F491238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1175 | 491 | 1121 | 331 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10012256|Ga0081455_100122564 |
| Length | 386 |
| Sequence | VLYNERLGKRQPGARNGLGAPPEAIDNGTAGWLLLSRLLGEGPRKAQESVPMRVLVTGAAGFIGYHTAARLLERGHAVIGFDNLSPYYDVSLKEARLKRLTEQERFSFIKGDLADRAVVEATFAEERPDRVIHLAAQAGVRYSLDHPHAYISSNVTGFLHVLEGCRHHGVEHLVYASTSAVYGANQKLPFAVSDNVDHPVSLYGATKKANELMAHSYAHLFGIPVSGLRFFTVYGPWGRPDMSLFLFTRSILAGEPIKVFNYGQHSRDFTYIDDAVEGVLRTLDVVATPDPSWNPANPDPETSSAPYRLYNIGNHSPVALLDYVAAIEKALGQKAKIELLPQQPGDVVATYADVDALKEATGFQPATPLEEGIKRFVAWYRDYYRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 3 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 4 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 5 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 6 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 9 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 10 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 11 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 12 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 13 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 14 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 15 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 16 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 17 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 18 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 19 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 20 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 21 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 22 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 23 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 24 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 25 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 26 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 27 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 28 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 29 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 30 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 31 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 32 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 33 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 34 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 35 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 36 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 37 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 38 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 39 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 40 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 41 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 42 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 43 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 44 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 45 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 46 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 47 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 48 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 49 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 50 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 51 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 52 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 53 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 54 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 55 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 57 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 58 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 59 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 60 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 69 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 108 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 114 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 128 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 129 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 130 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 131 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 132 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 133 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 134 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 135 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 136 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 137 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 138 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 139 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 140 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 144 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 145 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 147 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 148 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 149 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 150 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 151 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 152 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 153 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 182 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 190 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 266 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 267 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 268 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 270 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 274 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 275 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 276 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 279 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 299 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 300 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 301 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 302 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 305 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 306 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 307 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 308 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 309 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 310 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 311 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 312 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 313 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 314 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 315 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 316 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 317 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 320 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 415 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 416 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 417 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 418 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 458 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 479 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 482 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 486 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 487 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 488 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 489 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 490 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 491 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 0.09 |
| Isolates | 4.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.91 |
| Nodule | 1.45 |
| Rhizoplane | 3.83 |
| Rhizosphere | 84.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_240 | 2124908027 | Bacteria | 22649 |
| 2 | JGI24743J22301_10001386 | 3300001991 | Bacteria | 3337 |
| 3 | JGI24738J21930_10007302 | 3300002075 | Bacteria | 2557 |
| 4 | JGI25156J39149_1010418 | 3300002705 | Bacteria | 2187 |
| 5 | JGI25162J39368_1000345 | 3300002737 | Bacteria | 40115 |
| 6 | JGI25157J39369_1000317 | 3300002741 | Bacteria | 34756 |
| 7 | JGI25163J39215_1000267 | 3300002771 | Bacteria | 18439 |
| 8 | JGI25164J39214_1000187 | 3300002772 | Bacteria | 54560 |
| 9 | JGI25151J46595_10000090 | 3300003187 | Bacteria | 123141 |
| 10 | JGI25151J46595_10000168 | 3300003187 | Bacteria | 85167 |
| 11 | JGI25165J46597_1000338 | 3300003214 | Bacteria | 54560 |
| 12 | rootH2_10013714 | 3300003320 | Bacteria | 2600 |
| 13 | Ga0006562J51391_1027629 | 3300003578 | Bacteria | 2372 |
| 14 | Ga0055538_1001452 | 3300003751 | Bacteria | 4542 |
| 15 | Ga0055535_1000417 | 3300003761 | Bacteria | 40115 |
| 16 | Ga0055542_1000435 | 3300003762 | Bacteria | 40115 |
| 17 | Ga0055529_1000110 | 3300003763 | Bacteria | 120255 |
| 18 | Ga0055530_10001311 | 3300003791 | Bacteria | 18707 |
| 19 | Ga0055540_1000006 | 3300003792 | Bacteria | 372018 |
| 20 | Ga0055531_10000075 | 3300003794 | Bacteria | 107839 |
| 21 | Ga0065714_10000217 | 3300005288 | Bacteria | 11234 |
| 22 | Ga0065714_10002341 | 3300005288 | Bacteria | 31600 |
| 23 | Ga0065714_10005790 | 3300005288 | Bacteria | 8444 |
| 24 | Ga0065714_10007718 | 3300005288 | Bacteria | 3038 |
| 25 | Ga0065714_10013859 | 3300005288 | Bacteria | 1865 |
| 26 | Ga0065714_10028341 | 3300005288 | Bacteria | 1863 |
| 27 | Ga0065714_10032459 | 3300005288 | Bacteria | 1796 |
| 28 | Ga0065714_10065710 | 3300005288 | Bacteria | 8765 |
| 29 | Ga0065714_10089418 | 3300005288 | Bacteria | 1980 |
| 30 | Ga0065712_10004708 | 3300005290 | Bacteria | 3736 |
| 31 | Ga0065715_10003156 | 3300005293 | Bacteria | 6646 |
| 32 | Ga0070658_10338498 | 3300005327 | Bacteria | 1287 |
| 33 | Ga0070676_10000327 | 3300005328 | Bacteria | 21588 |
| 34 | Ga0070683_100013389 | 3300005329 | Bacteria | 7153 |
| 35 | Ga0070690_100000389 | 3300005330 | Bacteria | 22358 |
| 36 | Ga0070670_100004526 | 3300005331 | Bacteria | 11650 |
| 37 | Ga0068869_100006435 | 3300005334 | Bacteria | 7450 |
| 38 | Ga0068869_100030812 | 3300005334 | Bacteria | 3769 |
| 39 | Ga0068869_100211294 | 3300005334 | Bacteria | 1534 |
| 40 | Ga0070666_10001559 | 3300005335 | Bacteria | 13905 |
| 41 | Ga0070680_100002843 | 3300005336 | Bacteria | 12870 |
| 42 | Ga0070682_100001357 | 3300005337 | Bacteria | 13814 |
| 43 | Ga0068868_100000816 | 3300005338 | Bacteria | 21142 |
| 44 | Ga0070689_100000375 | 3300005340 | Bacteria | 26301 |
| 45 | Ga0070691_10003065 | 3300005341 | Bacteria | 7485 |
| 46 | Ga0070691_10021676 | 3300005341 | Bacteria | 2974 |
| 47 | Ga0070687_100153394 | 3300005343 | Bacteria | 1354 |
| 48 | Ga0070661_100000807 | 3300005344 | Bacteria | 22516 |
| 49 | Ga0070661_100172691 | 3300005344 | Bacteria | 1642 |
| 50 | Ga0070692_10014899 | 3300005345 | Bacteria | 3664 |
| 51 | Ga0070668_100002040 | 3300005347 | Bacteria | 14776 |
| 52 | Ga0070668_100059780 | 3300005347 | Bacteria | 2950 |
| 53 | Ga0070668_100373350 | 3300005347 | Bacteria | 1212 |
| 54 | Ga0070669_100001534 | 3300005353 | Bacteria | 16689 |
| 55 | Ga0070669_100028425 | 3300005353 | Bacteria | 4027 |
| 56 | Ga0070675_100001502 | 3300005354 | Bacteria | 17224 |
| 57 | Ga0070675_100002753 | 3300005354 | Bacteria | 13213 |
| 58 | Ga0070671_100000406 | 3300005355 | Bacteria | 29740 |
| 59 | Ga0070674_100003779 | 3300005356 | Bacteria | 8552 |
| 60 | Ga0070673_100000480 | 3300005364 | Bacteria | 21257 |
| 61 | Ga0070688_100001668 | 3300005365 | Bacteria | 11110 |
| 62 | Ga0070688_100110694 | 3300005365 | Bacteria | 1826 |
| 63 | Ga0070659_100004405 | 3300005366 | Bacteria | 10059 |
| 64 | Ga0070667_100001184 | 3300005367 | Bacteria | 23726 |
| 65 | Ga0070703_10010576 | 3300005406 | Bacteria | 2603 |
| 66 | Ga0070709_10001752 | 3300005434 | Bacteria | 11800 |
| 67 | Ga0070714_100069438 | 3300005435 | Bacteria | 3043 |
| 68 | Ga0070713_100001031 | 3300005436 | Bacteria | 17809 |
| 69 | Ga0070710_10000732 | 3300005437 | Bacteria | 15631 |
| 70 | Ga0070701_10002551 | 3300005438 | Bacteria | 7048 |
| 71 | Ga0070701_10151450 | 3300005438 | Bacteria | 1336 |
| 72 | Ga0070711_100000095 | 3300005439 | Bacteria | 47489 |
| 73 | Ga0070700_100003085 | 3300005441 | Bacteria | 8546 |
| 74 | Ga0070700_100095217 | 3300005441 | Bacteria | 1951 |
| 75 | Ga0070694_100001906 | 3300005444 | Bacteria | 12345 |
| 76 | Ga0070694_100337870 | 3300005444 | Bacteria | 1163 |
| 77 | Ga0070663_100001429 | 3300005455 | Bacteria | 13074 |
| 78 | Ga0070678_100001684 | 3300005456 | Bacteria | 11858 |
| 79 | Ga0070662_100001283 | 3300005457 | Bacteria | 15448 |
| 80 | Ga0070681_10015543 | 3300005458 | Bacteria | 7580 |
| 81 | Ga0070681_10021843 | 3300005458 | Bacteria | 6419 |
| 82 | Ga0070681_10217786 | 3300005458 | Bacteria | 1825 |
| 83 | Ga0068867_100042414 | 3300005459 | Bacteria | 3328 |
| 84 | Ga0070698_100249091 | 3300005471 | Bacteria | 1709 |
| 85 | Ga0070699_100204166 | 3300005518 | Bacteria | 1758 |
| 86 | Ga0070699_100274329 | 3300005518 | Bacteria | 1510 |
| 87 | Ga0070679_100269611 | 3300005530 | Bacteria | 1656 |
| 88 | Ga0070684_100007419 | 3300005535 | Bacteria | 8522 |
| 89 | Ga0070697_100000955 | 3300005536 | Bacteria | 21790 |
| 90 | Ga0068853_100000714 | 3300005539 | Bacteria | 22983 |
| 91 | Ga0068853_100308666 | 3300005539 | Bacteria | 1464 |
| 92 | Ga0070672_100035688 | 3300005543 | Bacteria | 3780 |
| 93 | Ga0070672_100054576 | 3300005543 | Bacteria | 3129 |
| 94 | Ga0070686_100008934 | 3300005544 | Bacteria | 5616 |
| 95 | Ga0070695_100000122 | 3300005545 | Bacteria | 34844 |
| 96 | Ga0070695_100007567 | 3300005545 | Bacteria | 6435 |
| 97 | Ga0070696_100000993 | 3300005546 | Bacteria | 18392 |
| 98 | Ga0070665_100005234 | 3300005548 | Bacteria | 13420 |
| 99 | Ga0070665_100119645 | 3300005548 | Bacteria | 2635 |
| 100 | Ga0070665_100204312 | 3300005548 | Bacteria | 1976 |
| 101 | Ga0070704_100000417 | 3300005549 | Bacteria | 19773 |
| 102 | Ga0070704_100010793 | 3300005549 | Bacteria | 5570 |
| 103 | Ga0068855_100001459 | 3300005563 | Bacteria | 29520 |
| 104 | Ga0070664_100002837 | 3300005564 | Bacteria | 14017 |
| 105 | Ga0068857_100004107 | 3300005577 | Bacteria | 12269 |
| 106 | Ga0068854_100000660 | 3300005578 | Bacteria | 20555 |
| 107 | Ga0068854_100175668 | 3300005578 | Bacteria | 1669 |
| 108 | Ga0068856_100065201 | 3300005614 | Bacteria | 3599 |
| 109 | Ga0070702_100000010 | 3300005615 | Bacteria | 60028 |
| 110 | Ga0070702_100057928 | 3300005615 | Bacteria | 2242 |
| 111 | Ga0070702_100175762 | 3300005615 | Bacteria | 1397 |
| 112 | Ga0068852_100213226 | 3300005616 | Bacteria | 1833 |
| 113 | Ga0068859_100003130 | 3300005617 | Bacteria | 16813 |
| 114 | Ga0068859_100168273 | 3300005617 | Bacteria | 2272 |
| 115 | Ga0068864_100022833 | 3300005618 | Bacteria | 5247 |
| 116 | Ga0068866_10002702 | 3300005718 | Bacteria | 7322 |
| 117 | Ga0068866_10160783 | 3300005718 | Bacteria | 1309 |
| 118 | Ga0068861_100396562 | 3300005719 | Bacteria | 1223 |
| 119 | Ga0068863_100006477 | 3300005841 | Bacteria | 11480 |
| 120 | Ga0068858_100144860 | 3300005842 | Bacteria | 2231 |
| 121 | Ga0068860_100000961 | 3300005843 | Bacteria | 31889 |
| 122 | Ga0068860_100162785 | 3300005843 | Bacteria | 2152 |
| 123 | Ga0068862_100004110 | 3300005844 | Bacteria | 12337 |
| 124 | Ga0068862_100008421 | 3300005844 | Bacteria | 8535 |
| 125 | Ga0068862_100026667 | 3300005844 | Bacteria | 4858 |
| 126 | Ga0081455_10011835 | 3300005937 | Bacteria | 8734 |
| 127 | Ga0081455_10012256 | 3300005937 | Bacteria | 8558 |
| 128 | Ga0081455_10012725 | 3300005937 | Bacteria | 8372 |
| 129 | Ga0081540_1000343 | 3300005983 | Bacteria | 47660 |
| 130 | Ga0081539_10001147 | 3300005985 | Bacteria | 47975 |
| 131 | Ga0075365_10168820 | 3300006038 | Bacteria | 1527 |
| 132 | Ga0075432_10000121 | 3300006058 | Bacteria | 17497 |
| 133 | Ga0075432_10001542 | 3300006058 | Bacteria | 7560 |
| 134 | Ga0075432_10013480 | 3300006058 | Bacteria | 2777 |
| 135 | Ga0075432_10046801 | 3300006058 | Bacteria | 1519 |
| 136 | Ga0070715_10000194 | 3300006163 | Bacteria | 14221 |
| 137 | Ga0070716_100039387 | 3300006173 | Bacteria | 2623 |
| 138 | Ga0070712_100002679 | 3300006175 | Bacteria | 10989 |
| 139 | Ga0070712_100099553 | 3300006175 | Bacteria | 2146 |
| 140 | Ga0075362_10005204 | 3300006177 | Bacteria | 4742 |
| 141 | Ga0075369_10008171 | 3300006186 | Bacteria | 4017 |
| 142 | Ga0097621_100049901 | 3300006237 | Bacteria | 3402 |
| 143 | Ga0097621_100127468 | 3300006237 | Bacteria | 2163 |
| 144 | Ga0075370_10022187 | 3300006353 | Bacteria | 3484 |
| 145 | Ga0068871_100007258 | 3300006358 | Bacteria | 7905 |
| 146 | Ga0068871_100046243 | 3300006358 | Bacteria | 3505 |
| 147 | Ga0075428_100008638 | 3300006844 | Bacteria | 11296 |
| 148 | Ga0075431_100071595 | 3300006847 | Bacteria | 3577 |
| 149 | Ga0075431_100094192 | 3300006847 | Bacteria | 3091 |
| 150 | Ga0075433_10037746 | 3300006852 | Bacteria | 4169 |
| 151 | Ga0068865_100000479 | 3300006881 | Bacteria | 22339 |
| 152 | Ga0068865_100011741 | 3300006881 | Bacteria | 5487 |
| 153 | Ga0068865_100100478 | 3300006881 | Bacteria | 2117 |
| 154 | Ga0075436_100001650 | 3300006914 | Bacteria | 15248 |
| 155 | Ga0097620_100003130 | 3300006931 | Bacteria | 16813 |
| 156 | Ga0097620_100168269 | 3300006931 | Bacteria | 2272 |
| 157 | Ga0079104_1000426 | 3300006946 | Bacteria | 48184 |
| 158 | Ga0079104_1001612 | 3300006946 | Bacteria | 14701 |
| 159 | Ga0075435_100110025 | 3300007076 | Bacteria | 2291 |
| 160 | Ga0105251_10005118 | 3300009011 | Bacteria | 8679 |
| 161 | Ga0105244_10002982 | 3300009036 | Bacteria | 12459 |
| 162 | Ga0105244_10046797 | 3300009036 | Bacteria | 2221 |
| 163 | Ga0105244_10052420 | 3300009036 | Bacteria | 2077 |
| 164 | Ga0105244_10054541 | 3300009036 | Bacteria | 2027 |
| 165 | Ga0105250_10006501 | 3300009092 | Bacteria | 5106 |
| 166 | Ga0105250_10006990 | 3300009092 | Bacteria | 4877 |
| 167 | Ga0105250_10008590 | 3300009092 | Bacteria | 4330 |
| 168 | Ga0105250_10020227 | 3300009092 | Bacteria | 2691 |
| 169 | Ga0105250_10061091 | 3300009092 | Bacteria | 1515 |
| 170 | Ga0105240_10006881 | 3300009093 | Bacteria | 16617 |
| 171 | Ga0105240_10019958 | 3300009093 | Bacteria | 8949 |
| 172 | Ga0111539_10136940 | 3300009094 | Bacteria | 2867 |
| 173 | Ga0111539_10137378 | 3300009094 | Bacteria | 2862 |
| 174 | Ga0111539_10409874 | 3300009094 | Bacteria | 1578 |
| 175 | Ga0105245_10018071 | 3300009098 | Bacteria | 6161 |
| 176 | Ga0105245_10475574 | 3300009098 | Bacteria | 1262 |
| 177 | Ga0105247_10001227 | 3300009101 | Bacteria | 19035 |
| 178 | Ga0105247_10033489 | 3300009101 | Bacteria | 3125 |
| 179 | Ga0105247_10052939 | 3300009101 | Bacteria | 2503 |
| 180 | Ga0114129_10007650 | 3300009147 | Bacteria | 15381 |
| 181 | Ga0114129_10026262 | 3300009147 | Bacteria | 8248 |
| 182 | Ga0114129_10029155 | 3300009147 | Bacteria | 7818 |
| 183 | Ga0114129_10045234 | 3300009147 | Bacteria | 6188 |
| 184 | Ga0114129_10203420 | 3300009147 | Bacteria | 2680 |
| 185 | Ga0114129_10248653 | 3300009147 | Bacteria | 2388 |
| 186 | Ga0105243_10000233 | 3300009148 | Bacteria | 64046 |
| 187 | Ga0105243_10271465 | 3300009148 | Bacteria | 1523 |
| 188 | Ga0105241_10004813 | 3300009174 | Bacteria | 9946 |
| 189 | Ga0105241_10445593 | 3300009174 | Bacteria | 1144 |
| 190 | Ga0105242_10000625 | 3300009176 | Bacteria | 27767 |
| 191 | Ga0105242_10112177 | 3300009176 | Bacteria | 2326 |
| 192 | Ga0105248_10005964 | 3300009177 | Bacteria | 13384 |
| 193 | Ga0105248_10048062 | 3300009177 | Bacteria | 4786 |
| 194 | Ga0105248_10085514 | 3300009177 | Bacteria | 3549 |
| 195 | Ga0105237_10006537 | 3300009545 | Bacteria | 12896 |
| 196 | Ga0105238_10023129 | 3300009551 | Bacteria | 6338 |
| 197 | Ga0105249_10021566 | 3300009553 | Bacteria | 5768 |
| 198 | Ga0105249_10235053 | 3300009553 | Bacteria | 1809 |
| 199 | Ga0105249_10527786 | 3300009553 | Bacteria | 1229 |
| 200 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 201 | Ga0105239_10040808 | 3300010375 | Bacteria | 5085 |
| 202 | Ga0105239_10130345 | 3300010375 | Bacteria | 2796 |
| 203 | Ga0105246_10000058 | 3300011119 | Bacteria | 44703 |
| 204 | Ga0105246_10033505 | 3300011119 | Bacteria | 3416 |
| 205 | Ga0105246_10042754 | 3300011119 | Bacteria | 3070 |
| 206 | Ga0157373_10002561 | 3300013100 | Bacteria | 13817 |
| 207 | Ga0157373_10006435 | 3300013100 | Bacteria | 8774 |
| 208 | Ga0157373_10243016 | 3300013100 | Bacteria | 1273 |
| 209 | Ga0157371_10002421 | 3300013102 | Bacteria | 17840 |
