0207662_102421072 310
30 3300025935 Ga0207709_10382458 Ga0207709_103824581 310
31 3300025936 Ga0207670_10355450 Ga0207670_103554502 310
32 3300025942 Ga0207689_10390617 Ga0207689_103906172 310
33 3300026023 Ga0207677_10023036 Ga0207677_100230364 310
34 3300026041 Ga0207639_10252117 Ga0207639_102521172 310
35 3300026089 Ga0207648_10450826 Ga0207648_104508262 310
36 3300026118 Ga0207675_100524412 Ga0207675_1005244122 310
37 3300028381 Ga0268264_10518161 Ga0268264_105181612 310
38 3300048920 Ga0496117_0065215 Ga0496117_0065215_1503_2465 310
39 3300049571 Ga0501034_0000625 Ga0501034_0000625_8780_9775 310
40 3300005985 Ga0081539_10001147 Ga0081539_1000114743 313
41 3300035088 Ga0373940_0065170 Ga0373940_0065170_18_983 313
42 3300046459 Ga0495629_0286209 Ga0495629_0286209_73_1050 313
43 3300042461 Ga0439460_0030465 Ga0439460_0030465_416_1387 314
44 3300053096 Ga0500641_0000096 Ga0500641_0000096_6657_7628 315
45 3300053177 Ga0500636_0059721 Ga0500636_0059721_729_1718 315
46 3300049743 Ga0501081_0200414 Ga0501081_0200414_56_1030 316
47 3300053087 Ga0500643_000731 Ga0500643_000731_16139_17107 316
48 3300005344 Ga0070661_100172691 Ga0070661_1001726911 317
49 3300005614 Ga0068856_100065201 Ga0068856_1000652012 317
50 3300005616 Ga0068852_100213226 Ga0068852_1002132262 317
51 3300025920 Ga0207649_10288529 Ga0207649_102885292 317
52 3300028800 Ga0265338_10085517 Ga0265338_100855172 317
53 3300031251 Ga0265327_10007921 Ga0265327_100079214 317
54 3300031711 Ga0265314_10011272 Ga0265314_100112725 317
55 3300036401 Ga0373937_0216024 Ga0373937_0216024_248_1225 317
56 3300046692 Ga0495671_0016906 Ga0495671_0016906_2055_3044 317
57 3300053091 Ga0500647_0008936 Ga0500647_0008936_2273_3268 317
58 iso_pu_bacteria 2738541271 2738692114 317
59 iso_pu_bacteria 2738543016 2739267772 317
60 3300044712 Ga0453684_0080701 Ga0453684_0080701_3035_4051 318
61 iso_pu_bacteria 2888578766 2888583049 318
62 iso_pu_bacteria 2919385768 2919390386 319
63 iso_pu_bacteria 2919487758 2919489187 319
64 iso_pu_bacteria 2974289157 2974291100 319
65 iso_pu_bacteria 8029995093 8029998053 319
66 iso_pu_bacteria 8056166840 8056168468 319
67 3300009011 Ga0105251_10005118 Ga0105251_100051183 320
68 3300013104 Ga0157370_10074868 Ga0157370_100748682 320
69 3300015265 Ga0182005_1003472 Ga0182005_10034723 320
70 3300015265 Ga0182005_1009503 Ga0182005_10095033 320
71 3300025735 Ga0207713_1011856 Ga0207713_10118562 320
72 3300041405 Ga0439438_006718 Ga0439438_006718_1299_2261 320
73 3300041411 Ga0439466_0000659 Ga0439466_0000659_4432_5394 320
74 3300046452 Ga0495617_013983 Ga0495617_013983_1176_2219 320
75 3300046452 Ga0495617_035448 Ga0495617_035448_124_1143 320
76 3300046453 Ga0495627_041568 Ga0495627_041568_16_1035 320
77 3300046457 Ga0495590_0001776 Ga0495590_0001776_58_1077 320
78 3300046457 Ga0495590_0002415 Ga0495590_0002415_3949_4992 320
79 3300046458 Ga0495591_000138 Ga0495591_000138_40561_41580 320
80 3300046460 Ga0495638_0001251 Ga0495638_0001251_9790_10833 320
81 3300046460 Ga0495638_0022381 Ga0495638_0022381_2274_3293 320
82 3300046471 Ga0495650_0002593 Ga0495650_0002593_8798_9817 320
83 3300046474 Ga0495605_0040574 Ga0495605_0040574_376_1395 320
84 3300046491 Ga0495584_0017629 Ga0495584_0017629_1653_2696 320
85 3300046491 Ga0495584_0028990 Ga0495584_0028990_1254_2273 320
86 3300046492 Ga0495585_0026259 Ga0495585_0026259_1015_2058 320
87 3300046500 Ga0495596_0000049 Ga0495596_0000049_31823_32842 320
88 3300046501 Ga0495607_0013223 Ga0495607_0013223_1615_2658 320
89 3300046501 Ga0495607_0085422 Ga0495607_0085422_642_1661 320
90 3300046513 Ga0495616_0030587 Ga0495616_0030587_1716_2759 320
91 3300046515 Ga0495620_0013985 Ga0495620_0013985_2718_3737 320
92 3300046519 Ga0495632_0003128 Ga0495632_0003128_10339_11358 320
93 3300046519 Ga0495632_0015296 Ga0495632_0015296_2666_3709 320
94 3300046520 Ga0495637_0000044 Ga0495637_0000044_4995_6014 320
95 3300046522 Ga0495643_0053579 Ga0495643_0053579_923_1966 320
96 3300046523 Ga0495644_0000731 Ga0495644_0000731_9844_10887 320
97 3300046530 Ga0495654_0018864 Ga0495654_0018864_1821_2840 320
98 3300046530 Ga0495654_0018940 Ga0495654_0018940_396_1439 320
99 3300046542 Ga0495597_0012278 Ga0495597_0012278_2532_3575 320
100 3300046616 Ga0495668_0000732 Ga0495668_0000732_8236_9255 320
101 3300046660 Ga0495625_0001805 Ga0495625_0001805_7845_8864 320
102 3300046692 Ga0495671_0025357 Ga0495671_0025357_1176_2219 320
103 3300046694 Ga0495649_0004259 Ga0495649_0004259_5580_6623 320
104 3300046794 Ga0495589_0008079 Ga0495589_0008079_4025_5044 320
105 3300046810 Ga0495660_0012170 Ga0495660_0012170_962_2005 320
106 3300047320 Ga0495672_0001830 Ga0495672_0001830_14452_15495 320
107 3300047320 Ga0495672_0002044 Ga0495672_0002044_13066_14109 320
108 3300047323 Ga0495683_0009568 Ga0495683_0009568_809_1828 320
109 3300047323 Ga0495683_0013424 Ga0495683_0013424_2501_3544 320
110 3300047469 Ga0495673_0001021 Ga0495673_0001021_16725_17768 320
111 3300047470 Ga0495681_0004803 Ga0495681_0004803_4805_5824 320
112 3300048091 Ga0495626_0000651 Ga0495626_0000651_11754_12773 320
113 3300048913 Ga0496110_0004935 Ga0496110_0004935_7263_8306 320
114 3300048914 Ga0496111_0166751 Ga0496111_0166751_327_1370 320
115 3300048927 Ga0496124_0007451 Ga0496124_0007451_8805_9848 320
116 3300049574 Ga0501038_0023928 Ga0501038_0023928_3760_4794 320
117 3300049581 Ga0501047_0012382 Ga0501047_0012382_971_2005 320
118 3300049661 Ga0501217_009414 Ga0501217_009414_321_1316 320
119 3300049823 Ga0501044_0050741 Ga0501044_0050741_1604_2638 320
120 iso_pu_bacteria 2511231017 2511334862 320
121 iso_pu_bacteria 2511231021 2511356868 320
122 3300042137 Ga0450902_007410 Ga0450902_007410_680_1645 321
123 3300046538 Ga0495609_0013487 Ga0495609_0013487_1576_2673 321
124 3300048927 Ga0496124_0000047 Ga0496124_0000047_81431_82477 321
125 3300049822 Ga0501035_0104892 Ga0501035_0104892_1490_2467 321
126 iso_pu_bacteria 2511231007 2511270359 321
127 iso_pu_bacteria 2511231010 2511288087 321
128 iso_pu_bacteria 2511231012 2511302695 321
129 iso_pu_bacteria 2511231014 2511317063 321
130 iso_pu_bacteria 2511231015 2511317831 321
131 iso_pu_bacteria 2511231016 2511325492 321
132 iso_pu_bacteria 2511231018 2511339257 321
133 iso_pu_bacteria 2511231019 2511346310 321
134 iso_pu_bacteria 2511231020 2511352504 321
135 iso_pu_bacteria 2511231022 2511364668 321
136 iso_pu_bacteria 2600255318 2601799000 321
137 iso_pu_bacteria 2603880185 2606077895 321
138 iso_pu_bacteria 2603880199 2606129930 321
139 iso_pu_bacteria 2623620443 2624480879 321
140 iso_pu_bacteria 2623620446 2624491269 321
141 iso_pu_bacteria 2643221565 2643843344 321
142 iso_pu_bacteria 2643221589 2643957039 321
143 iso_pu_bacteria 2643221602 2644024962 321
144 iso_pu_bacteria 2643221633 2644185398 321
145 iso_pu_bacteria 2713897149 2715756932 321
146 iso_pu_bacteria 2718217725 2718634046 321
147 iso_pu_bacteria 2738543004 2739197748 321
148 iso_pu_bacteria 2738543015 2739262490 321
149 iso_pu_bacteria 2773857670 2774119279 321
150 iso_pu_bacteria 2784132072 2784314928 321
151 iso_pu_bacteria 2808606379 2808941675 321
152 iso_pu_bacteria 2808606382 2808961227 321
153 iso_pu_bacteria 2860339153 2860345103 321
154 iso_pu_bacteria 2878029506 2878032811 321
155 iso_pu_bacteria 2904550169 2904550645 321
156 iso_pu_bacteria 2919063839 2919064901 321
157 iso_pu_bacteria 2919456309 2919459133 321
158 iso_pu_bacteria 2919456309 2919460303 321
159 iso_pu_bacteria 2919697872 2919701220 321
160 iso_pu_bacteria 2931396565 2931403130 321
161 iso_pu_bacteria 2939636861 2939639929 321
162 iso_pu_bacteria 2969304461 2969307444 321
163 iso_pu_bacteria 3007511990 3007515416 321
164 iso_pu_bacteria 3007855910 3007856950 321
165 iso_pu_bacteria 8019775933 8019778167 321
166 iso_pu_bacteria 8055878733 8055882190 321
167 iso_pu_bacteria 8056125926 8056129387 321
168 iso_pu_bacteria 8056177738 8056178134 321
169 3300006038 Ga0075365_10168820 Ga0075365_101688202 322
170 3300006177 Ga0075362_10005204 Ga0075362_100052042 322
171 3300006353 Ga0075370_10022187 Ga0075370_100221874 322
172 3300042004 Ga0439445_0014397 Ga0439445_0014397_233_1276 322
173 3300050491 nmdc:mga00v17_58477_c1 nmdc:mga00v17_58477_c1_1036_2076 322
174 3300050492 nmdc:mga0yw44_134823_c1 nmdc:mga0yw44_134823_c1_336_1376 322
175 3300013105 Ga0157369_10013364 Ga0157369_100133648 323
176 3300015261 Ga0182006_1000634 Ga0182006_100063422 323
177 3300021377 Ga0213874_10002783 Ga0213874_100027834 323
178 3300037853 Ga0436364_1293474 Ga0436364_1293474_2297_3280 323
179 3300037853 Ga0436364_1408706 Ga0436364_1408706_271_1254 323
180 3300039437 Ga0436365_0384831 Ga0436365_0384831_6668_7651 323
181 3300039437 Ga0436365_1633568 Ga0436365_1633568_2073_3056 323
182 3300039450 Ga0436363_0075424 Ga0436363_0075424_24500_25483 323
183 3300039450 Ga0436363_1071452 Ga0436363_1071452_3559_4542 323
184 3300039453 Ga0436362_0348730 Ga0436362_0348730_3397_4431 323
185 3300041405 Ga0439438_000048 Ga0439438_000048_55137_56111 323
186 3300041405 Ga0439438_000153 Ga0439438_000153_19410_20384 323
187 3300041407 Ga0439447_010099 Ga0439447_010099_1046_2020 323
188 3300042010 Ga0439452_018141 Ga0439452_018141_834_1808 323
189 3300042137 Ga0450902_004943 Ga0450902_004943_193_1167 323
190 3300042139 Ga0450904_004910 Ga0450904_004910_373_1347 323
191 3300046542 Ga0495597_0005702 Ga0495597_0005702_4930_5904 323
192 3300005471 Ga0070698_100249091 Ga0070698_1002490912 324
193 3300005518 Ga0070699_100274329 Ga0070699_1002743291 324
194 3300006058 Ga0075432_10046801 Ga0075432_100468012 324
195 3300028556 Ga0265337_1014581 Ga0265337_10145812 324
196 3300028563 Ga0265319_1018833 Ga0265319_10188332 324
197 3300031240 Ga0265320_10005248 Ga0265320_100052482 324
198 3300031250 Ga0265331_10062684 Ga0265331_100626842 324
199 3300031595 Ga0265313_10000291 Ga0265313_1000029120 324
200 3300041404 Ga0439436_0017063 Ga0439436_0017063_333_1337 324
201 3300042007 Ga0439449_0036597 Ga0439449_0036597_434_1438 324
202 3300046460 Ga0495638_0002925 Ga0495638_0002925_12222_13253 324
203 3300047323 Ga0495683_0074429 Ga0495683_0074429_99_1073 324
204 3300048927 Ga0496124_0043807 Ga0496124_0043807_640_1644 324
205 3300049460 Ga0495682_0010720 Ga0495682_0010720_428_1402 324
206 3300049766 Ga0501269_000742 Ga0501269_000742_2550_3530 324