| 210 | Ga0157371_10009277 | 3300013102 | Bacteria | 7760 |
| 211 | Ga0157371_10172191 | 3300013102 | Bacteria | 1547 |
| 212 | Ga0157370_10004153 | 3300013104 | Bacteria | 16762 |
| 213 | Ga0157370_10004666 | 3300013104 | Bacteria | 15646 |
| 214 | Ga0157370_10014316 | 3300013104 | Bacteria | 8117 |
| 215 | Ga0157370_10057498 | 3300013104 | Bacteria | 3698 |
| 216 | Ga0157370_10074868 | 3300013104 | Bacteria | 3193 |
| 217 | Ga0157370_10078142 | 3300013104 | Bacteria | 3116 |
| 218 | Ga0157370_10118740 | 3300013104 | Bacteria | 2470 |
| 219 | Ga0157370_10162596 | 3300013104 | Bacteria | 2077 |
| 220 | Ga0157369_10007040 | 3300013105 | Bacteria | 12967 |
| 221 | Ga0157369_10013364 | 3300013105 | Bacteria | 9288 |
| 222 | Ga0157378_10024775 | 3300013297 | Bacteria | 5283 |
| 223 | Ga0163162_10012818 | 3300013306 | Bacteria | 8189 |
| 224 | Ga0163162_10043764 | 3300013306 | Bacteria | 4483 |
| 225 | Ga0163162_10123219 | 3300013306 | Bacteria | 2697 |
| 226 | Ga0163162_10128911 | 3300013306 | Bacteria | 2638 |
| 227 | Ga0163162_10201771 | 3300013306 | Bacteria | 2118 |
| 228 | Ga0163162_10275575 | 3300013306 | Bacteria | 1814 |
| 229 | Ga0157375_10000904 | 3300013308 | Bacteria | 25826 |
| 230 | Ga0157375_10002641 | 3300013308 | Bacteria | 15519 |
| 231 | Ga0157375_10006942 | 3300013308 | Bacteria | 9884 |
| 232 | Ga0157375_10159839 | 3300013308 | Bacteria | 2394 |
| 233 | Ga0157380_10001119 | 3300014326 | Bacteria | 17292 |
| 234 | Ga0157380_10129955 | 3300014326 | Bacteria | 2147 |
| 235 | Ga0157380_10176449 | 3300014326 | Bacteria | 1873 |
| 236 | Ga0182008_10002677 | 3300014497 | Bacteria | 11060 |
| 237 | Ga0182008_10004190 | 3300014497 | Bacteria | 8479 |
| 238 | Ga0182008_10006903 | 3300014497 | Bacteria | 6307 |
| 239 | Ga0182008_10013085 | 3300014497 | Bacteria | 4365 |
| 240 | Ga0182008_10015667 | 3300014497 | Bacteria | 3952 |
| 241 | Ga0182008_10134174 | 3300014497 | Bacteria | 1236 |
| 242 | Ga0182008_10190314 | 3300014497 | Bacteria | 1041 |
| 243 | Ga0157377_10002624 | 3300014745 | Bacteria | 7977 |
| 244 | Ga0157377_10030559 | 3300014745 | Bacteria | 2919 |
| 245 | Ga0157379_10001136 | 3300014968 | Bacteria | 21783 |
| 246 | Ga0157376_10000941 | 3300014969 | Bacteria | 18932 |
| 247 | Ga0157376_10014199 | 3300014969 | Bacteria | 5969 |
| 248 | Ga0157376_10051877 | 3300014969 | Bacteria | 3408 |
| 249 | Ga0182006_1000083 | 3300015261 | Bacteria | 118727 |
| 250 | Ga0182006_1000634 | 3300015261 | Bacteria | 24973 |
| 251 | Ga0182006_1002021 | 3300015261 | Bacteria | 11395 |
| 252 | Ga0182006_1018107 | 3300015261 | Bacteria | 2981 |
| 253 | Ga0182006_1022438 | 3300015261 | Bacteria | 2624 |
| 254 | Ga0182007_10000086 | 3300015262 | Bacteria | 69920 |
| 255 | Ga0182007_10035409 | 3300015262 | Bacteria | 1682 |
| 256 | Ga0182005_1000675 | 3300015265 | Bacteria | 16002 |
| 257 | Ga0182005_1003472 | 3300015265 | Bacteria | 5331 |
| 258 | Ga0182005_1005936 | 3300015265 | Bacteria | 3779 |
| 259 | Ga0182005_1009503 | 3300015265 | Bacteria | 2829 |
| 260 | Ga0182005_1009968 | 3300015265 | Bacteria | 2744 |
| 261 | Ga0182005_1022603 | 3300015265 | Bacteria | 1722 |
| 262 | Ga0163161_10002612 | 3300017792 | Bacteria | 12822 |
| 263 | Ga0163161_10004580 | 3300017792 | Bacteria | 9625 |
| 264 | Ga0163161_10011584 | 3300017792 | Bacteria | 6121 |
| 265 | Ga0163161_10021506 | 3300017792 | Bacteria | 4533 |
| 266 | Ga0163161_10134852 | 3300017792 | Bacteria | 1865 |
| 267 | Ga0213874_10002783 | 3300021377 | Bacteria | 3806 |
| 268 | Ga0209760_100405 | 3300025207 | Bacteria | 10640 |
| 269 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 270 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 271 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 272 | Ga0209258_100043 | 3300025242 | Bacteria | 380685 |
| 273 | Ga0209026_1000047 | 3300025250 | Bacteria | 261867 |
| 274 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 275 | Ga0209759_1000715 | 3300025256 | Bacteria | 29291 |
| 276 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 277 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 278 | Ga0209675_1002396 | 3300025291 | Bacteria | 9670 |
| 279 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 280 | Ga0209676_1003788 | 3300025292 | Bacteria | 8956 |
| 281 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 282 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 283 | Ga0209050_1005631 | 3300025298 | Bacteria | 7768 |
| 284 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 285 | Ga0209051_1012244 | 3300025303 | Bacteria | 4160 |
| 286 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 287 | Ga0207696_1000405 | 3300025711 | Bacteria | 40190 |
| 288 | Ga0207696_1003824 | 3300025711 | Bacteria | 6695 |
| 289 | Ga0207655_1000481 | 3300025728 | Bacteria | 51474 |
| 290 | Ga0207655_1002986 | 3300025728 | Bacteria | 12972 |
| 291 | Ga0207655_1004462 | 3300025728 | Bacteria | 9922 |
| 292 | Ga0207655_1016216 | 3300025728 | Bacteria | 4089 |
| 293 | Ga0207713_1000893 | 3300025735 | Bacteria | 27043 |
| 294 | Ga0207713_1002558 | 3300025735 | Bacteria | 13140 |
| 295 | Ga0207713_1011856 | 3300025735 | Bacteria | 4703 |
| 296 | Ga0207692_10034656 | 3300025898 | Bacteria | 2445 |
| 297 | Ga0207642_10131051 | 3300025899 | Bacteria | 1309 |
| 298 | Ga0207710_10008378 | 3300025900 | Bacteria | 4361 |
| 299 | Ga0207710_10013949 | 3300025900 | Bacteria | 3384 |
| 300 | Ga0207688_10001350 | 3300025901 | Bacteria | 12748 |
| 301 | Ga0207680_10002690 | 3300025903 | Bacteria | 8305 |
| 302 | Ga0207647_10001011 | 3300025904 | Bacteria | 21846 |
| 303 | Ga0207685_10005233 | 3300025905 | Bacteria | 3402 |
| 304 | Ga0207645_10002031 | 3300025907 | Bacteria | 16251 |
| 305 | Ga0207705_10225365 | 3300025909 | Bacteria | 1425 |
| 306 | Ga0207654_10013888 | 3300025911 | Bacteria | 4150 |
| 307 | Ga0207707_10023111 | 3300025912 | Bacteria | 5441 |
| 308 | Ga0207707_10282464 | 3300025912 | Bacteria | 1438 |
| 309 | Ga0207695_10005620 | 3300025913 | Bacteria | 16569 |
| 310 | Ga0207693_10000062 | 3300025915 | Bacteria | 92689 |
| 311 | Ga0207663_10001357 | 3300025916 | Bacteria | 11339 |
| 312 | Ga0207660_10006479 | 3300025917 | Bacteria | 7592 |
| 313 | Ga0207662_10242107 | 3300025918 | Bacteria | 1181 |
| 314 | Ga0207657_10000023 | 3300025919 | Bacteria | 152701 |
| 315 | Ga0207649_10002977 | 3300025920 | Bacteria | 9330 |
| 316 | Ga0207649_10288529 | 3300025920 | Bacteria | 1196 |
| 317 | Ga0207681_10004374 | 3300025923 | Bacteria | 8708 |
| 318 | Ga0207681_10092779 | 3300025923 | Bacteria | 2159 |
| 319 | Ga0207650_10003802 | 3300025925 | Bacteria | 10322 |
| 320 | Ga0207659_10010335 | 3300025926 | Bacteria | 5862 |
| 321 | Ga0207687_10003089 | 3300025927 | Bacteria | 11289 |
| 322 | Ga0207664_10071628 | 3300025929 | Bacteria | 2793 |
| 323 | Ga0207690_10000718 | 3300025932 | Bacteria | 21331 |
| 324 | Ga0207706_10000019 | 3300025933 | Bacteria | 167592 |
| 325 | Ga0207706_10125161 | 3300025933 | Bacteria | 2261 |
| 326 | Ga0207709_10002908 | 3300025935 | Bacteria | 10453 |
| 327 | Ga0207709_10183391 | 3300025935 | Bacteria | 1480 |
| 328 | Ga0207709_10382458 | 3300025935 | Bacteria | 1071 |
| 329 | Ga0207670_10007526 | 3300025936 | Bacteria | 6082 |
| 330 | Ga0207670_10355450 | 3300025936 | Bacteria | 1161 |
| 331 | Ga0207669_10008631 | 3300025937 | Bacteria | 4796 |
| 332 | Ga0207669_10307788 | 3300025937 | Bacteria | 1207 |
| 333 | Ga0207704_10060146 | 3300025938 | Bacteria | 2349 |
| 334 | Ga0207665_10000161 | 3300025939 | Bacteria | 45172 |
| 335 | Ga0207691_10002469 | 3300025940 | Bacteria | 18087 |
| 336 | Ga0207689_10006185 | 3300025942 | Bacteria | 10599 |
| 337 | Ga0207689_10390617 | 3300025942 | Bacteria | 1159 |
| 338 | Ga0207661_10006687 | 3300025944 | Bacteria | 8157 |
| 339 | Ga0207667_10048216 | 3300025949 | Bacteria | 4505 |
| 340 | Ga0207651_10011625 | 3300025960 | Bacteria | 4935 |
| 341 | Ga0207651_10317025 | 3300025960 | Bacteria | 1302 |
| 342 | Ga0207712_10007216 | 3300025961 | Bacteria | 7011 |
| 343 | Ga0207668_10002748 | 3300025972 | Bacteria | 10281 |
| 344 | Ga0207668_10105038 | 3300025972 | Bacteria | 2107 |
| 345 | Ga0207640_10144135 | 3300025981 | Bacteria | 1741 |
| 346 | Ga0207658_10069788 | 3300025986 | Bacteria | 2656 |
| 347 | Ga0207658_10353570 | 3300025986 | Bacteria | 1280 |
| 348 | Ga0207677_10023036 | 3300026023 | Bacteria | 3838 |
| 349 | Ga0207703_10027778 | 3300026035 | Bacteria | 4456 |
| 350 | Ga0207639_10002698 | 3300026041 | Bacteria | 11913 |
| 351 | Ga0207639_10252117 | 3300026041 | Bacteria | 1539 |
| 352 | Ga0207678_10000017 | 3300026067 | Bacteria | 135871 |
| 353 | Ga0207678_10097106 | 3300026067 | Bacteria | 2518 |
| 354 | Ga0207678_10128460 | 3300026067 | Bacteria | 2162 |
| 355 | Ga0207708_10000315 | 3300026075 | Bacteria | 38170 |
| 356 | Ga0207708_10024104 | 3300026075 | Bacteria | 4601 |
| 357 | Ga0207708_10054070 | 3300026075 | Bacteria | 3060 |
| 358 | Ga0207702_10273898 | 3300026078 | Bacteria | 1593 |
| 359 | Ga0207641_10025704 | 3300026088 | Bacteria | 4854 |
| 360 | Ga0207648_10014325 | 3300026089 | Bacteria | 7329 |
| 361 | Ga0207648_10342553 | 3300026089 | Bacteria | 1346 |
| 362 | Ga0207648_10450826 | 3300026089 | Bacteria | 1171 |
| 363 | Ga0207676_10024347 | 3300026095 | Bacteria | 4478 |
| 364 | Ga0207675_100000439 | 3300026118 | Bacteria | 40472 |
| 365 | Ga0207675_100524412 | 3300026118 | Bacteria | 1181 |
| 366 | Ga0207683_10000030 | 3300026121 | Bacteria | 109087 |
| 367 | Ga0207698_10104671 | 3300026142 | Bacteria | 2355 |
| 368 | Ga0209281_1000534 | 3300027111 | Bacteria | 48198 |
| 369 | Ga0209281_1010564 | 3300027111 | Bacteria | 2107 |
| 370 | Ga0207428_10013069 | 3300027907 | Bacteria | 7270 |
| 371 | Ga0207428_10063830 | 3300027907 | Bacteria | 2909 |
| 372 | Ga0207428_10212828 | 3300027907 | Bacteria | 1452 |
| 373 | Ga0268266_10367654 | 3300028379 | Bacteria | 1354 |
| 374 | Ga0268265_10048382 | 3300028380 | Bacteria | 3192 |
| 375 | Ga0268265_10168506 | 3300028380 | Bacteria | 1869 |
| 376 | Ga0268265_10265606 | 3300028380 | Bacteria | 1528 |
| 377 | Ga0268264_10007754 | 3300028381 | Bacteria | 8937 |
| 378 | Ga0268264_10063714 | 3300028381 | Bacteria | 3100 |
| 379 | Ga0268264_10518161 | 3300028381 | Bacteria | 1165 |
| 380 | Ga0265337_1009926 | 3300028556 | Bacteria | 3364 |
| 381 | Ga0265337_1014581 | 3300028556 | Bacteria | 2602 |
| 382 | Ga0265319_1001000 | 3300028563 | Bacteria | 17721 |
| 383 | Ga0265319_1018833 | 3300028563 | Bacteria | 2591 |
| 384 | Ga0265323_10000409 | 3300028653 | Bacteria | 24593 |
| 385 | Ga0265336_10000099 | 3300028666 | Bacteria | 66151 |
| 386 | Ga0265338_10000207 | 3300028800 | Bacteria | 110193 |
| 387 | Ga0265338_10085517 | 3300028800 | Bacteria | 2628 |
| 388 | Ga0265324_10017130 | 3300029957 | Bacteria | 2636 |
| 389 | Ga0265330_10040844 | 3300031235 | Bacteria | 2059 |
| 390 | Ga0265320_10005248 | 3300031240 | Bacteria | 8349 |
| 391 | Ga0265325_10033605 | 3300031241 | Bacteria | 2734 |
| 392 | Ga0265331_10062684 | 3300031250 | Bacteria | 1753 |
| 393 | Ga0265327_10007921 | 3300031251 | Bacteria | 8047 |
| 394 | Ga0265313_10000291 | 3300031595 | Bacteria | 54688 |
| 395 | Ga0265314_10011272 | 3300031711 | Bacteria | 7394 |
| 396 | Ga0307412_10032254 | 3300031911 | Bacteria | 3317 |
| 397 | Ga0373940_0065170 | 3300035088 | Bacteria | 1050 |
| 398 | Ga0373939_0017207 | 3300035114 | Bacteria | 1918 |
| 399 | Ga0373943_0088480 | 3300035170 | Bacteria | 1600 |
| 400 | Ga0373955_0129711 | 3300035172 | Bacteria | 1471 |
| 401 | Ga0373962_0003078 | 3300035242 | Bacteria | 3996 |
| 402 | Ga0373931_0000691 | 3300035691 | Bacteria | 13957 |
| 403 | Ga0373931_0147111 | 3300035691 | Bacteria | 1370 |
| 404 | Ga0373935_0082940 | 3300035692 | Bacteria | 2086 |
| 405 | Ga0373927_0001084 | 3300035695 | Bacteria | 20711 |
| 406 | Ga0373947_0001088 | 3300035725 | Bacteria | 16660 |
| 407 | Ga0373937_0115504 | 3300036401 | Bacteria | 2499 |
| 408 | Ga0373937_0216024 | 3300036401 | Bacteria | 1805 |
| 409 | Ga0373925_0009820 | 3300037068 | Bacteria | 6950 |
| 410 | Ga0395900_0021026 | 3300037418 | Bacteria | 6669 |
| 411 | Ga0395898_0053977 | 3300037466 | Bacteria | 3923 |
| 412 | Ga0395898_0129439 | 3300037466 | Bacteria | 2418 |
| 413 | Ga0395905_0001187 | 3300037471 | Bacteria | 32583 |
| 414 | Ga0395905_0073920 | 3300037471 | Bacteria | 3195 |
| 415 | Ga0436364_1293474 | 3300037853 | Bacteria | 4076 |
| 416 | Ga0436364_1408706 | 3300037853 | Bacteria | 2344 |
| 417 | Ga0395901_0001359 | 3300038443 | Bacteria | 25608 |
| 418 | Ga0400483_108990 | 3300039062 | Bacteria | 4667 |
| 419 | Ga0436365_0384831 | 3300039437 | Bacteria | 21866 |
| 420 | Ga0436365_1633568 | 3300039437 | Bacteria | 6619 |
| 421 | Ga0436363_0075424 | 3300039450 | Bacteria | 36209 |
| 422 | Ga0436363_1071452 | 3300039450 | Bacteria | 10612 |
| 423 | Ga0436362_0348730 | 3300039453 | Bacteria | 10345 |
| 424 | Ga0439436_0017063 | 3300041404 | Bacteria | 2173 |
| 425 | Ga0439438_000048 | 3300041405 | Bacteria | 58674 |
| 426 | Ga0439438_000153 | 3300041405 | Bacteria | 31443 |
| 427 | Ga0439438_006718 | 3300041405 | Bacteria | 4015 |
| 428 | Ga0439438_008693 | 3300041405 | Bacteria | 3343 |
| 429 | Ga0439447_000014 | 3300041407 | Bacteria | 72178 |
| 430 | Ga0439447_000414 | 3300041407 | Bacteria | 15820 |
| 431 | Ga0439447_010099 | 3300041407 | Bacteria | 2818 |
| 432 | Ga0439466_0000659 | 3300041411 | Bacteria | 12989 |
| 433 | Ga0439466_0002820 | 3300041411 | Bacteria | 6802 |
| 434 | Ga0439466_0013376 | 3300041411 | Bacteria | 3005 |
| 435 | Ga0439466_0022364 | 3300041411 | Bacteria | 2232 |
| 436 | Ga0451853_0192445 | 3300041512 | Bacteria | 1073 |
| 437 | Ga0439445_0014397 | 3300042004 | Bacteria | 1925 |
| 438 | Ga0439449_0036597 | 3300042007 | Bacteria | 1826 |
| 439 | Ga0439451_010941 | 3300042009 | Bacteria | 1829 |
| 440 | Ga0439451_012870 | 3300042009 | Bacteria | 1690 |
| 441 | Ga0439452_000137 | 3300042010 | Bacteria | 55736 |
| 442 | Ga0439452_012445 | 3300042010 | Bacteria | 2420 |
| 443 | Ga0439452_018141 | 3300042010 | Bacteria | 1879 |
| 444 | Ga0439456_006194 | 3300042013 | Bacteria | 2438 |
| 445 | Ga0439456_006458 | 3300042013 | Bacteria | 2396 |
| 446 | Ga0439463_017211 | 3300042016 | Bacteria | 1791 |
| 447 | Ga0450911_002279 | 3300042115 | Bacteria | 3850 |
| 448 | Ga0450911_009615 | 3300042115 | Bacteria | 1352 |
| 449 | Ga0450902_004943 | 3300042137 | Bacteria | 2000 |
| 450 | Ga0450902_007410 | 3300042137 | Bacteria | 1698 |
| 451 | Ga0450903_000548 | 3300042138 | Bacteria | 7789 |
| 452 | Ga0450903_002041 | 3300042138 | Bacteria | 3634 |
| 453 | Ga0450903_009088 | 3300042138 | Bacteria | 1622 |
| 454 | Ga0450904_004910 | 3300042139 | Bacteria | 1373 |
| 455 | Ga0450905_003625 | 3300042142 | Bacteria | 2031 |
| 456 | Ga0450906_013666 | 3300042145 | Bacteria | 1494 |
| 457 | Ga0450907_001628 | 3300042146 | Bacteria | 4705 |
| 458 | Ga0450910_000637 | 3300042147 | Bacteria | 4170 |
| 459 | Ga0439460_0002902 | 3300042461 | Bacteria | 4131 |
| 460 | Ga0439460_0030465 | 3300042461 | Bacteria | 1534 |
| 461 | Ga0453684_0080701 | 3300044712 | Bacteria | 4061 |
| 462 | Ga0495617_000106 | 3300046452 | Bacteria | 61107 |
| 463 | Ga0495617_000201 | 3300046452 | Bacteria | 37750 |
| 464 | Ga0495617_003527 | 3300046452 | Bacteria | 5857 |
| 465 | Ga0495617_004861 | 3300046452 | Bacteria | 4836 |
| 466 | Ga0495617_006482 | 3300046452 | Bacteria | 4099 |
| 467 | Ga0495617_013983 | 3300046452 | Bacteria | 2728 |
| 468 | Ga0495617_025287 | 3300046452 | Bacteria | 2002 |
| 469 | Ga0495617_028601 | 3300046452 | Bacteria | 1873 |
| 470 | Ga0495617_035448 | 3300046452 | Bacteria | 1675 |
| 471 | Ga0495627_002130 | 3300046453 | Bacteria | 9974 |
| 472 | Ga0495627_011247 | 3300046453 | Bacteria | 3217 |
| 473 | Ga0495627_041568 | 3300046453 | Bacteria | 1411 |
| 474 | Ga0495603_0000238 | 3300046455 | Bacteria | 28693 |
| 475 | Ga0495603_0003168 | 3300046455 | Bacteria | 9778 |
| 476 | Ga0495603_0026485 | 3300046455 | Bacteria | 3503 |
| 477 | Ga0495603_0042054 | 3300046455 | Bacteria | 2732 |
| 478 | Ga0495603_0073397 | 3300046455 | Bacteria | 2010 |
| 479 | Ga0495603_0179507 | 3300046455 | Bacteria | 1225 |
| 480 | Ga0495590_0000226 | 3300046457 | Bacteria | 30856 |
| 481 | Ga0495590_0001776 | 3300046457 | Bacteria | 9162 |
| 482 | Ga0495590_0002415 | 3300046457 | Bacteria | 7733 |
| 483 | Ga0495590_0002968 | 3300046457 | Bacteria | 6966 |
| 484 | Ga0495590_0008979 | 3300046457 | Bacteria | 3798 |
| 485 | Ga0495590_0024121 | 3300046457 | Bacteria | 2144 |
| 486 | Ga0495591_000138 | 3300046458 | Bacteria | 78836 |
| 487 | Ga0495591_000139 | 3300046458 | Bacteria | 78636 |
| 488 | Ga0495591_003357 | 3300046458 | Bacteria | 8317 |
| 489 | Ga0495591_004318 | 3300046458 | Bacteria | 7006 |
| 490 | Ga0495591_005080 | 3300046458 | Bacteria | 6178 |
| 491 | Ga0495591_006752 | 3300046458 | Bacteria | 5000 |
| 492 | Ga0495591_008966 | 3300046458 | Bacteria | 4033 |
| 493 | Ga0495591_018119 | 3300046458 | Bacteria | 2395 |
| 494 | Ga0495591_021457 | 3300046458 | Bacteria | 2106 |
| 495 | Ga0495591_043537 | 3300046458 | Bacteria | 1262 |
| 496 | Ga0495629_0000781 | 3300046459 | Bacteria | 25685 |
| 497 | Ga0495629_0009940 | 3300046459 | Bacteria | 6943 |
| 498 | Ga0495629_0286209 | 3300046459 | Bacteria | 1130 |
| 499 | Ga0495638_0000117 | 3300046460 | Bacteria | 127788 |
| 500 | Ga0495638_0001251 | 3300046460 | Bacteria | 23897 |
| 501 | Ga0495638_0002925 | 3300046460 | Bacteria | 13642 |
| 502 | Ga0495638_0003030 | 3300046460 | Bacteria | 13383 |
| 503 | Ga0495638_0006658 | 3300046460 | Bacteria | 8384 |
| 504 | Ga0495638_0008506 | 3300046460 | Bacteria | 7271 |
| 505 | Ga0495638_0015837 | 3300046460 | Bacteria | 5052 |
| 506 | Ga0495638_0021001 | 3300046460 | Bacteria | 4309 |
| 507 | Ga0495638_0022381 | 3300046460 | Bacteria | 4149 |
| 508 | Ga0495638_0024211 | 3300046460 | Bacteria | 3961 |
| 509 | Ga0495638_0038404 | 3300046460 | Bacteria | 3042 |
| 510 | Ga0495638_0078104 | 3300046460 | Bacteria | 2014 |
| 511 | Ga0495653_0001441 | 3300046463 | Bacteria | 18559 |
| 512 | Ga0495653_0007024 | 3300046463 | Bacteria | 9241 |
| 513 | Ga0495653_0016699 | 3300046463 | Bacteria | 5974 |
| 514 | Ga0495653_0073281 | 3300046463 | Bacteria | 2555 |
| 515 | Ga0495650_0001886 | 3300046471 | Bacteria | 18639 |
| 516 | Ga0495650_0002593 | 3300046471 | Bacteria | 14217 |
| 517 | Ga0495650_0003727 | 3300046471 | Bacteria | 10899 |
| 518 | Ga0495650_0007809 | 3300046471 | Bacteria | 6362 |
| 519 | Ga0495650_0008937 | 3300046471 | Bacteria | 5768 |
| 520 | Ga0495650_0020294 | 3300046471 | Bacteria | 3243 |
| 521 | Ga0495650_0038164 | 3300046471 | Bacteria | 2083 |
| 522 | Ga0495650_0095781 | 3300046471 | Bacteria | 1121 |
| 523 | Ga0495580_0000522 | 3300046472 | Bacteria | 32417 |
| 524 | Ga0495582_0000670 | 3300046473 | Bacteria | 18834 |
| 525 | Ga0495582_0009450 | 3300046473 | Bacteria | 5370 |
| 526 | Ga0495605_0000114 | 3300046474 | Bacteria | 103834 |
| 527 | Ga0495605_0000557 | 3300046474 | Bacteria | 30487 |
| 528 | Ga0495605_0002643 | 3300046474 | Bacteria | 10978 |
| 529 | Ga0495605_0005058 | 3300046474 | Bacteria | 7696 |
| 530 | Ga0495605_0007050 | 3300046474 | Bacteria | 6407 |
| 531 | Ga0495605_0007746 | 3300046474 | Bacteria | 6086 |
| 532 | Ga0495605_0008069 | 3300046474 | Bacteria | 5959 |
| 533 | Ga0495605_0010101 | 3300046474 | Bacteria | 5288 |
| 534 | Ga0495605_0015923 | 3300046474 | Bacteria | 4080 |
| 535 | Ga0495605_0034356 | 3300046474 | Bacteria | 2567 |
| 536 | Ga0495605_0037372 | 3300046474 | Bacteria | 2443 |
| 537 | Ga0495605_0040574 | 3300046474 | Bacteria | 2322 |
| 538 | Ga0495639_0000001 | 3300046475 | Bacteria | 204442 |
| 539 | Ga0495639_0006700 | 3300046475 | Bacteria | 4957 |
| 540 | Ga0495639_0013989 | 3300046475 | Bacteria | 3472 |
| 541 | Ga0495639_0015494 | 3300046475 | Bacteria | 3306 |
| 542 | Ga0495639_0026285 | 3300046475 | Bacteria | 2572 |
| 543 | Ga0495639_0031314 | 3300046475 | Bacteria | 2367 |
| 544 | Ga0495584_0000140 | 3300046491 | Bacteria | 50112 |
| 545 | Ga0495584_0000469 | 3300046491 | Bacteria | 27780 |
| 546 | Ga0495584_0001357 | 3300046491 | Bacteria | 14807 |
| 547 | Ga0495584_0010763 | 3300046491 | Bacteria | 4697 |
| 548 | Ga0495584_0017629 | 3300046491 | Bacteria | 3633 |
| 549 | Ga0495584_0019149 | 3300046491 | Bacteria | 3476 |
| 550 | Ga0495584_0020466 | 3300046491 | Bacteria | 3361 |
| 551 | Ga0495584_0028990 | 3300046491 | Bacteria | 2805 |
| 552 | Ga0495584_0040341 | 3300046491 | Bacteria | 2357 |
| 553 | Ga0495585_0000605 | 3300046492 | Bacteria | 33591 |
| 554 | Ga0495585_0003016 | 3300046492 | Bacteria | 11604 |
| 555 | Ga0495585_0003480 | 3300046492 | Bacteria | 10628 |
| 556 | Ga0495585_0006756 | 3300046492 | Bacteria | 7079 |
| 557 | Ga0495585_0009789 | 3300046492 | Bacteria | 5734 |
| 558 | Ga0495585_0016584 | 3300046492 | Bacteria | 4268 |
| 559 | Ga0495585_0018499 | 3300046492 | Bacteria | 4018 |
| 560 | Ga0495585_0026259 | 3300046492 | Bacteria | 3327 |
| 561 | Ga0495585_0060336 | 3300046492 | Bacteria | 2087 |
| 562 | Ga0495594_0000025 | 3300046499 | Bacteria | 69403 |
| 563 | Ga0495594_0001211 | 3300046499 | Bacteria | 13483 |
| 564 | Ga0495594_0013051 | 3300046499 | Bacteria | 4332 |
| 565 | Ga0495594_0015740 | 3300046499 | Bacteria | 3977 |
| 566 | Ga0495596_0000049 | 3300046500 | Bacteria | 87906 |
| 567 | Ga0495596_0025824 | 3300046500 | Bacteria | 2372 |
| 568 | Ga0495607_0000188 | 3300046501 | Bacteria | 66018 |
| 569 | Ga0495607_0000709 | 3300046501 | Bacteria | 32137 |
| 570 | Ga0495607_0001305 | 3300046501 | Bacteria | 22209 |
| 571 | Ga0495607_0003254 | 3300046501 | Bacteria | 12507 |
| 572 | Ga0495607_0013223 | 3300046501 | Bacteria | 5419 |
| 573 | Ga0495607_0020829 | 3300046501 | Bacteria | 4136 |
| 574 | Ga0495607_0036444 | 3300046501 | Bacteria | 2963 |
| 575 | Ga0495607_0041815 | 3300046501 | Bacteria | 2720 |
| 576 | Ga0495607_0085422 | 3300046501 | Bacteria | 1723 |
| 577 | Ga0495607_0085595 | 3300046501 | Bacteria | 1721 |
| 578 | Ga0495607_0183724 | 3300046501 | Bacteria | 1046 |
| 579 | Ga0495583_0003084 | 3300046506 | Bacteria | 13195 |
| 580 | Ga0495583_0004168 | 3300046506 | Bacteria | 10536 |
| 581 | Ga0495583_0006113 | 3300046506 | Bacteria | 7942 |
| 582 | Ga0495606_0001909 | 3300046507 | Bacteria | 25955 |
| 583 | Ga0495606_0003137 | 3300046507 | Bacteria | 17919 |
| 584 | Ga0495606_0003315 | 3300046507 | Bacteria | 17184 |
| 585 | Ga0495606_0005520 | 3300046507 | Bacteria | 12075 |
| 586 | Ga0495606_0011709 | 3300046507 | Bacteria | 7119 |
| 587 | Ga0495606_0071619 | 3300046507 | Bacteria | 2181 |
| 588 | Ga0495610_0000577 | 3300046512 | Bacteria | 36435 |
| 589 | Ga0495610_0002921 | 3300046512 | Bacteria | 13810 |
| 590 | Ga0495610_0005314 | 3300046512 | Bacteria | 9204 |
| 591 | Ga0495610_0015560 | 3300046512 | Bacteria | 4414 |
| 592 | Ga0495610_0022499 | 3300046512 | Bacteria | 3446 |
| 593 | Ga0495610_0025009 | 3300046512 | Bacteria | 3214 |
| 594 | Ga0495610_0097142 | 3300046512 | Bacteria | 1325 |
| 595 | Ga0495616_0000101 | 3300046513 | Bacteria | 73493 |
| 596 | Ga0495616_0002771 | 3300046513 | Bacteria | 11450 |
| 597 | Ga0495616_0004149 | 3300046513 | Bacteria | 9182 |
| 598 | Ga0495616_0004349 | 3300046513 | Bacteria | 8939 |
| 599 | Ga0495616_0006099 | 3300046513 | Bacteria | 7343 |
| 600 | Ga0495616_0027320 | 3300046513 | Bacteria | 3029 |
| 601 | Ga0495616_0027440 | 3300046513 | Bacteria | 3021 |
| 602 | Ga0495616_0030587 | 3300046513 | Bacteria | 2827 |
| 603 | Ga0495620_0003671 | 3300046515 | Bacteria | 8764 |
| 604 | Ga0495620_0004593 | 3300046515 | Bacteria | 7765 |
| 605 | Ga0495620_0004634 | 3300046515 | Bacteria | 7727 |
| 606 | Ga0495620_0006538 | 3300046515 | Bacteria | 6393 |
| 607 | Ga0495620_0013985 | 3300046515 | Bacteria | 4092 |
| 608 | Ga0495620_0021167 | 3300046515 | Bacteria | 3162 |
| 609 | Ga0495620_0026770 | 3300046515 | Bacteria | 2707 |
| 610 | Ga0495628_0066143 | 3300046516 | Bacteria | 2826 |
| 611 | Ga0495630_0000706 | 3300046517 | Bacteria | 23762 |
| 612 | Ga0495630_0006789 | 3300046517 | Bacteria | 8157 |
| 613 | Ga0495630_0025835 | 3300046517 | Bacteria | 4344 |
| 614 | Ga0495630_0026071 | 3300046517 | Bacteria | 4326 |
| 615 | Ga0495631_0000002 | 3300046518 | Bacteria | 178694 |
| 616 | Ga0495631_0000005 | 3300046518 | Bacteria | 159179 |
| 617 | Ga0495631_0009196 | 3300046518 | Bacteria | 4949 |
| 618 | Ga0495631_0021330 | 3300046518 | Bacteria | 3016 |
| 619 | Ga0495631_0021622 | 3300046518 | Bacteria | 2995 |
| 620 | Ga0495632_0000322 | 3300046519 | Bacteria | 46210 |
| 621 | Ga0495632_0001664 | 3300046519 | Bacteria | 18204 |
| 622 | Ga0495632_0003128 | 3300046519 | Bacteria | 11977 |
| 623 | Ga0495632_0006053 | 3300046519 | Bacteria | 7852 |
| 624 | Ga0495632_0009894 | 3300046519 | Bacteria | 5701 |
| 625 | Ga0495632_0013189 | 3300046519 | Bacteria | 4727 |
| 626 | Ga0495632_0015296 | 3300046519 | Bacteria | 4309 |
| 627 | Ga0495632_0015974 | 3300046519 | Bacteria | 4189 |
| 628 | Ga0495632_0077760 | 3300046519 | Bacteria | 1586 |
| 629 | Ga0495632_0097640 | 3300046519 | Bacteria | 1386 |
| 630 | Ga0495632_0107873 | 3300046519 | Bacteria | 1309 |
| 631 | Ga0495637_0000044 | 3300046520 | Bacteria | 111531 |
| 632 | Ga0495637_0000681 | 3300046520 | Bacteria | 23563 |
| 633 | Ga0495637_0004891 | 3300046520 | Bacteria | 6896 |
| 634 | Ga0495637_0007731 | 3300046520 | Bacteria | 5315 |
| 635 | Ga0495637_0008150 | 3300046520 | Bacteria | 5155 |
| 636 | Ga0495637_0010618 | 3300046520 | Bacteria | 4448 |
| 637 | Ga0495637_0012047 | 3300046520 | Bacteria | 4145 |
| 638 | Ga0495637_0023014 | 3300046520 | Bacteria | 2836 |
| 639 | Ga0495637_0027239 | 3300046520 | Bacteria | 2559 |
| 640 | Ga0495637_0087599 | 3300046520 | Bacteria | 1232 |
| 641 | Ga0495643_0015564 | 3300046522 | Bacteria | 4492 |
| 642 | Ga0495643_0019946 | 3300046522 | Bacteria | 3874 |
| 643 | Ga0495643_0020086 | 3300046522 | Bacteria | 3858 |
| 644 | Ga0495643_0053579 | 3300046522 | Bacteria | 2162 |
| 645 | Ga0495643_0053632 | 3300046522 | Bacteria | 2161 |
| 646 | Ga0495644_0000731 | 3300046523 | Bacteria | 13631 |
| 647 | Ga0495644_0001290 | 3300046523 | Bacteria | 10285 |
| 648 | Ga0495644_0055584 | 3300046523 | Bacteria | 1487 |
| 649 | Ga0495648_0003121 | 3300046524 | Bacteria | 14779 |
| 650 | Ga0495648_0004989 | 3300046524 | Bacteria | 11147 |
| 651 | Ga0495648_0007416 | 3300046524 | Bacteria | 8775 |
| 652 | Ga0495648_0016666 | 3300046524 | Bacteria | 5288 |
| 653 | Ga0495648_0019606 | 3300046524 | Bacteria | 4748 |
| 654 | Ga0495648_0064662 | 3300046524 | Bacteria | 2154 |
| 655 | Ga0495648_0171466 | 3300046524 | Bacteria | 1111 |
| 656 | Ga0495663_0031541 | 3300046525 | Bacteria | 1575 |
| 657 | Ga0495666_0000043 | 3300046526 | Bacteria | 46931 |
| 658 | Ga0495666_0001238 | 3300046526 | Bacteria | 12361 |
| 659 | Ga0495666_0005337 | 3300046526 | Bacteria | 6481 |
| 660 | Ga0495666_0022824 | 3300046526 | Bacteria | 3097 |
| 661 | Ga0495666_0063680 | 3300046526 | Bacteria | 1760 |
| 662 | Ga0495642_0000019 | 3300046528 | Bacteria | 106141 |
| 663 | Ga0495642_0000130 | 3300046528 | Bacteria | 43443 |
| 664 | Ga0495642_0000221 | 3300046528 | Bacteria | 32689 |
| 665 | Ga0495654_0000088 | 3300046530 | Bacteria | 104763 |
| 666 | Ga0495654_0000145 | 3300046530 | Bacteria | 73703 |
| 667 | Ga0495654_0001307 | 3300046530 | Bacteria | 17424 |
| 668 | Ga0495654_0004399 | 3300046530 | Bacteria | 8374 |
| 669 | Ga0495654_0008378 | 3300046530 | Bacteria | 5715 |
| 670 | Ga0495654_0010718 | 3300046530 | Bacteria | 4978 |
| 671 | Ga0495654_0012190 | 3300046530 | Bacteria | 4625 |
| 672 | Ga0495654_0012471 | 3300046530 | Bacteria | 4562 |
| 673 | Ga0495654_0013597 | 3300046530 | Bacteria | 4352 |
| 674 | Ga0495654_0014729 | 3300046530 | Bacteria | 4157 |
| 675 | Ga0495654_0017179 | 3300046530 | Bacteria | 3808 |
| 676 | Ga0495654_0018864 | 3300046530 | Bacteria | 3609 |
| 677 | Ga0495654_0018940 | 3300046530 | Bacteria | 3601 |
| 678 | Ga0495654_0021708 | 3300046530 | Bacteria | 3338 |
| 679 | Ga0495654_0030618 | 3300046530 | Bacteria | 2736 |
| 680 | Ga0495654_0035971 | 3300046530 | Bacteria | 2490 |
| 681 | Ga0495665_0002289 | 3300046531 | Bacteria | 10344 |
| 682 | Ga0495586_0007464 | 3300046535 | Bacteria | 5834 |
| 683 | Ga0495587_0006912 | 3300046536 | Bacteria | 7377 |
| 684 | Ga0495587_0053762 | 3300046536 | Bacteria | 2373 |
| 685 | Ga0495598_0063608 | 3300046537 | Bacteria | 1145 |
| 686 | Ga0495609_0001246 | 3300046538 | Bacteria | 17513 |
| 687 | Ga0495609_0001924 | 3300046538 | Bacteria | 13212 |
| 688 | Ga0495609_0002918 | 3300046538 | Bacteria | 10176 |
| 689 | Ga0495609_0006052 | 3300046538 | Bacteria | 6232 |
| 690 | Ga0495609_0008107 | 3300046538 | Bacteria | 5171 |
| 691 | Ga0495609_0013487 | 3300046538 | Bacteria | 3856 |
| 692 | Ga0495609_0018581 | 3300046538 | Bacteria | 3220 |
| 693 | Ga0495609_0054110 | 3300046538 | Bacteria | 1783 |
| 694 | Ga0495597_0005702 | 3300046542 | Bacteria | 6550 |
| 695 | Ga0495597_0007011 | 3300046542 | Bacteria | 5775 |
| 696 | Ga0495597_0007149 | 3300046542 | Bacteria | 5704 |
| 697 | Ga0495597_0011444 | 3300046542 | Bacteria | 4301 |
| 698 | Ga0495597_0012278 | 3300046542 | Bacteria | 4133 |
| 699 | Ga0495597_0014156 | 3300046542 | Bacteria | 3801 |
| 700 | Ga0495597_0041379 | 3300046542 | Bacteria | 2058 |
| 701 | Ga0495597_0062137 | 3300046542 | Bacteria | 1625 |
| 702 | Ga0495597_0085661 | 3300046542 | Bacteria | 1342 |
| 703 | Ga0495645_0037872 | 3300046543 | Bacteria | 3516 |
| 704 | Ga0495622_0000347 | 3300046557 | Bacteria | 33186 |
| 705 | Ga0495622_0000784 | 3300046557 | Bacteria | 17691 |
| 706 | Ga0495622_0014420 | 3300046557 | Bacteria | 3669 |
| 707 | Ga0495622_0024060 | 3300046557 | Bacteria | 2842 |
| 708 | Ga0495633_0000412 | 3300046558 | Bacteria | 44548 |
| 709 | Ga0495633_0001574 | 3300046558 | Bacteria | 17471 |
| 710 | Ga0495633_0007856 | 3300046558 | Bacteria | 6088 |
| 711 | Ga0495633_0050633 | 3300046558 | Bacteria | 1958 |
| 712 | Ga0495656_0005448 | 3300046615 | Bacteria | 4395 |
| 713 | Ga0495656_0020605 | 3300046615 | Bacteria | 2558 |
| 714 | Ga0495656_0054045 | 3300046615 | Bacteria | 1727 |
| 715 | Ga0495656_0059756 | 3300046615 | Bacteria | 1659 |
| 716 | Ga0495668_0000732 | 3300046616 | Bacteria | 39331 |
| 717 | Ga0495668_0031160 | 3300046616 | Bacteria | 3006 |
| 718 | Ga0495668_0033454 | 3300046616 | Bacteria | 2888 |
| 719 | Ga0495668_0204165 | 3300046616 | Bacteria | 1082 |
| 720 | Ga0495634_0003589 | 3300046642 | Bacteria | 12402 |
| 721 | Ga0495634_0031362 | 3300046642 | Bacteria | 3661 |
| 722 | Ga0495611_0000612 | 3300046648 | Bacteria | 20591 |
| 723 | Ga0495611_0005091 | 3300046648 | Bacteria | 5632 |
| 724 | Ga0495611_0005145 | 3300046648 | Bacteria | 5606 |
| 725 | Ga0495625_0001435 | 3300046660 | Bacteria | 29011 |
| 726 | Ga0495625_0001805 | 3300046660 | Bacteria | 24590 |
| 727 | Ga0495625_0003496 | 3300046660 | Bacteria | 15579 |
| 728 | Ga0495625_0005136 | 3300046660 | Bacteria | 12086 |
| 729 | Ga0495625_0005271 | 3300046660 | Bacteria | 11870 |
| 730 | Ga0495625_0006297 | 3300046660 | Bacteria | 10612 |
| 731 | Ga0495625_0006992 | 3300046660 | Bacteria | 9944 |
| 732 | Ga0495625_0036878 | 3300046660 | Bacteria | 3589 |
| 733 | Ga0495625_0047511 | 3300046660 | Bacteria | 3094 |
| 734 | Ga0495625_0121169 | 3300046660 | Bacteria | 1779 |
| 735 | Ga0495625_0263251 | 3300046660 | Bacteria | 1115 |
| 736 | Ga0495635_0005441 | 3300046663 | Bacteria | 8855 |
| 737 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 738 | Ga0495659_0003290 | 3300046664 | Bacteria | 5182 |
| 739 | Ga0495661_0000036 | 3300046665 | Bacteria | 164694 |
| 740 | Ga0495661_0018807 | 3300046665 | Bacteria | 4535 |
| 741 | Ga0495661_0020356 | 3300046665 | Bacteria | 4333 |
| 742 | Ga0495661_0029068 | 3300046665 | Bacteria | 3531 |
| 743 | Ga0495661_0070299 | 3300046665 | Bacteria | 2049 |
| 744 | Ga0495661_0080891 | 3300046665 | Bacteria | 1874 |
| 745 | Ga0495588_0004882 | 3300046674 | Bacteria | 5944 |
| 746 | Ga0495588_0013375 | 3300046674 | Bacteria | 3910 |
| 747 | Ga0495588_0018651 | 3300046674 | Bacteria | 3387 |
| 748 | Ga0495588_0024295 | 3300046674 | Bacteria | 3009 |
| 749 | Ga0495588_0047393 | 3300046674 | Bacteria | 2206 |
| 750 | Ga0495588_0047943 | 3300046674 | Bacteria | 2194 |
| 751 | Ga0495623_0005212 | 3300046679 | Bacteria | 8524 |
| 752 | Ga0495623_0006880 | 3300046679 | Bacteria | 7398 |
| 753 | Ga0495646_0006459 | 3300046680 | Bacteria | 7437 |
| 754 | Ga0495647_0007179 | 3300046681 | Bacteria | 3723 |
| 755 | Ga0495658_0001055 | 3300046683 | Bacteria | 14545 |
| 756 | Ga0495669_0013407 | 3300046684 | Bacteria | 3492 |
| 757 | Ga0495613_0000236 | 3300046689 | Bacteria | 52791 |
| 758 | Ga0495613_0027231 | 3300046689 | Bacteria | 4253 |
| 759 | Ga0495613_0051427 | 3300046689 | Bacteria | 3036 |
| 760 | Ga0495670_0000596 | 3300046691 | Bacteria | 17241 |
| 761 | Ga0495670_0001315 | 3300046691 | Bacteria | 12114 |
| 762 | Ga0495670_0001962 | 3300046691 | Bacteria | 10108 |
| 763 | Ga0495670_0003569 | 3300046691 | Bacteria | 7636 |
| 764 | Ga0495670_0010342 | 3300046691 | Bacteria | 4583 |
| 765 | Ga0495670_0022689 | 3300046691 | Bacteria | 3100 |
| 766 | Ga0495670_0024323 | 3300046691 | Bacteria | 2993 |
| 767 | Ga0495670_0025300 | 3300046691 | Bacteria | 2936 |
| 768 | Ga0495670_0087280 | 3300046691 | Bacteria | 1594 |
| 769 | Ga0495670_0114449 | 3300046691 | Bacteria | 1398 |
| 770 | Ga0495671_0000567 | 3300046692 | Bacteria | 27640 |
| 771 | Ga0495671_0000807 | 3300046692 | Bacteria | 22388 |
| 772 | Ga0495671_0005047 | 3300046692 | Bacteria | 7776 |
| 773 | Ga0495671_0008889 | 3300046692 | Bacteria | 5640 |
| 774 | Ga0495671_0016906 | 3300046692 | Bacteria | 3888 |
| 775 | Ga0495671_0021233 | 3300046692 | Bacteria | 3412 |
| 776 | Ga0495671_0025357 | 3300046692 | Bacteria | 3082 |
| 777 | Ga0495671_0031820 | 3300046692 | Bacteria | 2695 |
| 778 | Ga0495671_0048874 | 3300046692 | Bacteria | 2109 |
| 779 | Ga0495671_0082008 | 3300046692 | Bacteria | 1580 |
| 780 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 781 | Ga0495649_0001103 | 3300046694 | Bacteria | 21058 |
| 782 | Ga0495649_0003185 | 3300046694 | Bacteria | 11216 |
| 783 | Ga0495649_0004259 | 3300046694 | Bacteria | 9385 |
| 784 | Ga0495649_0004478 | 3300046694 | Bacteria | 9122 |
| 785 | Ga0495649_0005254 | 3300046694 | Bacteria | 8275 |
| 786 | Ga0495649_0019444 | 3300046694 | Bacteria | 3816 |
| 787 | Ga0495649_0027772 | 3300046694 | Bacteria | 3138 |
| 788 | Ga0495649_0031137 | 3300046694 | Bacteria | 2942 |
| 789 | Ga0495649_0044517 | 3300046694 | Bacteria | 2423 |
| 790 | Ga0495589_0000123 | 3300046794 | Bacteria | 72582 |
| 791 | Ga0495589_0000487 | 3300046794 | Bacteria | 28372 |
| 792 | Ga0495589_0000650 | 3300046794 | Bacteria | 22768 |
| 793 | Ga0495589_0004463 | 3300046794 | Bacteria | 7440 |
| 794 | Ga0495589_0007473 | 3300046794 | Bacteria | 5727 |
| 795 | Ga0495589_0008079 | 3300046794 | Bacteria | 5499 |
| 796 | Ga0495589_0026177 | 3300046794 | Bacteria | 2956 |
| 797 | Ga0495589_0075597 | 3300046794 | Bacteria | 1642 |
| 798 | Ga0495589_0080729 | 3300046794 | Bacteria | 1582 |
| 799 | Ga0495589_0128884 | 3300046794 | Bacteria | 1216 |
| 800 | Ga0495600_0019987 | 3300046809 | Bacteria | 4281 |
| 801 | Ga0495600_0155638 | 3300046809 | Bacteria | 1478 |
| 802 | Ga0495660_0002985 | 3300046810 | Bacteria | 10556 |
| 803 | Ga0495660_0007274 | 3300046810 | Bacteria | 6511 |
| 804 | Ga0495660_0012170 | 3300046810 | Bacteria | 4992 |
| 805 | Ga0495660_0017347 | 3300046810 | Bacteria | 4145 |
| 806 | Ga0495660_0018155 | 3300046810 | Bacteria | 4044 |
| 807 | Ga0495660_0026725 | 3300046810 | Bacteria | 3269 |
| 808 | Ga0495660_0051817 | 3300046810 | Bacteria | 2232 |
| 809 | Ga0495660_0085492 | 3300046810 | Bacteria | 1647 |
| 810 | Ga0495660_0092293 | 3300046810 | Bacteria | 1571 |
| 811 | Ga0495581_0002739 | 3300047315 | Bacteria | 10051 |
| 812 | Ga0495581_0003500 | 3300047315 | Bacteria | 9011 |
| 813 | Ga0495581_0057407 | 3300047315 | Bacteria | 2247 |
| 814 | Ga0495604_0001667 | 3300047317 | Bacteria | 18283 |
| 815 | Ga0495604_0019410 | 3300047317 | Bacteria | 5440 |
| 816 | Ga0495604_0086223 | 3300047317 | Bacteria | 2341 |
| 817 | Ga0495604_0233306 | 3300047317 | Bacteria | 1261 |
| 818 | Ga0495636_0000844 | 3300047318 | Bacteria | 11305 |
| 819 | Ga0495636_0004395 | 3300047318 | Bacteria | 5525 |
| 820 | Ga0495636_0025461 | 3300047318 | Bacteria | 2402 |
| 821 | Ga0495674_0006549 | 3300047319 | Bacteria | 11173 |
| 822 | Ga0495672_0000773 | 3300047320 | Bacteria | 34808 |
| 823 | Ga0495672_0001311 | 3300047320 | Bacteria | 24758 |
| 824 | Ga0495672_0001830 | 3300047320 | Bacteria | 20344 |
| 825 | Ga0495672_0002044 | 3300047320 | Bacteria | 18957 |
| 826 | Ga0495672_0003350 | 3300047320 | Bacteria | 13804 |
| 827 | Ga0495672_0006601 | 3300047320 | Bacteria | 8932 |
| 828 | Ga0495672_0008255 | 3300047320 | Bacteria | 7712 |
| 829 | Ga0495672_0012327 | 3300047320 | Bacteria | 5973 |
| 830 | Ga0495672_0017001 | 3300047320 | Bacteria | 4874 |
| 831 | Ga0495672_0019829 | 3300047320 | Bacteria | 4423 |
| 832 | Ga0495672_0076972 | 3300047320 | Bacteria | 1871 |
| 833 | Ga0495672_0099858 | 3300047320 | Bacteria | 1576 |
| 834 | Ga0495672_0127192 | 3300047320 | Bacteria | 1346 |
| 835 | Ga0495680_0001808 | 3300047322 | Bacteria | 22585 |
| 836 | Ga0495680_0005161 | 3300047322 | Bacteria | 12319 |
| 837 | Ga0495680_0005410 | 3300047322 | Bacteria | 12025 |
| 838 | Ga0495680_0031379 | 3300047322 | Bacteria | 4326 |
| 839 | Ga0495680_0036454 | 3300047322 | Bacteria | 3947 |
| 840 | Ga0495680_0152958 | 3300047322 | Bacteria | 1681 |
| 841 | Ga0495683_0000010 | 3300047323 | Bacteria | 223494 |
| 842 | Ga0495683_0000037 | 3300047323 | Bacteria | 140632 |
| 843 | Ga0495683_0000139 | 3300047323 | Bacteria | 71403 |
| 844 | Ga0495683_0002618 | 3300047323 | Bacteria | 10766 |
| 845 | Ga0495683_0002622 | 3300047323 | Bacteria | 10755 |
| 846 | Ga0495683_0009568 | 3300047323 | Bacteria | 5161 |
| 847 | Ga0495683_0010235 | 3300047323 | Bacteria | 4965 |
| 848 | Ga0495683_0013424 | 3300047323 | Bacteria | 4283 |
| 849 | Ga0495683_0016449 | 3300047323 | Bacteria | 3841 |
| 850 | Ga0495683_0019719 | 3300047323 | Bacteria | 3480 |
| 851 | Ga0495683_0031822 | 3300047323 | Bacteria | 2687 |
| 852 | Ga0495683_0032697 | 3300047323 | Bacteria | 2649 |
| 853 | Ga0495683_0036020 | 3300047323 | Bacteria | 2514 |
| 854 | Ga0495683_0074429 | 3300047323 | Bacteria | 1664 |
| 855 | Ga0495683_0110572 | 3300047323 | Bacteria | 1312 |
| 856 | Ga0495687_001399 | 3300047443 | Bacteria | 22271 |
| 857 | Ga0495687_021012 | 3300047443 | Bacteria | 3170 |
| 858 | Ga0495687_084809 | 3300047443 | Bacteria | 1230 |
| 859 | Ga0495675_0026843 | 3300047444 | Bacteria | 3671 |
| 860 | Ga0495675_0051226 | 3300047444 | Bacteria | 2622 |
| 861 | Ga0495677_0075961 | 3300047445 | Bacteria | 1255 |
| 862 | Ga0495679_002402 | 3300047446 | Bacteria | 9565 |
| 863 | Ga0495679_004407 | 3300047446 | Bacteria | 6515 |
| 864 | Ga0495679_005202 | 3300047446 | Bacteria | 5814 |
| 865 | Ga0495679_006403 | 3300047446 | Bacteria | 5076 |
| 866 | Ga0495679_045246 | 3300047446 | Bacteria | 1345 |
| 867 | Ga0495685_004423 | 3300047447 | Bacteria | 4541 |
| 868 | Ga0495685_024352 | 3300047447 | Bacteria | 2083 |
| 869 | Ga0495673_0000084 | 3300047469 | Bacteria | 193599 |
| 870 | Ga0495673_0000093 | 3300047469 | Bacteria | 185841 |
| 871 | Ga0495673_0000434 | 3300047469 | Bacteria | 46894 |
| 872 | Ga0495673_0001021 | 3300047469 | Bacteria | 24677 |
| 873 | Ga0495673_0001694 | 3300047469 | Bacteria | 16897 |
| 874 | Ga0495673_0003443 | 3300047469 | Bacteria | 10421 |
| 875 | Ga0495673_0003466 | 3300047469 | Bacteria | 10382 |
| 876 | Ga0495673_0005152 | 3300047469 | Bacteria | 7967 |
| 877 | Ga0495673_0010917 | 3300047469 | Bacteria | 4915 |
| 878 | Ga0495673_0014710 | 3300047469 | Bacteria | 4060 |
| 879 | Ga0495673_0024507 | 3300047469 | Bacteria | 2914 |
| 880 | Ga0495673_0025370 | 3300047469 | Bacteria | 2848 |
| 881 | Ga0495673_0034996 | 3300047469 | Bacteria | 2318 |
| 882 | Ga0495681_0000370 | 3300047470 | Bacteria | 35144 |
| 883 | Ga0495681_0001251 | 3300047470 | Bacteria | 19278 |
| 884 | Ga0495681_0001487 | 3300047470 | Bacteria | 17508 |
| 885 | Ga0495681_0001828 | 3300047470 | Bacteria | 15639 |
| 886 | Ga0495681_0003228 | 3300047470 | Bacteria | 11369 |
| 887 | Ga0495681_0004803 | 3300047470 | Bacteria | 9156 |
| 888 | Ga0495681_0007652 | 3300047470 | Bacteria | 6868 |
| 889 | Ga0495681_0016633 | 3300047470 | Bacteria | 4112 |
| 890 | Ga0495681_0065108 | 3300047470 | Bacteria | 1667 |
| 891 | Ga0495684_0018688 | 3300047471 | Bacteria | 5339 |
| 892 | Ga0495686_0000291 | 3300047472 | Bacteria | 88142 |
| 893 | Ga0495686_0084186 | 3300047472 | Bacteria | 1938 |
| 894 | Ga0495593_0000510 | 3300047673 | Bacteria | 21940 |
| 895 | Ga0495593_0001007 | 3300047673 | Bacteria | 16531 |
| 896 | Ga0495593_0003372 | 3300047673 | Bacteria | 9568 |
| 897 | Ga0495593_0034317 | 3300047673 | Bacteria | 2760 |