207 3300050494 nmdc:mga06z11_160883_c1 nmdc:mga06z11_160883_c1_222_1244 324
208 2124908027 MRS2a_Contig_240 MRS2a_00144010 325
209 3300001991 JGI24743J22301_10001386 JGI24743J22301_100013863 325
210 3300002075 JGI24738J21930_10007302 JGI24738J21930_100073022 325
211 3300002705 JGI25156J39149_1010418 JGI25156J39149_10104182 325
212 3300002737 JGI25162J39368_1000345 JGI25162J39368_100034515 325
213 3300002741 JGI25157J39369_1000317 JGI25157J39369_100031715 325
214 3300002771 JGI25163J39215_1000267 JGI25163J39215_10002675 325
215 3300002772 JGI25164J39214_1000187 JGI25164J39214_100018726 325
216 3300003187 JGI25151J46595_10000090 JGI25151J46595_1000009028 325
217 3300003187 JGI25151J46595_10000168 JGI25151J46595_1000016849 325
218 3300003214 JGI25165J46597_1000338 JGI25165J46597_100033815 325
219 3300003320 rootH2_10013714 rootH2_100137143 325
220 3300003578 Ga0006562J51391_1027629 Ga0006562J51391_10276293 325
221 3300003751 Ga0055538_1001452 Ga0055538_10014523 325
222 3300003761 Ga0055535_1000417 Ga0055535_100041715 325
223 3300003762 Ga0055542_1000435 Ga0055542_100043515 325
224 3300003763 Ga0055529_1000110 Ga0055529_100011015 325
225 3300003791 Ga0055530_10001311 Ga0055530_100013117 325
226 3300003792 Ga0055540_1000006 Ga0055540_100000656 325
227 3300003794 Ga0055531_10000075 Ga0055531_1000007529 325
228 3300005288 Ga0065714_10000217 Ga0065714_100002176 325
229 3300005288 Ga0065714_10002341 Ga0065714_1000234112 325
230 3300005288 Ga0065714_10005790 Ga0065714_100057904 325
231 3300005288 Ga0065714_10007718 Ga0065714_100077182 325
232 3300005288 Ga0065714_10013859 Ga0065714_100138592 325
233 3300005288 Ga0065714_10028341 Ga0065714_100283412 325
234 3300005288 Ga0065714_10032459 Ga0065714_100324592 325
235 3300005288 Ga0065714_10065710 Ga0065714_100657105 325
236 3300005288 Ga0065714_10089418 Ga0065714_100894181 325
237 3300005290 Ga0065712_10004708 Ga0065712_100047082 325
238 3300005293 Ga0065715_10003156 Ga0065715_100031566 325
239 3300005327 Ga0070658_10338498 Ga0070658_103384981 325
240 3300005328 Ga0070676_10000327 Ga0070676_1000032716 325
241 3300005329 Ga0070683_100013389 Ga0070683_1000133892 325
242 3300005330 Ga0070690_100000389 Ga0070690_1000003892 325
243 3300005331 Ga0070670_100004526 Ga0070670_1000045266 325
244 3300005334 Ga0068869_100006435 Ga0068869_1000064356 325
245 3300005334 Ga0068869_100211294 Ga0068869_1002112941 325
246 3300005335 Ga0070666_10001559 Ga0070666_1000155911 325
247 3300005336 Ga0070680_100002843 Ga0070680_1000028438 325
248 3300005337 Ga0070682_100001357 Ga0070682_10000135710 325
249 3300005338 Ga0068868_100000816 Ga0068868_1000008169 325
250 3300005340 Ga0070689_100000375 Ga0070689_1000003759 325
251 3300005341 Ga0070691_10003065 Ga0070691_100030654 325
252 3300005341 Ga0070691_10021676 Ga0070691_100216763 325
253 3300005344 Ga0070661_100000807 Ga0070661_10000080716 325
254 3300005345 Ga0070692_10014899 Ga0070692_100148994 325
255 3300005347 Ga0070668_100002040 Ga0070668_10000204012 325
256 3300005347 Ga0070668_100059780 Ga0070668_1000597805 325
257 3300005347 Ga0070668_100373350 Ga0070668_1003733501 325
258 3300005353 Ga0070669_100001534 Ga0070669_1000015346 325
259 3300005353 Ga0070669_100028425 Ga0070669_1000284253 325
260 3300005354 Ga0070675_100001502 Ga0070675_1000015024 325
261 3300005354 Ga0070675_100002753 Ga0070675_1000027538 325
262 3300005355 Ga0070671_100000406 Ga0070671_1000004066 325
263 3300005356 Ga0070674_100003779 Ga0070674_1000037795 325
264 3300005364 Ga0070673_100000480 Ga0070673_1000004804 325
265 3300005365 Ga0070688_100001668 Ga0070688_1000016687 325
266 3300005365 Ga0070688_100110694 Ga0070688_1001106942 325
267 3300005366 Ga0070659_100004405 Ga0070659_1000044056 325
268 3300005367 Ga0070667_100001184 Ga0070667_10000118417 325
269 3300005406 Ga0070703_10010576 Ga0070703_100105763 325
270 3300005434 Ga0070709_10001752 Ga0070709_100017525 325
271 3300005435 Ga0070714_100069438 Ga0070714_1000694382 325
272 3300005436 Ga0070713_100001031 Ga0070713_10000103111 325
273 3300005437 Ga0070710_10000732 Ga0070710_1000073211 325
274 3300005438 Ga0070701_10002551 Ga0070701_100025512 325
275 3300005438 Ga0070701_10151450 Ga0070701_101514501 325
276 3300005439 Ga0070711_100000095 Ga0070711_1000000956 325
277 3300005441 Ga0070700_100003085 Ga0070700_1000030856 325
278 3300005441 Ga0070700_100095217 Ga0070700_1000952171 325
279 3300005444 Ga0070694_100001906 Ga0070694_1000019069 325
280 3300005455 Ga0070663_100001429 Ga0070663_1000014294 325
281 3300005456 Ga0070678_100001684 Ga0070678_1000016847 325
282 3300005457 Ga0070662_100001283 Ga0070662_1000012839 325
283 3300005458 Ga0070681_10015543 Ga0070681_100155434 325
284 3300005458 Ga0070681_10021843 Ga0070681_100218434 325
285 3300005458 Ga0070681_10217786 Ga0070681_102177862 325
286 3300005459 Ga0068867_100042414 Ga0068867_1000424143 325
287 3300005518 Ga0070699_100204166 Ga0070699_1002041662 325
288 3300005530 Ga0070679_100269611 Ga0070679_1002696112 325
289 3300005535 Ga0070684_100007419 Ga0070684_1000074194 325
290 3300005536 Ga0070697_100000955 Ga0070697_10000095514 325
291 3300005539 Ga0068853_100000714 Ga0068853_1000007146 325
292 3300005539 Ga0068853_100308666 Ga0068853_1003086662 325
293 3300005543 Ga0070672_100035688 Ga0070672_1000356881 325
294 3300005543 Ga0070672_100054576 Ga0070672_1000545764 325
295 3300005544 Ga0070686_100008934 Ga0070686_1000089342 325
296 3300005545 Ga0070695_100000122 Ga0070695_10000012219 325
297 3300005545 Ga0070695_100007567 Ga0070695_1000075675 325
298 3300005546 Ga0070696_100000993 Ga0070696_1000009937 325
299 3300005548 Ga0070665_100005234 Ga0070665_1000052344 325
300 3300005548 Ga0070665_100119645 Ga0070665_1001196453 325
301 3300005548 Ga0070665_100204312 Ga0070665_1002043123 325
302 3300005549 Ga0070704_100000417 Ga0070704_1000004174 325
303 3300005563 Ga0068855_100001459 Ga0068855_10000145928 325
304 3300005564 Ga0070664_100002837 Ga0070664_1000028371 325
305 3300005577 Ga0068857_100004107 Ga0068857_1000041075 325
306 3300005578 Ga0068854_100000660 Ga0068854_1000006603 325
307 3300005578 Ga0068854_100175668 Ga0068854_1001756682 325
308 3300005615 Ga0070702_100000010 Ga0070702_10000001044 325
309 3300005615 Ga0070702_100057928 Ga0070702_1000579283 325
310 3300005615 Ga0070702_100175762 Ga0070702_1001757622 325
311 3300005617 Ga0068859_100003130 Ga0068859_10000313013 325
312 3300005617 Ga0068859_100168273 Ga0068859_1001682732 325
313 3300005618 Ga0068864_100022833 Ga0068864_1000228335 325
314 3300005718 Ga0068866_10002702 Ga0068866_100027023 325
315 3300005841 Ga0068863_100006477 Ga0068863_1000064773 325
316 3300005842 Ga0068858_100144860 Ga0068858_1001448602 325
317 3300005843 Ga0068860_100000961 Ga0068860_1000009614 325
318 3300005843 Ga0068860_100162785 Ga0068860_1001627853 325
319 3300005844 Ga0068862_100008421 Ga0068862_1000084215 325
320 3300005844 Ga0068862_100026667 Ga0068862_1000266673 325
321 3300005937 Ga0081455_10011835 Ga0081455_100118355 325
322 3300005937 Ga0081455_10012256 Ga0081455_100122564 325
323 3300005937 Ga0081455_10012725 Ga0081455_100127256 325
324 3300005983 Ga0081540_1000343 Ga0081540_10003432 325
325 3300006058 Ga0075432_10000121 Ga0075432_1000012121 325
326 3300006058 Ga0075432_10001542 Ga0075432_100015424 325
327 3300006058 Ga0075432_10013480 Ga0075432_100134802 325
328 3300006163 Ga0070715_10000194 Ga0070715_100001947 325
329 3300006173 Ga0070716_100039387 Ga0070716_1000393872 325
330 3300006175 Ga0070712_100002679 Ga0070712_1000026795 325
331 3300006175 Ga0070712_100099553 Ga0070712_1000995532 325
332 3300006186 Ga0075369_10008171 Ga0075369_100081713 325
333 3300006237 Ga0097621_100049901 Ga0097621_1000499014 325
334 3300006237 Ga0097621_100127468 Ga0097621_1001274681 325
335 3300006358 Ga0068871_100007258 Ga0068871_1000072583 325
336 3300006358 Ga0068871_100046243 Ga0068871_1000462435 325
337 3300006844 Ga0075428_100008638 Ga0075428_1000086382 325
338 3300006847 Ga0075431_100071595 Ga0075431_1000715953 325
339 3300006847 Ga0075431_100094192 Ga0075431_1000941922 325
340 3300006852 Ga0075433_10037746 Ga0075433_100377463 325
341 3300006881 Ga0068865_100000479 Ga0068865_1000004799 325
342 3300006881 Ga0068865_100100478 Ga0068865_1001004783 325
343 3300006914 Ga0075436_100001650 Ga0075436_10000165010 325
344 3300006931 Ga0097620_100003130 Ga0097620_10000313013 325
345 3300006931 Ga0097620_100168269 Ga0097620_1001682692 325
346 3300006946 Ga0079104_1000426 Ga0079104_100042633 325
347 3300006946 Ga0079104_1001612 Ga0079104_10016123 325
348 3300007076 Ga0075435_100110025 Ga0075435_1001100252 325
349 3300009036 Ga0105244_10002982 Ga0105244_100029827 325
350 3300009036 Ga0105244_10046797 Ga0105244_100467972 325
351 3300009036 Ga0105244_10052420 Ga0105244_100524202 325
352 3300009036 Ga0105244_10054541 Ga0105244_100545412 325
353 3300009092 Ga0105250_10006501 Ga0105250_100065012 325
354 3300009092 Ga0105250_10006990 Ga0105250_100069904 325
355 3300009092 Ga0105250_10008590 Ga0105250_100085903 325
356 3300009092 Ga0105250_10020227 Ga0105250_100202272 325
357 3300009092 Ga0105250_10061091 Ga0105250_100610913 325
358 3300009093 Ga0105240_10006881 Ga0105240_100068817 325
359 3300009093 Ga0105240_10019958 Ga0105240_100199587 325
360 3300009094 Ga0111539_10136940 Ga0111539_101369403 325
361 3300009094 Ga0111539_10137378 Ga0111539_101373783 325
362 3300009094 Ga0111539_10409874 Ga0111539_104098742 325
363 3300009098 Ga0105245_10018071 Ga0105245_100180714 325
364 3300009101 Ga0105247_10001227 Ga0105247_1000122716 325
365 3300009101 Ga0105247_10033489 Ga0105247_100334893 325
366 3300009101 Ga0105247_10052939 Ga0105247_100529393 325
367 3300009147 Ga0114129_10007650 Ga0114129_1000765010 325
368 3300009147 Ga0114129_10026262 Ga0114129_100262626 325
369 3300009147 Ga0114129_10029155 Ga0114129_100291558 325
370 3300009147 Ga0114129_10045234 Ga0114129_100452347 325
371 3300009147 Ga0114129_10203420 Ga0114129_102034202 325
372 3300009147 Ga0114129_10248653 Ga0114129_102486532 325
373 3300009148 Ga0105243_10000233 Ga0105243_1000023347 325
374 3300009148 Ga0105243_10271465 Ga0105243_102714652 325
375 3300009174 Ga0105241_10004813 Ga0105241_1000481310 325
376 3300009174 Ga0105241_10445593 Ga0105241_104455931 325