| 898 | Ga0495626_0000031 | 3300048091 | Bacteria | 197930 |
| 899 | Ga0495626_0000326 | 3300048091 | Bacteria | 50232 |
| 900 | Ga0495626_0000340 | 3300048091 | Bacteria | 49123 |
| 901 | Ga0495626_0000373 | 3300048091 | Bacteria | 46792 |
| 902 | Ga0495626_0000631 | 3300048091 | Bacteria | 34169 |
| 903 | Ga0495626_0000651 | 3300048091 | Bacteria | 33467 |
| 904 | Ga0495626_0000671 | 3300048091 | Bacteria | 32949 |
| 905 | Ga0495626_0002579 | 3300048091 | Bacteria | 12394 |
| 906 | Ga0495626_0003819 | 3300048091 | Bacteria | 9458 |
| 907 | Ga0495626_0004207 | 3300048091 | Bacteria | 8910 |
| 908 | Ga0495626_0025179 | 3300048091 | Bacteria | 2911 |
| 909 | Ga0496100_0000632 | 3300048903 | Bacteria | 16686 |
| 910 | Ga0496101_0003736 | 3300048904 | Bacteria | 9500 |
| 911 | Ga0496102_0000052 | 3300048905 | Bacteria | 177388 |
| 912 | Ga0496102_0005098 | 3300048905 | Bacteria | 11127 |
| 913 | Ga0496102_0009276 | 3300048905 | Bacteria | 8443 |
| 914 | Ga0496102_0182413 | 3300048905 | Bacteria | 1978 |
| 915 | Ga0496102_0198595 | 3300048905 | Bacteria | 1890 |
| 916 | Ga0496103_0003881 | 3300048906 | Bacteria | 9094 |
| 917 | Ga0496103_0009805 | 3300048906 | Bacteria | 5672 |
| 918 | Ga0496104_0009987 | 3300048907 | Bacteria | 8475 |
| 919 | Ga0496104_0013732 | 3300048907 | Bacteria | 7305 |
| 920 | Ga0496104_0044933 | 3300048907 | Bacteria | 4152 |
| 921 | Ga0496105_0004032 | 3300048908 | Bacteria | 10989 |
| 922 | Ga0496105_0067673 | 3300048908 | Bacteria | 2949 |
| 923 | Ga0496105_0096306 | 3300048908 | Bacteria | 2444 |
| 924 | Ga0496106_0222824 | 3300048909 | Bacteria | 1504 |
| 925 | Ga0496107_0000431 | 3300048910 | Bacteria | 22701 |
| 926 | Ga0496107_0021707 | 3300048910 | Bacteria | 4536 |
| 927 | Ga0496107_0037617 | 3300048910 | Bacteria | 3472 |
| 928 | Ga0496107_0049341 | 3300048910 | Bacteria | 3033 |
| 929 | Ga0496107_0201487 | 3300048910 | Bacteria | 1479 |
| 930 | Ga0496108_0058039 | 3300048911 | Bacteria | 3252 |
| 931 | Ga0496108_0097493 | 3300048911 | Bacteria | 2505 |
| 932 | Ga0496108_0281780 | 3300048911 | Bacteria | 1447 |
| 933 | Ga0496109_0045278 | 3300048912 | Bacteria | 3991 |
| 934 | Ga0496109_0072402 | 3300048912 | Bacteria | 3166 |
| 935 | Ga0496109_0448740 | 3300048912 | Bacteria | 1218 |
| 936 | Ga0496110_0004935 | 3300048913 | Bacteria | 10418 |
| 937 | Ga0496110_0230232 | 3300048913 | Bacteria | 1685 |
| 938 | Ga0496111_0008007 | 3300048914 | Bacteria | 6972 |
| 939 | Ga0496111_0166751 | 3300048914 | Bacteria | 1636 |
| 940 | Ga0496112_0026077 | 3300048915 | Bacteria | 5619 |
| 941 | Ga0496112_0060333 | 3300048915 | Bacteria | 3738 |
| 942 | Ga0496114_0003041 | 3300048917 | Bacteria | 12849 |
| 943 | Ga0496114_0004340 | 3300048917 | Bacteria | 10977 |
| 944 | Ga0496114_0290109 | 3300048917 | Bacteria | 1443 |
| 945 | Ga0496114_0464991 | 3300048917 | Bacteria | 1120 |
| 946 | Ga0496115_0002227 | 3300048918 | Bacteria | 13912 |
| 947 | Ga0496115_0055709 | 3300048918 | Bacteria | 3176 |
| 948 | Ga0496115_0083452 | 3300048918 | Bacteria | 2604 |
| 949 | Ga0496115_0123213 | 3300048918 | Bacteria | 2134 |
| 950 | Ga0496115_0219732 | 3300048918 | Bacteria | 1568 |
| 951 | Ga0496116_0000475 | 3300048919 | Bacteria | 55484 |
| 952 | Ga0496116_0011151 | 3300048919 | Bacteria | 7470 |
| 953 | Ga0496117_0011375 | 3300048920 | Bacteria | 7975 |
| 954 | Ga0496117_0048512 | 3300048920 | Bacteria | 3032 |
| 955 | Ga0496117_0051342 | 3300048920 | Bacteria | 2916 |
| 956 | Ga0496117_0065215 | 3300048920 | Bacteria | 2477 |
| 957 | Ga0496117_0087895 | 3300048920 | Bacteria | 2012 |
| 958 | Ga0496117_0219865 | 3300048920 | Bacteria | 1058 |
| 959 | Ga0496118_0004037 | 3300048921 | Bacteria | 17839 |
| 960 | Ga0496118_0009946 | 3300048921 | Bacteria | 9496 |
| 961 | Ga0496118_0064052 | 3300048921 | Bacteria | 2700 |
| 962 | Ga0496118_0096553 | 3300048921 | Bacteria | 2014 |
| 963 | Ga0496119_0000018 | 3300048922 | Bacteria | 306476 |
| 964 | Ga0496119_0085359 | 3300048922 | Bacteria | 1807 |
| 965 | Ga0496120_0000002 | 3300048923 | Bacteria | 547999 |
| 966 | Ga0496121_0005286 | 3300048924 | Bacteria | 16631 |
| 967 | Ga0496121_0030892 | 3300048924 | Bacteria | 4910 |
| 968 | Ga0496121_0032500 | 3300048924 | Bacteria | 4742 |
| 969 | Ga0496121_0051984 | 3300048924 | Bacteria | 3445 |
| 970 | Ga0496121_0179013 | 3300048924 | Bacteria | 1532 |
| 971 | Ga0496122_0002729 | 3300048925 | Bacteria | 24434 |
| 972 | Ga0496122_0157125 | 3300048925 | Bacteria | 1393 |
| 973 | Ga0496123_0015383 | 3300048926 | Bacteria | 6277 |
| 974 | Ga0496124_0000047 | 3300048927 | Bacteria | 285554 |
| 975 | Ga0496124_0007451 | 3300048927 | Bacteria | 11623 |
| 976 | Ga0496124_0012073 | 3300048927 | Bacteria | 8574 |
| 977 | Ga0496124_0029049 | 3300048927 | Bacteria | 4933 |
| 978 | Ga0496124_0043807 | 3300048927 | Bacteria | 3844 |
| 979 | Ga0496124_0048559 | 3300048927 | Bacteria | 3626 |
| 980 | Ga0496124_0091321 | 3300048927 | Bacteria | 2482 |
| 981 | Ga0496125_0004944 | 3300048928 | Bacteria | 15081 |
| 982 | Ga0496125_0009232 | 3300048928 | Bacteria | 10188 |
| 983 | Ga0496125_0038439 | 3300048928 | Bacteria | 4142 |
| 984 | Ga0496125_0072216 | 3300048928 | Bacteria | 2691 |
| 985 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 986 | Ga0496126_0075946 | 3300048929 | Bacteria | 2981 |
| 987 | Ga0496126_0099647 | 3300048929 | Bacteria | 2544 |
| 988 | Ga0496126_0270542 | 3300048929 | Bacteria | 1410 |
| 989 | Ga0495678_000420 | 3300049459 | Bacteria | 42717 |
| 990 | Ga0495678_001193 | 3300049459 | Bacteria | 21367 |
| 991 | Ga0495678_004789 | 3300049459 | Bacteria | 7702 |
| 992 | Ga0495678_008151 | 3300049459 | Bacteria | 5330 |
| 993 | Ga0495678_019168 | 3300049459 | Bacteria | 3058 |
| 994 | Ga0495678_041226 | 3300049459 | Bacteria | 1849 |
| 995 | Ga0495678_063834 | 3300049459 | Bacteria | 1374 |
| 996 | Ga0495682_0004619 | 3300049460 | Bacteria | 5850 |
| 997 | Ga0495682_0010190 | 3300049460 | Bacteria | 3651 |
| 998 | Ga0495682_0010720 | 3300049460 | Bacteria | 3540 |
| 999 | Ga0495682_0035001 | 3300049460 | Bacteria | 1850 |
| 1000 | Ga0495682_0041039 | 3300049460 | Bacteria | 1696 |
| 1001 | Ga0501031_0022726 | 3300049568 | Bacteria | 4088 |
| 1002 | Ga0501031_0067538 | 3300049568 | Bacteria | 2329 |
| 1003 | Ga0501032_0055078 | 3300049569 | Bacteria | 2676 |
| 1004 | Ga0501032_0110489 | 3300049569 | Bacteria | 1819 |
| 1005 | Ga0501033_0009352 | 3300049570 | Bacteria | 7545 |
| 1006 | Ga0501034_0000625 | 3300049571 | Bacteria | 55247 |
| 1007 | Ga0501036_0020608 | 3300049572 | Bacteria | 5538 |
| 1008 | Ga0501036_0074660 | 3300049572 | Bacteria | 2868 |
| 1009 | Ga0501036_0082793 | 3300049572 | Bacteria | 2712 |
| 1010 | Ga0501036_0103320 | 3300049572 | Bacteria | 2410 |
| 1011 | Ga0501036_0341208 | 3300049572 | Bacteria | 1251 |
| 1012 | Ga0501038_0023928 | 3300049574 | Bacteria | 5454 |
| 1013 | Ga0501038_0035894 | 3300049574 | Bacteria | 4351 |
| 1014 | Ga0501038_0099837 | 3300049574 | Bacteria | 2419 |
| 1015 | Ga0501038_0132179 | 3300049574 | Bacteria | 2048 |
| 1016 | Ga0501039_0013549 | 3300049575 | Bacteria | 6235 |
| 1017 | Ga0501039_0036029 | 3300049575 | Bacteria | 3817 |
| 1018 | Ga0501039_0081884 | 3300049575 | Bacteria | 2513 |
| 1019 | Ga0501039_0243905 | 3300049575 | Bacteria | 1413 |
| 1020 | Ga0501040_0036124 | 3300049576 | Bacteria | 3352 |
| 1021 | Ga0501040_0066010 | 3300049576 | Bacteria | 2493 |
| 1022 | Ga0501040_0091306 | 3300049576 | Bacteria | 2117 |
| 1023 | Ga0501040_0105448 | 3300049576 | Bacteria | 1969 |
| 1024 | Ga0501041_0006968 | 3300049577 | Bacteria | 6629 |
| 1025 | Ga0501041_0054670 | 3300049577 | Bacteria | 2436 |
| 1026 | Ga0501041_0129490 | 3300049577 | Bacteria | 1572 |
| 1027 | Ga0501042_0045261 | 3300049578 | Bacteria | 3136 |
| 1028 | Ga0501042_0071986 | 3300049578 | Bacteria | 2473 |
| 1029 | Ga0501043_0044829 | 3300049579 | Bacteria | 3478 |
| 1030 | Ga0501046_0019335 | 3300049580 | Bacteria | 5651 |
| 1031 | Ga0501046_0058686 | 3300049580 | Bacteria | 3016 |
| 1032 | Ga0501047_0012382 | 3300049581 | Bacteria | 8075 |
| 1033 | Ga0501047_0126148 | 3300049581 | Bacteria | 2440 |
| 1034 | Ga0501048_0022275 | 3300049582 | Bacteria | 4636 |
| 1035 | Ga0501048_0066266 | 3300049582 | Bacteria | 2553 |
| 1036 | Ga0501070_0008224 | 3300049586 | Bacteria | 8823 |
| 1037 | Ga0501071_0004660 | 3300049587 | Bacteria | 8712 |
| 1038 | Ga0501071_0021688 | 3300049587 | Bacteria | 4477 |
| 1039 | Ga0501071_0022166 | 3300049587 | Bacteria | 4427 |
| 1040 | Ga0501071_0062720 | 3300049587 | Bacteria | 2693 |
| 1041 | Ga0501071_0115800 | 3300049587 | Bacteria | 1984 |
| 1042 | Ga0501071_0122273 | 3300049587 | Bacteria | 1930 |
| 1043 | Ga0501072_0005876 | 3300049588 | Bacteria | 9345 |
| 1044 | Ga0501072_0012869 | 3300049588 | Bacteria | 6399 |
| 1045 | Ga0501072_0070658 | 3300049588 | Bacteria | 2757 |
| 1046 | Ga0501072_0159163 | 3300049588 | Bacteria | 1801 |
| 1047 | Ga0501074_0071296 | 3300049590 | Bacteria | 2498 |
| 1048 | Ga0501074_0081873 | 3300049590 | Bacteria | 2315 |
| 1049 | Ga0501074_0288038 | 3300049590 | Bacteria | 1167 |
| 1050 | Ga0501075_0022895 | 3300049591 | Bacteria | 4569 |
| 1051 | Ga0501075_0047310 | 3300049591 | Bacteria | 3233 |
| 1052 | Ga0501075_0075481 | 3300049591 | Bacteria | 2549 |
| 1053 | Ga0501075_0220559 | 3300049591 | Bacteria | 1446 |
| 1054 | Ga0501075_0238452 | 3300049591 | Bacteria | 1386 |
| 1055 | Ga0501076_0024551 | 3300049592 | Bacteria | 4660 |
| 1056 | Ga0501076_0025793 | 3300049592 | Bacteria | 4551 |
| 1057 | Ga0501076_0081163 | 3300049592 | Bacteria | 2603 |
| 1058 | Ga0501077_0018855 | 3300049593 | Bacteria | 4366 |
| 1059 | Ga0501077_0193708 | 3300049593 | Bacteria | 1291 |
| 1060 | Ga0501217_009414 | 3300049661 | Bacteria | 2125 |
| 1061 | Ga0501079_0013491 | 3300049741 | Bacteria | 6230 |
| 1062 | Ga0501079_0037890 | 3300049741 | Bacteria | 3717 |
| 1063 | Ga0501079_0039754 | 3300049741 | Bacteria | 3628 |
| 1064 | Ga0501079_0167682 | 3300049741 | Bacteria | 1712 |
| 1065 | Ga0501080_0109673 | 3300049742 | Bacteria | 2558 |
| 1066 | Ga0501080_0165041 | 3300049742 | Bacteria | 2044 |
| 1067 | Ga0501080_0230764 | 3300049742 | Bacteria | 1692 |
| 1068 | Ga0501081_0018089 | 3300049743 | Bacteria | 4676 |
| 1069 | Ga0501081_0036980 | 3300049743 | Bacteria | 3330 |
| 1070 | Ga0501081_0191991 | 3300049743 | Bacteria | 1479 |
| 1071 | Ga0501081_0200414 | 3300049743 | Bacteria | 1447 |
| 1072 | Ga0501081_0230238 | 3300049743 | Bacteria | 1349 |
| 1073 | Ga0501083_0071373 | 3300049744 | Bacteria | 2309 |
| 1074 | Ga0501083_0212830 | 3300049744 | Bacteria | 1260 |
| 1075 | Ga0501241_000047 | 3300049758 | Bacteria | 35882 |
| 1076 | Ga0501269_000742 | 3300049766 | Bacteria | 5257 |
| 1077 | Ga0501035_0056359 | 3300049822 | Bacteria | 3507 |
| 1078 | Ga0501035_0104892 | 3300049822 | Bacteria | 2479 |
| 1079 | Ga0501044_0000106 | 3300049823 | Bacteria | 101709 |
| 1080 | Ga0501044_0050741 | 3300049823 | Bacteria | 4279 |
| 1081 | Ga0501044_0231263 | 3300049823 | Bacteria | 1796 |
| 1082 | Ga0501045_0017591 | 3300049824 | Bacteria | 5076 |
| 1083 | Ga0501045_0123072 | 3300049824 | Bacteria | 1926 |
| 1084 | Ga0501045_0353652 | 3300049824 | Bacteria | 1093 |
| 1085 | nmdc:mga03683_53567_c1 | 3300050489 | Bacteria | 1689 |
| 1086 | nmdc:mga00v17_36197_c1 | 3300050491 | Bacteria | 2941 |
| 1087 | nmdc:mga00v17_58477_c1 | 3300050491 | Bacteria | 2362 |
| 1088 | nmdc:mga0yw44_134823_c1 | 3300050492 | Bacteria | 1601 |
| 1089 | nmdc:mga0yw44_293096_c1 | 3300050492 | Bacteria | 1089 |
| 1090 | nmdc:mga06z11_160883_c1 | 3300050494 | Bacteria | 1283 |
| 1091 | nmdc:mga05p37_114181_c1 | 3300050507 | Bacteria | 3320 |
| 1092 | nmdc:mga05p37_15089_c1 | 3300050507 | Bacteria | 9276 |
| 1093 | nmdc:mga05p37_78729_c1 | 3300050507 | Bacteria | 4059 |
| 1094 | nmdc:mga09592_65524_c1 | 3300050508 | Bacteria | 3078 |
| 1095 | nmdc:mga06r32_54035_c1 | 3300050510 | Bacteria | 3851 |
| 1096 | nmdc:mga06r32_6675_c1 | 3300050510 | Bacteria | 10371 |
| 1097 | nmdc:mga08y16_44676_c1 | 3300050511 | Bacteria | 4643 |
| 1098 | nmdc:mga0n895_10036_c1 | 3300050512 | Bacteria | 8334 |
| 1099 | nmdc:mga0rr50_8552_c1 | 3300050513 | Bacteria | 6378 |
| 1100 | nmdc:mga0a205_78623_c1 | 3300050515 | Bacteria | 3187 |
| 1101 | nmdc:mga0a205_93022_c1 | 3300050515 | Bacteria | 2913 |
| 1102 | nmdc:mga0sz30_7158_c2 | 3300050516 | Bacteria | 3875 |
| 1103 | Ga0495601_0000744 | 3300053077 | Bacteria | 17523 |
| 1104 | Ga0495612_0032116 | 3300053078 | Bacteria | 2120 |
| 1105 | Ga0495655_0001249 | 3300053083 | Bacteria | 3927 |
| 1106 | Ga0495619_0006422 | 3300053085 | Bacteria | 7449 |
| 1107 | Ga0500643_000731 | 3300053087 | Bacteria | 21473 |
| 1108 | Ga0500647_0008936 | 3300053091 | Bacteria | 4373 |
| 1109 | Ga0500641_0000096 | 3300053096 | Bacteria | 34208 |
| 1110 | Ga0500568_0023689 | 3300053139 | Bacteria | 2609 |
| 1111 | Ga0500636_0059721 | 3300053177 | Bacteria | 2228 |
| 1112 | Ga0501084_0013266 | 3300054114 | Bacteria | 6819 |
| 1113 | Ga0501084_0025016 | 3300054114 | Bacteria | 4982 |
| 1114 | Ga0501084_0139314 | 3300054114 | Bacteria | 2042 |
| 1115 | Ga0501082_0000007 | 3300060353 | Bacteria | 126506 |
| 1116 | Ga0501082_0035720 | 3300060353 | Bacteria | 4283 |
| 1117 | Ga0501082_0185998 | 3300060353 | Bacteria | 1807 |
| 1118 | Ga0530510_0011063 | 3300061734 | Bacteria | 6329 |
| 1119 | Ga0530510_0014173 | 3300061734 | Bacteria | 5619 |
| 1120 | Ga0530510_0115302 | 3300061734 | Bacteria | 1969 |
| 1121 | Ga0530510_0142524 | 3300061734 | Bacteria | 1766 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041512 | Ga0451853_0192445 | Ga0451853_0192445_165_1061 | 275 |
| 2 | 3300046522 | Ga0495643_0053632 | Ga0495643_0053632_1281_2144 | 287 |
| 3 | 3300046471 | Ga0495650_0020294 | Ga0495650_0020294_2274_3167 | 288 |
| 4 | 3300046474 | Ga0495605_0007746 | Ga0495605_0007746_2215_3108 | 288 |
| 5 | 3300046513 | Ga0495616_0000101 | Ga0495616_0000101_65705_66598 | 288 |
| 6 | 3300046519 | Ga0495632_0015974 | Ga0495632_0015974_3145_4038 | 288 |
| 7 | 3300046530 | Ga0495654_0000145 | Ga0495654_0000145_7134_8027 | 288 |
| 8 | 3300046538 | Ga0495609_0008107 | Ga0495609_0008107_1940_2833 | 288 |
| 9 | 3300046660 | Ga0495625_0005136 | Ga0495625_0005136_5143_6036 | 288 |
| 10 | 3300047323 | Ga0495683_0019719 | Ga0495683_0019719_117_1010 | 288 |
| 11 | 3300047469 | Ga0495673_0003466 | Ga0495673_0003466_2938_3831 | 288 |
| 12 | 3300048091 | Ga0495626_0000671 | Ga0495626_0000671_27895_28788 | 288 |
| 13 | 3300049459 | Ga0495678_008151 | Ga0495678_008151_2008_2901 | 288 |
| 14 | 3300046518 | Ga0495631_0009196 | Ga0495631_0009196_4001_4906 | 301 |
| 15 | 3300039062 | Ga0400483_108990 | Ga0400483_108990_1902_2909 | 305 |
| 16 | 3300046501 | Ga0495607_0183724 | Ga0495607_0183724_108_1028 | 306 |
| 17 | 3300046522 | Ga0495643_0020086 | Ga0495643_0020086_36_956 | 306 |
| 18 | 3300005334 | Ga0068869_100030812 | Ga0068869_1000308124 | 310 |
| 19 | 3300005343 | Ga0070687_100153394 | Ga0070687_1001533942 | 310 |
| 20 | 3300005444 | Ga0070694_100337870 | Ga0070694_1003378701 | 310 |
| 21 | 3300005549 | Ga0070704_100010793 | Ga0070704_1000107936 | 310 |
| 22 | 3300005718 | Ga0068866_10160783 | Ga0068866_101607832 | 310 |
| 23 | 3300005719 | Ga0068861_100396562 | Ga0068861_1003965622 | 310 |
| 24 | 3300005844 | Ga0068862_100004110 | Ga0068862_1000041103 | 310 |
| 25 | 3300006881 | Ga0068865_100011741 | Ga0068865_1000117413 | 310 |
| 26 | 3300009098 | Ga0105245_10475574 | Ga0105245_104755742 | 310 |
| 27 | 3300009553 | Ga0105249_10527786 | Ga0105249_105277862 | 310 |
| 28 | 3300025899 | Ga0207642_10131051 | Ga0207642_101310512 | 310 |
| 29 | 3300025918 | Ga0207662_10242107 | Ga0207662_102421072 | 310 |
| 30 | 3300025935 | Ga0207709_10382458 | Ga0207709_103824581 | 310 |
| 31 | 3300025936 | Ga0207670_10355450 | Ga0207670_103554502 | 310 |
| 32 | 3300025942 | Ga0207689_10390617 | Ga0207689_103906172 | 310 |
| 33 | 3300026023 | Ga0207677_10023036 | Ga0207677_100230364 | 310 |
| 34 | 3300026041 | Ga0207639_10252117 | Ga0207639_102521172 | 310 |
| 35 | 3300026089 | Ga0207648_10450826 | Ga0207648_104508262 | 310 |
| 36 | 3300026118 | Ga0207675_100524412 | Ga0207675_1005244122 | 310 |
| 37 | 3300028381 | Ga0268264_10518161 | Ga0268264_105181612 | 310 |
| 38 | 3300048920 | Ga0496117_0065215 | Ga0496117_0065215_1503_2465 | 310 |
| 39 | 3300049571 | Ga0501034_0000625 | Ga0501034_0000625_8780_9775 | 310 |
| 40 | 3300005985 | Ga0081539_10001147 | Ga0081539_1000114743 | 313 |
| 41 | 3300035088 | Ga0373940_0065170 | Ga0373940_0065170_18_983 | 313 |
| 42 | 3300046459 | Ga0495629_0286209 | Ga0495629_0286209_73_1050 | 313 |
| 43 | 3300042461 | Ga0439460_0030465 | Ga0439460_0030465_416_1387 | 314 |
| 44 | 3300053096 | Ga0500641_0000096 | Ga0500641_0000096_6657_7628 | 315 |
| 45 | 3300053177 | Ga0500636_0059721 | Ga0500636_0059721_729_1718 | 315 |
| 46 | 3300049743 | Ga0501081_0200414 | Ga0501081_0200414_56_1030 | 316 |
| 47 | 3300053087 | Ga0500643_000731 | Ga0500643_000731_16139_17107 | 316 |
| 48 | 3300005344 | Ga0070661_100172691 | Ga0070661_1001726911 | 317 |
| 49 | 3300005614 | Ga0068856_100065201 | Ga0068856_1000652012 | 317 |
| 50 | 3300005616 | Ga0068852_100213226 | Ga0068852_1002132262 | 317 |
| 51 | 3300025920 | Ga0207649_10288529 | Ga0207649_102885292 | 317 |
| 52 | 3300028800 | Ga0265338_10085517 | Ga0265338_100855172 | 317 |
| 53 | 3300031251 | Ga0265327_10007921 | Ga0265327_100079214 | 317 |
| 54 | 3300031711 | Ga0265314_10011272 | Ga0265314_100112725 | 317 |
| 55 | 3300036401 | Ga0373937_0216024 | Ga0373937_0216024_248_1225 | 317 |
| 56 | 3300046692 | Ga0495671_0016906 | Ga0495671_0016906_2055_3044 | 317 |
| 57 | 3300053091 | Ga0500647_0008936 | Ga0500647_0008936_2273_3268 | 317 |
| 58 | iso_pu_bacteria | 2738541271 | 2738692114 | 317 |
| 59 | iso_pu_bacteria | 2738543016 | 2739267772 | 317 |
| 60 | 3300044712 | Ga0453684_0080701 | Ga0453684_0080701_3035_4051 | 318 |
| 61 | iso_pu_bacteria | 2888578766 | 2888583049 | 318 |
| 62 | iso_pu_bacteria | 2919385768 | 2919390386 | 319 |
| 63 | iso_pu_bacteria | 2919487758 | 2919489187 | 319 |
| 64 | iso_pu_bacteria | 2974289157 | 2974291100 | 319 |
| 65 | iso_pu_bacteria | 8029995093 | 8029998053 | 319 |
| 66 | iso_pu_bacteria | 8056166840 | 8056168468 | 319 |
| 67 | 3300009011 | Ga0105251_10005118 | Ga0105251_100051183 | 320 |
| 68 | 3300013104 | Ga0157370_10074868 | Ga0157370_100748682 | 320 |
| 69 | 3300015265 | Ga0182005_1003472 | Ga0182005_10034723 | 320 |
| 70 | 3300015265 | Ga0182005_1009503 | Ga0182005_10095033 | 320 |
| 71 | 3300025735 | Ga0207713_1011856 | Ga0207713_10118562 | 320 |
| 72 | 3300041405 | Ga0439438_006718 | Ga0439438_006718_1299_2261 | 320 |
| 73 | 3300041411 | Ga0439466_0000659 | Ga0439466_0000659_4432_5394 | 320 |
| 74 | 3300046452 | Ga0495617_013983 | Ga0495617_013983_1176_2219 | 320 |
| 75 | 3300046452 | Ga0495617_035448 | Ga0495617_035448_124_1143 | 320 |
| 76 | 3300046453 | Ga0495627_041568 | Ga0495627_041568_16_1035 | 320 |
| 77 | 3300046457 | Ga0495590_0001776 | Ga0495590_0001776_58_1077 | 320 |
| 78 | 3300046457 | Ga0495590_0002415 | Ga0495590_0002415_3949_4992 | 320 |
| 79 | 3300046458 | Ga0495591_000138 | Ga0495591_000138_40561_41580 | 320 |
| 80 | 3300046460 | Ga0495638_0001251 | Ga0495638_0001251_9790_10833 | 320 |
| 81 | 3300046460 | Ga0495638_0022381 | Ga0495638_0022381_2274_3293 | 320 |
| 82 | 3300046471 | Ga0495650_0002593 | Ga0495650_0002593_8798_9817 | 320 |
| 83 | 3300046474 | Ga0495605_0040574 | Ga0495605_0040574_376_1395 | 320 |
| 84 | 3300046491 | Ga0495584_0017629 | Ga0495584_0017629_1653_2696 | 320 |
| 85 | 3300046491 | Ga0495584_0028990 | Ga0495584_0028990_1254_2273 | 320 |
| 86 | 3300046492 | Ga0495585_0026259 | Ga0495585_0026259_1015_2058 | 320 |
| 87 | 3300046500 | Ga0495596_0000049 | Ga0495596_0000049_31823_32842 | 320 |
| 88 | 3300046501 | Ga0495607_0013223 | Ga0495607_0013223_1615_2658 | 320 |
| 89 | 3300046501 | Ga0495607_0085422 | Ga0495607_0085422_642_1661 | 320 |
| 90 | 3300046513 | Ga0495616_0030587 | Ga0495616_0030587_1716_2759 | 320 |
| 91 | 3300046515 | Ga0495620_0013985 | Ga0495620_0013985_2718_3737 | 320 |
| 92 | 3300046519 | Ga0495632_0003128 | Ga0495632_0003128_10339_11358 | 320 |
| 93 | 3300046519 | Ga0495632_0015296 | Ga0495632_0015296_2666_3709 | 320 |
| 94 | 3300046520 | Ga0495637_0000044 | Ga0495637_0000044_4995_6014 | 320 |
| 95 | 3300046522 | Ga0495643_0053579 | Ga0495643_0053579_923_1966 | 320 |
| 96 | 3300046523 | Ga0495644_0000731 | Ga0495644_0000731_9844_10887 | 320 |
| 97 | 3300046530 | Ga0495654_0018864 | Ga0495654_0018864_1821_2840 | 320 |
| 98 | 3300046530 | Ga0495654_0018940 | Ga0495654_0018940_396_1439 | 320 |
| 99 | 3300046542 | Ga0495597_0012278 | Ga0495597_0012278_2532_3575 | 320 |
| 100 | 3300046616 | Ga0495668_0000732 | Ga0495668_0000732_8236_9255 | 320 |
| 101 | 3300046660 | Ga0495625_0001805 | Ga0495625_0001805_7845_8864 | 320 |
| 102 | 3300046692 | Ga0495671_0025357 | Ga0495671_0025357_1176_2219 | 320 |
| 103 | 3300046694 | Ga0495649_0004259 | Ga0495649_0004259_5580_6623 | 320 |
| 104 | 3300046794 | Ga0495589_0008079 | Ga0495589_0008079_4025_5044 | 320 |
| 105 | 3300046810 | Ga0495660_0012170 | Ga0495660_0012170_962_2005 | 320 |
| 106 | 3300047320 | Ga0495672_0001830 | Ga0495672_0001830_14452_15495 | 320 |
| 107 | 3300047320 | Ga0495672_0002044 | Ga0495672_0002044_13066_14109 | 320 |
| 108 | 3300047323 | Ga0495683_0009568 | Ga0495683_0009568_809_1828 | 320 |
| 109 | 3300047323 | Ga0495683_0013424 | Ga0495683_0013424_2501_3544 | 320 |
| 110 | 3300047469 | Ga0495673_0001021 | Ga0495673_0001021_16725_17768 | 320 |
| 111 | 3300047470 | Ga0495681_0004803 | Ga0495681_0004803_4805_5824 | 320 |
| 112 | 3300048091 | Ga0495626_0000651 | Ga0495626_0000651_11754_12773 | 320 |
| 113 | 3300048913 | Ga0496110_0004935 | Ga0496110_0004935_7263_8306 | 320 |
| 114 | 3300048914 | Ga0496111_0166751 | Ga0496111_0166751_327_1370 | 320 |
| 115 | 3300048927 | Ga0496124_0007451 | Ga0496124_0007451_8805_9848 | 320 |
| 116 | 3300049574 | Ga0501038_0023928 | Ga0501038_0023928_3760_4794 | 320 |
| 117 | 3300049581 | Ga0501047_0012382 | Ga0501047_0012382_971_2005 | 320 |
| 118 | 3300049661 | Ga0501217_009414 | Ga0501217_009414_321_1316 | 320 |
| 119 | 3300049823 | Ga0501044_0050741 | Ga0501044_0050741_1604_2638 | 320 |
| 120 | iso_pu_bacteria | 2511231017 | 2511334862 | 320 |
| 121 | iso_pu_bacteria | 2511231021 | 2511356868 | 320 |
| 122 | 3300042137 | Ga0450902_007410 | Ga0450902_007410_680_1645 | 321 |
| 123 | 3300046538 | Ga0495609_0013487 | Ga0495609_0013487_1576_2673 | 321 |
| 124 | 3300048927 | Ga0496124_0000047 | Ga0496124_0000047_81431_82477 | 321 |
| 125 | 3300049822 | Ga0501035_0104892 | Ga0501035_0104892_1490_2467 | 321 |
| 126 | iso_pu_bacteria | 2511231007 | 2511270359 | 321 |
| 127 | iso_pu_bacteria | 2511231010 | 2511288087 | 321 |
| 128 | iso_pu_bacteria | 2511231012 | 2511302695 | 321 |
| 129 | iso_pu_bacteria | 2511231014 | 2511317063 | 321 |
| 130 | iso_pu_bacteria | 2511231015 | 2511317831 | 321 |
| 131 | iso_pu_bacteria | 2511231016 | 2511325492 | 321 |
| 132 | iso_pu_bacteria | 2511231018 | 2511339257 | 321 |
| 133 | iso_pu_bacteria | 2511231019 | 2511346310 | 321 |
| 134 | iso_pu_bacteria | 2511231020 | 2511352504 | 321 |
| 135 | iso_pu_bacteria | 2511231022 | 2511364668 | 321 |
| 136 | iso_pu_bacteria | 2600255318 | 2601799000 | 321 |
| 137 | iso_pu_bacteria | 2603880185 | 2606077895 | 321 |
| 138 | iso_pu_bacteria | 2603880199 | 2606129930 | 321 |
| 139 | iso_pu_bacteria | 2623620443 | 2624480879 | 321 |
| 140 | iso_pu_bacteria | 2623620446 | 2624491269 | 321 |
| 141 | iso_pu_bacteria | 2643221565 | 2643843344 | 321 |
| 142 | iso_pu_bacteria | 2643221589 | 2643957039 | 321 |
| 143 | iso_pu_bacteria | 2643221602 | 2644024962 | 321 |
| 144 | iso_pu_bacteria | 2643221633 | 2644185398 | 321 |
| 145 | iso_pu_bacteria | 2713897149 | 2715756932 | 321 |
| 146 | iso_pu_bacteria | 2718217725 | 2718634046 | 321 |
| 147 | iso_pu_bacteria | 2738543004 | 2739197748 | 321 |
| 148 | iso_pu_bacteria | 2738543015 | 2739262490 | 321 |
| 149 | iso_pu_bacteria | 2773857670 | 2774119279 | 321 |
| 150 | iso_pu_bacteria | 2784132072 | 2784314928 | 321 |
| 151 | iso_pu_bacteria | 2808606379 | 2808941675 | 321 |
| 152 | iso_pu_bacteria | 2808606382 | 2808961227 | 321 |
| 153 | iso_pu_bacteria | 2860339153 | 2860345103 | 321 |
| 154 | iso_pu_bacteria | 2878029506 | 2878032811 | 321 |
| 155 | iso_pu_bacteria | 2904550169 | 2904550645 | 321 |
| 156 | iso_pu_bacteria | 2919063839 | 2919064901 | 321 |
| 157 | iso_pu_bacteria | 2919456309 | 2919459133 | 321 |
| 158 | iso_pu_bacteria | 2919456309 | 2919460303 | 321 |
| 159 | iso_pu_bacteria | 2919697872 | 2919701220 | 321 |
| 160 | iso_pu_bacteria | 2931396565 | 2931403130 | 321 |
| 161 | iso_pu_bacteria | 2939636861 | 2939639929 | 321 |
| 162 | iso_pu_bacteria | 2969304461 | 2969307444 | 321 |
| 163 | iso_pu_bacteria | 3007511990 | 3007515416 | 321 |
| 164 | iso_pu_bacteria | 3007855910 | 3007856950 | 321 |
| 165 | iso_pu_bacteria | 8019775933 | 8019778167 | 321 |
| 166 | iso_pu_bacteria | 8055878733 | 8055882190 | 321 |
| 167 | iso_pu_bacteria | 8056125926 | 8056129387 | 321 |
| 168 | iso_pu_bacteria | 8056177738 | 8056178134 | 321 |
| 169 | 3300006038 | Ga0075365_10168820 | Ga0075365_101688202 | 322 |
| 170 | 3300006177 | Ga0075362_10005204 | Ga0075362_100052042 | 322 |
| 171 | 3300006353 | Ga0075370_10022187 | Ga0075370_100221874 | 322 |
| 172 | 3300042004 | Ga0439445_0014397 | Ga0439445_0014397_233_1276 | 322 |
| 173 | 3300050491 | nmdc:mga00v17_58477_c1 | nmdc:mga00v17_58477_c1_1036_2076 | 322 |
| 174 | 3300050492 | nmdc:mga0yw44_134823_c1 | nmdc:mga0yw44_134823_c1_336_1376 | 322 |
| 175 | 3300013105 | Ga0157369_10013364 | Ga0157369_100133648 | 323 |
| 176 | 3300015261 | Ga0182006_1000634 | Ga0182006_100063422 | 323 |
| 177 | 3300021377 | Ga0213874_10002783 | Ga0213874_100027834 | 323 |
| 178 | 3300037853 | Ga0436364_1293474 | Ga0436364_1293474_2297_3280 | 323 |
| 179 | 3300037853 | Ga0436364_1408706 | Ga0436364_1408706_271_1254 | 323 |
| 180 | 3300039437 | Ga0436365_0384831 | Ga0436365_0384831_6668_7651 | 323 |
| 181 | 3300039437 | Ga0436365_1633568 | Ga0436365_1633568_2073_3056 | 323 |
| 182 | 3300039450 | Ga0436363_0075424 | Ga0436363_0075424_24500_25483 | 323 |
| 183 | 3300039450 | Ga0436363_1071452 | Ga0436363_1071452_3559_4542 | 323 |
| 184 | 3300039453 | Ga0436362_0348730 | Ga0436362_0348730_3397_4431 | 323 |
| 185 | 3300041405 | Ga0439438_000048 | Ga0439438_000048_55137_56111 | 323 |
| 186 | 3300041405 | Ga0439438_000153 | Ga0439438_000153_19410_20384 | 323 |
| 187 | 3300041407 | Ga0439447_010099 | Ga0439447_010099_1046_2020 | 323 |
| 188 | 3300042010 | Ga0439452_018141 | Ga0439452_018141_834_1808 | 323 |
| 189 | 3300042137 | Ga0450902_004943 | Ga0450902_004943_193_1167 | 323 |
| 190 | 3300042139 | Ga0450904_004910 | Ga0450904_004910_373_1347 | 323 |
| 191 | 3300046542 | Ga0495597_0005702 | Ga0495597_0005702_4930_5904 | 323 |
| 192 | 3300005471 | Ga0070698_100249091 | Ga0070698_1002490912 | 324 |
| 193 | 3300005518 | Ga0070699_100274329 | Ga0070699_1002743291 | 324 |
| 194 | 3300006058 | Ga0075432_10046801 | Ga0075432_100468012 | 324 |
| 195 | 3300028556 | Ga0265337_1014581 | Ga0265337_10145812 | 324 |
| 196 | 3300028563 | Ga0265319_1018833 | Ga0265319_10188332 | 324 |
| 197 | 3300031240 | Ga0265320_10005248 | Ga0265320_100052482 | 324 |
| 198 | 3300031250 | Ga0265331_10062684 | Ga0265331_100626842 | 324 |
| 199 | 3300031595 | Ga0265313_10000291 | Ga0265313_1000029120 | 324 |
| 200 | 3300041404 | Ga0439436_0017063 | Ga0439436_0017063_333_1337 | 324 |
| 201 | 3300042007 | Ga0439449_0036597 | Ga0439449_0036597_434_1438 | 324 |
| 202 | 3300046460 | Ga0495638_0002925 | Ga0495638_0002925_12222_13253 | 324 |
| 203 | 3300047323 | Ga0495683_0074429 | Ga0495683_0074429_99_1073 | 324 |
| 204 | 3300048927 | Ga0496124_0043807 | Ga0496124_0043807_640_1644 | 324 |
| 205 | 3300049460 | Ga0495682_0010720 | Ga0495682_0010720_428_1402 | 324 |
| 206 | 3300049766 | Ga0501269_000742 | Ga0501269_000742_2550_3530 | 324 |
| 207 | 3300050494 | nmdc:mga06z11_160883_c1 | nmdc:mga06z11_160883_c1_222_1244 | 324 |
| 208 | 2124908027 | MRS2a_Contig_240 | MRS2a_00144010 | 325 |
| 209 | 3300001991 | JGI24743J22301_10001386 | JGI24743J22301_100013863 | 325 |
| 210 | 3300002075 | JGI24738J21930_10007302 | JGI24738J21930_100073022 | 325 |
| 211 | 3300002705 | JGI25156J39149_1010418 | JGI25156J39149_10104182 | 325 |
| 212 | 3300002737 | JGI25162J39368_1000345 | JGI25162J39368_100034515 | 325 |
| 213 | 3300002741 | JGI25157J39369_1000317 | JGI25157J39369_100031715 | 325 |
| 214 | 3300002771 | JGI25163J39215_1000267 | JGI25163J39215_10002675 | 325 |
| 215 | 3300002772 | JGI25164J39214_1000187 | JGI25164J39214_100018726 | 325 |
| 216 | 3300003187 | JGI25151J46595_10000090 | JGI25151J46595_1000009028 | 325 |
| 217 | 3300003187 | JGI25151J46595_10000168 | JGI25151J46595_1000016849 | 325 |
| 218 | 3300003214 | JGI25165J46597_1000338 | JGI25165J46597_100033815 | 325 |
| 219 | 3300003320 | rootH2_10013714 | rootH2_100137143 | 325 |
| 220 | 3300003578 | Ga0006562J51391_1027629 | Ga0006562J51391_10276293 | 325 |
| 221 | 3300003751 | Ga0055538_1001452 | Ga0055538_10014523 | 325 |
| 222 | 3300003761 | Ga0055535_1000417 | Ga0055535_100041715 | 325 |
| 223 | 3300003762 | Ga0055542_1000435 | Ga0055542_100043515 | 325 |
| 224 | 3300003763 | Ga0055529_1000110 | Ga0055529_100011015 | 325 |
| 225 | 3300003791 | Ga0055530_10001311 | Ga0055530_100013117 | 325 |
| 226 | 3300003792 | Ga0055540_1000006 | Ga0055540_100000656 | 325 |
| 227 | 3300003794 | Ga0055531_10000075 | Ga0055531_1000007529 | 325 |
| 228 | 3300005288 | Ga0065714_10000217 | Ga0065714_100002176 | 325 |
| 229 | 3300005288 | Ga0065714_10002341 | Ga0065714_1000234112 | 325 |
| 230 | 3300005288 | Ga0065714_10005790 | Ga0065714_100057904 | 325 |
| 231 | 3300005288 | Ga0065714_10007718 | Ga0065714_100077182 | 325 |
| 232 | 3300005288 | Ga0065714_10013859 | Ga0065714_100138592 | 325 |
| 233 | 3300005288 | Ga0065714_10028341 | Ga0065714_100283412 | 325 |
| 234 | 3300005288 | Ga0065714_10032459 | Ga0065714_100324592 | 325 |
| 235 | 3300005288 | Ga0065714_10065710 | Ga0065714_100657105 | 325 |
| 236 | 3300005288 | Ga0065714_10089418 | Ga0065714_100894181 | 325 |
| 237 | 3300005290 | Ga0065712_10004708 | Ga0065712_100047082 | 325 |
| 238 | 3300005293 | Ga0065715_10003156 | Ga0065715_100031566 | 325 |
| 239 | 3300005327 | Ga0070658_10338498 | Ga0070658_103384981 | 325 |
| 240 | 3300005328 | Ga0070676_10000327 | Ga0070676_1000032716 | 325 |
| 241 | 3300005329 | Ga0070683_100013389 | Ga0070683_1000133892 | 325 |
| 242 | 3300005330 | Ga0070690_100000389 | Ga0070690_1000003892 | 325 |
| 243 | 3300005331 | Ga0070670_100004526 | Ga0070670_1000045266 | 325 |
| 244 | 3300005334 | Ga0068869_100006435 | Ga0068869_1000064356 | 325 |
| 245 | 3300005334 | Ga0068869_100211294 | Ga0068869_1002112941 | 325 |
| 246 | 3300005335 | Ga0070666_10001559 | Ga0070666_1000155911 | 325 |
| 247 | 3300005336 | Ga0070680_100002843 | Ga0070680_1000028438 | 325 |
| 248 | 3300005337 | Ga0070682_100001357 | Ga0070682_10000135710 | 325 |
| 249 | 3300005338 | Ga0068868_100000816 | Ga0068868_1000008169 | 325 |
| 250 | 3300005340 | Ga0070689_100000375 | Ga0070689_1000003759 | 325 |
| 251 | 3300005341 | Ga0070691_10003065 | Ga0070691_100030654 | 325 |
| 252 | 3300005341 | Ga0070691_10021676 | Ga0070691_100216763 | 325 |
| 253 | 3300005344 | Ga0070661_100000807 | Ga0070661_10000080716 | 325 |
| 254 | 3300005345 | Ga0070692_10014899 | Ga0070692_100148994 | 325 |
| 255 | 3300005347 | Ga0070668_100002040 | Ga0070668_10000204012 | 325 |
| 256 | 3300005347 | Ga0070668_100059780 | Ga0070668_1000597805 | 325 |
| 257 | 3300005347 | Ga0070668_100373350 | Ga0070668_1003733501 | 325 |
| 258 | 3300005353 | Ga0070669_100001534 | Ga0070669_1000015346 | 325 |
| 259 | 3300005353 | Ga0070669_100028425 | Ga0070669_1000284253 | 325 |
| 260 | 3300005354 | Ga0070675_100001502 | Ga0070675_1000015024 | 325 |
| 261 | 3300005354 | Ga0070675_100002753 | Ga0070675_1000027538 | 325 |
| 262 | 3300005355 | Ga0070671_100000406 | Ga0070671_1000004066 | 325 |
| 263 | 3300005356 | Ga0070674_100003779 | Ga0070674_1000037795 | 325 |
| 264 | 3300005364 | Ga0070673_100000480 | Ga0070673_1000004804 | 325 |
| 265 | 3300005365 | Ga0070688_100001668 | Ga0070688_1000016687 | 325 |
| 266 | 3300005365 | Ga0070688_100110694 | Ga0070688_1001106942 | 325 |
| 267 | 3300005366 | Ga0070659_100004405 | Ga0070659_1000044056 | 325 |
| 268 | 3300005367 | Ga0070667_100001184 | Ga0070667_10000118417 | 325 |
| 269 | 3300005406 | Ga0070703_10010576 | Ga0070703_100105763 | 325 |
| 270 | 3300005434 | Ga0070709_10001752 | Ga0070709_100017525 | 325 |
| 271 | 3300005435 | Ga0070714_100069438 | Ga0070714_1000694382 | 325 |
| 272 | 3300005436 | Ga0070713_100001031 | Ga0070713_10000103111 | 325 |
| 273 | 3300005437 | Ga0070710_10000732 | Ga0070710_1000073211 | 325 |
| 274 | 3300005438 | Ga0070701_10002551 | Ga0070701_100025512 | 325 |
| 275 | 3300005438 | Ga0070701_10151450 | Ga0070701_101514501 | 325 |
| 276 | 3300005439 | Ga0070711_100000095 | Ga0070711_1000000956 | 325 |
| 277 | 3300005441 | Ga0070700_100003085 | Ga0070700_1000030856 | 325 |
| 278 | 3300005441 | Ga0070700_100095217 | Ga0070700_1000952171 | 325 |
| 279 | 3300005444 | Ga0070694_100001906 | Ga0070694_1000019069 | 325 |
| 280 | 3300005455 | Ga0070663_100001429 | Ga0070663_1000014294 | 325 |
| 281 | 3300005456 | Ga0070678_100001684 | Ga0070678_1000016847 | 325 |
| 282 | 3300005457 | Ga0070662_100001283 | Ga0070662_1000012839 | 325 |
| 283 | 3300005458 | Ga0070681_10015543 | Ga0070681_100155434 | 325 |
| 284 | 3300005458 | Ga0070681_10021843 | Ga0070681_100218434 | 325 |
| 285 | 3300005458 | Ga0070681_10217786 | Ga0070681_102177862 | 325 |
| 286 | 3300005459 | Ga0068867_100042414 | Ga0068867_1000424143 | 325 |
| 287 | 3300005518 | Ga0070699_100204166 | Ga0070699_1002041662 | 325 |
| 288 | 3300005530 | Ga0070679_100269611 | Ga0070679_1002696112 | 325 |
| 289 | 3300005535 | Ga0070684_100007419 | Ga0070684_1000074194 | 325 |
| 290 | 3300005536 | Ga0070697_100000955 | Ga0070697_10000095514 | 325 |
| 291 | 3300005539 | Ga0068853_100000714 | Ga0068853_1000007146 | 325 |
| 292 | 3300005539 | Ga0068853_100308666 | Ga0068853_1003086662 | 325 |
| 293 | 3300005543 | Ga0070672_100035688 | Ga0070672_1000356881 | 325 |
| 294 | 3300005543 | Ga0070672_100054576 | Ga0070672_1000545764 | 325 |
| 295 | 3300005544 | Ga0070686_100008934 | Ga0070686_1000089342 | 325 |
| 296 | 3300005545 | Ga0070695_100000122 | Ga0070695_10000012219 | 325 |
| 297 | 3300005545 | Ga0070695_100007567 | Ga0070695_1000075675 | 325 |
| 298 | 3300005546 | Ga0070696_100000993 | Ga0070696_1000009937 | 325 |
| 299 | 3300005548 | Ga0070665_100005234 | Ga0070665_1000052344 | 325 |
| 300 | 3300005548 | Ga0070665_100119645 | Ga0070665_1001196453 | 325 |
| 301 | 3300005548 | Ga0070665_100204312 | Ga0070665_1002043123 | 325 |
| 302 | 3300005549 | Ga0070704_100000417 | Ga0070704_1000004174 | 325 |
| 303 | 3300005563 | Ga0068855_100001459 | Ga0068855_10000145928 | 325 |
| 304 | 3300005564 | Ga0070664_100002837 | Ga0070664_1000028371 | 325 |
| 305 | 3300005577 | Ga0068857_100004107 | Ga0068857_1000041075 | 325 |
| 306 | 3300005578 | Ga0068854_100000660 | Ga0068854_1000006603 | 325 |
| 307 | 3300005578 | Ga0068854_100175668 | Ga0068854_1001756682 | 325 |
| 308 | 3300005615 | Ga0070702_100000010 | Ga0070702_10000001044 | 325 |
| 309 | 3300005615 | Ga0070702_100057928 | Ga0070702_1000579283 | 325 |
| 310 | 3300005615 | Ga0070702_100175762 | Ga0070702_1001757622 | 325 |
| 311 | 3300005617 | Ga0068859_100003130 | Ga0068859_10000313013 | 325 |
| 312 | 3300005617 | Ga0068859_100168273 | Ga0068859_1001682732 | 325 |
| 313 | 3300005618 | Ga0068864_100022833 | Ga0068864_1000228335 | 325 |
| 314 | 3300005718 | Ga0068866_10002702 | Ga0068866_100027023 | 325 |
| 315 | 3300005841 | Ga0068863_100006477 | Ga0068863_1000064773 | 325 |
| 316 | 3300005842 | Ga0068858_100144860 | Ga0068858_1001448602 | 325 |
| 317 | 3300005843 | Ga0068860_100000961 | Ga0068860_1000009614 | 325 |
| 318 | 3300005843 | Ga0068860_100162785 | Ga0068860_1001627853 | 325 |
| 319 | 3300005844 | Ga0068862_100008421 | Ga0068862_1000084215 | 325 |
| 320 | 3300005844 | Ga0068862_100026667 | Ga0068862_1000266673 | 325 |
| 321 | 3300005937 | Ga0081455_10011835 | Ga0081455_100118355 | 325 |
| 322 | 3300005937 | Ga0081455_10012256 | Ga0081455_100122564 | 325 |
| 323 | 3300005937 | Ga0081455_10012725 | Ga0081455_100127256 | 325 |
| 324 | 3300005983 | Ga0081540_1000343 | Ga0081540_10003432 | 325 |
| 325 | 3300006058 | Ga0075432_10000121 | Ga0075432_1000012121 | 325 |
| 326 | 3300006058 | Ga0075432_10001542 | Ga0075432_100015424 | 325 |
| 327 | 3300006058 | Ga0075432_10013480 | Ga0075432_100134802 | 325 |
| 328 | 3300006163 | Ga0070715_10000194 | Ga0070715_100001947 | 325 |
| 329 | 3300006173 | Ga0070716_100039387 | Ga0070716_1000393872 | 325 |
| 330 | 3300006175 | Ga0070712_100002679 | Ga0070712_1000026795 | 325 |
| 331 | 3300006175 | Ga0070712_100099553 | Ga0070712_1000995532 | 325 |
| 332 | 3300006186 | Ga0075369_10008171 | Ga0075369_100081713 | 325 |
| 333 | 3300006237 | Ga0097621_100049901 | Ga0097621_1000499014 | 325 |
| 334 | 3300006237 | Ga0097621_100127468 | Ga0097621_1001274681 | 325 |
| 335 | 3300006358 | Ga0068871_100007258 | Ga0068871_1000072583 | 325 |
| 336 | 3300006358 | Ga0068871_100046243 | Ga0068871_1000462435 | 325 |
| 337 | 3300006844 | Ga0075428_100008638 | Ga0075428_1000086382 | 325 |
| 338 | 3300006847 | Ga0075431_100071595 | Ga0075431_1000715953 | 325 |
| 339 | 3300006847 | Ga0075431_100094192 | Ga0075431_1000941922 | 325 |
| 340 | 3300006852 | Ga0075433_10037746 | Ga0075433_100377463 | 325 |
| 341 | 3300006881 | Ga0068865_100000479 | Ga0068865_1000004799 | 325 |
| 342 | 3300006881 | Ga0068865_100100478 | Ga0068865_1001004783 | 325 |
| 343 | 3300006914 | Ga0075436_100001650 | Ga0075436_10000165010 | 325 |
| 344 | 3300006931 | Ga0097620_100003130 | Ga0097620_10000313013 | 325 |
| 345 | 3300006931 | Ga0097620_100168269 | Ga0097620_1001682692 | 325 |
| 346 | 3300006946 | Ga0079104_1000426 | Ga0079104_100042633 | 325 |
| 347 | 3300006946 | Ga0079104_1001612 | Ga0079104_10016123 | 325 |
| 348 | 3300007076 | Ga0075435_100110025 | Ga0075435_1001100252 | 325 |
| 349 | 3300009036 | Ga0105244_10002982 | Ga0105244_100029827 | 325 |
| 350 | 3300009036 | Ga0105244_10046797 | Ga0105244_100467972 | 325 |
| 351 | 3300009036 | Ga0105244_10052420 | Ga0105244_100524202 | 325 |
| 352 | 3300009036 | Ga0105244_10054541 | Ga0105244_100545412 | 325 |
| 353 | 3300009092 | Ga0105250_10006501 | Ga0105250_100065012 | 325 |
| 354 | 3300009092 | Ga0105250_10006990 | Ga0105250_100069904 | 325 |
| 355 | 3300009092 | Ga0105250_10008590 | Ga0105250_100085903 | 325 |
| 356 | 3300009092 | Ga0105250_10020227 | Ga0105250_100202272 | 325 |
| 357 | 3300009092 | Ga0105250_10061091 | Ga0105250_100610913 | 325 |
| 358 | 3300009093 | Ga0105240_10006881 | Ga0105240_100068817 | 325 |
| 359 | 3300009093 | Ga0105240_10019958 | Ga0105240_100199587 | 325 |
| 360 | 3300009094 | Ga0111539_10136940 | Ga0111539_101369403 | 325 |
| 361 | 3300009094 | Ga0111539_10137378 | Ga0111539_101373783 | 325 |
| 362 | 3300009094 | Ga0111539_10409874 | Ga0111539_104098742 | 325 |
| 363 | 3300009098 | Ga0105245_10018071 | Ga0105245_100180714 | 325 |
| 364 | 3300009101 | Ga0105247_10001227 | Ga0105247_1000122716 | 325 |
| 365 | 3300009101 | Ga0105247_10033489 | Ga0105247_100334893 | 325 |
| 366 | 3300009101 | Ga0105247_10052939 | Ga0105247_100529393 | 325 |
| 367 | 3300009147 | Ga0114129_10007650 | Ga0114129_1000765010 | 325 |
| 368 | 3300009147 | Ga0114129_10026262 | Ga0114129_100262626 | 325 |
| 369 | 3300009147 | Ga0114129_10029155 | Ga0114129_100291558 | 325 |
| 370 | 3300009147 | Ga0114129_10045234 | Ga0114129_100452347 | 325 |
| 371 | 3300009147 | Ga0114129_10203420 | Ga0114129_102034202 | 325 |
| 372 | 3300009147 | Ga0114129_10248653 | Ga0114129_102486532 | 325 |
| 373 | 3300009148 | Ga0105243_10000233 | Ga0105243_1000023347 | 325 |
| 374 | 3300009148 | Ga0105243_10271465 | Ga0105243_102714652 | 325 |
| 375 | 3300009174 | Ga0105241_10004813 | Ga0105241_1000481310 | 325 |
| 376 | 3300009174 | Ga0105241_10445593 | Ga0105241_104455931 | 325 |
| 377 | 3300009176 | Ga0105242_10000625 | Ga0105242_100006251 | 325 |
| 378 | 3300009176 | Ga0105242_10112177 | Ga0105242_101121772 | 325 |
| 379 | 3300009177 | Ga0105248_10005964 | Ga0105248_1000596415 | 325 |
| 380 | 3300009177 | Ga0105248_10048062 | Ga0105248_100480622 | 325 |
| 381 | 3300009177 | Ga0105248_10085514 | Ga0105248_100855142 | 325 |
| 382 | 3300009545 | Ga0105237_10006537 | Ga0105237_1000653710 | 325 |
| 383 | 3300009551 | Ga0105238_10023129 | Ga0105238_100231296 | 325 |
| 384 | 3300009553 | Ga0105249_10021566 | Ga0105249_100215664 | 325 |
| 385 | 3300009553 | Ga0105249_10235053 | Ga0105249_102350532 | 325 |
| 386 | 3300010375 | Ga0105239_10000033 | Ga0105239_10000033160 | 325 |
| 387 | 3300010375 | Ga0105239_10040808 | Ga0105239_100408084 | 325 |