377 3300009176 Ga0105242_10000625 Ga0105242_100006251 325
378 3300009176 Ga0105242_10112177 Ga0105242_101121772 325
379 3300009177 Ga0105248_10005964 Ga0105248_1000596415 325
380 3300009177 Ga0105248_10048062 Ga0105248_100480622 325
381 3300009177 Ga0105248_10085514 Ga0105248_100855142 325
382 3300009545 Ga0105237_10006537 Ga0105237_1000653710 325
383 3300009551 Ga0105238_10023129 Ga0105238_100231296 325
384 3300009553 Ga0105249_10021566 Ga0105249_100215664 325
385 3300009553 Ga0105249_10235053 Ga0105249_102350532 325
386 3300010375 Ga0105239_10000033 Ga0105239_10000033160 325
387 3300010375 Ga0105239_10040808 Ga0105239_100408084 325
388 3300010375 Ga0105239_10130345 Ga0105239_101303452 325
389 3300011119 Ga0105246_10000058 Ga0105246_100000581 325
390 3300011119 Ga0105246_10033505 Ga0105246_100335054 325
391 3300011119 Ga0105246_10042754 Ga0105246_100427545 325
392 3300013100 Ga0157373_10002561 Ga0157373_100025614 325
393 3300013100 Ga0157373_10006435 Ga0157373_100064353 325
394 3300013100 Ga0157373_10243016 Ga0157373_102430162 325
395 3300013102 Ga0157371_10002421 Ga0157371_1000242119 325
396 3300013102 Ga0157371_10009277 Ga0157371_100092774 325
397 3300013102 Ga0157371_10172191 Ga0157371_101721912 325
398 3300013104 Ga0157370_10004153 Ga0157370_1000415311 325
399 3300013104 Ga0157370_10004666 Ga0157370_1000466613 325
400 3300013104 Ga0157370_10014316 Ga0157370_100143168 325
401 3300013104 Ga0157370_10057498 Ga0157370_100574984 325
402 3300013104 Ga0157370_10078142 Ga0157370_100781424 325
403 3300013104 Ga0157370_10118740 Ga0157370_101187402 325
404 3300013104 Ga0157370_10162596 Ga0157370_101625962 325
405 3300013105 Ga0157369_10007040 Ga0157369_1000704013 325
406 3300013297 Ga0157378_10024775 Ga0157378_100247752 325
407 3300013306 Ga0163162_10012818 Ga0163162_100128187 325
408 3300013306 Ga0163162_10043764 Ga0163162_100437646 325
409 3300013306 Ga0163162_10123219 Ga0163162_101232193 325
410 3300013306 Ga0163162_10128911 Ga0163162_101289113 325
411 3300013306 Ga0163162_10201771 Ga0163162_102017712 325
412 3300013306 Ga0163162_10275575 Ga0163162_102755752 325
413 3300013308 Ga0157375_10000904 Ga0157375_1000090413 325
414 3300013308 Ga0157375_10002641 Ga0157375_1000264113 325
415 3300013308 Ga0157375_10006942 Ga0157375_100069425 325
416 3300013308 Ga0157375_10159839 Ga0157375_101598393 325
417 3300014326 Ga0157380_10001119 Ga0157380_1000111910 325
418 3300014326 Ga0157380_10129955 Ga0157380_101299552 325
419 3300014326 Ga0157380_10176449 Ga0157380_101764491 325
420 3300014497 Ga0182008_10002677 Ga0182008_100026778 325
421 3300014497 Ga0182008_10004190 Ga0182008_100041905 325
422 3300014497 Ga0182008_10006903 Ga0182008_100069034 325
423 3300014497 Ga0182008_10013085 Ga0182008_100130854 325
424 3300014497 Ga0182008_10015667 Ga0182008_100156675 325
425 3300014497 Ga0182008_10134174 Ga0182008_101341742 325
426 3300014497 Ga0182008_10190314 Ga0182008_101903141 325
427 3300014745 Ga0157377_10002624 Ga0157377_100026246 325
428 3300014745 Ga0157377_10030559 Ga0157377_100305592 325
429 3300014968 Ga0157379_10001136 Ga0157379_1000113615 325
430 3300014969 Ga0157376_10000941 Ga0157376_1000094113 325
431 3300014969 Ga0157376_10014199 Ga0157376_100141995 325
432 3300014969 Ga0157376_10051877 Ga0157376_100518772 325
433 3300015261 Ga0182006_1000083 Ga0182006_100008380 325
434 3300015261 Ga0182006_1002021 Ga0182006_10020219 325
435 3300015261 Ga0182006_1018107 Ga0182006_10181072 325
436 3300015261 Ga0182006_1022438 Ga0182006_10224382 325
437 3300015262 Ga0182007_10000086 Ga0182007_1000008644 325
438 3300015262 Ga0182007_10035409 Ga0182007_100354092 325
439 3300015265 Ga0182005_1000675 Ga0182005_10006758 325
440 3300015265 Ga0182005_1005936 Ga0182005_10059362 325
441 3300015265 Ga0182005_1009968 Ga0182005_10099682 325
442 3300015265 Ga0182005_1022603 Ga0182005_10226031 325
443 3300017792 Ga0163161_10002612 Ga0163161_100026122 325
444 3300017792 Ga0163161_10004580 Ga0163161_100045802 325
445 3300017792 Ga0163161_10011584 Ga0163161_100115843 325
446 3300017792 Ga0163161_10021506 Ga0163161_100215062 325
447 3300017792 Ga0163161_10134852 Ga0163161_101348522 325
448 3300025207 Ga0209760_100405 Ga0209760_1004054 325
449 3300025224 Ga0209784_100026 Ga0209784_100026296 325
450 3300025231 Ga0207427_100023 Ga0207427_100023296 325
451 3300025233 Ga0209437_100015 Ga0209437_100015620 325
452 3300025242 Ga0209258_100043 Ga0209258_10004315 325
453 3300025250 Ga0209026_1000047 Ga0209026_100004715 325
454 3300025254 Ga0209148_1000010 Ga0209148_1000010295 325
455 3300025256 Ga0209759_1000715 Ga0209759_10007156 325
456 3300025261 Ga0209233_1000009 Ga0209233_1000009877 325
457 3300025272 Ga0209455_1000020 Ga0209455_1000020309 325
458 3300025291 Ga0209675_1002396 Ga0209675_10023966 325
459 3300025292 Ga0209676_1000002 Ga0209676_10000021019 325
460 3300025292 Ga0209676_1003788 Ga0209676_10037887 325
461 3300025294 Ga0209025_1000010 Ga0209025_1000010582 325
462 3300025298 Ga0209050_1000006 Ga0209050_1000006551 325
463 3300025298 Ga0209050_1005631 Ga0209050_10056312 325
464 3300025303 Ga0209051_1000001 Ga0209051_10000011019 325
465 3300025303 Ga0209051_1012244 Ga0209051_10122445 325
466 3300025304 Ga0209257_1000029 Ga0209257_1000029551 325
467 3300025711 Ga0207696_1000405 Ga0207696_10004054 325
468 3300025711 Ga0207696_1003824 Ga0207696_10038242 325
469 3300025728 Ga0207655_1000481 Ga0207655_100048119 325
470 3300025728 Ga0207655_1002986 Ga0207655_10029861 325
471 3300025728 Ga0207655_1004462 Ga0207655_10044625 325
472 3300025728 Ga0207655_1016216 Ga0207655_10162164 325
473 3300025735 Ga0207713_1000893 Ga0207713_10008932 325
474 3300025735 Ga0207713_1002558 Ga0207713_10025588 325
475 3300025898 Ga0207692_10034656 Ga0207692_100346562 325
476 3300025900 Ga0207710_10008378 Ga0207710_100083781 325
477 3300025900 Ga0207710_10013949 Ga0207710_100139492 325
478 3300025901 Ga0207688_10001350 Ga0207688_100013509 325
479 3300025903 Ga0207680_10002690 Ga0207680_100026908 325
480 3300025904 Ga0207647_10001011 Ga0207647_100010119 325
481 3300025905 Ga0207685_10005233 Ga0207685_100052333 325
482 3300025907 Ga0207645_10002031 Ga0207645_1000203110 325
483 3300025909 Ga0207705_10225365 Ga0207705_102253651 325
484 3300025911 Ga0207654_10013888 Ga0207654_100138884 325
485 3300025912 Ga0207707_10023111 Ga0207707_100231113 325
486 3300025912 Ga0207707_10282464 Ga0207707_102824641 325
487 3300025913 Ga0207695_10005620 Ga0207695_100056207 325
488 3300025915 Ga0207693_10000062 Ga0207693_1000006260 325
489 3300025916 Ga0207663_10001357 Ga0207663_100013575 325
490 3300025917 Ga0207660_10006479 Ga0207660_100064793 325
491 3300025919 Ga0207657_10000023 Ga0207657_1000002322 325
492 3300025920 Ga0207649_10002977 Ga0207649_100029777 325
493 3300025923 Ga0207681_10004374 Ga0207681_100043742 325
494 3300025923 Ga0207681_10092779 Ga0207681_100927791 325
495 3300025925 Ga0207650_10003802 Ga0207650_100038026 325
496 3300025926 Ga0207659_10010335 Ga0207659_100103354 325
497 3300025927 Ga0207687_10003089 Ga0207687_100030894 325
498 3300025929 Ga0207664_10071628 Ga0207664_100716283 325
499 3300025932 Ga0207690_10000718 Ga0207690_1000071813 325
500 3300025933 Ga0207706_10000019 Ga0207706_1000001929 325
501 3300025933 Ga0207706_10125161 Ga0207706_101251613 325
502 3300025935 Ga0207709_10002908 Ga0207709_100029082 325
503 3300025935 Ga0207709_10183391 Ga0207709_101833911 325
504 3300025936 Ga0207670_10007526 Ga0207670_100075265 325
505 3300025937 Ga0207669_10008631 Ga0207669_100086311 325
506 3300025937 Ga0207669_10307788 Ga0207669_103077881 325
507 3300025938 Ga0207704_10060146 Ga0207704_100601463 325
508 3300025939 Ga0207665_10000161 Ga0207665_1000016110 325
509 3300025940 Ga0207691_10002469 Ga0207691_100024697 325
510 3300025942 Ga0207689_10006185 Ga0207689_100061856 325
511 3300025944 Ga0207661_10006687 Ga0207661_100066874 325
512 3300025949 Ga0207667_10048216 Ga0207667_100482162 325
513 3300025960 Ga0207651_10011625 Ga0207651_100116255 325
514 3300025960 Ga0207651_10317025 Ga0207651_103170251 325
515 3300025961 Ga0207712_10007216 Ga0207712_100072164 325
516 3300025972 Ga0207668_10002748 Ga0207668_100027485 325
517 3300025972 Ga0207668_10105038 Ga0207668_101050382 325
518 3300025981 Ga0207640_10144135 Ga0207640_101441352 325
519 3300025986 Ga0207658_10069788 Ga0207658_100697882 325
520 3300025986 Ga0207658_10353570 Ga0207658_103535701 325
521 3300026035 Ga0207703_10027778 Ga0207703_100277785 325
522 3300026041 Ga0207639_10002698 Ga0207639_100026985 325
523 3300026067 Ga0207678_10000017 Ga0207678_1000001729 325
524 3300026067 Ga0207678_10097106 Ga0207678_100971063 325
525 3300026067 Ga0207678_10128460 Ga0207678_101284602 325
526 3300026075 Ga0207708_10000315 Ga0207708_1000031518 325
527 3300026075 Ga0207708_10024104 Ga0207708_100241042 325
528 3300026075 Ga0207708_10054070 Ga0207708_100540701 325
529 3300026078 Ga0207702_10273898 Ga0207702_102738981 325
530 3300026088 Ga0207641_10025704 Ga0207641_100257045 325
531 3300026089 Ga0207648_10014325 Ga0207648_100143256 325
532 3300026089 Ga0207648_10342553 Ga0207648_103425531 325
533 3300026095 Ga0207676_10024347 Ga0207676_100243472 325
534 3300026118 Ga0207675_100000439 Ga0207675_1000004397 325
535 3300026121 Ga0207683_10000030 Ga0207683_1000003071 325
536 3300026142 Ga0207698_10104671 Ga0207698_101046713 325
537 3300027111 Ga0209281_1000534 Ga0209281_100053423 325
538 3300027111 Ga0209281_1010564 Ga0209281_10105643 325
539 3300027907 Ga0207428_10013069 Ga0207428_100130691 325
540 3300027907 Ga0207428_10063830 Ga0207428_100638302 325
541 3300027907 Ga0207428_10212828 Ga0207428_102128281 325
542 3300028379 Ga0268266_10367654 Ga0268266_103676542 325
543 3300028380 Ga0268265_10048382 Ga0268265_100483821 325
544 3300028380 Ga0268265_10168506 Ga0268265_101685061 325
545 3300028380 Ga0268265_10265606 Ga0268265_102656061 325
546 3300028381 Ga0268264_10007754 Ga0268264_100077544 325
547 3300028381 Ga0268264_10063714 Ga0268264_100637144 325
548 3300028556 Ga0265337_1009926 Ga0265337_10099262 325
549 3300028563 Ga0265319_1001000 Ga0265319_100100011 325
550 3300028653 Ga0265323_10000409 Ga0265323_100004094 325
551 3300028666 Ga0265336_10000099 Ga0265336_1000009942 325