| 388 | 3300010375 | Ga0105239_10130345 | Ga0105239_101303452 | 325 |
| 389 | 3300011119 | Ga0105246_10000058 | Ga0105246_100000581 | 325 |
| 390 | 3300011119 | Ga0105246_10033505 | Ga0105246_100335054 | 325 |
| 391 | 3300011119 | Ga0105246_10042754 | Ga0105246_100427545 | 325 |
| 392 | 3300013100 | Ga0157373_10002561 | Ga0157373_100025614 | 325 |
| 393 | 3300013100 | Ga0157373_10006435 | Ga0157373_100064353 | 325 |
| 394 | 3300013100 | Ga0157373_10243016 | Ga0157373_102430162 | 325 |
| 395 | 3300013102 | Ga0157371_10002421 | Ga0157371_1000242119 | 325 |
| 396 | 3300013102 | Ga0157371_10009277 | Ga0157371_100092774 | 325 |
| 397 | 3300013102 | Ga0157371_10172191 | Ga0157371_101721912 | 325 |
| 398 | 3300013104 | Ga0157370_10004153 | Ga0157370_1000415311 | 325 |
| 399 | 3300013104 | Ga0157370_10004666 | Ga0157370_1000466613 | 325 |
| 400 | 3300013104 | Ga0157370_10014316 | Ga0157370_100143168 | 325 |
| 401 | 3300013104 | Ga0157370_10057498 | Ga0157370_100574984 | 325 |
| 402 | 3300013104 | Ga0157370_10078142 | Ga0157370_100781424 | 325 |
| 403 | 3300013104 | Ga0157370_10118740 | Ga0157370_101187402 | 325 |
| 404 | 3300013104 | Ga0157370_10162596 | Ga0157370_101625962 | 325 |
| 405 | 3300013105 | Ga0157369_10007040 | Ga0157369_1000704013 | 325 |
| 406 | 3300013297 | Ga0157378_10024775 | Ga0157378_100247752 | 325 |
| 407 | 3300013306 | Ga0163162_10012818 | Ga0163162_100128187 | 325 |
| 408 | 3300013306 | Ga0163162_10043764 | Ga0163162_100437646 | 325 |
| 409 | 3300013306 | Ga0163162_10123219 | Ga0163162_101232193 | 325 |
| 410 | 3300013306 | Ga0163162_10128911 | Ga0163162_101289113 | 325 |
| 411 | 3300013306 | Ga0163162_10201771 | Ga0163162_102017712 | 325 |
| 412 | 3300013306 | Ga0163162_10275575 | Ga0163162_102755752 | 325 |
| 413 | 3300013308 | Ga0157375_10000904 | Ga0157375_1000090413 | 325 |
| 414 | 3300013308 | Ga0157375_10002641 | Ga0157375_1000264113 | 325 |
| 415 | 3300013308 | Ga0157375_10006942 | Ga0157375_100069425 | 325 |
| 416 | 3300013308 | Ga0157375_10159839 | Ga0157375_101598393 | 325 |
| 417 | 3300014326 | Ga0157380_10001119 | Ga0157380_1000111910 | 325 |
| 418 | 3300014326 | Ga0157380_10129955 | Ga0157380_101299552 | 325 |
| 419 | 3300014326 | Ga0157380_10176449 | Ga0157380_101764491 | 325 |
| 420 | 3300014497 | Ga0182008_10002677 | Ga0182008_100026778 | 325 |
| 421 | 3300014497 | Ga0182008_10004190 | Ga0182008_100041905 | 325 |
| 422 | 3300014497 | Ga0182008_10006903 | Ga0182008_100069034 | 325 |
| 423 | 3300014497 | Ga0182008_10013085 | Ga0182008_100130854 | 325 |
| 424 | 3300014497 | Ga0182008_10015667 | Ga0182008_100156675 | 325 |
| 425 | 3300014497 | Ga0182008_10134174 | Ga0182008_101341742 | 325 |
| 426 | 3300014497 | Ga0182008_10190314 | Ga0182008_101903141 | 325 |
| 427 | 3300014745 | Ga0157377_10002624 | Ga0157377_100026246 | 325 |
| 428 | 3300014745 | Ga0157377_10030559 | Ga0157377_100305592 | 325 |
| 429 | 3300014968 | Ga0157379_10001136 | Ga0157379_1000113615 | 325 |
| 430 | 3300014969 | Ga0157376_10000941 | Ga0157376_1000094113 | 325 |
| 431 | 3300014969 | Ga0157376_10014199 | Ga0157376_100141995 | 325 |
| 432 | 3300014969 | Ga0157376_10051877 | Ga0157376_100518772 | 325 |
| 433 | 3300015261 | Ga0182006_1000083 | Ga0182006_100008380 | 325 |
| 434 | 3300015261 | Ga0182006_1002021 | Ga0182006_10020219 | 325 |
| 435 | 3300015261 | Ga0182006_1018107 | Ga0182006_10181072 | 325 |
| 436 | 3300015261 | Ga0182006_1022438 | Ga0182006_10224382 | 325 |
| 437 | 3300015262 | Ga0182007_10000086 | Ga0182007_1000008644 | 325 |
| 438 | 3300015262 | Ga0182007_10035409 | Ga0182007_100354092 | 325 |
| 439 | 3300015265 | Ga0182005_1000675 | Ga0182005_10006758 | 325 |
| 440 | 3300015265 | Ga0182005_1005936 | Ga0182005_10059362 | 325 |
| 441 | 3300015265 | Ga0182005_1009968 | Ga0182005_10099682 | 325 |
| 442 | 3300015265 | Ga0182005_1022603 | Ga0182005_10226031 | 325 |
| 443 | 3300017792 | Ga0163161_10002612 | Ga0163161_100026122 | 325 |
| 444 | 3300017792 | Ga0163161_10004580 | Ga0163161_100045802 | 325 |
| 445 | 3300017792 | Ga0163161_10011584 | Ga0163161_100115843 | 325 |
| 446 | 3300017792 | Ga0163161_10021506 | Ga0163161_100215062 | 325 |
| 447 | 3300017792 | Ga0163161_10134852 | Ga0163161_101348522 | 325 |
| 448 | 3300025207 | Ga0209760_100405 | Ga0209760_1004054 | 325 |
| 449 | 3300025224 | Ga0209784_100026 | Ga0209784_100026296 | 325 |
| 450 | 3300025231 | Ga0207427_100023 | Ga0207427_100023296 | 325 |
| 451 | 3300025233 | Ga0209437_100015 | Ga0209437_100015620 | 325 |
| 452 | 3300025242 | Ga0209258_100043 | Ga0209258_10004315 | 325 |
| 453 | 3300025250 | Ga0209026_1000047 | Ga0209026_100004715 | 325 |
| 454 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010295 | 325 |
| 455 | 3300025256 | Ga0209759_1000715 | Ga0209759_10007156 | 325 |
| 456 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009877 | 325 |
| 457 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020309 | 325 |
| 458 | 3300025291 | Ga0209675_1002396 | Ga0209675_10023966 | 325 |
| 459 | 3300025292 | Ga0209676_1000002 | Ga0209676_10000021019 | 325 |
| 460 | 3300025292 | Ga0209676_1003788 | Ga0209676_10037887 | 325 |
| 461 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010582 | 325 |
| 462 | 3300025298 | Ga0209050_1000006 | Ga0209050_1000006551 | 325 |
| 463 | 3300025298 | Ga0209050_1005631 | Ga0209050_10056312 | 325 |
| 464 | 3300025303 | Ga0209051_1000001 | Ga0209051_10000011019 | 325 |
| 465 | 3300025303 | Ga0209051_1012244 | Ga0209051_10122445 | 325 |
| 466 | 3300025304 | Ga0209257_1000029 | Ga0209257_1000029551 | 325 |
| 467 | 3300025711 | Ga0207696_1000405 | Ga0207696_10004054 | 325 |
| 468 | 3300025711 | Ga0207696_1003824 | Ga0207696_10038242 | 325 |
| 469 | 3300025728 | Ga0207655_1000481 | Ga0207655_100048119 | 325 |
| 470 | 3300025728 | Ga0207655_1002986 | Ga0207655_10029861 | 325 |
| 471 | 3300025728 | Ga0207655_1004462 | Ga0207655_10044625 | 325 |
| 472 | 3300025728 | Ga0207655_1016216 | Ga0207655_10162164 | 325 |
| 473 | 3300025735 | Ga0207713_1000893 | Ga0207713_10008932 | 325 |
| 474 | 3300025735 | Ga0207713_1002558 | Ga0207713_10025588 | 325 |
| 475 | 3300025898 | Ga0207692_10034656 | Ga0207692_100346562 | 325 |
| 476 | 3300025900 | Ga0207710_10008378 | Ga0207710_100083781 | 325 |
| 477 | 3300025900 | Ga0207710_10013949 | Ga0207710_100139492 | 325 |
| 478 | 3300025901 | Ga0207688_10001350 | Ga0207688_100013509 | 325 |
| 479 | 3300025903 | Ga0207680_10002690 | Ga0207680_100026908 | 325 |
| 480 | 3300025904 | Ga0207647_10001011 | Ga0207647_100010119 | 325 |
| 481 | 3300025905 | Ga0207685_10005233 | Ga0207685_100052333 | 325 |
| 482 | 3300025907 | Ga0207645_10002031 | Ga0207645_1000203110 | 325 |
| 483 | 3300025909 | Ga0207705_10225365 | Ga0207705_102253651 | 325 |
| 484 | 3300025911 | Ga0207654_10013888 | Ga0207654_100138884 | 325 |
| 485 | 3300025912 | Ga0207707_10023111 | Ga0207707_100231113 | 325 |
| 486 | 3300025912 | Ga0207707_10282464 | Ga0207707_102824641 | 325 |
| 487 | 3300025913 | Ga0207695_10005620 | Ga0207695_100056207 | 325 |
| 488 | 3300025915 | Ga0207693_10000062 | Ga0207693_1000006260 | 325 |
| 489 | 3300025916 | Ga0207663_10001357 | Ga0207663_100013575 | 325 |
| 490 | 3300025917 | Ga0207660_10006479 | Ga0207660_100064793 | 325 |
| 491 | 3300025919 | Ga0207657_10000023 | Ga0207657_1000002322 | 325 |
| 492 | 3300025920 | Ga0207649_10002977 | Ga0207649_100029777 | 325 |
| 493 | 3300025923 | Ga0207681_10004374 | Ga0207681_100043742 | 325 |
| 494 | 3300025923 | Ga0207681_10092779 | Ga0207681_100927791 | 325 |
| 495 | 3300025925 | Ga0207650_10003802 | Ga0207650_100038026 | 325 |
| 496 | 3300025926 | Ga0207659_10010335 | Ga0207659_100103354 | 325 |
| 497 | 3300025927 | Ga0207687_10003089 | Ga0207687_100030894 | 325 |
| 498 | 3300025929 | Ga0207664_10071628 | Ga0207664_100716283 | 325 |
| 499 | 3300025932 | Ga0207690_10000718 | Ga0207690_1000071813 | 325 |
| 500 | 3300025933 | Ga0207706_10000019 | Ga0207706_1000001929 | 325 |
| 501 | 3300025933 | Ga0207706_10125161 | Ga0207706_101251613 | 325 |
| 502 | 3300025935 | Ga0207709_10002908 | Ga0207709_100029082 | 325 |
| 503 | 3300025935 | Ga0207709_10183391 | Ga0207709_101833911 | 325 |
| 504 | 3300025936 | Ga0207670_10007526 | Ga0207670_100075265 | 325 |
| 505 | 3300025937 | Ga0207669_10008631 | Ga0207669_100086311 | 325 |
| 506 | 3300025937 | Ga0207669_10307788 | Ga0207669_103077881 | 325 |
| 507 | 3300025938 | Ga0207704_10060146 | Ga0207704_100601463 | 325 |
| 508 | 3300025939 | Ga0207665_10000161 | Ga0207665_1000016110 | 325 |
| 509 | 3300025940 | Ga0207691_10002469 | Ga0207691_100024697 | 325 |
| 510 | 3300025942 | Ga0207689_10006185 | Ga0207689_100061856 | 325 |
| 511 | 3300025944 | Ga0207661_10006687 | Ga0207661_100066874 | 325 |
| 512 | 3300025949 | Ga0207667_10048216 | Ga0207667_100482162 | 325 |
| 513 | 3300025960 | Ga0207651_10011625 | Ga0207651_100116255 | 325 |
| 514 | 3300025960 | Ga0207651_10317025 | Ga0207651_103170251 | 325 |
| 515 | 3300025961 | Ga0207712_10007216 | Ga0207712_100072164 | 325 |
| 516 | 3300025972 | Ga0207668_10002748 | Ga0207668_100027485 | 325 |
| 517 | 3300025972 | Ga0207668_10105038 | Ga0207668_101050382 | 325 |
| 518 | 3300025981 | Ga0207640_10144135 | Ga0207640_101441352 | 325 |
| 519 | 3300025986 | Ga0207658_10069788 | Ga0207658_100697882 | 325 |
| 520 | 3300025986 | Ga0207658_10353570 | Ga0207658_103535701 | 325 |
| 521 | 3300026035 | Ga0207703_10027778 | Ga0207703_100277785 | 325 |
| 522 | 3300026041 | Ga0207639_10002698 | Ga0207639_100026985 | 325 |
| 523 | 3300026067 | Ga0207678_10000017 | Ga0207678_1000001729 | 325 |
| 524 | 3300026067 | Ga0207678_10097106 | Ga0207678_100971063 | 325 |
| 525 | 3300026067 | Ga0207678_10128460 | Ga0207678_101284602 | 325 |
| 526 | 3300026075 | Ga0207708_10000315 | Ga0207708_1000031518 | 325 |
| 527 | 3300026075 | Ga0207708_10024104 | Ga0207708_100241042 | 325 |
| 528 | 3300026075 | Ga0207708_10054070 | Ga0207708_100540701 | 325 |
| 529 | 3300026078 | Ga0207702_10273898 | Ga0207702_102738981 | 325 |
| 530 | 3300026088 | Ga0207641_10025704 | Ga0207641_100257045 | 325 |
| 531 | 3300026089 | Ga0207648_10014325 | Ga0207648_100143256 | 325 |
| 532 | 3300026089 | Ga0207648_10342553 | Ga0207648_103425531 | 325 |
| 533 | 3300026095 | Ga0207676_10024347 | Ga0207676_100243472 | 325 |
| 534 | 3300026118 | Ga0207675_100000439 | Ga0207675_1000004397 | 325 |
| 535 | 3300026121 | Ga0207683_10000030 | Ga0207683_1000003071 | 325 |
| 536 | 3300026142 | Ga0207698_10104671 | Ga0207698_101046713 | 325 |
| 537 | 3300027111 | Ga0209281_1000534 | Ga0209281_100053423 | 325 |
| 538 | 3300027111 | Ga0209281_1010564 | Ga0209281_10105643 | 325 |
| 539 | 3300027907 | Ga0207428_10013069 | Ga0207428_100130691 | 325 |
| 540 | 3300027907 | Ga0207428_10063830 | Ga0207428_100638302 | 325 |
| 541 | 3300027907 | Ga0207428_10212828 | Ga0207428_102128281 | 325 |
| 542 | 3300028379 | Ga0268266_10367654 | Ga0268266_103676542 | 325 |
| 543 | 3300028380 | Ga0268265_10048382 | Ga0268265_100483821 | 325 |
| 544 | 3300028380 | Ga0268265_10168506 | Ga0268265_101685061 | 325 |
| 545 | 3300028380 | Ga0268265_10265606 | Ga0268265_102656061 | 325 |
| 546 | 3300028381 | Ga0268264_10007754 | Ga0268264_100077544 | 325 |
| 547 | 3300028381 | Ga0268264_10063714 | Ga0268264_100637144 | 325 |
| 548 | 3300028556 | Ga0265337_1009926 | Ga0265337_10099262 | 325 |
| 549 | 3300028563 | Ga0265319_1001000 | Ga0265319_100100011 | 325 |
| 550 | 3300028653 | Ga0265323_10000409 | Ga0265323_100004094 | 325 |
| 551 | 3300028666 | Ga0265336_10000099 | Ga0265336_1000009942 | 325 |
| 552 | 3300028800 | Ga0265338_10000207 | Ga0265338_1000020755 | 325 |
| 553 | 3300029957 | Ga0265324_10017130 | Ga0265324_100171302 | 325 |
| 554 | 3300031235 | Ga0265330_10040844 | Ga0265330_100408442 | 325 |
| 555 | 3300031241 | Ga0265325_10033605 | Ga0265325_100336052 | 325 |
| 556 | 3300031911 | Ga0307412_10032254 | Ga0307412_100322541 | 325 |
| 557 | 3300035114 | Ga0373939_0017207 | Ga0373939_0017207_777_1784 | 325 |
| 558 | 3300035170 | Ga0373943_0088480 | Ga0373943_0088480_436_1443 | 325 |
| 559 | 3300035172 | Ga0373955_0129711 | Ga0373955_0129711_428_1435 | 325 |
| 560 | 3300035242 | Ga0373962_0003078 | Ga0373962_0003078_1133_2140 | 325 |
| 561 | 3300035691 | Ga0373931_0000691 | Ga0373931_0000691_9229_10236 | 325 |
| 562 | 3300035691 | Ga0373931_0147111 | Ga0373931_0147111_300_1307 | 325 |
| 563 | 3300035692 | Ga0373935_0082940 | Ga0373935_0082940_601_1608 | 325 |
| 564 | 3300035695 | Ga0373927_0001084 | Ga0373927_0001084_5169_6176 | 325 |
| 565 | 3300035725 | Ga0373947_0001088 | Ga0373947_0001088_1932_2939 | 325 |
| 566 | 3300036401 | Ga0373937_0115504 | Ga0373937_0115504_87_1094 | 325 |
| 567 | 3300037068 | Ga0373925_0009820 | Ga0373925_0009820_761_1768 | 325 |
| 568 | 3300037418 | Ga0395900_0021026 | Ga0395900_0021026_2558_3565 | 325 |
| 569 | 3300037466 | Ga0395898_0053977 | Ga0395898_0053977_2118_3152 | 325 |
| 570 | 3300037466 | Ga0395898_0129439 | Ga0395898_0129439_615_1622 | 325 |
| 571 | 3300037471 | Ga0395905_0001187 | Ga0395905_0001187_1546_2553 | 325 |
| 572 | 3300037471 | Ga0395905_0073920 | Ga0395905_0073920_1066_2100 | 325 |
| 573 | 3300038443 | Ga0395901_0001359 | Ga0395901_0001359_23288_24295 | 325 |
| 574 | 3300041405 | Ga0439438_008693 | Ga0439438_008693_1735_2712 | 325 |
| 575 | 3300041407 | Ga0439447_000014 | Ga0439447_000014_56787_57797 | 325 |
| 576 | 3300041407 | Ga0439447_000414 | Ga0439447_000414_131_1108 | 325 |
| 577 | 3300041411 | Ga0439466_0002820 | Ga0439466_0002820_2397_3407 | 325 |
| 578 | 3300041411 | Ga0439466_0013376 | Ga0439466_0013376_1749_2741 | 325 |
| 579 | 3300041411 | Ga0439466_0022364 | Ga0439466_0022364_552_1529 | 325 |
| 580 | 3300042009 | Ga0439451_010941 | Ga0439451_010941_59_1051 | 325 |
| 581 | 3300042009 | Ga0439451_012870 | Ga0439451_012870_193_1170 | 325 |
| 582 | 3300042010 | Ga0439452_000137 | Ga0439452_000137_46056_47033 | 325 |
| 583 | 3300042010 | Ga0439452_012445 | Ga0439452_012445_820_1797 | 325 |
| 584 | 3300042013 | Ga0439456_006194 | Ga0439456_006194_1080_2057 | 325 |
| 585 | 3300042013 | Ga0439456_006458 | Ga0439456_006458_678_1655 | 325 |
| 586 | 3300042016 | Ga0439463_017211 | Ga0439463_017211_580_1557 | 325 |
| 587 | 3300042115 | Ga0450911_002279 | Ga0450911_002279_2000_2977 | 325 |
| 588 | 3300042115 | Ga0450911_009615 | Ga0450911_009615_300_1277 | 325 |
| 589 | 3300042138 | Ga0450903_000548 | Ga0450903_000548_4322_5314 | 325 |
| 590 | 3300042138 | Ga0450903_002041 | Ga0450903_002041_487_1464 | 325 |
| 591 | 3300042138 | Ga0450903_009088 | Ga0450903_009088_106_1083 | 325 |
| 592 | 3300042142 | Ga0450905_003625 | Ga0450905_003625_108_1085 | 325 |
| 593 | 3300042145 | Ga0450906_013666 | Ga0450906_013666_475_1452 | 325 |
| 594 | 3300042146 | Ga0450907_001628 | Ga0450907_001628_2794_3771 | 325 |
| 595 | 3300042147 | Ga0450910_000637 | Ga0450910_000637_379_1356 | 325 |
| 596 | 3300042461 | Ga0439460_0002902 | Ga0439460_0002902_283_1260 | 325 |
| 597 | 3300046452 | Ga0495617_000106 | Ga0495617_000106_21098_22075 | 325 |
| 598 | 3300046452 | Ga0495617_000201 | Ga0495617_000201_31889_32866 | 325 |
| 599 | 3300046452 | Ga0495617_003527 | Ga0495617_003527_3319_4296 | 325 |
| 600 | 3300046452 | Ga0495617_004861 | Ga0495617_004861_2463_3440 | 325 |
| 601 | 3300046452 | Ga0495617_006482 | Ga0495617_006482_2826_3803 | 325 |
| 602 | 3300046452 | Ga0495617_025287 | Ga0495617_025287_250_1227 | 325 |
| 603 | 3300046452 | Ga0495617_028601 | Ga0495617_028601_175_1152 | 325 |
| 604 | 3300046453 | Ga0495627_002130 | Ga0495627_002130_2229_3206 | 325 |
| 605 | 3300046453 | Ga0495627_011247 | Ga0495627_011247_1240_2259 | 325 |
| 606 | 3300046455 | Ga0495603_0000238 | Ga0495603_0000238_21661_22668 | 325 |
| 607 | 3300046455 | Ga0495603_0003168 | Ga0495603_0003168_167_1144 | 325 |
| 608 | 3300046455 | Ga0495603_0026485 | Ga0495603_0026485_100_1077 | 325 |
| 609 | 3300046455 | Ga0495603_0042054 | Ga0495603_0042054_1113_2090 | 325 |
| 610 | 3300046455 | Ga0495603_0073397 | Ga0495603_0073397_971_1948 | 325 |
| 611 | 3300046455 | Ga0495603_0179507 | Ga0495603_0179507_68_1102 | 325 |
| 612 | 3300046457 | Ga0495590_0000226 | Ga0495590_0000226_6554_7531 | 325 |
| 613 | 3300046457 | Ga0495590_0002968 | Ga0495590_0002968_2046_3023 | 325 |
| 614 | 3300046457 | Ga0495590_0008979 | Ga0495590_0008979_2261_3238 | 325 |
| 615 | 3300046457 | Ga0495590_0024121 | Ga0495590_0024121_243_1220 | 325 |
| 616 | 3300046458 | Ga0495591_000139 | Ga0495591_000139_6889_7866 | 325 |
| 617 | 3300046458 | Ga0495591_003357 | Ga0495591_003357_1065_2042 | 325 |
| 618 | 3300046458 | Ga0495591_004318 | Ga0495591_004318_3296_4288 | 325 |
| 619 | 3300046458 | Ga0495591_005080 | Ga0495591_005080_2730_3707 | 325 |
| 620 | 3300046458 | Ga0495591_006752 | Ga0495591_006752_512_1489 | 325 |
| 621 | 3300046458 | Ga0495591_008966 | Ga0495591_008966_3009_3986 | 325 |
| 622 | 3300046458 | Ga0495591_018119 | Ga0495591_018119_1123_2142 | 325 |
| 623 | 3300046458 | Ga0495591_021457 | Ga0495591_021457_745_1722 | 325 |
| 624 | 3300046458 | Ga0495591_043537 | Ga0495591_043537_269_1246 | 325 |
| 625 | 3300046459 | Ga0495629_0000781 | Ga0495629_0000781_5358_6365 | 325 |
| 626 | 3300046459 | Ga0495629_0009940 | Ga0495629_0009940_3361_4413 | 325 |
| 627 | 3300046460 | Ga0495638_0000117 | Ga0495638_0000117_72290_73267 | 325 |
| 628 | 3300046460 | Ga0495638_0003030 | Ga0495638_0003030_2853_3830 | 325 |
| 629 | 3300046460 | Ga0495638_0006658 | Ga0495638_0006658_6926_7903 | 325 |
| 630 | 3300046460 | Ga0495638_0008506 | Ga0495638_0008506_4879_5856 | 325 |
| 631 | 3300046460 | Ga0495638_0015837 | Ga0495638_0015837_1608_2585 | 325 |
| 632 | 3300046460 | Ga0495638_0021001 | Ga0495638_0021001_1491_2513 | 325 |
| 633 | 3300046460 | Ga0495638_0024211 | Ga0495638_0024211_1277_2254 | 325 |
| 634 | 3300046460 | Ga0495638_0038404 | Ga0495638_0038404_855_1961 | 325 |
| 635 | 3300046460 | Ga0495638_0078104 | Ga0495638_0078104_1023_2000 | 325 |
| 636 | 3300046463 | Ga0495653_0001441 | Ga0495653_0001441_11152_12150 | 325 |
| 637 | 3300046463 | Ga0495653_0007024 | Ga0495653_0007024_967_2019 | 325 |
| 638 | 3300046463 | Ga0495653_0016699 | Ga0495653_0016699_2622_3599 | 325 |
| 639 | 3300046463 | Ga0495653_0073281 | Ga0495653_0073281_337_1314 | 325 |
| 640 | 3300046471 | Ga0495650_0001886 | Ga0495650_0001886_3209_4201 | 325 |
| 641 | 3300046471 | Ga0495650_0003727 | Ga0495650_0003727_5971_7005 | 325 |
| 642 | 3300046471 | Ga0495650_0007809 | Ga0495650_0007809_1064_2041 | 325 |
| 643 | 3300046471 | Ga0495650_0008937 | Ga0495650_0008937_1230_2207 | 325 |
| 644 | 3300046471 | Ga0495650_0038164 | Ga0495650_0038164_1028_2005 | 325 |
| 645 | 3300046471 | Ga0495650_0095781 | Ga0495650_0095781_79_1056 | 325 |
| 646 | 3300046472 | Ga0495580_0000522 | Ga0495580_0000522_29642_30649 | 325 |
| 647 | 3300046473 | Ga0495582_0000670 | Ga0495582_0000670_14070_15077 | 325 |
| 648 | 3300046473 | Ga0495582_0009450 | Ga0495582_0009450_956_2008 | 325 |
| 649 | 3300046474 | Ga0495605_0000114 | Ga0495605_0000114_19504_20481 | 325 |
| 650 | 3300046474 | Ga0495605_0000557 | Ga0495605_0000557_19609_20586 | 325 |
| 651 | 3300046474 | Ga0495605_0002643 | Ga0495605_0002643_5245_6222 | 325 |
| 652 | 3300046474 | Ga0495605_0005058 | Ga0495605_0005058_5942_6919 | 325 |
| 653 | 3300046474 | Ga0495605_0007050 | Ga0495605_0007050_903_1880 | 325 |
| 654 | 3300046474 | Ga0495605_0008069 | Ga0495605_0008069_2831_3850 | 325 |
| 655 | 3300046474 | Ga0495605_0010101 | Ga0495605_0010101_290_1324 | 325 |
| 656 | 3300046474 | Ga0495605_0015923 | Ga0495605_0015923_427_1404 | 325 |
| 657 | 3300046474 | Ga0495605_0034356 | Ga0495605_0034356_748_1725 | 325 |
| 658 | 3300046474 | Ga0495605_0037372 | Ga0495605_0037372_968_1945 | 325 |
| 659 | 3300046475 | Ga0495639_0000001 | Ga0495639_0000001_131148_132125 | 325 |
| 660 | 3300046475 | Ga0495639_0006700 | Ga0495639_0006700_853_1905 | 325 |
| 661 | 3300046475 | Ga0495639_0013989 | Ga0495639_0013989_1744_2721 | 325 |
| 662 | 3300046475 | Ga0495639_0015494 | Ga0495639_0015494_44_1051 | 325 |
| 663 | 3300046475 | Ga0495639_0026285 | Ga0495639_0026285_240_1217 | 325 |
| 664 | 3300046475 | Ga0495639_0031314 | Ga0495639_0031314_398_1375 | 325 |
| 665 | 3300046491 | Ga0495584_0000140 | Ga0495584_0000140_2157_3134 | 325 |
| 666 | 3300046491 | Ga0495584_0000469 | Ga0495584_0000469_14553_15530 | 325 |
| 667 | 3300046491 | Ga0495584_0001357 | Ga0495584_0001357_7329_8306 | 325 |
| 668 | 3300046491 | Ga0495584_0010763 | Ga0495584_0010763_2784_3761 | 325 |
| 669 | 3300046491 | Ga0495584_0019149 | Ga0495584_0019149_237_1214 | 325 |
| 670 | 3300046491 | Ga0495584_0020466 | Ga0495584_0020466_1552_2571 | 325 |
| 671 | 3300046491 | Ga0495584_0040341 | Ga0495584_0040341_1242_2249 | 325 |
| 672 | 3300046492 | Ga0495585_0000605 | Ga0495585_0000605_26398_27375 | 325 |
| 673 | 3300046492 | Ga0495585_0003016 | Ga0495585_0003016_10541_11539 | 325 |
| 674 | 3300046492 | Ga0495585_0003480 | Ga0495585_0003480_7032_8009 | 325 |
| 675 | 3300046492 | Ga0495585_0006756 | Ga0495585_0006756_2055_3032 | 325 |
| 676 | 3300046492 | Ga0495585_0009789 | Ga0495585_0009789_725_1702 | 325 |
| 677 | 3300046492 | Ga0495585_0016584 | Ga0495585_0016584_2232_3209 | 325 |
| 678 | 3300046492 | Ga0495585_0018499 | Ga0495585_0018499_1287_2264 | 325 |
| 679 | 3300046492 | Ga0495585_0060336 | Ga0495585_0060336_936_1913 | 325 |
| 680 | 3300046499 | Ga0495594_0000025 | Ga0495594_0000025_48696_49703 | 325 |
| 681 | 3300046499 | Ga0495594_0001211 | Ga0495594_0001211_3165_4142 | 325 |
| 682 | 3300046499 | Ga0495594_0013051 | Ga0495594_0013051_699_1751 | 325 |
| 683 | 3300046499 | Ga0495594_0015740 | Ga0495594_0015740_1370_2347 | 325 |
| 684 | 3300046500 | Ga0495596_0025824 | Ga0495596_0025824_655_1632 | 325 |
| 685 | 3300046501 | Ga0495607_0000188 | Ga0495607_0000188_63614_64591 | 325 |
| 686 | 3300046501 | Ga0495607_0000709 | Ga0495607_0000709_10196_11188 | 325 |
| 687 | 3300046501 | Ga0495607_0001305 | Ga0495607_0001305_3926_4960 | 325 |
| 688 | 3300046501 | Ga0495607_0003254 | Ga0495607_0003254_5500_6477 | 325 |
| 689 | 3300046501 | Ga0495607_0020829 | Ga0495607_0020829_2263_3240 | 325 |
| 690 | 3300046501 | Ga0495607_0036444 | Ga0495607_0036444_185_1204 | 325 |
| 691 | 3300046501 | Ga0495607_0041815 | Ga0495607_0041815_439_1425 | 325 |
| 692 | 3300046501 | Ga0495607_0085595 | Ga0495607_0085595_308_1285 | 325 |
| 693 | 3300046506 | Ga0495583_0003084 | Ga0495583_0003084_8886_9863 | 325 |
| 694 | 3300046506 | Ga0495583_0004168 | Ga0495583_0004168_7751_8728 | 325 |
| 695 | 3300046506 | Ga0495583_0006113 | Ga0495583_0006113_4024_5001 | 325 |
| 696 | 3300046507 | Ga0495606_0001909 | Ga0495606_0001909_20349_21368 | 325 |
| 697 | 3300046507 | Ga0495606_0003137 | Ga0495606_0003137_10775_11773 | 325 |
| 698 | 3300046507 | Ga0495606_0003315 | Ga0495606_0003315_14635_15612 | 325 |
| 699 | 3300046507 | Ga0495606_0005520 | Ga0495606_0005520_7425_8459 | 325 |
| 700 | 3300046507 | Ga0495606_0011709 | Ga0495606_0011709_4608_5585 | 325 |
| 701 | 3300046507 | Ga0495606_0071619 | Ga0495606_0071619_969_1946 | 325 |
| 702 | 3300046512 | Ga0495610_0000577 | Ga0495610_0000577_7214_8191 | 325 |
| 703 | 3300046512 | Ga0495610_0002921 | Ga0495610_0002921_9532_10509 | 325 |
| 704 | 3300046512 | Ga0495610_0005314 | Ga0495610_0005314_5986_6978 | 325 |
| 705 | 3300046512 | Ga0495610_0015560 | Ga0495610_0015560_1575_2552 | 325 |
| 706 | 3300046512 | Ga0495610_0022499 | Ga0495610_0022499_1458_2564 | 325 |
| 707 | 3300046512 | Ga0495610_0025009 | Ga0495610_0025009_1691_2668 | 325 |
| 708 | 3300046512 | Ga0495610_0097142 | Ga0495610_0097142_42_1061 | 325 |
| 709 | 3300046513 | Ga0495616_0002771 | Ga0495616_0002771_3496_4473 | 325 |
| 710 | 3300046513 | Ga0495616_0004149 | Ga0495616_0004149_7805_8782 | 325 |
| 711 | 3300046513 | Ga0495616_0004349 | Ga0495616_0004349_3169_4146 | 325 |
| 712 | 3300046513 | Ga0495616_0006099 | Ga0495616_0006099_1647_2624 | 325 |
| 713 | 3300046513 | Ga0495616_0027320 | Ga0495616_0027320_1048_2025 | 325 |
| 714 | 3300046513 | Ga0495616_0027440 | Ga0495616_0027440_1735_2712 | 325 |
| 715 | 3300046515 | Ga0495620_0003671 | Ga0495620_0003671_1700_2734 | 325 |
| 716 | 3300046515 | Ga0495620_0004593 | Ga0495620_0004593_5600_6619 | 325 |
| 717 | 3300046515 | Ga0495620_0004634 | Ga0495620_0004634_3307_4299 | 325 |
| 718 | 3300046515 | Ga0495620_0006538 | Ga0495620_0006538_4875_5852 | 325 |
| 719 | 3300046515 | Ga0495620_0021167 | Ga0495620_0021167_253_1230 | 325 |
| 720 | 3300046515 | Ga0495620_0026770 | Ga0495620_0026770_1310_2287 | 325 |
| 721 | 3300046516 | Ga0495628_0066143 | Ga0495628_0066143_212_1189 | 325 |
| 722 | 3300046517 | Ga0495630_0000706 | Ga0495630_0000706_5223_6200 | 325 |
| 723 | 3300046517 | Ga0495630_0006789 | Ga0495630_0006789_1062_2039 | 325 |
| 724 | 3300046517 | Ga0495630_0025835 | Ga0495630_0025835_1355_2332 | 325 |
| 725 | 3300046517 | Ga0495630_0026071 | Ga0495630_0026071_957_2009 | 325 |
| 726 | 3300046518 | Ga0495631_0000002 | Ga0495631_0000002_119203_120237 | 325 |
| 727 | 3300046518 | Ga0495631_0000005 | Ga0495631_0000005_87622_88599 | 325 |
| 728 | 3300046518 | Ga0495631_0021330 | Ga0495631_0021330_79_1056 | 325 |
| 729 | 3300046518 | Ga0495631_0021622 | Ga0495631_0021622_1395_2414 | 325 |
| 730 | 3300046519 | Ga0495632_0000322 | Ga0495632_0000322_13172_14149 | 325 |
| 731 | 3300046519 | Ga0495632_0001664 | Ga0495632_0001664_2135_3112 | 325 |
| 732 | 3300046519 | Ga0495632_0006053 | Ga0495632_0006053_587_1564 | 325 |
| 733 | 3300046519 | Ga0495632_0009894 | Ga0495632_0009894_3320_4339 | 325 |
| 734 | 3300046519 | Ga0495632_0013189 | Ga0495632_0013189_1897_2874 | 325 |
| 735 | 3300046519 | Ga0495632_0077760 | Ga0495632_0077760_411_1388 | 325 |
| 736 | 3300046519 | Ga0495632_0097640 | Ga0495632_0097640_366_1343 | 325 |
| 737 | 3300046519 | Ga0495632_0107873 | Ga0495632_0107873_295_1272 | 325 |
| 738 | 3300046520 | Ga0495637_0000681 | Ga0495637_0000681_17663_18640 | 325 |
| 739 | 3300046520 | Ga0495637_0004891 | Ga0495637_0004891_816_1793 | 325 |
| 740 | 3300046520 | Ga0495637_0007731 | Ga0495637_0007731_213_1190 | 325 |
| 741 | 3300046520 | Ga0495637_0008150 | Ga0495637_0008150_2294_3271 | 325 |
| 742 | 3300046520 | Ga0495637_0010618 | Ga0495637_0010618_2966_3943 | 325 |
| 743 | 3300046520 | Ga0495637_0012047 | Ga0495637_0012047_1168_2145 | 325 |
| 744 | 3300046520 | Ga0495637_0023014 | Ga0495637_0023014_355_1332 | 325 |
| 745 | 3300046520 | Ga0495637_0027239 | Ga0495637_0027239_1215_2234 | 325 |
| 746 | 3300046520 | Ga0495637_0087599 | Ga0495637_0087599_143_1135 | 325 |
| 747 | 3300046522 | Ga0495643_0015564 | Ga0495643_0015564_3263_4369 | 325 |
| 748 | 3300046522 | Ga0495643_0019946 | Ga0495643_0019946_2274_3293 | 325 |
| 749 | 3300046523 | Ga0495644_0001290 | Ga0495644_0001290_1277_2254 | 325 |
| 750 | 3300046523 | Ga0495644_0055584 | Ga0495644_0055584_463_1440 | 325 |
| 751 | 3300046524 | Ga0495648_0003121 | Ga0495648_0003121_13119_14096 | 325 |
| 752 | 3300046524 | Ga0495648_0004989 | Ga0495648_0004989_1908_2885 | 325 |
| 753 | 3300046524 | Ga0495648_0007416 | Ga0495648_0007416_7637_8614 | 325 |
| 754 | 3300046524 | Ga0495648_0016666 | Ga0495648_0016666_764_1741 | 325 |
| 755 | 3300046524 | Ga0495648_0019606 | Ga0495648_0019606_1327_2304 | 325 |
| 756 | 3300046524 | Ga0495648_0064662 | Ga0495648_0064662_181_1158 | 325 |
| 757 | 3300046524 | Ga0495648_0171466 | Ga0495648_0171466_53_1072 | 325 |
| 758 | 3300046525 | Ga0495663_0031541 | Ga0495663_0031541_124_1131 | 325 |
| 759 | 3300046526 | Ga0495666_0000043 | Ga0495666_0000043_36082_37059 | 325 |
| 760 | 3300046526 | Ga0495666_0001238 | Ga0495666_0001238_3702_4679 | 325 |
| 761 | 3300046526 | Ga0495666_0005337 | Ga0495666_0005337_1967_2944 | 325 |
| 762 | 3300046526 | Ga0495666_0022824 | Ga0495666_0022824_1953_2930 | 325 |
| 763 | 3300046526 | Ga0495666_0063680 | Ga0495666_0063680_325_1332 | 325 |
| 764 | 3300046528 | Ga0495642_0000019 | Ga0495642_0000019_90177_91154 | 325 |
| 765 | 3300046528 | Ga0495642_0000130 | Ga0495642_0000130_11978_12955 | 325 |
| 766 | 3300046528 | Ga0495642_0000221 | Ga0495642_0000221_23350_24327 | 325 |
| 767 | 3300046530 | Ga0495654_0000088 | Ga0495654_0000088_53732_54709 | 325 |
| 768 | 3300046530 | Ga0495654_0001307 | Ga0495654_0001307_6028_7020 | 325 |
| 769 | 3300046530 | Ga0495654_0004399 | Ga0495654_0004399_3799_4776 | 325 |
| 770 | 3300046530 | Ga0495654_0008378 | Ga0495654_0008378_4694_5671 | 325 |
| 771 | 3300046530 | Ga0495654_0010718 | Ga0495654_0010718_3519_4496 | 325 |
| 772 | 3300046530 | Ga0495654_0012190 | Ga0495654_0012190_717_1694 | 325 |
| 773 | 3300046530 | Ga0495654_0012471 | Ga0495654_0012471_2040_3017 | 325 |
| 774 | 3300046530 | Ga0495654_0013597 | Ga0495654_0013597_443_1420 | 325 |
| 775 | 3300046530 | Ga0495654_0014729 | Ga0495654_0014729_2034_3011 | 325 |
| 776 | 3300046530 | Ga0495654_0017179 | Ga0495654_0017179_1002_2036 | 325 |
| 777 | 3300046530 | Ga0495654_0021708 | Ga0495654_0021708_2013_2990 | 325 |
| 778 | 3300046530 | Ga0495654_0030618 | Ga0495654_0030618_518_1624 | 325 |
| 779 | 3300046530 | Ga0495654_0035971 | Ga0495654_0035971_1277_2254 | 325 |
| 780 | 3300046531 | Ga0495665_0002289 | Ga0495665_0002289_8418_9425 | 325 |
| 781 | 3300046535 | Ga0495586_0007464 | Ga0495586_0007464_3170_4222 | 325 |
| 782 | 3300046536 | Ga0495587_0006912 | Ga0495587_0006912_3626_4603 | 325 |
| 783 | 3300046536 | Ga0495587_0053762 | Ga0495587_0053762_965_2017 | 325 |
| 784 | 3300046537 | Ga0495598_0063608 | Ga0495598_0063608_47_1024 | 325 |
| 785 | 3300046538 | Ga0495609_0001246 | Ga0495609_0001246_15219_16196 | 325 |
| 786 | 3300046538 | Ga0495609_0001924 | Ga0495609_0001924_6318_7295 | 325 |
| 787 | 3300046538 | Ga0495609_0002918 | Ga0495609_0002918_3195_4172 | 325 |
| 788 | 3300046538 | Ga0495609_0006052 | Ga0495609_0006052_2562_3539 | 325 |
| 789 | 3300046538 | Ga0495609_0018581 | Ga0495609_0018581_1860_2837 | 325 |
| 790 | 3300046538 | Ga0495609_0054110 | Ga0495609_0054110_280_1257 | 325 |
| 791 | 3300046542 | Ga0495597_0007011 | Ga0495597_0007011_1856_2833 | 325 |
| 792 | 3300046542 | Ga0495597_0007149 | Ga0495597_0007149_4547_5524 | 325 |
| 793 | 3300046542 | Ga0495597_0011444 | Ga0495597_0011444_3247_4224 | 325 |
| 794 | 3300046542 | Ga0495597_0014156 | Ga0495597_0014156_489_1508 | 325 |
| 795 | 3300046542 | Ga0495597_0041379 | Ga0495597_0041379_376_1353 | 325 |
| 796 | 3300046542 | Ga0495597_0062137 | Ga0495597_0062137_399_1376 | 325 |
| 797 | 3300046542 | Ga0495597_0085661 | Ga0495597_0085661_212_1189 | 325 |
| 798 | 3300046543 | Ga0495645_0037872 | Ga0495645_0037872_2346_3398 | 325 |
| 799 | 3300046557 | Ga0495622_0000347 | Ga0495622_0000347_26521_27498 | 325 |
| 800 | 3300046557 | Ga0495622_0000784 | Ga0495622_0000784_9552_10529 | 325 |
| 801 | 3300046557 | Ga0495622_0014420 | Ga0495622_0014420_2640_3617 | 325 |
| 802 | 3300046557 | Ga0495622_0024060 | Ga0495622_0024060_1374_2351 | 325 |
| 803 | 3300046558 | Ga0495633_0000412 | Ga0495633_0000412_42077_43054 | 325 |
| 804 | 3300046558 | Ga0495633_0001574 | Ga0495633_0001574_10372_11349 | 325 |
| 805 | 3300046558 | Ga0495633_0007856 | Ga0495633_0007856_3073_4179 | 325 |
| 806 | 3300046558 | Ga0495633_0050633 | Ga0495633_0050633_607_1584 | 325 |
| 807 | 3300046615 | Ga0495656_0005448 | Ga0495656_0005448_2951_3928 | 325 |
| 808 | 3300046615 | Ga0495656_0020605 | Ga0495656_0020605_849_1826 | 325 |
| 809 | 3300046615 | Ga0495656_0054045 | Ga0495656_0054045_657_1664 | 325 |
| 810 | 3300046615 | Ga0495656_0059756 | Ga0495656_0059756_126_1103 | 325 |
| 811 | 3300046616 | Ga0495668_0031160 | Ga0495668_0031160_537_1514 | 325 |
| 812 | 3300046616 | Ga0495668_0033454 | Ga0495668_0033454_318_1295 | 325 |
| 813 | 3300046616 | Ga0495668_0204165 | Ga0495668_0204165_40_1032 | 325 |
| 814 | 3300046642 | Ga0495634_0003589 | Ga0495634_0003589_2724_3701 | 325 |
| 815 | 3300046642 | Ga0495634_0031362 | Ga0495634_0031362_633_1640 | 325 |
| 816 | 3300046648 | Ga0495611_0000612 | Ga0495611_0000612_1224_2201 | 325 |
| 817 | 3300046648 | Ga0495611_0005091 | Ga0495611_0005091_4022_4999 | 325 |
| 818 | 3300046648 | Ga0495611_0005145 | Ga0495611_0005145_172_1149 | 325 |
| 819 | 3300046660 | Ga0495625_0001435 | Ga0495625_0001435_13663_14655 | 325 |
| 820 | 3300046660 | Ga0495625_0003496 | Ga0495625_0003496_7179_8213 | 325 |
| 821 | 3300046660 | Ga0495625_0005271 | Ga0495625_0005271_2484_3461 | 325 |
| 822 | 3300046660 | Ga0495625_0006297 | Ga0495625_0006297_6553_7530 | 325 |
| 823 | 3300046660 | Ga0495625_0006992 | Ga0495625_0006992_4817_5794 | 325 |
| 824 | 3300046660 | Ga0495625_0036878 | Ga0495625_0036878_2362_3339 | 325 |
| 825 | 3300046660 | Ga0495625_0047511 | Ga0495625_0047511_713_1732 | 325 |
| 826 | 3300046660 | Ga0495625_0121169 | Ga0495625_0121169_79_1056 | 325 |
| 827 | 3300046660 | Ga0495625_0263251 | Ga0495625_0263251_17_994 | 325 |
| 828 | 3300046663 | Ga0495635_0005441 | Ga0495635_0005441_4165_5142 | 325 |
| 829 | 3300046664 | Ga0495659_0000002 | Ga0495659_0000002_127649_128626 | 325 |
| 830 | 3300046664 | Ga0495659_0003290 | Ga0495659_0003290_1215_2192 | 325 |
| 831 | 3300046665 | Ga0495661_0000036 | Ga0495661_0000036_109745_110743 | 325 |
| 832 | 3300046665 | Ga0495661_0018807 | Ga0495661_0018807_2800_3819 | 325 |
| 833 | 3300046665 | Ga0495661_0020356 | Ga0495661_0020356_1149_2126 | 325 |
| 834 | 3300046665 | Ga0495661_0029068 | Ga0495661_0029068_675_1652 | 325 |
| 835 | 3300046665 | Ga0495661_0070299 | Ga0495661_0070299_627_1604 | 325 |
| 836 | 3300046665 | Ga0495661_0080891 | Ga0495661_0080891_270_1247 | 325 |
| 837 | 3300046674 | Ga0495588_0004882 | Ga0495588_0004882_2462_3439 | 325 |
| 838 | 3300046674 | Ga0495588_0013375 | Ga0495588_0013375_2469_3446 | 325 |
| 839 | 3300046674 | Ga0495588_0018651 | Ga0495588_0018651_783_1835 | 325 |
| 840 | 3300046674 | Ga0495588_0024295 | Ga0495588_0024295_1594_2571 | 325 |
| 841 | 3300046674 | Ga0495588_0047393 | Ga0495588_0047393_904_1911 | 325 |
| 842 | 3300046674 | Ga0495588_0047943 | Ga0495588_0047943_145_1122 | 325 |
| 843 | 3300046679 | Ga0495623_0005212 | Ga0495623_0005212_5765_6742 | 325 |
| 844 | 3300046679 | Ga0495623_0006880 | Ga0495623_0006880_3817_4794 | 325 |
| 845 | 3300046680 | Ga0495646_0006459 | Ga0495646_0006459_4187_5164 | 325 |
| 846 | 3300046681 | Ga0495647_0007179 | Ga0495647_0007179_985_1992 | 325 |
| 847 | 3300046683 | Ga0495658_0001055 | Ga0495658_0001055_2943_3950 | 325 |
| 848 | 3300046684 | Ga0495669_0013407 | Ga0495669_0013407_2014_2991 | 325 |
| 849 | 3300046689 | Ga0495613_0000236 | Ga0495613_0000236_19135_20142 | 325 |
| 850 | 3300046689 | Ga0495613_0027231 | Ga0495613_0027231_2224_3276 | 325 |
| 851 | 3300046689 | Ga0495613_0051427 | Ga0495613_0051427_2022_2999 | 325 |
| 852 | 3300046691 | Ga0495670_0000596 | Ga0495670_0000596_2034_3011 | 325 |
| 853 | 3300046691 | Ga0495670_0001315 | Ga0495670_0001315_6565_7542 | 325 |
| 854 | 3300046691 | Ga0495670_0001962 | Ga0495670_0001962_3893_4870 | 325 |
| 855 | 3300046691 | Ga0495670_0003569 | Ga0495670_0003569_545_1522 | 325 |
| 856 | 3300046691 | Ga0495670_0010342 | Ga0495670_0010342_1573_2550 | 325 |
| 857 | 3300046691 | Ga0495670_0022689 | Ga0495670_0022689_1092_2069 | 325 |
| 858 | 3300046691 | Ga0495670_0024323 | Ga0495670_0024323_814_1791 | 325 |
| 859 | 3300046691 | Ga0495670_0025300 | Ga0495670_0025300_1793_2770 | 325 |
| 860 | 3300046691 | Ga0495670_0087280 | Ga0495670_0087280_11_988 | 325 |
| 861 | 3300046691 | Ga0495670_0114449 | Ga0495670_0114449_44_1051 | 325 |
| 862 | 3300046692 | Ga0495671_0000567 | Ga0495671_0000567_12217_13194 | 325 |
| 863 | 3300046692 | Ga0495671_0000807 | Ga0495671_0000807_10160_11137 | 325 |
| 864 | 3300046692 | Ga0495671_0005047 | Ga0495671_0005047_1510_2496 | 325 |
| 865 | 3300046692 | Ga0495671_0008889 | Ga0495671_0008889_2863_3840 | 325 |
| 866 | 3300046692 | Ga0495671_0021233 | Ga0495671_0021233_298_1275 | 325 |
| 867 | 3300046692 | Ga0495671_0031820 | Ga0495671_0031820_1210_2187 | 325 |
| 868 | 3300046692 | Ga0495671_0048874 | Ga0495671_0048874_231_1208 | 325 |
| 869 | 3300046692 | Ga0495671_0082008 | Ga0495671_0082008_422_1399 | 325 |
| 870 | 3300046694 | Ga0495649_0000013 | Ga0495649_0000013_55595_56572 | 325 |
| 871 | 3300046694 | Ga0495649_0001103 | Ga0495649_0001103_16888_17865 | 325 |
| 872 | 3300046694 | Ga0495649_0003185 | Ga0495649_0003185_9457_10434 | 325 |
| 873 | 3300046694 | Ga0495649_0004478 | Ga0495649_0004478_6051_7028 | 325 |
| 874 | 3300046694 | Ga0495649_0005254 | Ga0495649_0005254_6877_7854 | 325 |
| 875 | 3300046694 | Ga0495649_0019444 | Ga0495649_0019444_1832_2809 | 325 |
| 876 | 3300046694 | Ga0495649_0027772 | Ga0495649_0027772_449_1426 | 325 |
| 877 | 3300046694 | Ga0495649_0031137 | Ga0495649_0031137_1615_2592 | 325 |
| 878 | 3300046694 | Ga0495649_0044517 | Ga0495649_0044517_1037_2014 | 325 |
| 879 | 3300046794 | Ga0495589_0000123 | Ga0495589_0000123_17229_18206 | 325 |
| 880 | 3300046794 | Ga0495589_0000487 | Ga0495589_0000487_25949_26926 | 325 |
| 881 | 3300046794 | Ga0495589_0000650 | Ga0495589_0000650_7510_8616 | 325 |
| 882 | 3300046794 | Ga0495589_0004463 | Ga0495589_0004463_4254_5231 | 325 |
| 883 | 3300046794 | Ga0495589_0007473 | Ga0495589_0007473_3296_4273 | 325 |
| 884 | 3300046794 | Ga0495589_0026177 | Ga0495589_0026177_1902_2879 | 325 |
| 885 | 3300046794 | Ga0495589_0075597 | Ga0495589_0075597_200_1234 | 325 |
| 886 | 3300046794 | Ga0495589_0080729 | Ga0495589_0080729_15_992 | 325 |
| 887 | 3300046794 | Ga0495589_0128884 | Ga0495589_0128884_174_1193 | 325 |
| 888 | 3300046809 | Ga0495600_0019987 | Ga0495600_0019987_1678_2655 | 325 |
| 889 | 3300046809 | Ga0495600_0155638 | Ga0495600_0155638_70_1122 | 325 |
| 890 | 3300046810 | Ga0495660_0002985 | Ga0495660_0002985_2000_2977 | 325 |
| 891 | 3300046810 | Ga0495660_0007274 | Ga0495660_0007274_4990_5967 | 325 |
| 892 | 3300046810 | Ga0495660_0017347 | Ga0495660_0017347_196_1173 | 325 |
| 893 | 3300046810 | Ga0495660_0018155 | Ga0495660_0018155_1769_2746 | 325 |
| 894 | 3300046810 | Ga0495660_0026725 | Ga0495660_0026725_2042_3019 | 325 |
| 895 | 3300046810 | Ga0495660_0051817 | Ga0495660_0051817_499_1476 | 325 |
| 896 | 3300046810 | Ga0495660_0085492 | Ga0495660_0085492_302_1279 | 325 |
| 897 | 3300046810 | Ga0495660_0092293 | Ga0495660_0092293_347_1324 | 325 |
| 898 | 3300047315 | Ga0495581_0002739 | Ga0495581_0002739_4196_5173 | 325 |
| 899 | 3300047315 | Ga0495581_0003500 | Ga0495581_0003500_5660_6667 | 325 |
| 900 | 3300047315 | Ga0495581_0057407 | Ga0495581_0057407_994_2046 | 325 |
| 901 | 3300047317 | Ga0495604_0001667 | Ga0495604_0001667_13431_14408 | 325 |
| 902 | 3300047317 | Ga0495604_0019410 | Ga0495604_0019410_442_1494 | 325 |
| 903 | 3300047317 | Ga0495604_0086223 | Ga0495604_0086223_362_1339 | 325 |
| 904 | 3300047317 | Ga0495604_0233306 | Ga0495604_0233306_69_1076 | 325 |
| 905 | 3300047318 | Ga0495636_0000844 | Ga0495636_0000844_391_1398 | 325 |
| 906 | 3300047318 | Ga0495636_0004395 | Ga0495636_0004395_3474_4451 | 325 |
| 907 | 3300047318 | Ga0495636_0025461 | Ga0495636_0025461_1093_2100 | 325 |
| 908 | 3300047319 | Ga0495674_0006549 | Ga0495674_0006549_7388_8365 | 325 |
| 909 | 3300047320 | Ga0495672_0000773 | Ga0495672_0000773_5405_6382 | 325 |
| 910 | 3300047320 | Ga0495672_0001311 | Ga0495672_0001311_1428_2405 | 325 |
| 911 | 3300047320 | Ga0495672_0003350 | Ga0495672_0003350_11558_12535 | 325 |
| 912 | 3300047320 | Ga0495672_0006601 | Ga0495672_0006601_4017_4994 | 325 |
| 913 | 3300047320 | Ga0495672_0008255 | Ga0495672_0008255_6144_7121 | 325 |
| 914 | 3300047320 | Ga0495672_0012327 | Ga0495672_0012327_3197_4174 | 325 |
| 915 | 3300047320 | Ga0495672_0017001 | Ga0495672_0017001_2658_3635 | 325 |
| 916 | 3300047320 | Ga0495672_0019829 | Ga0495672_0019829_1487_2464 | 325 |
| 917 | 3300047320 | Ga0495672_0076972 | Ga0495672_0076972_451_1428 | 325 |
| 918 | 3300047320 | Ga0495672_0099858 | Ga0495672_0099858_452_1429 | 325 |
| 919 | 3300047320 | Ga0495672_0127192 | Ga0495672_0127192_233_1210 | 325 |
| 920 | 3300047322 | Ga0495680_0001808 | Ga0495680_0001808_11600_12652 | 325 |
| 921 | 3300047322 | Ga0495680_0005161 | Ga0495680_0005161_2657_3634 | 325 |
| 922 | 3300047322 | Ga0495680_0005410 | Ga0495680_0005410_5981_6958 | 325 |
| 923 | 3300047322 | Ga0495680_0031379 | Ga0495680_0031379_3125_4102 | 325 |
| 924 | 3300047322 | Ga0495680_0036454 | Ga0495680_0036454_1598_2575 | 325 |
| 925 | 3300047322 | Ga0495680_0152958 | Ga0495680_0152958_661_1638 | 325 |
| 926 | 3300047323 | Ga0495683_0000010 | Ga0495683_0000010_116882_117874 | 325 |
| 927 | 3300047323 | Ga0495683_0000037 | Ga0495683_0000037_119582_120616 | 325 |
| 928 | 3300047323 | Ga0495683_0000139 | Ga0495683_0000139_24965_25942 | 325 |
| 929 | 3300047323 | Ga0495683_0002618 | Ga0495683_0002618_7720_8697 | 325 |
| 930 | 3300047323 | Ga0495683_0002622 | Ga0495683_0002622_7520_8497 | 325 |
| 931 | 3300047323 | Ga0495683_0010235 | Ga0495683_0010235_3333_4310 | 325 |
| 932 | 3300047323 | Ga0495683_0016449 | Ga0495683_0016449_2508_3485 | 325 |
| 933 | 3300047323 | Ga0495683_0031822 | Ga0495683_0031822_654_1631 | 325 |
| 934 | 3300047323 | Ga0495683_0032697 | Ga0495683_0032697_914_1891 | 325 |
| 935 | 3300047323 | Ga0495683_0036020 | Ga0495683_0036020_160_1137 | 325 |