552 3300028800 Ga0265338_10000207 Ga0265338_1000020755 325
553 3300029957 Ga0265324_10017130 Ga0265324_100171302 325
554 3300031235 Ga0265330_10040844 Ga0265330_100408442 325
555 3300031241 Ga0265325_10033605 Ga0265325_100336052 325
556 3300031911 Ga0307412_10032254 Ga0307412_100322541 325
557 3300035114 Ga0373939_0017207 Ga0373939_0017207_777_1784 325
558 3300035170 Ga0373943_0088480 Ga0373943_0088480_436_1443 325
559 3300035172 Ga0373955_0129711 Ga0373955_0129711_428_1435 325
560 3300035242 Ga0373962_0003078 Ga0373962_0003078_1133_2140 325
561 3300035691 Ga0373931_0000691 Ga0373931_0000691_9229_10236 325
562 3300035691 Ga0373931_0147111 Ga0373931_0147111_300_1307 325
563 3300035692 Ga0373935_0082940 Ga0373935_0082940_601_1608 325
564 3300035695 Ga0373927_0001084 Ga0373927_0001084_5169_6176 325
565 3300035725 Ga0373947_0001088 Ga0373947_0001088_1932_2939 325
566 3300036401 Ga0373937_0115504 Ga0373937_0115504_87_1094 325
567 3300037068 Ga0373925_0009820 Ga0373925_0009820_761_1768 325
568 3300037418 Ga0395900_0021026 Ga0395900_0021026_2558_3565 325
569 3300037466 Ga0395898_0053977 Ga0395898_0053977_2118_3152 325
570 3300037466 Ga0395898_0129439 Ga0395898_0129439_615_1622 325
571 3300037471 Ga0395905_0001187 Ga0395905_0001187_1546_2553 325
572 3300037471 Ga0395905_0073920 Ga0395905_0073920_1066_2100 325
573 3300038443 Ga0395901_0001359 Ga0395901_0001359_23288_24295 325
574 3300041405 Ga0439438_008693 Ga0439438_008693_1735_2712 325
575 3300041407 Ga0439447_000014 Ga0439447_000014_56787_57797 325
576 3300041407 Ga0439447_000414 Ga0439447_000414_131_1108 325
577 3300041411 Ga0439466_0002820 Ga0439466_0002820_2397_3407 325
578 3300041411 Ga0439466_0013376 Ga0439466_0013376_1749_2741 325
579 3300041411 Ga0439466_0022364 Ga0439466_0022364_552_1529 325
580 3300042009 Ga0439451_010941 Ga0439451_010941_59_1051 325
581 3300042009 Ga0439451_012870 Ga0439451_012870_193_1170 325
582 3300042010 Ga0439452_000137 Ga0439452_000137_46056_47033 325
583 3300042010 Ga0439452_012445 Ga0439452_012445_820_1797 325
584 3300042013 Ga0439456_006194 Ga0439456_006194_1080_2057 325
585 3300042013 Ga0439456_006458 Ga0439456_006458_678_1655 325
586 3300042016 Ga0439463_017211 Ga0439463_017211_580_1557 325
587 3300042115 Ga0450911_002279 Ga0450911_002279_2000_2977 325
588 3300042115 Ga0450911_009615 Ga0450911_009615_300_1277 325
589 3300042138 Ga0450903_000548 Ga0450903_000548_4322_5314 325
590 3300042138 Ga0450903_002041 Ga0450903_002041_487_1464 325
591 3300042138 Ga0450903_009088 Ga0450903_009088_106_1083 325
592 3300042142 Ga0450905_003625 Ga0450905_003625_108_1085 325
593 3300042145 Ga0450906_013666 Ga0450906_013666_475_1452 325
594 3300042146 Ga0450907_001628 Ga0450907_001628_2794_3771 325
595 3300042147 Ga0450910_000637 Ga0450910_000637_379_1356 325
596 3300042461 Ga0439460_0002902 Ga0439460_0002902_283_1260 325
597 3300046452 Ga0495617_000106 Ga0495617_000106_21098_22075 325
598 3300046452 Ga0495617_000201 Ga0495617_000201_31889_32866 325
599 3300046452 Ga0495617_003527 Ga0495617_003527_3319_4296 325
600 3300046452 Ga0495617_004861 Ga0495617_004861_2463_3440 325
601 3300046452 Ga0495617_006482 Ga0495617_006482_2826_3803 325
602 3300046452 Ga0495617_025287 Ga0495617_025287_250_1227 325
603 3300046452 Ga0495617_028601 Ga0495617_028601_175_1152 325
604 3300046453 Ga0495627_002130 Ga0495627_002130_2229_3206 325
605 3300046453 Ga0495627_011247 Ga0495627_011247_1240_2259 325
606 3300046455 Ga0495603_0000238 Ga0495603_0000238_21661_22668 325
607 3300046455 Ga0495603_0003168 Ga0495603_0003168_167_1144 325
608 3300046455 Ga0495603_0026485 Ga0495603_0026485_100_1077 325
609 3300046455 Ga0495603_0042054 Ga0495603_0042054_1113_2090 325
610 3300046455 Ga0495603_0073397 Ga0495603_0073397_971_1948 325
611 3300046455 Ga0495603_0179507 Ga0495603_0179507_68_1102 325
612 3300046457 Ga0495590_0000226 Ga0495590_0000226_6554_7531 325
613 3300046457 Ga0495590_0002968 Ga0495590_0002968_2046_3023 325
614 3300046457 Ga0495590_0008979 Ga0495590_0008979_2261_3238 325
615 3300046457 Ga0495590_0024121 Ga0495590_0024121_243_1220 325
616 3300046458 Ga0495591_000139 Ga0495591_000139_6889_7866 325
617 3300046458 Ga0495591_003357 Ga0495591_003357_1065_2042 325
618 3300046458 Ga0495591_004318 Ga0495591_004318_3296_4288 325
619 3300046458 Ga0495591_005080 Ga0495591_005080_2730_3707 325
620 3300046458 Ga0495591_006752 Ga0495591_006752_512_1489 325
621 3300046458 Ga0495591_008966 Ga0495591_008966_3009_3986 325
622 3300046458 Ga0495591_018119 Ga0495591_018119_1123_2142 325
623 3300046458 Ga0495591_021457 Ga0495591_021457_745_1722 325
624 3300046458 Ga0495591_043537 Ga0495591_043537_269_1246 325
625 3300046459 Ga0495629_0000781 Ga0495629_0000781_5358_6365 325
626 3300046459 Ga0495629_0009940 Ga0495629_0009940_3361_4413 325
627 3300046460 Ga0495638_0000117 Ga0495638_0000117_72290_73267 325
628 3300046460 Ga0495638_0003030 Ga0495638_0003030_2853_3830 325
629 3300046460 Ga0495638_0006658 Ga0495638_0006658_6926_7903 325
630 3300046460 Ga0495638_0008506 Ga0495638_0008506_4879_5856 325
631 3300046460 Ga0495638_0015837 Ga0495638_0015837_1608_2585 325
632 3300046460 Ga0495638_0021001 Ga0495638_0021001_1491_2513 325
633 3300046460 Ga0495638_0024211 Ga0495638_0024211_1277_2254 325
634 3300046460 Ga0495638_0038404 Ga0495638_0038404_855_1961 325
635 3300046460 Ga0495638_0078104 Ga0495638_0078104_1023_2000 325
636 3300046463 Ga0495653_0001441 Ga0495653_0001441_11152_12150 325
637 3300046463 Ga0495653_0007024 Ga0495653_0007024_967_2019 325
638 3300046463 Ga0495653_0016699 Ga0495653_0016699_2622_3599 325
639 3300046463 Ga0495653_0073281 Ga0495653_0073281_337_1314 325
640 3300046471 Ga0495650_0001886 Ga0495650_0001886_3209_4201 325
641 3300046471 Ga0495650_0003727 Ga0495650_0003727_5971_7005 325
642 3300046471 Ga0495650_0007809 Ga0495650_0007809_1064_2041 325
643 3300046471 Ga0495650_0008937 Ga0495650_0008937_1230_2207 325
644 3300046471 Ga0495650_0038164 Ga0495650_0038164_1028_2005 325
645 3300046471 Ga0495650_0095781 Ga0495650_0095781_79_1056 325
646 3300046472 Ga0495580_0000522 Ga0495580_0000522_29642_30649 325
647 3300046473 Ga0495582_0000670 Ga0495582_0000670_14070_15077 325
648 3300046473 Ga0495582_0009450 Ga0495582_0009450_956_2008 325
649 3300046474 Ga0495605_0000114 Ga0495605_0000114_19504_20481 325
650 3300046474 Ga0495605_0000557 Ga0495605_0000557_19609_20586 325
651 3300046474 Ga0495605_0002643 Ga0495605_0002643_5245_6222 325
652 3300046474 Ga0495605_0005058 Ga0495605_0005058_5942_6919 325
653 3300046474 Ga0495605_0007050 Ga0495605_0007050_903_1880 325
654 3300046474 Ga0495605_0008069 Ga0495605_0008069_2831_3850 325
655 3300046474 Ga0495605_0010101 Ga0495605_0010101_290_1324 325
656 3300046474 Ga0495605_0015923 Ga0495605_0015923_427_1404 325
657 3300046474 Ga0495605_0034356 Ga0495605_0034356_748_1725 325
658 3300046474 Ga0495605_0037372 Ga0495605_0037372_968_1945 325
659 3300046475 Ga0495639_0000001 Ga0495639_0000001_131148_132125 325
660 3300046475 Ga0495639_0006700 Ga0495639_0006700_853_1905 325
661 3300046475 Ga0495639_0013989 Ga0495639_0013989_1744_2721 325
662 3300046475 Ga0495639_0015494 Ga0495639_0015494_44_1051 325
663 3300046475 Ga0495639_0026285 Ga0495639_0026285_240_1217 325
664 3300046475 Ga0495639_0031314 Ga0495639_0031314_398_1375 325
665 3300046491 Ga0495584_0000140 Ga0495584_0000140_2157_3134 325
666 3300046491 Ga0495584_0000469 Ga0495584_0000469_14553_15530 325
667 3300046491 Ga0495584_0001357 Ga0495584_0001357_7329_8306 325
668 3300046491 Ga0495584_0010763 Ga0495584_0010763_2784_3761 325
669 3300046491 Ga0495584_0019149 Ga0495584_0019149_237_1214 325
670 3300046491 Ga0495584_0020466 Ga0495584_0020466_1552_2571 325
671 3300046491 Ga0495584_0040341 Ga0495584_0040341_1242_2249 325
672 3300046492 Ga0495585_0000605 Ga0495585_0000605_26398_27375 325
673 3300046492 Ga0495585_0003016 Ga0495585_0003016_10541_11539 325
674 3300046492 Ga0495585_0003480 Ga0495585_0003480_7032_8009 325
675 3300046492 Ga0495585_0006756 Ga0495585_0006756_2055_3032 325
676 3300046492 Ga0495585_0009789 Ga0495585_0009789_725_1702 325
677 3300046492 Ga0495585_0016584 Ga0495585_0016584_2232_3209 325
678 3300046492 Ga0495585_0018499 Ga0495585_0018499_1287_2264 325
679 3300046492 Ga0495585_0060336 Ga0495585_0060336_936_1913 325
680 3300046499 Ga0495594_0000025 Ga0495594_0000025_48696_49703 325
681 3300046499 Ga0495594_0001211 Ga0495594_0001211_3165_4142 325
682 3300046499 Ga0495594_0013051 Ga0495594_0013051_699_1751 325
683 3300046499 Ga0495594_0015740 Ga0495594_0015740_1370_2347 325
684 3300046500 Ga0495596_0025824 Ga0495596_0025824_655_1632 325
685 3300046501 Ga0495607_0000188 Ga0495607_0000188_63614_64591 325
686 3300046501 Ga0495607_0000709 Ga0495607_0000709_10196_11188 325
687 3300046501 Ga0495607_0001305 Ga0495607_0001305_3926_4960 325
688 3300046501 Ga0495607_0003254 Ga0495607_0003254_5500_6477 325
689 3300046501 Ga0495607_0020829 Ga0495607_0020829_2263_3240 325
690 3300046501 Ga0495607_0036444 Ga0495607_0036444_185_1204 325
691 3300046501 Ga0495607_0041815 Ga0495607_0041815_439_1425 325
692 3300046501 Ga0495607_0085595 Ga0495607_0085595_308_1285 325
693 3300046506 Ga0495583_0003084 Ga0495583_0003084_8886_9863 325
694 3300046506 Ga0495583_0004168 Ga0495583_0004168_7751_8728 325
695 3300046506 Ga0495583_0006113 Ga0495583_0006113_4024_5001 325
696 3300046507 Ga0495606_0001909 Ga0495606_0001909_20349_21368 325
697 3300046507 Ga0495606_0003137 Ga0495606_0003137_10775_11773 325
698 3300046507 Ga0495606_0003315 Ga0495606_0003315_14635_15612 325
699 3300046507 Ga0495606_0005520 Ga0495606_0005520_7425_8459 325
700 3300046507 Ga0495606_0011709 Ga0495606_0011709_4608_5585 325
701 3300046507 Ga0495606_0071619 Ga0495606_0071619_969_1946 325
702 3300046512 Ga0495610_0000577 Ga0495610_0000577_7214_8191 325
703 3300046512 Ga0495610_0002921 Ga0495610_0002921_9532_10509 325
704 3300046512 Ga0495610_0005314 Ga0495610_0005314_5986_6978 325
705 3300046512 Ga0495610_0015560 Ga0495610_0015560_1575_2552 325
706 3300046512 Ga0495610_0022499 Ga0495610_0022499_1458_2564 325
707 3300046512 Ga0495610_0025009 Ga0495610_0025009_1691_2668 325
708 3300046512 Ga0495610_0097142 Ga0495610_0097142_42_1061 325
709 3300046513 Ga0495616_0002771 Ga0495616_0002771_3496_4473 325
710 3300046513 Ga0495616_0004149 Ga0495616_0004149_7805_8782 325
711 3300046513 Ga0495616_0004349 Ga0495616_0004349_3169_4146 325
712 3300046513 Ga0495616_0006099 Ga0495616_0006099_1647_2624 325
713 3300046513 Ga0495616_0027320 Ga0495616_0027320_1048_2025 325
714 3300046513 Ga0495616_0027440 Ga0495616_0027440_1735_2712 325
715 3300046515 Ga0495620_0003671 Ga0495620_0003671_1700_2734 325
716 3300046515 Ga0495620_0004593 Ga0495620_0004593_5600_6619 325
717 3300046515 Ga0495620_0004634 Ga0495620_0004634_3307_4299 325
718 3300046515 Ga0495620_0006538 Ga0495620_0006538_4875_5852 325
719 3300046515 Ga0495620_0021167 Ga0495620_0021167_253_1230 325
720 3300046515 Ga0495620_0026770 Ga0495620_0026770_1310_2287 325
721 3300046516 Ga0495628_0066143 Ga0495628_0066143_212_1189 325
722 3300046517 Ga0495630_0000706 Ga0495630_0000706_5223_6200 325
723 3300046517 Ga0495630_0006789 Ga0495630_0006789_1062_2039 325
724 3300046517 Ga0495630_0025835 Ga0495630_0025835_1355_2332 325
725 3300046517 Ga0495630_0026071 Ga0495630_0026071_957_2009 325
726 3300046518 Ga0495631_0000002 Ga0495631_0000002_119203_120237 325
727 3300046518 Ga0495631_0000005 Ga0495631_0000005_87622_88599 325
728 3300046518 Ga0495631_0021330 Ga0495631_0021330_79_1056 325
729 3300046518 Ga0495631_0021622 Ga0495631_0021622_1395_2414 325
730 3300046519 Ga0495632_0000322 Ga0495632_0000322_13172_14149 325
731 3300046519 Ga0495632_0001664 Ga0495632_0001664_2135_3112 325
732 3300046519 Ga0495632_0006053 Ga0495632_0006053_587_1564 325
733 3300046519 Ga0495632_0009894 Ga0495632_0009894_3320_4339 325
734 3300046519 Ga0495632_0013189 Ga0495632_0013189_1897_2874 325
735 3300046519 Ga0495632_0077760 Ga0495632_0077760_411_1388 325
736 3300046519 Ga0495632_0097640 Ga0495632_0097640_366_1343 325
737 3300046519 Ga0495632_0107873 Ga0495632_0107873_295_1272 325
738 3300046520 Ga0495637_0000681 Ga0495637_0000681_17663_18640 325
739 3300046520 Ga0495637_0004891 Ga0495637_0004891_816_1793 325
740 3300046520 Ga0495637_0007731 Ga0495637_0007731_213_1190 325
741 3300046520 Ga0495637_0008150 Ga0495637_0008150_2294_3271 325
742 3300046520 Ga0495637_0010618 Ga0495637_0010618_2966_3943 325
743 3300046520 Ga0495637_0012047 Ga0495637_0012047_1168_2145 325
744 3300046520 Ga0495637_0023014 Ga0495637_0023014_355_1332 325
745 3300046520 Ga0495637_0027239 Ga0495637_0027239_1215_2234 325
746 3300046520 Ga0495637_0087599 Ga0495637_0087599_143_1135 325
747 3300046522 Ga0495643_0015564 Ga0495643_0015564_3263_4369 325
748 3300046522 Ga0495643_0019946 Ga0495643_0019946_2274_3293 325
749 3300046523 Ga0495644_0001290 Ga0495644_0001290_1277_2254 325
750 3300046523 Ga0495644_0055584 Ga0495644_0055584_463_1440 325
751 3300046524 Ga0495648_0003121 Ga0495648_0003121_13119_14096 325
752 3300046524 Ga0495648_0004989 Ga0495648_0004989_1908_2885 325
753 3300046524 Ga0495648_0007416 Ga0495648_0007416_7637_8614 325
754 3300046524 Ga0495648_0016666 Ga0495648_0016666_764_1741 325
755 3300046524 Ga0495648_0019606 Ga0495648_0019606_1327_2304 325
756 3300046524 Ga0495648_0064662 Ga0495648_0064662_181_1158 325
757 3300046524 Ga0495648_0171466 Ga0495648_0171466_53_1072 325
758 3300046525 Ga0495663_0031541 Ga0495663_0031541_124_1131 325
759 3300046526 Ga0495666_0000043 Ga0495666_0000043_36082_37059 325
760 3300046526 Ga0495666_0001238 Ga0495666_0001238_3702_4679 325
761 3300046526 Ga0495666_0005337 Ga0495666_0005337_1967_2944 325
762 3300046526 Ga0495666_0022824 Ga0495666_0022824_1953_2930 325
763 3300046526 Ga0495666_0063680 Ga0495666_0063680_325_1332 325
764 3300046528 Ga0495642_0000019 Ga0495642_0000019_90177_91154 325
765 3300046528 Ga0495642_0000130 Ga0495642_0000130_11978_12955 325
766 3300046528 Ga0495642_0000221 Ga0495642_0000221_23350_24327 325
767 3300046530 Ga0495654_0000088 Ga0495654_0000088_53732_54709 325
768 3300046530 Ga0495654_0001307 Ga0495654_0001307_6028_7020 325
769 3300046530 Ga0495654_0004399 Ga0495654_0004399_3799_4776 325
770 3300046530 Ga0495654_0008378 Ga0495654_0008378_4694_5671 325
771 3300046530 Ga0495654_0010718 Ga0495654_0010718_3519_4496 325
772 3300046530 Ga0495654_0012190 Ga0495654_0012190_717_1694 325
773 3300046530 Ga0495654_0012471 Ga0495654_0012471_2040_3017 325
774 3300046530 Ga0495654_0013597 Ga0495654_0013597_443_1420 325
775 3300046530 Ga0495654_0014729 Ga0495654_0014729_2034_3011 325
776 3300046530 Ga0495654_0017179 Ga0495654_0017179_1002_2036 325
777 3300046530 Ga0495654_0021708 Ga0495654_0021708_2013_2990 325
778 3300046530 Ga0495654_0030618 Ga0495654_0030618_518_1624 325
779 3300046530 Ga0495654_0035971 Ga0495654_0035971_1277_2254 325
780 3300046531 Ga0495665_0002289 Ga0495665_0002289_8418_9425 325
781 3300046535 Ga0495586_0007464 Ga0495586_0007464_3170_4222 325
782 3300046536 Ga0495587_0006912 Ga0495587_0006912_3626_4603 325
783 3300046536 Ga0495587_0053762 Ga0495587_0053762_965_2017 325
784 3300046537 Ga0495598_0063608 Ga0495598_0063608_47_1024 325
785 3300046538 Ga0495609_0001246 Ga0495609_0001246_15219_16196 325
786 3300046538 Ga0495609_0001924 Ga0495609_0001924_6318_7295 325
787 3300046538 Ga0495609_0002918 Ga0495609_0002918_3195_4172 325
788 3300046538 Ga0495609_0006052 Ga0495609_0006052_2562_3539 325
789 3300046538 Ga0495609_0018581 Ga0495609_0018581_1860_2837 325
790 3300046538 Ga0495609_0054110 Ga0495609_0054110_280_1257 325
791 3300046542 Ga0495597_0007011 Ga0495597_0007011_1856_2833 325
792 3300046542 Ga0495597_0007149 Ga0495597_0007149_4547_5524 325
793 3300046542 Ga0495597_0011444 Ga0495597_0011444_3247_4224 325
794 3300046542 Ga0495597_0014156 Ga0495597_0014156_489_1508 325
795 3300046542 Ga0495597_0041379 Ga0495597_0041379_376_1353 325
796 3300046542 Ga0495597_0062137 Ga0495597_0062137_399_1376 325
797 3300046542 Ga0495597_0085661 Ga0495597_0085661_212_1189 325
798 3300046543 Ga0495645_0037872 Ga0495645_0037872_2346_3398 325
799 3300046557 Ga0495622_0000347 Ga0495622_0000347_26521_27498 325
800 3300046557 Ga0495622_0000784 Ga0495622_0000784_9552_10529 325
801 3300046557 Ga0495622_0014420 Ga0495622_0014420_2640_3617 325
802 3300046557 Ga0495622_0024060 Ga0495622_0024060_1374_2351 325
803 3300046558 Ga0495633_0000412 Ga0495633_0000412_42077_43054 325
804 3300046558 Ga0495633_0001574 Ga0495633_0001574_10372_11349 325
805 3300046558 Ga0495633_0007856 Ga0495633_0007856_3073_4179 325
806 3300046558 Ga0495633_0050633 Ga0495633_0050633_607_1584 325
807 3300046615 Ga0495656_0005448 Ga0495656_0005448_2951_3928 325
808 3300046615 Ga0495656_0020605 Ga0495656_0020605_849_1826 325
809 3300046615 Ga0495656_0054045 Ga0495656_0054045_657_1664 325
810 3300046615 Ga0495656_0059756 Ga0495656_0059756_126_1103 325
811 3300046616 Ga0495668_0031160 Ga0495668_0031160_537_1514 325
812 3300046616 Ga0495668_0033454 Ga0495668_0033454_318_1295 325
813 3300046616 Ga0495668_0204165 Ga0495668_0204165_40_1032 325
814 3300046642 Ga0495634_0003589 Ga0495634_0003589_2724_3701 325
815 3300046642 Ga0495634_0031362 Ga0495634_0031362_633_1640 325
816 3300046648 Ga0495611_0000612 Ga0495611_0000612_1224_2201 325
817 3300046648 Ga0495611_0005091 Ga0495611_0005091_4022_4999 325
818 3300046648 Ga0495611_0005145 Ga0495611_0005145_172_1149 325
819 3300046660 Ga0495625_0001435 Ga0495625_0001435_13663_14655 325
820 3300046660 Ga0495625_0003496 Ga0495625_0003496_7179_8213 325
821 3300046660 Ga0495625_0005271 Ga0495625_0005271_2484_3461 325
822 3300046660 Ga0495625_0006297 Ga0495625_0006297_6553_7530 325
823 3300046660 Ga0495625_0006992 Ga0495625_0006992_4817_5794 325
824 3300046660 Ga0495625_0036878 Ga0495625_0036878_2362_3339 325
825 3300046660 Ga0495625_0047511 Ga0495625_0047511_713_1732 325
826 3300046660 Ga0495625_0121169 Ga0495625_0121169_79_1056 325
827 3300046660 Ga0495625_0263251 Ga0495625_0263251_17_994 325
828 3300046663 Ga0495635_0005441 Ga0495635_0005441_4165_5142 325
829 3300046664 Ga0495659_0000002 Ga0495659_0000002_127649_128626 325
830 3300046664 Ga0495659_0003290 Ga0495659_0003290_1215_2192 325
831 3300046665 Ga0495661_0000036 Ga0495661_0000036_109745_110743 325
832 3300046665 Ga0495661_0018807 Ga0495661_0018807_2800_3819 325
833 3300046665 Ga0495661_0020356 Ga0495661_0020356_1149_2126 325
834 3300046665 Ga0495661_0029068 Ga0495661_0029068_675_1652 325
835 3300046665 Ga0495661_0070299 Ga0495661_0070299_627_1604 325
836 3300046665 Ga0495661_0080891 Ga0495661_0080891_270_1247 325
837 3300046674 Ga0495588_0004882 Ga0495588_0004882_2462_3439 325
838 3300046674 Ga0495588_0013375 Ga0495588_0013375_2469_3446 325
839 3300046674 Ga0495588_0018651 Ga0495588_0018651_783_1835 325
840 3300046674 Ga0495588_0024295 Ga0495588_0024295_1594_2571 325
841 3300046674 Ga0495588_0047393 Ga0495588_0047393_904_1911 325
842 3300046674 Ga0495588_0047943 Ga0495588_0047943_145_1122 325
843 3300046679 Ga0495623_0005212 Ga0495623_0005212_5765_6742 325
844 3300046679 Ga0495623_0006880 Ga0495623_0006880_3817_4794 325
845 3300046680 Ga0495646_0006459 Ga0495646_0006459_4187_5164 325
846 3300046681 Ga0495647_0007179 Ga0495647_0007179_985_1992 325
847 3300046683 Ga0495658_0001055 Ga0495658_0001055_2943_3950 325
848 3300046684 Ga0495669_0013407 Ga0495669_0013407_2014_2991 325
849 3300046689 Ga0495613_0000236 Ga0495613_0000236_19135_20142 325
850 3300046689 Ga0495613_0027231 Ga0495613_0027231_2224_3276 325
851 3300046689 Ga0495613_0051427 Ga0495613_0051427_2022_2999 325
852 3300046691 Ga0495670_0000596 Ga0495670_0000596_2034_3011 325
853 3300046691 Ga0495670_0001315 Ga0495670_0001315_6565_7542 325
854 3300046691 Ga0495670_0001962 Ga0495670_0001962_3893_4870 325
855 3300046691 Ga0495670_0003569 Ga0495670_0003569_545_1522 325
856 3300046691 Ga0495670_0010342 Ga0495670_0010342_1573_2550 325
857 3300046691 Ga0495670_0022689 Ga0495670_0022689_1092_2069 325
858 3300046691 Ga0495670_0024323 Ga0495670_0024323_814_1791 325
859 3300046691 Ga0495670_0025300 Ga0495670_0025300_1793_2770 325
860 3300046691 Ga0495670_0087280 Ga0495670_0087280_11_988 325
861 3300046691 Ga0495670_0114449 Ga0495670_0114449_44_1051 325
862 3300046692 Ga0495671_0000567 Ga0495671_0000567_12217_13194 325
863 3300046692 Ga0495671_0000807 Ga0495671_0000807_10160_11137 325
864 3300046692 Ga0495671_0005047 Ga0495671_0005047_1510_2496 325
865 3300046692 Ga0495671_0008889 Ga0495671_0008889_2863_3840 325
866 3300046692 Ga0495671_0021233 Ga0495671_0021233_298_1275 325
867 3300046692 Ga0495671_0031820 Ga0495671_0031820_1210_2187 325
868 3300046692 Ga0495671_0048874 Ga0495671_0048874_231_1208 325
869 3300046692 Ga0495671_0082008 Ga0495671_0082008_422_1399 325
870 3300046694 Ga0495649_0000013 Ga0495649_0000013_55595_56572 325
871 3300046694 Ga0495649_0001103 Ga0495649_0001103_16888_17865 325
872 3300046694 Ga0495649_0003185 Ga0495649_0003185_9457_10434 325
873 3300046694 Ga0495649_0004478 Ga0495649_0004478_6051_7028 325
874 3300046694 Ga0495649_0005254 Ga0495649_0005254_6877_7854 325
875 3300046694 Ga0495649_0019444 Ga0495649_0019444_1832_2809 325
876 3300046694 Ga0495649_0027772 Ga0495649_0027772_449_1426 325
877 3300046694 Ga0495649_0031137 Ga0495649_0031137_1615_2592 325
878 3300046694 Ga0495649_0044517 Ga0495649_0044517_1037_2014 325
879 3300046794 Ga0495589_0000123 Ga0495589_0000123_17229_18206 325
880 3300046794 Ga0495589_0000487 Ga0495589_0000487_25949_26926 325
881 3300046794 Ga0495589_0000650 Ga0495589_0000650_7510_8616 325
882 3300046794 Ga0495589_0004463 Ga0495589_0004463_4254_5231 325
883 3300046794 Ga0495589_0007473 Ga0495589_0007473_3296_4273 325
884 3300046794 Ga0495589_0026177 Ga0495589_0026177_1902_2879 325
885 3300046794 Ga0495589_0075597 Ga0495589_0075597_200_1234 325
886 3300046794 Ga0495589_0080729 Ga0495589_0080729_15_992 325
887 3300046794 Ga0495589_0128884 Ga0495589_0128884_174_1193 325
888 3300046809 Ga0495600_0019987 Ga0495600_0019987_1678_2655 325
889 3300046809 Ga0495600_0155638 Ga0495600_0155638_70_1122 325
890 3300046810 Ga0495660_0002985 Ga0495660_0002985_2000_2977 325
891 3300046810 Ga0495660_0007274 Ga0495660_0007274_4990_5967 325
892 3300046810 Ga0495660_0017347 Ga0495660_0017347_196_1173 325
893 3300046810 Ga0495660_0018155 Ga0495660_0018155_1769_2746 325
894 3300046810 Ga0495660_0026725 Ga0495660_0026725_2042_3019 325
895 3300046810 Ga0495660_0051817 Ga0495660_0051817_499_1476 325
896 3300046810 Ga0495660_0085492 Ga0495660_0085492_302_1279 325
897 3300046810 Ga0495660_0092293 Ga0495660_0092293_347_1324 325
898 3300047315 Ga0495581_0002739 Ga0495581_0002739_4196_5173 325
899 3300047315 Ga0495581_0003500 Ga0495581_0003500_5660_6667 325
900 3300047315 Ga0495581_0057407 Ga0495581_0057407_994_2046 325
901 3300047317 Ga0495604_0001667 Ga0495604_0001667_13431_14408 325
902 3300047317 Ga0495604_0019410 Ga0495604_0019410_442_1494 325
903 3300047317 Ga0495604_0086223 Ga0495604_0086223_362_1339 325
904 3300047317 Ga0495604_0233306 Ga0495604_0233306_69_1076 325
905 3300047318 Ga0495636_0000844 Ga0495636_0000844_391_1398 325
906 3300047318 Ga0495636_0004395 Ga0495636_0004395_3474_4451 325
907 3300047318 Ga0495636_0025461 Ga0495636_0025461_1093_2100 325
908 3300047319 Ga0495674_0006549 Ga0495674_0006549_7388_8365 325
909 3300047320 Ga0495672_0000773 Ga0495672_0000773_5405_6382 325
910 3300047320 Ga0495672_0001311 Ga0495672_0001311_1428_2405 325
911 3300047320 Ga0495672_0003350 Ga0495672_0003350_11558_12535 325
912 3300047320 Ga0495672_0006601 Ga0495672_0006601_4017_4994 325
913 3300047320 Ga0495672_0008255 Ga0495672_0008255_6144_7121 325
914 3300047320 Ga0495672_0012327 Ga0495672_0012327_3197_4174 325
915 3300047320 Ga0495672_0017001 Ga0495672_0017001_2658_3635 325
916 3300047320 Ga0495672_0019829 Ga0495672_0019829_1487_2464 325
917 3300047320 Ga0495672_0076972 Ga0495672_0076972_451_1428 325
918 3300047320 Ga0495672_0099858 Ga0495672_0099858_452_1429 325
919 3300047320 Ga0495672_0127192 Ga0495672_0127192_233_1210 325
920 3300047322 Ga0495680_0001808 Ga0495680_0001808_11600_12652 325
921 3300047322 Ga0495680_0005161 Ga0495680_0005161_2657_3634 325
922 3300047322 Ga0495680_0005410 Ga0495680_0005410_5981_6958 325
923 3300047322 Ga0495680_0031379 Ga0495680_0031379_3125_4102 325
924 3300047322 Ga0495680_0036454 Ga0495680_0036454_1598_2575 325
925 3300047322 Ga0495680_0152958 Ga0495680_0152958_661_1638 325
926 3300047323 Ga0495683_0000010 Ga0495683_0000010_116882_117874 325
927 3300047323 Ga0495683_0000037 Ga0495683_0000037_119582_120616 325
928 3300047323 Ga0495683_0000139 Ga0495683_0000139_24965_25942 325
929 3300047323 Ga0495683_0002618 Ga0495683_0002618_7720_8697 325
930 3300047323 Ga0495683_0002622 Ga0495683_0002622_7520_8497 325
931 3300047323 Ga0495683_0010235 Ga0495683_0010235_3333_4310 325
932 3300047323 Ga0495683_0016449 Ga0495683_0016449_2508_3485 325
933 3300047323 Ga0495683_0031822 Ga0495683_0031822_654_1631 325
934 3300047323 Ga0495683_0032697 Ga0495683_0032697_914_1891 325
935 3300047323 Ga0495683_0036020 Ga0495683_0036020_160_1137 325
936 3300047323 Ga0495683_0110572 Ga0495683_0110572_151_1128 325
937 3300047443 Ga0495687_001399 Ga0495687_001399_6822_7799 325
938 3300047443 Ga0495687_021012 Ga0495687_021012_1911_2888 325
939 3300047443 Ga0495687_084809 Ga0495687_084809_242_1219 325
940 3300047444 Ga0495675_0026843 Ga0495675_0026843_2586_3563 325
941 3300047444 Ga0495675_0051226 Ga0495675_0051226_1135_2187 325
942 3300047445 Ga0495677_0075961 Ga0495677_0075961_72_1049 325
943 3300047446 Ga0495679_002402 Ga0495679_002402_2369_3346 325
944 3300047446 Ga0495679_004407 Ga0495679_004407_2782_3858 325
945 3300047446 Ga0495679_005202 Ga0495679_005202_1859_2836 325
946 3300047446 Ga0495679_006403 Ga0495679_006403_1733_2752 325
947 3300047446 Ga0495679_045246 Ga0495679_045246_41_1018 325
948 3300047447 Ga0495685_004423 Ga0495685_004423_3338_4315 325
949 3300047447 Ga0495685_024352 Ga0495685_024352_1049_2026 325
950 3300047469 Ga0495673_0000084 Ga0495673_0000084_120877_121923 325
951 3300047469 Ga0495673_0000093 Ga0495673_0000093_69907_70941 325
952 3300047469 Ga0495673_0000434 Ga0495673_0000434_31060_32037 325
953 3300047469 Ga0495673_0001694 Ga0495673_0001694_10665_11642 325
954 3300047469 Ga0495673_0003443 Ga0495673_0003443_351_1328 325
955 3300047469 Ga0495673_0005152 Ga0495673_0005152_6953_7930 325
956 3300047469 Ga0495673_0010917 Ga0495673_0010917_82_1059 325
957 3300047469 Ga0495673_0014710 Ga0495673_0014710_778_1755 325
958 3300047469 Ga0495673_0024507 Ga0495673_0024507_584_1561 325
959 3300047469 Ga0495673_0025370 Ga0495673_0025370_462_1439 325
960 3300047469 Ga0495673_0034996 Ga0495673_0034996_447_1424 325
961 3300047470 Ga0495681_0000370 Ga0495681_0000370_26049_27026 325
962 3300047470 Ga0495681_0001251 Ga0495681_0001251_7427_8404 325
963 3300047470 Ga0495681_0001487 Ga0495681_0001487_12489_13466 325
964 3300047470 Ga0495681_0001828 Ga0495681_0001828_8033_9010 325
965 3300047470 Ga0495681_0003228 Ga0495681_0003228_7749_8726 325
966 3300047470 Ga0495681_0007652 Ga0495681_0007652_1745_2779 325
967 3300047470 Ga0495681_0016633 Ga0495681_0016633_1754_2731 325
968 3300047470 Ga0495681_0065108 Ga0495681_0065108_215_1192 325
969 3300047471 Ga0495684_0018688 Ga0495684_0018688_221_1198 325
970 3300047472 Ga0495686_0000291 Ga0495686_0000291_4088_5065 325
971 3300047472 Ga0495686_0084186 Ga0495686_0084186_64_1041 325
972 3300047673 Ga0495593_0000510 Ga0495593_0000510_20172_21179 325
973 3300047673 Ga0495593_0001007 Ga0495593_0001007_5081_6058 325
974 3300047673 Ga0495593_0003372 Ga0495593_0003372_2297_3274 325
975 3300047673 Ga0495593_0034317 Ga0495593_0034317_844_1821 325
976 3300048091 Ga0495626_0000031 Ga0495626_0000031_143743_144720 325
977 3300048091 Ga0495626_0000326 Ga0495626_0000326_45171_46148 325
978 3300048091 Ga0495626_0000340 Ga0495626_0000340_5810_6829 325
979 3300048091 Ga0495626_0000373 Ga0495626_0000373_34253_35230 325
980 3300048091 Ga0495626_0000631 Ga0495626_0000631_9343_10320 325
981 3300048091 Ga0495626_0002579 Ga0495626_0002579_7575_8552 325
982 3300048091 Ga0495626_0003819 Ga0495626_0003819_6926_7903 325
983 3300048091 Ga0495626_0004207 Ga0495626_0004207_6004_6981 325
984 3300048091 Ga0495626_0025179 Ga0495626_0025179_1283_2260 325
985 3300048903 Ga0496100_0000632 Ga0496100_0000632_11685_12692 325
986 3300048904 Ga0496101_0003736 Ga0496101_0003736_7666_8673 325
987 3300048905 Ga0496102_0000052 Ga0496102_0000052_163699_164676 325
988 3300048905 Ga0496102_0005098 Ga0496102_0005098_6946_7953 325
989 3300048905 Ga0496102_0009276 Ga0496102_0009276_2016_3023 325
990 3300048905 Ga0496102_0182413 Ga0496102_0182413_734_1777 325
991 3300048905 Ga0496102_0198595 Ga0496102_0198595_749_1756 325
992 3300048906 Ga0496103_0003881 Ga0496103_0003881_1701_2678 325
993 3300048906 Ga0496103_0009805 Ga0496103_0009805_3533_4540 325
994 3300048907 Ga0496104_0009987 Ga0496104_0009987_3882_4889 325
995 3300048907 Ga0496104_0013732 Ga0496104_0013732_3586_4593 325
996 3300048907 Ga0496104_0044933 Ga0496104_0044933_3034_4107 325
997 3300048908 Ga0496105_0004032 Ga0496105_0004032_5892_6899 325
998 3300048908 Ga0496105_0067673 Ga0496105_0067673_853_1830 325
999 3300048908 Ga0496105_0096306 Ga0496105_0096306_371_1444 325
1000 3300048909 Ga0496106_0222824 Ga0496106_0222824_152_1159 325
1001 3300048910 Ga0496107_0000431 Ga0496107_0000431_497_1570 325
1002 3300048910 Ga0496107_0021707 Ga0496107_0021707_153_1160 325
1003 3300048910 Ga0496107_0037617 Ga0496107_0037617_129_1136 325
1004 3300048910 Ga0496107_0049341 Ga0496107_0049341_575_1582 325
1005 3300048910 Ga0496107_0201487 Ga0496107_0201487_358_1365 325
1006 3300048911 Ga0496108_0058039 Ga0496108_0058039_306_1313 325
1007 3300048911 Ga0496108_0097493 Ga0496108_0097493_818_1825 325
1008 3300048911 Ga0496108_0281780 Ga0496108_0281780_45_1052 325
1009 3300048912 Ga0496109_0045278 Ga0496109_0045278_1575_2582 325
1010 3300048912 Ga0496109_0072402 Ga0496109_0072402_911_1984 325
1011 3300048912 Ga0496109_0448740 Ga0496109_0448740_91_1098 325
1012 3300048913 Ga0496110_0230232 Ga0496110_0230232_340_1317 325
1013 3300048914 Ga0496111_0008007 Ga0496111_0008007_2112_3119 325
1014 3300048915 Ga0496112_0026077 Ga0496112_0026077_3835_4842 325
1015 3300048915 Ga0496112_0060333 Ga0496112_0060333_2525_3532 325
1016 3300048917 Ga0496114_0003041 Ga0496114_0003041_7345_8418 325
1017 3300048917 Ga0496114_0004340 Ga0496114_0004340_1183_2190 325
1018 3300048917 Ga0496114_0290109 Ga0496114_0290109_152_1159 325
1019 3300048917 Ga0496114_0464991 Ga0496114_0464991_47_1054 325
1020 3300048918 Ga0496115_0002227 Ga0496115_0002227_134_1141 325
1021 3300048918 Ga0496115_0055709 Ga0496115_0055709_594_1601 325
1022 3300048918 Ga0496115_0083452 Ga0496115_0083452_1271_2248 325
1023 3300048918 Ga0496115_0123213 Ga0496115_0123213_566_1639 325
1024 3300048918 Ga0496115_0219732 Ga0496115_0219732_353_1360 325
1025 3300048919 Ga0496116_0000475 Ga0496116_0000475_47284_48261 325
1026 3300048919 Ga0496116_0011151 Ga0496116_0011151_2528_3505 325
1027 3300048920 Ga0496117_0011375 Ga0496117_0011375_3924_4901 325
1028 3300048920 Ga0496117_0048512 Ga0496117_0048512_1094_2071 325
1029 3300048920 Ga0496117_0051342 Ga0496117_0051342_621_1598 325
1030 3300048920 Ga0496117_0087895 Ga0496117_0087895_652_1629 325
1031 3300048920 Ga0496117_0219865 Ga0496117_0219865_15_1007 325
1032 3300048921 Ga0496118_0004037 Ga0496118_0004037_5139_6146 325
1033 3300048921 Ga0496118_0009946 Ga0496118_0009946_2476_3453 325
1034 3300048921 Ga0496118_0064052 Ga0496118_0064052_646_1623 325
1035 3300048921 Ga0496118_0096553 Ga0496118_0096553_412_1389 325
1036 3300048922 Ga0496119_0000018 Ga0496119_0000018_139806_140813 325
1037 3300048922 Ga0496119_0085359 Ga0496119_0085359_178_1155 325
1038 3300048923 Ga0496120_0000002 Ga0496120_0000002_195363_196370 325
1039 3300048924 Ga0496121_0005286 Ga0496121_0005286_6070_7077 325
1040 3300048924 Ga0496121_0030892 Ga0496121_0030892_2968_3945 325
1041 3300048924 Ga0496121_0032500 Ga0496121_0032500_441_1418 325
1042 3300048924 Ga0496121_0051984 Ga0496121_0051984_655_1632 325
1043 3300048924 Ga0496121_0179013 Ga0496121_0179013_166_1143 325
1044 3300048925 Ga0496122_0002729 Ga0496122_0002729_11970_12947 325
1045 3300048925 Ga0496122_0157125 Ga0496122_0157125_304_1281 325
1046 3300048926 Ga0496123_0015383 Ga0496123_0015383_628_1605 325
1047 3300048927 Ga0496124_0012073 Ga0496124_0012073_2597_3574 325
1048 3300048927 Ga0496124_0029049 Ga0496124_0029049_1707_2684 325
1049 3300048927 Ga0496124_0048559 Ga0496124_0048559_1097_2131 325
1050 3300048927 Ga0496124_0091321 Ga0496124_0091321_894_1871 325
1051 3300048928 Ga0496125_0004944 Ga0496125_0004944_10343_11335 325
1052 3300048928 Ga0496125_0009232 Ga0496125_0009232_3810_4787 325
1053 3300048928 Ga0496125_0038439 Ga0496125_0038439_638_1672 325
1054 3300048928 Ga0496125_0072216 Ga0496125_0072216_129_1106 325
1055 3300048929 Ga0496126_0000160 Ga0496126_0000160_5424_6431 325
1056 3300048929 Ga0496126_0075946 Ga0496126_0075946_25_1002 325
1057 3300048929 Ga0496126_0099647 Ga0496126_0099647_1211_2188 325
1058 3300048929 Ga0496126_0270542 Ga0496126_0270542_168_1145 325
1059 3300049459 Ga0495678_000420 Ga0495678_000420_24546_25523 325
1060 3300049459 Ga0495678_001193 Ga0495678_001193_12703_13680 325
1061 3300049459 Ga0495678_004789 Ga0495678_004789_150_1127 325
1062 3300049459 Ga0495678_019168 Ga0495678_019168_1362_2360 325
1063 3300049459 Ga0495678_041226 Ga0495678_041226_282_1301 325
1064 3300049459 Ga0495678_063834 Ga0495678_063834_147_1124 325
1065 3300049460 Ga0495682_0004619 Ga0495682_0004619_4026_5003 325
1066 3300049460 Ga0495682_0010190 Ga0495682_0010190_955_1932 325
1067 3300049460 Ga0495682_0035001 Ga0495682_0035001_227_1204 325
1068 3300049460 Ga0495682_0041039 Ga0495682_0041039_136_1113 325
1069 3300049568 Ga0501031_0022726 Ga0501031_0022726_2771_3778 325
1070 3300049568 Ga0501031_0067538 Ga0501031_0067538_913_1920 325
1071 3300049569 Ga0501032_0055078 Ga0501032_0055078_1318_2325 325
1072 3300049569 Ga0501032_0110489 Ga0501032_0110489_768_1760 325
1073 3300049570 Ga0501033_0009352 Ga0501033_0009352_476_1495 325
1074 3300049572 Ga0501036_0020608 Ga0501036_0020608_2464_3471 325
1075 3300049572 Ga0501036_0074660 Ga0501036_0074660_302_1309 325
1076 3300049572 Ga0501036_0082793 Ga0501036_0082793_711_1718 325
1077 3300049572 Ga0501036_0103320 Ga0501036_0103320_14_1021 325
1078 3300049572 Ga0501036_0341208 Ga0501036_0341208_115_1122 325
1079 3300049574 Ga0501038_0035894 Ga0501038_0035894_1423_2430 325
1080 3300049574 Ga0501038_0099837 Ga0501038_0099837_1111_2118 325
1081 3300049574 Ga0501038_0132179 Ga0501038_0132179_896_1903 325
1082 3300049575 Ga0501039_0013549 Ga0501039_0013549_4447_5454 325
1083 3300049575 Ga0501039_0036029 Ga0501039_0036029_405_1418 325
1084 3300049575 Ga0501039_0081884 Ga0501039_0081884_1374_2384 325
1085 3300049575 Ga0501039_0243905 Ga0501039_0243905_372_1379 325
1086 3300049576 Ga0501040_0036124 Ga0501040_0036124_1333_2340 325
1087 3300049576 Ga0501040_0066010 Ga0501040_0066010_1107_2114 325
1088 3300049576 Ga0501040_0091306 Ga0501040_0091306_485_1492 325
1089 3300049576 Ga0501040_0105448 Ga0501040_0105448_430_1437 325
1090 3300049577 Ga0501041_0006968 Ga0501041_0006968_5054_6061 325
1091 3300049577 Ga0501041_0054670 Ga0501041_0054670_795_1802 325
1092 3300049577 Ga0501041_0129490 Ga0501041_0129490_363_1370 325
1093 3300049578 Ga0501042_0045261 Ga0501042_0045261_1808_2815 325
1094 3300049578 Ga0501042_0071986 Ga0501042_0071986_1178_2185 325
1095 3300049579 Ga0501043_0044829 Ga0501043_0044829_1989_2996 325
1096 3300049580 Ga0501046_0019335 Ga0501046_0019335_4233_5240 325
1097 3300049580 Ga0501046_0058686 Ga0501046_0058686_322_1329 325
1098 3300049581 Ga0501047_0126148 Ga0501047_0126148_1246_2256 325
1099 3300049582 Ga0501048_0022275 Ga0501048_0022275_2026_3033 325
1100 3300049582 Ga0501048_0066266 Ga0501048_0066266_388_1395 325
1101 3300049586 Ga0501070_0008224 Ga0501070_0008224_6216_7250 325
1102 3300049587 Ga0501071_0004660 Ga0501071_0004660_2803_3810 325
1103 3300049587 Ga0501071_0021688 Ga0501071_0021688_2691_3698 325
1104 3300049587 Ga0501071_0022166 Ga0501071_0022166_2044_3096 325
1105 3300049587 Ga0501071_0062720 Ga0501071_0062720_409_1416 325
1106 3300049587 Ga0501071_0115800 Ga0501071_0115800_802_1812 325
1107 3300049587 Ga0501071_0122273 Ga0501071_0122273_432_1439 325
1108 3300049588 Ga0501072_0005876 Ga0501072_0005876_2731_3783 325
1109 3300049588 Ga0501072_0012869 Ga0501072_0012869_5362_6369 325
1110 3300049588 Ga0501072_0070658 Ga0501072_0070658_344_1351 325
1111 3300049588 Ga0501072_0159163 Ga0501072_0159163_153_1160 325
1112 3300049590 Ga0501074_0071296 Ga0501074_0071296_1401_2408 325
1113 3300049590 Ga0501074_0081873 Ga0501074_0081873_33_1040 325
1114 3300049590 Ga0501074_0288038 Ga0501074_0288038_86_1138 325
1115 3300049591 Ga0501075_0022895 Ga0501075_0022895_110_1162 325
1116 3300049591 Ga0501075_0047310 Ga0501075_0047310_1294_2301 325
1117 3300049591 Ga0501075_0075481 Ga0501075_0075481_791_1798 325
1118 3300049591 Ga0501075_0220559 Ga0501075_0220559_42_1049 325
1119 3300049591 Ga0501075_0238452 Ga0501075_0238452_267_1274 325
1120 3300049592 Ga0501076_0024551 Ga0501076_0024551_2176_3183 325
1121 3300049592 Ga0501076_0025793 Ga0501076_0025793_1247_2299 325
1122 3300049592 Ga0501076_0081163 Ga0501076_0081163_475_1482 325
1123 3300049593 Ga0501077_0018855 Ga0501077_0018855_527_1534 325
1124 3300049593 Ga0501077_0193708 Ga0501077_0193708_125_1132 325
1125 3300049741 Ga0501079_0013491 Ga0501079_0013491_1468_2475 325
1126 3300049741 Ga0501079_0037890 Ga0501079_0037890_617_1624 325
1127 3300049741 Ga0501079_0039754 Ga0501079_0039754_2138_3145 325
1128 3300049741 Ga0501079_0167682 Ga0501079_0167682_526_1533 325
1129 3300049742 Ga0501080_0109673 Ga0501080_0109673_1161_2168 325
1130 3300049742 Ga0501080_0165041 Ga0501080_0165041_234_1241 325
1131 3300049742 Ga0501080_0230764 Ga0501080_0230764_131_1183 325
1132 3300049743 Ga0501081_0018089 Ga0501081_0018089_1482_2489 325
1133 3300049743 Ga0501081_0036980 Ga0501081_0036980_2248_3255 325
1134 3300049743 Ga0501081_0191991 Ga0501081_0191991_76_1083 325
1135 3300049743 Ga0501081_0230238 Ga0501081_0230238_205_1257 325
1136 3300049744 Ga0501083_0071373 Ga0501083_0071373_342_1349 325
1137 3300049744 Ga0501083_0212830 Ga0501083_0212830_202_1209 325
1138 3300049758 Ga0501241_000047 Ga0501241_000047_4358_5341 325
1139 3300049822 Ga0501035_0056359 Ga0501035_0056359_1852_2859 325
1140 3300049823 Ga0501044_0000106 Ga0501044_0000106_28295_29314 325
1141 3300049823 Ga0501044_0231263 Ga0501044_0231263_451_1488 325
1142 3300049824 Ga0501045_0017591 Ga0501045_0017591_1823_2830 325
1143 3300049824 Ga0501045_0123072 Ga0501045_0123072_496_1503 325
1144 3300049824 Ga0501045_0353652 Ga0501045_0353652_11_1063 325
1145 3300050489 nmdc:mga03683_53567_c1 nmdc:mga03683_53567_c1_318_1295 325
1146 3300050491 nmdc:mga00v17_36197_c1 nmdc:mga00v17_36197_c1_1447_2424 325
1147 3300050492 nmdc:mga0yw44_293096_c1 nmdc:mga0yw44_293096_c1_72_1079 325
1148 3300050507 nmdc:mga05p37_114181_c1 nmdc:mga05p37_114181_c1_1893_2900 325
1149 3300050507 nmdc:mga05p37_15089_c1 nmdc:mga05p37_15089_c1_5665_6684 325
1150 3300050507 nmdc:mga05p37_78729_c1 nmdc:mga05p37_78729_c1_937_1968 325
1151 3300050508 nmdc:mga09592_65524_c1 nmdc:mga09592_65524_c1_1807_2814 325
1152 3300050510 nmdc:mga06r32_54035_c1 nmdc:mga06r32_54035_c1_312_1319 325
1153 3300050510 nmdc:mga06r32_6675_c1 nmdc:mga06r32_6675_c1_3914_4921 325
1154 3300050511 nmdc:mga08y16_44676_c1 nmdc:mga08y16_44676_c1_2880_3887 325
1155 3300050512 nmdc:mga0n895_10036_c1 nmdc:mga0n895_10036_c1_7060_8067 325
1156 3300050513 nmdc:mga0rr50_8552_c1 nmdc:mga0rr50_8552_c1_591_1598 325
1157 3300050515 nmdc:mga0a205_78623_c1 nmdc:mga0a205_78623_c1_43_1050 325
1158 3300050515 nmdc:mga0a205_93022_c1 nmdc:mga0a205_93022_c1_1182_2189 325
1159 3300050516 nmdc:mga0sz30_7158_c2 nmdc:mga0sz30_7158_c2_1215_2192 325
1160 3300053077 Ga0495601_0000744 Ga0495601_0000744_10688_11695 325
1161 3300053078 Ga0495612_0032116 Ga0495612_0032116_187_1194 325
1162 3300053083 Ga0495655_0001249 Ga0495655_0001249_768_1775 325
1163 3300053085 Ga0495619_0006422 Ga0495619_0006422_6010_7017 325
1164 3300053139 Ga0500568_0023689 Ga0500568_0023689_924_1901 325
1165 3300054114 Ga0501084_0013266 Ga0501084_0013266_1745_2752 325
1166 3300054114 Ga0501084_0025016 Ga0501084_0025016_935_1942 325
1167 3300054114 Ga0501084_0139314 Ga0501084_0139314_294_1301 325
1168 3300060353 Ga0501082_0000007 Ga0501082_0000007_23571_24584 325
1169 3300060353 Ga0501082_0035720 Ga0501082_0035720_2920_3927 325
1170 3300060353 Ga0501082_0185998 Ga0501082_0185998_567_1574 325
1171 3300061734 Ga0530510_0011063 Ga0530510_0011063_1286_2293 325
1172 3300061734 Ga0530510_0014173 Ga0530510_0014173_174_1181 325
1173 3300061734 Ga0530510_0115302 Ga0530510_0115302_405_1412 325
1174 3300061734 Ga0530510_0142524 Ga0530510_0142524_507_1514 325
1175 iso_pu_bacteria 2841917233 2841921706 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

54

296

0.95

PF08659

KR

KR domain

53

207

0.86

PF04321

RmlD_sub_bind

RmlD substrate binding domain

52

294

0.85

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

54

290

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

55

376

0.83

PF00106

adh_short

short chain dehydrogenase

52

172

0.82

PF07993

NAD_binding_4

Male sterility protein

56

249

0.78

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

55

341

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4q-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. 0.9307 1 325
6zlj-assembly1.cif.gz_B-2 crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad 0.9285 1 323
6zla-assembly1.cif.gz_A crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad 0.9281 1 324
6zlj-assembly1.cif.gz_B-2 crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad 0.9257 1 323
6zlk-assembly2.cif.gz_B equilibrium structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid/udp-galacturonic acid and nad 0.9256 1 323
ID Description Score Start End Superfamily
af_Q0DDZ4_1_298_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9468 37 325 3.40.50.720
af_K7VFN4_114_450_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 1 323 3.40.50.720
af_K7VFN4_114_450_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9354 1 323 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9274 1 325 3.40.50.720
5u4qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9244 1 325 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A523M0X6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.98 1 127
AF-A0A352NRJ6-F1-model_v4 NAD-dependent epimerase 0.9797 29 235
AF-A0A382S169-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.979 81 225
AF-A0A849W6Q5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9786 1 324
AF-V7FNM4-F1-model_v4 NAD dependent epimerase/dehydratase 0.9784 2 324

Feature Viewer

pLDDT pTM Quality
94.24 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map