| 936 | 3300047323 | Ga0495683_0110572 | Ga0495683_0110572_151_1128 | 325 |
| 937 | 3300047443 | Ga0495687_001399 | Ga0495687_001399_6822_7799 | 325 |
| 938 | 3300047443 | Ga0495687_021012 | Ga0495687_021012_1911_2888 | 325 |
| 939 | 3300047443 | Ga0495687_084809 | Ga0495687_084809_242_1219 | 325 |
| 940 | 3300047444 | Ga0495675_0026843 | Ga0495675_0026843_2586_3563 | 325 |
| 941 | 3300047444 | Ga0495675_0051226 | Ga0495675_0051226_1135_2187 | 325 |
| 942 | 3300047445 | Ga0495677_0075961 | Ga0495677_0075961_72_1049 | 325 |
| 943 | 3300047446 | Ga0495679_002402 | Ga0495679_002402_2369_3346 | 325 |
| 944 | 3300047446 | Ga0495679_004407 | Ga0495679_004407_2782_3858 | 325 |
| 945 | 3300047446 | Ga0495679_005202 | Ga0495679_005202_1859_2836 | 325 |
| 946 | 3300047446 | Ga0495679_006403 | Ga0495679_006403_1733_2752 | 325 |
| 947 | 3300047446 | Ga0495679_045246 | Ga0495679_045246_41_1018 | 325 |
| 948 | 3300047447 | Ga0495685_004423 | Ga0495685_004423_3338_4315 | 325 |
| 949 | 3300047447 | Ga0495685_024352 | Ga0495685_024352_1049_2026 | 325 |
| 950 | 3300047469 | Ga0495673_0000084 | Ga0495673_0000084_120877_121923 | 325 |
| 951 | 3300047469 | Ga0495673_0000093 | Ga0495673_0000093_69907_70941 | 325 |
| 952 | 3300047469 | Ga0495673_0000434 | Ga0495673_0000434_31060_32037 | 325 |
| 953 | 3300047469 | Ga0495673_0001694 | Ga0495673_0001694_10665_11642 | 325 |
| 954 | 3300047469 | Ga0495673_0003443 | Ga0495673_0003443_351_1328 | 325 |
| 955 | 3300047469 | Ga0495673_0005152 | Ga0495673_0005152_6953_7930 | 325 |
| 956 | 3300047469 | Ga0495673_0010917 | Ga0495673_0010917_82_1059 | 325 |
| 957 | 3300047469 | Ga0495673_0014710 | Ga0495673_0014710_778_1755 | 325 |
| 958 | 3300047469 | Ga0495673_0024507 | Ga0495673_0024507_584_1561 | 325 |
| 959 | 3300047469 | Ga0495673_0025370 | Ga0495673_0025370_462_1439 | 325 |
| 960 | 3300047469 | Ga0495673_0034996 | Ga0495673_0034996_447_1424 | 325 |
| 961 | 3300047470 | Ga0495681_0000370 | Ga0495681_0000370_26049_27026 | 325 |
| 962 | 3300047470 | Ga0495681_0001251 | Ga0495681_0001251_7427_8404 | 325 |
| 963 | 3300047470 | Ga0495681_0001487 | Ga0495681_0001487_12489_13466 | 325 |
| 964 | 3300047470 | Ga0495681_0001828 | Ga0495681_0001828_8033_9010 | 325 |
| 965 | 3300047470 | Ga0495681_0003228 | Ga0495681_0003228_7749_8726 | 325 |
| 966 | 3300047470 | Ga0495681_0007652 | Ga0495681_0007652_1745_2779 | 325 |
| 967 | 3300047470 | Ga0495681_0016633 | Ga0495681_0016633_1754_2731 | 325 |
| 968 | 3300047470 | Ga0495681_0065108 | Ga0495681_0065108_215_1192 | 325 |
| 969 | 3300047471 | Ga0495684_0018688 | Ga0495684_0018688_221_1198 | 325 |
| 970 | 3300047472 | Ga0495686_0000291 | Ga0495686_0000291_4088_5065 | 325 |
| 971 | 3300047472 | Ga0495686_0084186 | Ga0495686_0084186_64_1041 | 325 |
| 972 | 3300047673 | Ga0495593_0000510 | Ga0495593_0000510_20172_21179 | 325 |
| 973 | 3300047673 | Ga0495593_0001007 | Ga0495593_0001007_5081_6058 | 325 |
| 974 | 3300047673 | Ga0495593_0003372 | Ga0495593_0003372_2297_3274 | 325 |
| 975 | 3300047673 | Ga0495593_0034317 | Ga0495593_0034317_844_1821 | 325 |
| 976 | 3300048091 | Ga0495626_0000031 | Ga0495626_0000031_143743_144720 | 325 |
| 977 | 3300048091 | Ga0495626_0000326 | Ga0495626_0000326_45171_46148 | 325 |
| 978 | 3300048091 | Ga0495626_0000340 | Ga0495626_0000340_5810_6829 | 325 |
| 979 | 3300048091 | Ga0495626_0000373 | Ga0495626_0000373_34253_35230 | 325 |
| 980 | 3300048091 | Ga0495626_0000631 | Ga0495626_0000631_9343_10320 | 325 |
| 981 | 3300048091 | Ga0495626_0002579 | Ga0495626_0002579_7575_8552 | 325 |
| 982 | 3300048091 | Ga0495626_0003819 | Ga0495626_0003819_6926_7903 | 325 |
| 983 | 3300048091 | Ga0495626_0004207 | Ga0495626_0004207_6004_6981 | 325 |
| 984 | 3300048091 | Ga0495626_0025179 | Ga0495626_0025179_1283_2260 | 325 |
| 985 | 3300048903 | Ga0496100_0000632 | Ga0496100_0000632_11685_12692 | 325 |
| 986 | 3300048904 | Ga0496101_0003736 | Ga0496101_0003736_7666_8673 | 325 |
| 987 | 3300048905 | Ga0496102_0000052 | Ga0496102_0000052_163699_164676 | 325 |
| 988 | 3300048905 | Ga0496102_0005098 | Ga0496102_0005098_6946_7953 | 325 |
| 989 | 3300048905 | Ga0496102_0009276 | Ga0496102_0009276_2016_3023 | 325 |
| 990 | 3300048905 | Ga0496102_0182413 | Ga0496102_0182413_734_1777 | 325 |
| 991 | 3300048905 | Ga0496102_0198595 | Ga0496102_0198595_749_1756 | 325 |
| 992 | 3300048906 | Ga0496103_0003881 | Ga0496103_0003881_1701_2678 | 325 |
| 993 | 3300048906 | Ga0496103_0009805 | Ga0496103_0009805_3533_4540 | 325 |
| 994 | 3300048907 | Ga0496104_0009987 | Ga0496104_0009987_3882_4889 | 325 |
| 995 | 3300048907 | Ga0496104_0013732 | Ga0496104_0013732_3586_4593 | 325 |
| 996 | 3300048907 | Ga0496104_0044933 | Ga0496104_0044933_3034_4107 | 325 |
| 997 | 3300048908 | Ga0496105_0004032 | Ga0496105_0004032_5892_6899 | 325 |
| 998 | 3300048908 | Ga0496105_0067673 | Ga0496105_0067673_853_1830 | 325 |
| 999 | 3300048908 | Ga0496105_0096306 | Ga0496105_0096306_371_1444 | 325 |
| 1000 | 3300048909 | Ga0496106_0222824 | Ga0496106_0222824_152_1159 | 325 |
| 1001 | 3300048910 | Ga0496107_0000431 | Ga0496107_0000431_497_1570 | 325 |
| 1002 | 3300048910 | Ga0496107_0021707 | Ga0496107_0021707_153_1160 | 325 |
| 1003 | 3300048910 | Ga0496107_0037617 | Ga0496107_0037617_129_1136 | 325 |
| 1004 | 3300048910 | Ga0496107_0049341 | Ga0496107_0049341_575_1582 | 325 |
| 1005 | 3300048910 | Ga0496107_0201487 | Ga0496107_0201487_358_1365 | 325 |
| 1006 | 3300048911 | Ga0496108_0058039 | Ga0496108_0058039_306_1313 | 325 |
| 1007 | 3300048911 | Ga0496108_0097493 | Ga0496108_0097493_818_1825 | 325 |
| 1008 | 3300048911 | Ga0496108_0281780 | Ga0496108_0281780_45_1052 | 325 |
| 1009 | 3300048912 | Ga0496109_0045278 | Ga0496109_0045278_1575_2582 | 325 |
| 1010 | 3300048912 | Ga0496109_0072402 | Ga0496109_0072402_911_1984 | 325 |
| 1011 | 3300048912 | Ga0496109_0448740 | Ga0496109_0448740_91_1098 | 325 |
| 1012 | 3300048913 | Ga0496110_0230232 | Ga0496110_0230232_340_1317 | 325 |
| 1013 | 3300048914 | Ga0496111_0008007 | Ga0496111_0008007_2112_3119 | 325 |
| 1014 | 3300048915 | Ga0496112_0026077 | Ga0496112_0026077_3835_4842 | 325 |
| 1015 | 3300048915 | Ga0496112_0060333 | Ga0496112_0060333_2525_3532 | 325 |
| 1016 | 3300048917 | Ga0496114_0003041 | Ga0496114_0003041_7345_8418 | 325 |
| 1017 | 3300048917 | Ga0496114_0004340 | Ga0496114_0004340_1183_2190 | 325 |
| 1018 | 3300048917 | Ga0496114_0290109 | Ga0496114_0290109_152_1159 | 325 |
| 1019 | 3300048917 | Ga0496114_0464991 | Ga0496114_0464991_47_1054 | 325 |
| 1020 | 3300048918 | Ga0496115_0002227 | Ga0496115_0002227_134_1141 | 325 |
| 1021 | 3300048918 | Ga0496115_0055709 | Ga0496115_0055709_594_1601 | 325 |
| 1022 | 3300048918 | Ga0496115_0083452 | Ga0496115_0083452_1271_2248 | 325 |
| 1023 | 3300048918 | Ga0496115_0123213 | Ga0496115_0123213_566_1639 | 325 |
| 1024 | 3300048918 | Ga0496115_0219732 | Ga0496115_0219732_353_1360 | 325 |
| 1025 | 3300048919 | Ga0496116_0000475 | Ga0496116_0000475_47284_48261 | 325 |
| 1026 | 3300048919 | Ga0496116_0011151 | Ga0496116_0011151_2528_3505 | 325 |
| 1027 | 3300048920 | Ga0496117_0011375 | Ga0496117_0011375_3924_4901 | 325 |
| 1028 | 3300048920 | Ga0496117_0048512 | Ga0496117_0048512_1094_2071 | 325 |
| 1029 | 3300048920 | Ga0496117_0051342 | Ga0496117_0051342_621_1598 | 325 |
| 1030 | 3300048920 | Ga0496117_0087895 | Ga0496117_0087895_652_1629 | 325 |
| 1031 | 3300048920 | Ga0496117_0219865 | Ga0496117_0219865_15_1007 | 325 |
| 1032 | 3300048921 | Ga0496118_0004037 | Ga0496118_0004037_5139_6146 | 325 |
| 1033 | 3300048921 | Ga0496118_0009946 | Ga0496118_0009946_2476_3453 | 325 |
| 1034 | 3300048921 | Ga0496118_0064052 | Ga0496118_0064052_646_1623 | 325 |
| 1035 | 3300048921 | Ga0496118_0096553 | Ga0496118_0096553_412_1389 | 325 |
| 1036 | 3300048922 | Ga0496119_0000018 | Ga0496119_0000018_139806_140813 | 325 |
| 1037 | 3300048922 | Ga0496119_0085359 | Ga0496119_0085359_178_1155 | 325 |
| 1038 | 3300048923 | Ga0496120_0000002 | Ga0496120_0000002_195363_196370 | 325 |
| 1039 | 3300048924 | Ga0496121_0005286 | Ga0496121_0005286_6070_7077 | 325 |
| 1040 | 3300048924 | Ga0496121_0030892 | Ga0496121_0030892_2968_3945 | 325 |
| 1041 | 3300048924 | Ga0496121_0032500 | Ga0496121_0032500_441_1418 | 325 |
| 1042 | 3300048924 | Ga0496121_0051984 | Ga0496121_0051984_655_1632 | 325 |
| 1043 | 3300048924 | Ga0496121_0179013 | Ga0496121_0179013_166_1143 | 325 |
| 1044 | 3300048925 | Ga0496122_0002729 | Ga0496122_0002729_11970_12947 | 325 |
| 1045 | 3300048925 | Ga0496122_0157125 | Ga0496122_0157125_304_1281 | 325 |
| 1046 | 3300048926 | Ga0496123_0015383 | Ga0496123_0015383_628_1605 | 325 |
| 1047 | 3300048927 | Ga0496124_0012073 | Ga0496124_0012073_2597_3574 | 325 |
| 1048 | 3300048927 | Ga0496124_0029049 | Ga0496124_0029049_1707_2684 | 325 |
| 1049 | 3300048927 | Ga0496124_0048559 | Ga0496124_0048559_1097_2131 | 325 |
| 1050 | 3300048927 | Ga0496124_0091321 | Ga0496124_0091321_894_1871 | 325 |
| 1051 | 3300048928 | Ga0496125_0004944 | Ga0496125_0004944_10343_11335 | 325 |
| 1052 | 3300048928 | Ga0496125_0009232 | Ga0496125_0009232_3810_4787 | 325 |
| 1053 | 3300048928 | Ga0496125_0038439 | Ga0496125_0038439_638_1672 | 325 |
| 1054 | 3300048928 | Ga0496125_0072216 | Ga0496125_0072216_129_1106 | 325 |
| 1055 | 3300048929 | Ga0496126_0000160 | Ga0496126_0000160_5424_6431 | 325 |
| 1056 | 3300048929 | Ga0496126_0075946 | Ga0496126_0075946_25_1002 | 325 |
| 1057 | 3300048929 | Ga0496126_0099647 | Ga0496126_0099647_1211_2188 | 325 |
| 1058 | 3300048929 | Ga0496126_0270542 | Ga0496126_0270542_168_1145 | 325 |
| 1059 | 3300049459 | Ga0495678_000420 | Ga0495678_000420_24546_25523 | 325 |
| 1060 | 3300049459 | Ga0495678_001193 | Ga0495678_001193_12703_13680 | 325 |
| 1061 | 3300049459 | Ga0495678_004789 | Ga0495678_004789_150_1127 | 325 |
| 1062 | 3300049459 | Ga0495678_019168 | Ga0495678_019168_1362_2360 | 325 |
| 1063 | 3300049459 | Ga0495678_041226 | Ga0495678_041226_282_1301 | 325 |
| 1064 | 3300049459 | Ga0495678_063834 | Ga0495678_063834_147_1124 | 325 |
| 1065 | 3300049460 | Ga0495682_0004619 | Ga0495682_0004619_4026_5003 | 325 |
| 1066 | 3300049460 | Ga0495682_0010190 | Ga0495682_0010190_955_1932 | 325 |
| 1067 | 3300049460 | Ga0495682_0035001 | Ga0495682_0035001_227_1204 | 325 |
| 1068 | 3300049460 | Ga0495682_0041039 | Ga0495682_0041039_136_1113 | 325 |
| 1069 | 3300049568 | Ga0501031_0022726 | Ga0501031_0022726_2771_3778 | 325 |
| 1070 | 3300049568 | Ga0501031_0067538 | Ga0501031_0067538_913_1920 | 325 |
| 1071 | 3300049569 | Ga0501032_0055078 | Ga0501032_0055078_1318_2325 | 325 |
| 1072 | 3300049569 | Ga0501032_0110489 | Ga0501032_0110489_768_1760 | 325 |
| 1073 | 3300049570 | Ga0501033_0009352 | Ga0501033_0009352_476_1495 | 325 |
| 1074 | 3300049572 | Ga0501036_0020608 | Ga0501036_0020608_2464_3471 | 325 |
| 1075 | 3300049572 | Ga0501036_0074660 | Ga0501036_0074660_302_1309 | 325 |
| 1076 | 3300049572 | Ga0501036_0082793 | Ga0501036_0082793_711_1718 | 325 |
| 1077 | 3300049572 | Ga0501036_0103320 | Ga0501036_0103320_14_1021 | 325 |
| 1078 | 3300049572 | Ga0501036_0341208 | Ga0501036_0341208_115_1122 | 325 |
| 1079 | 3300049574 | Ga0501038_0035894 | Ga0501038_0035894_1423_2430 | 325 |
| 1080 | 3300049574 | Ga0501038_0099837 | Ga0501038_0099837_1111_2118 | 325 |
| 1081 | 3300049574 | Ga0501038_0132179 | Ga0501038_0132179_896_1903 | 325 |
| 1082 | 3300049575 | Ga0501039_0013549 | Ga0501039_0013549_4447_5454 | 325 |
| 1083 | 3300049575 | Ga0501039_0036029 | Ga0501039_0036029_405_1418 | 325 |
| 1084 | 3300049575 | Ga0501039_0081884 | Ga0501039_0081884_1374_2384 | 325 |
| 1085 | 3300049575 | Ga0501039_0243905 | Ga0501039_0243905_372_1379 | 325 |
| 1086 | 3300049576 | Ga0501040_0036124 | Ga0501040_0036124_1333_2340 | 325 |
| 1087 | 3300049576 | Ga0501040_0066010 | Ga0501040_0066010_1107_2114 | 325 |
| 1088 | 3300049576 | Ga0501040_0091306 | Ga0501040_0091306_485_1492 | 325 |
| 1089 | 3300049576 | Ga0501040_0105448 | Ga0501040_0105448_430_1437 | 325 |
| 1090 | 3300049577 | Ga0501041_0006968 | Ga0501041_0006968_5054_6061 | 325 |
| 1091 | 3300049577 | Ga0501041_0054670 | Ga0501041_0054670_795_1802 | 325 |
| 1092 | 3300049577 | Ga0501041_0129490 | Ga0501041_0129490_363_1370 | 325 |
| 1093 | 3300049578 | Ga0501042_0045261 | Ga0501042_0045261_1808_2815 | 325 |
| 1094 | 3300049578 | Ga0501042_0071986 | Ga0501042_0071986_1178_2185 | 325 |
| 1095 | 3300049579 | Ga0501043_0044829 | Ga0501043_0044829_1989_2996 | 325 |
| 1096 | 3300049580 | Ga0501046_0019335 | Ga0501046_0019335_4233_5240 | 325 |
| 1097 | 3300049580 | Ga0501046_0058686 | Ga0501046_0058686_322_1329 | 325 |
| 1098 | 3300049581 | Ga0501047_0126148 | Ga0501047_0126148_1246_2256 | 325 |
| 1099 | 3300049582 | Ga0501048_0022275 | Ga0501048_0022275_2026_3033 | 325 |
| 1100 | 3300049582 | Ga0501048_0066266 | Ga0501048_0066266_388_1395 | 325 |
| 1101 | 3300049586 | Ga0501070_0008224 | Ga0501070_0008224_6216_7250 | 325 |
| 1102 | 3300049587 | Ga0501071_0004660 | Ga0501071_0004660_2803_3810 | 325 |
| 1103 | 3300049587 | Ga0501071_0021688 | Ga0501071_0021688_2691_3698 | 325 |
| 1104 | 3300049587 | Ga0501071_0022166 | Ga0501071_0022166_2044_3096 | 325 |
| 1105 | 3300049587 | Ga0501071_0062720 | Ga0501071_0062720_409_1416 | 325 |
| 1106 | 3300049587 | Ga0501071_0115800 | Ga0501071_0115800_802_1812 | 325 |
| 1107 | 3300049587 | Ga0501071_0122273 | Ga0501071_0122273_432_1439 | 325 |
| 1108 | 3300049588 | Ga0501072_0005876 | Ga0501072_0005876_2731_3783 | 325 |
| 1109 | 3300049588 | Ga0501072_0012869 | Ga0501072_0012869_5362_6369 | 325 |
| 1110 | 3300049588 | Ga0501072_0070658 | Ga0501072_0070658_344_1351 | 325 |
| 1111 | 3300049588 | Ga0501072_0159163 | Ga0501072_0159163_153_1160 | 325 |
| 1112 | 3300049590 | Ga0501074_0071296 | Ga0501074_0071296_1401_2408 | 325 |
| 1113 | 3300049590 | Ga0501074_0081873 | Ga0501074_0081873_33_1040 | 325 |
| 1114 | 3300049590 | Ga0501074_0288038 | Ga0501074_0288038_86_1138 | 325 |
| 1115 | 3300049591 | Ga0501075_0022895 | Ga0501075_0022895_110_1162 | 325 |
| 1116 | 3300049591 | Ga0501075_0047310 | Ga0501075_0047310_1294_2301 | 325 |
| 1117 | 3300049591 | Ga0501075_0075481 | Ga0501075_0075481_791_1798 | 325 |
| 1118 | 3300049591 | Ga0501075_0220559 | Ga0501075_0220559_42_1049 | 325 |
| 1119 | 3300049591 | Ga0501075_0238452 | Ga0501075_0238452_267_1274 | 325 |
| 1120 | 3300049592 | Ga0501076_0024551 | Ga0501076_0024551_2176_3183 | 325 |
| 1121 | 3300049592 | Ga0501076_0025793 | Ga0501076_0025793_1247_2299 | 325 |
| 1122 | 3300049592 | Ga0501076_0081163 | Ga0501076_0081163_475_1482 | 325 |
| 1123 | 3300049593 | Ga0501077_0018855 | Ga0501077_0018855_527_1534 | 325 |
| 1124 | 3300049593 | Ga0501077_0193708 | Ga0501077_0193708_125_1132 | 325 |
| 1125 | 3300049741 | Ga0501079_0013491 | Ga0501079_0013491_1468_2475 | 325 |
| 1126 | 3300049741 | Ga0501079_0037890 | Ga0501079_0037890_617_1624 | 325 |
| 1127 | 3300049741 | Ga0501079_0039754 | Ga0501079_0039754_2138_3145 | 325 |
| 1128 | 3300049741 | Ga0501079_0167682 | Ga0501079_0167682_526_1533 | 325 |
| 1129 | 3300049742 | Ga0501080_0109673 | Ga0501080_0109673_1161_2168 | 325 |
| 1130 | 3300049742 | Ga0501080_0165041 | Ga0501080_0165041_234_1241 | 325 |
| 1131 | 3300049742 | Ga0501080_0230764 | Ga0501080_0230764_131_1183 | 325 |
| 1132 | 3300049743 | Ga0501081_0018089 | Ga0501081_0018089_1482_2489 | 325 |
| 1133 | 3300049743 | Ga0501081_0036980 | Ga0501081_0036980_2248_3255 | 325 |
| 1134 | 3300049743 | Ga0501081_0191991 | Ga0501081_0191991_76_1083 | 325 |
| 1135 | 3300049743 | Ga0501081_0230238 | Ga0501081_0230238_205_1257 | 325 |
| 1136 | 3300049744 | Ga0501083_0071373 | Ga0501083_0071373_342_1349 | 325 |
| 1137 | 3300049744 | Ga0501083_0212830 | Ga0501083_0212830_202_1209 | 325 |
| 1138 | 3300049758 | Ga0501241_000047 | Ga0501241_000047_4358_5341 | 325 |
| 1139 | 3300049822 | Ga0501035_0056359 | Ga0501035_0056359_1852_2859 | 325 |
| 1140 | 3300049823 | Ga0501044_0000106 | Ga0501044_0000106_28295_29314 | 325 |
| 1141 | 3300049823 | Ga0501044_0231263 | Ga0501044_0231263_451_1488 | 325 |
| 1142 | 3300049824 | Ga0501045_0017591 | Ga0501045_0017591_1823_2830 | 325 |
| 1143 | 3300049824 | Ga0501045_0123072 | Ga0501045_0123072_496_1503 | 325 |
| 1144 | 3300049824 | Ga0501045_0353652 | Ga0501045_0353652_11_1063 | 325 |
| 1145 | 3300050489 | nmdc:mga03683_53567_c1 | nmdc:mga03683_53567_c1_318_1295 | 325 |
| 1146 | 3300050491 | nmdc:mga00v17_36197_c1 | nmdc:mga00v17_36197_c1_1447_2424 | 325 |
| 1147 | 3300050492 | nmdc:mga0yw44_293096_c1 | nmdc:mga0yw44_293096_c1_72_1079 | 325 |
| 1148 | 3300050507 | nmdc:mga05p37_114181_c1 | nmdc:mga05p37_114181_c1_1893_2900 | 325 |
| 1149 | 3300050507 | nmdc:mga05p37_15089_c1 | nmdc:mga05p37_15089_c1_5665_6684 | 325 |
| 1150 | 3300050507 | nmdc:mga05p37_78729_c1 | nmdc:mga05p37_78729_c1_937_1968 | 325 |
| 1151 | 3300050508 | nmdc:mga09592_65524_c1 | nmdc:mga09592_65524_c1_1807_2814 | 325 |
| 1152 | 3300050510 | nmdc:mga06r32_54035_c1 | nmdc:mga06r32_54035_c1_312_1319 | 325 |
| 1153 | 3300050510 | nmdc:mga06r32_6675_c1 | nmdc:mga06r32_6675_c1_3914_4921 | 325 |
| 1154 | 3300050511 | nmdc:mga08y16_44676_c1 | nmdc:mga08y16_44676_c1_2880_3887 | 325 |
| 1155 | 3300050512 | nmdc:mga0n895_10036_c1 | nmdc:mga0n895_10036_c1_7060_8067 | 325 |
| 1156 | 3300050513 | nmdc:mga0rr50_8552_c1 | nmdc:mga0rr50_8552_c1_591_1598 | 325 |
| 1157 | 3300050515 | nmdc:mga0a205_78623_c1 | nmdc:mga0a205_78623_c1_43_1050 | 325 |
| 1158 | 3300050515 | nmdc:mga0a205_93022_c1 | nmdc:mga0a205_93022_c1_1182_2189 | 325 |
| 1159 | 3300050516 | nmdc:mga0sz30_7158_c2 | nmdc:mga0sz30_7158_c2_1215_2192 | 325 |
| 1160 | 3300053077 | Ga0495601_0000744 | Ga0495601_0000744_10688_11695 | 325 |
| 1161 | 3300053078 | Ga0495612_0032116 | Ga0495612_0032116_187_1194 | 325 |
| 1162 | 3300053083 | Ga0495655_0001249 | Ga0495655_0001249_768_1775 | 325 |
| 1163 | 3300053085 | Ga0495619_0006422 | Ga0495619_0006422_6010_7017 | 325 |
| 1164 | 3300053139 | Ga0500568_0023689 | Ga0500568_0023689_924_1901 | 325 |
| 1165 | 3300054114 | Ga0501084_0013266 | Ga0501084_0013266_1745_2752 | 325 |
| 1166 | 3300054114 | Ga0501084_0025016 | Ga0501084_0025016_935_1942 | 325 |
| 1167 | 3300054114 | Ga0501084_0139314 | Ga0501084_0139314_294_1301 | 325 |
| 1168 | 3300060353 | Ga0501082_0000007 | Ga0501082_0000007_23571_24584 | 325 |
| 1169 | 3300060353 | Ga0501082_0035720 | Ga0501082_0035720_2920_3927 | 325 |
| 1170 | 3300060353 | Ga0501082_0185998 | Ga0501082_0185998_567_1574 | 325 |
| 1171 | 3300061734 | Ga0530510_0011063 | Ga0530510_0011063_1286_2293 | 325 |
| 1172 | 3300061734 | Ga0530510_0014173 | Ga0530510_0014173_174_1181 | 325 |
| 1173 | 3300061734 | Ga0530510_0115302 | Ga0530510_0115302_405_1412 | 325 |
| 1174 | 3300061734 | Ga0530510_0142524 | Ga0530510_0142524_507_1514 | 325 |
| 1175 | iso_pu_bacteria | 2841917233 | 2841921706 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5u4q-assembly1.cif.gz_A | 1.5 angstrom resolution crystal structure of nad-dependent epimerase from klebsiella pneumoniae in complex with nad. | 0.9307 | 1 | 325 |
| 6zlj-assembly1.cif.gz_B-2 | crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad | 0.9285 | 1 | 323 |
| 6zla-assembly1.cif.gz_A | crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with nad | 0.9281 | 1 | 324 |
| 6zlj-assembly1.cif.gz_B-2 | crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and nad | 0.9257 | 1 | 323 |
| 6zlk-assembly2.cif.gz_B | equilibrium structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid/udp-galacturonic acid and nad | 0.9256 | 1 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0DDZ4_1_298_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9468 | 37 | 325 | 3.40.50.720 |
| af_K7VFN4_114_450_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9439 | 1 | 323 | 3.40.50.720 |
| af_K7VFN4_114_450_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9354 | 1 | 323 | 3.40.50.720 |
| 5u4qA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9274 | 1 | 325 | 3.40.50.720 |
| 5u4qA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9244 | 1 | 325 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523M0X6-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.98 | 1 | 127 |
|
| AF-A0A352NRJ6-F1-model_v4 | NAD-dependent epimerase | 0.9797 | 29 | 235 |
|
| AF-A0A382S169-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.979 | 81 | 225 |
|
| AF-A0A849W6Q5-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9786 | 1 | 324 |
|
| AF-V7FNM4-F1-model_v4 | NAD dependent epimerase/dehydratase | 0.9784 | 2 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar