F491165

General Info

Members Datasets Scaffolds Average Seq Length
1171 965 438 238

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100111903|Ga0070694_1001119033
Length 263
Sequence MTKETITVAEVFGVTIQGEGPLIGRPTIFVRTGGCDFRCTWCDSMHAVDPKHRPEWEELTARQIMVRIGDLLGVNAGAVNRDVLITLSGGNPALQPMDELLRLGRVSGFKFAMETQGSVCREWFEHLDYLILSPKGPSANVPMHPLKLGNSLDDCINAVRRGDGIRRDVCFKIVIFNDADYDFARALSREFIYVPMYLQVGTDQLPAEGERAWPGIISREQALSQNILDRMRWLIGKVRDDRWFDVTVLPQLHVLLWGDQKGV

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
12 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
17 2512875024 Mesorhizobium loti R88b Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
32 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681786 Brucella suis 92/29 Isolate Unclassified
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
61 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
62 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
63 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
64 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
65 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
66 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
67 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
68 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
69 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
70 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
71 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
72 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
73 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
74 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
75 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
76 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
77 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
78 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
79 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
80 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
81 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
82 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
83 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
84 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
85 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
86 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
87 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
88 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
89 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
90 2643221557 Ensifer sp. Root558 Isolate Unclassified
91 2643221558 Rhizobium sp. Root149 Isolate Unclassified
92 2643221599 Rhizobium sp. Root708 Isolate Unclassified
93 2643221607 Rhizobium sp. Root73 Isolate Unclassified
94 2643221610 Ensifer sp. Root74 Isolate Unclassified
95 2643221618 Ensifer sp. Root231 Isolate Unclassified
96 2643221626 Ensifer sp. Root31 Isolate Unclassified
97 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
98 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
99 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
100 2643221655 Ensifer sp. Root1252 Isolate Unclassified
101 2643221659 Ensifer sp. Root127 Isolate Unclassified
102 2643221668 Ensifer sp. Root423 Isolate Unclassified
103 2643221675 Ensifer sp. Root1298 Isolate Unclassified
104 2643221680 Ensifer sp. Root1312 Isolate Unclassified
105 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
106 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
107 2643221712 Ensifer sp. Root258 Isolate Unclassified
108 2643221723 Ensifer sp. Root278 Isolate Unclassified
109 2643221726 Ensifer sp. Root954 Isolate Unclassified
110 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
111 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
112 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
113 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
114 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
115 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
116 2718217927 Rhizobium sp. N324 Isolate Nodule
117 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
118 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
119 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
120 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
121 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
122 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
123 2718218365 Rhizobium sp. N731 Isolate Nodule
124 2718218423 Rhizobium sp. N941 Isolate Nodule
125 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
126 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
127 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
128 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
129 2721755809 Rhizobium sp. N541 Isolate Nodule
130 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
131 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
132 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
133 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
134 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
135 2728369397 Rhizobium sp. N1314 Isolate Nodule
136 2738541293 Rhizobium sp. GV031 Isolate Unclassified
137 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
138 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
139 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
140 2773857925 Microvirga vignae BR3299 Isolate Unclassified
141 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
142 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
143 2791355256 Rhizobium sp. M10 Isolate Nodule
144 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
145 2791355260 Rhizobium sp. L9 Isolate Nodule
146 2791355261 Rhizobium sp. J15 Isolate Nodule
147 2791355262 Rhizobium sp. M1 Isolate Nodule
148 2791355263 Rhizobium chutanense C5 Isolate Nodule
149 2791355265 Rhizobium sp. H4 Isolate Nodule
150 2791355266 Rhizobium sp. L43 Isolate Nodule
151 2791355267 Rhizobium sp. L18 Isolate Nodule
152 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
153 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
154 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
155 2802429633 Rhizobium anhuiense J3 Isolate Nodule
156 2802429634 Rhizobium anhuiense S10 Isolate Nodule
157 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
158 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
159 2802429637 Rhizobium anhuiense C15 Isolate Nodule
160 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
161 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
162 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
163 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
164 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
165 2838048938 Rhizobium pisi 27/80 Isolate Nodule
166 2838061910 Rhizobium phaseoli L15 Isolate Nodule
167 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
168 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
169 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
170 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
171 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
172 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
173 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
174 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
175 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
176 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
177 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
178 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
179 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
180 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
181 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
182 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
183 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
184 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
185 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
186 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
187 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
188 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
189 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
190 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
191 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
192 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
193 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
194 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
195 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
196 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
197 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
198 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
199 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
200 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
201 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
202 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
203 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
204 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
205 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
206 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
207 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
208 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
209 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
210 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
211 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
212 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
213 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
214 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
215 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
216 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
217 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
218 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
219 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
220 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
221 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
222 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
223 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
224 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
225 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
226 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
227 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
228 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
229 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
230 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
231 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
232 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
233 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
234 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
235 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
236 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
237 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
238 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
239 2844163670 Ensifer sp. 1H6 Isolate Unclassified
240 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
241 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
242 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
243 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
244 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
245 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
246 2854911287 Brucella lupini LUP21 Isolate Unclassified
247 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
248 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
249 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
250 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
251 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
252 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
253 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
254 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
255 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
256 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
257 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
258 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
259 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
260 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
261 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
262 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
263 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
264 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
265 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
266 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
267 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
268 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
269 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
270 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
271 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
272 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
273 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
274 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
275 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
276 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
277 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
278 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
279 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
280 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
281 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
282 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
283 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
284 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
285 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
286 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
287 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
288 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
289 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
290 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
291 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
292 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
293 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
294 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
295 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
296 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
297 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
298 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
299 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
300 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
301 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
302 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
303 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
304 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
305 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
306 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
307 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
308 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
309 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
310 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
311 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
312 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
313 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
314 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
315 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
316 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
317 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
318 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
319 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
320 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
321 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
322 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
323 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
324 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
325 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
326 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
327 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
328 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
329 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
330 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
331 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
332 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
333 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
334 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
335 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
336 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
337 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
338 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
339 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
340 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
341 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
342 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
343 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
344 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
345 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
346 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
347 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
348 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
349 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
350 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
351 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
352 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
353 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
354 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
355 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
356 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
357 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
358 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
359 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
360 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
361 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
362 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
363 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
364 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
365 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
366 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
367 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
368 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
369 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
370 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
371 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
372 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
373 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
374 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
375 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
376 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
377 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
378 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
379 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
380 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
381 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
382 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
383 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
384 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
385 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
386 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
387 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
388 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
389 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
390 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
391 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
392 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
393 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
394 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
395 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
396 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
397 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
398 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
399 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
400 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
401 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
402 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
403 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
404 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
405 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
406 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
407 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
408 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
409 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
410 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
411 2933599457 Rhizobium phaseoli M3 Isolate Nodule
412 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
413 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
414 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
415 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
416 2936381700 Rhizobium chutanense C16 Isolate Unclassified
417 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
418 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
419 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
420 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
421 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
422 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
423 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
424 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
425 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
426 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
427 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
428 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
429 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
430 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
431 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
432 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
433 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
434 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
435 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
436 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
437 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
438 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
439 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
440 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
441 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
442 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
443 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
444 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
445 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
446 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
447 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
448 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
449 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
450 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
451 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
452 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
453 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
454 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
455 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
456 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
457 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
458 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
459 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
460 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
461 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
462 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
463 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
464 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
465 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
466 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
467 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
468 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
469 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
470 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
471 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
472 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
473 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
474 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
475 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
476 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
477 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
478 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
479 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
480 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
481 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
482 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
483 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
484 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
485 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
486 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
487 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
488 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
489 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
490 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
491 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
492 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
493 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
494 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
495 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
496 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
497 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
498 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
499 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
500 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
501 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
502 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
503 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
504 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
505 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
506 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
507 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
508 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
509 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
510 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
511 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
512 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
513 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
514 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
515 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
516 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
517 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
518 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
519 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
520 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
521 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
522 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
523 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
524 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
525 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
526 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
527 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
528 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
529 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
530 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
531 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
532 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
533 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
534 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
535 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
536 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
537 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
538 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
539 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
540 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
541 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
542 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
543 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
544 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
545 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
546 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
547 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
548 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
549 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
550 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
551 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
552 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
553 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
554 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
555 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
556 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
557 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
558 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
559 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
560 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
561 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
562 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
563 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
564 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
565 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
566 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
567 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
568 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
569 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
570 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
571 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
572 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
573 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
574 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
575 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
576 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
577 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
578 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
579 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
580 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
581 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
582 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
583 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
584 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
585 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
586 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
587 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
588 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
589 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
590 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
591 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
592 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
593 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
594 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
595 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
596 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
597 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
598 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
599 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
600 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
601 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
602 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
603 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
604 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
605 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
606 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
607 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
608 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
609 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
610 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
611 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
612 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
613 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
614 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
615 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
616 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
617 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
618 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
619 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
620 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
621 2996887358 Rhizobium sp. R711 Isolate Nodule
622 2996893221 Rhizobium sp. R635 Isolate Nodule
623 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
624 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
625 3004167301 Mesorhizobium loti 582 Isolate Unclassified
626 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
627 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
628 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
629 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
630 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
631 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
632 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
633 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
634 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
635 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
636 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
637 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
638 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
639 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
640 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
641 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
642 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
643 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
644 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
645 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
646 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
647 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
648 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
649 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
650 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
651 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
652 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
653 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
654 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
655 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
656 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
657 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
658 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
659 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
660 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
661 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
662 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
663 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
664 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
665 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
666 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
667 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
668 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
669 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
670 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
671 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
672 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
673 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
674 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
675 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
676 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
677 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
678 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
679 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
680 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
681 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
682 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
683 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
684 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
685 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
686 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
687 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
688 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
689 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
690 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
691 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
692 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
693 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
694 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
695 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
696 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
697 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
698 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
699 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
700 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
701 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
702 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
703 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
704 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
705 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
706 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
707 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
708 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
709 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
710 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
711 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
712 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
713 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
714 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
715 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
716 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
717 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
718 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
719 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
720 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
721 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
722 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
723 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
724 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
725 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
726 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
727 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
728 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
729 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
730 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
731 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
732 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
733 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
734 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
735 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
736 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
737 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
738 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
739 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
740 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
741 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
742 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
743 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
744 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
745 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
746 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
747 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
766 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
767 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
768 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
769 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
770 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
771 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
772 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
773 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
774 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
775 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
776 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
777 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
778 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
779 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
780 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
781 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
782 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
783 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
784 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
785 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
786 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
787 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
788 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
789 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
790 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
791 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
792 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
793 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
794 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
795 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
796 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
797 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
798 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
799 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
800 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
801 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
802 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
803 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
804 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
805 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
806 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
807 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
808 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
809 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
810 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
811 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
812 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
813 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
814 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
815 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
816 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
817 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
818 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
819 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
820 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
821 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
822 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
823 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
824 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
825 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
826 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
827 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
828 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
829 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
830 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
831 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
832 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
833 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
834 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
835 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
836 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
837 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
838 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
839 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
840 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
841 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
842 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
843 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
844 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
845 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
846 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
847 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
848 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
849 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
850 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
851 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
852 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
853 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
854 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
855 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
856 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
857 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
858 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
859 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
860 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
861 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
862 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
863 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
864 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
865 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
866 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
867 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
868 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
869 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
870 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
871 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
872 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
873 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
874 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
875 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
876 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
877 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
878 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
879 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
880 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
881 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
882 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
883 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
884 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
885 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
886 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
887 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
888 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
889 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
890 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
891 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
892 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
893 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
894 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
895 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
896 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
897 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
898 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
899 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
900 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
901 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
902 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
903 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
904 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
905 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
906 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
907 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
908 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
909 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
910 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
911 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
912 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
913 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
914 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
915 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
916 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
917 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
918 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
919 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
920 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
921 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
922 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
923 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
924 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
925 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
926 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
927 8005258706 Rhizobium sp. R693 Isolate Nodule
928 8005275841 Rhizobium sp. N4311 Isolate Nodule
929 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
930 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
931 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
932 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
933 8005321885 Rhizobium sp. R72 Isolate Nodule
934 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
935 8005382845 Rhizobium sp. R634 Isolate Nodule
936 8005395548 Rhizobium sp. R339 Isolate Nodule
937 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
938 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
939 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
940 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
941 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
942 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
943 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
944 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
945 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
946 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
947 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
948 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
949 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
950 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
951 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
952 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
953 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
954 8018176218 Rhizobium sp. N122 Isolate Nodule
955 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
956 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
957 8024501048 Rhizobium sp. H4 Isolate Nodule
958 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
959 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
960 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
961 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
962 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
963 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
964 8056382006 Rhizobium croatiense 13T Isolate Nodule
965 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.32
Metatranscriptomes 0.09
Isolates 62.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.76
Nodule 53.29
Rhizoplane 1.45
Rhizosphere 21.35
Stem 0
Stem Tuber 0
Unclassified 13.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001752 3300001979 Bacteria 9976
2 JGI25155J39150_1000047 3300002704 Bacteria 80068
3 JGI25162J39368_1000184 3300002737 Bacteria 67069
4 JGI25158J39367_1004730 3300002739 Bacteria 2029
5 JGI25150J39212_1000142 3300002774 Bacteria 40535
6 JGI25150J39212_1013108 3300002774 Bacteria 1445
7 JGI25159J45721_1000038 3300002987 Bacteria 72800
8 JGI25159J45721_1000110 3300002987 Bacteria 38863
9 JGI25151J46595_10000031 3300003187 Bacteria 197865
10 JGI25151J46595_10000656 3300003187 Bacteria 29464
11 JGI25151J46595_10019595 3300003187 Bacteria 2872
12 JGI25165J46597_1000163 3300003214 Bacteria 104693
13 JGI25153J46596_10004335 3300003215 Bacteria 7668
14 JGI25153J46596_10004354 3300003215 Bacteria 7642
15 JGI25153J46596_10031260 3300003215 Bacteria 1795
16 rootH1_10098713 3300003323 Bacteria 5669
17 JGI25160J50197_1000007 3300003354 Bacteria 316012
18 JGI25160J50197_1012499 3300003354 Bacteria 2943
19 JGI25161J50226_1000651 3300003374 Bacteria 13930
20 Ga0055526_1001177 3300003771 Bacteria 18950
21 Ga0055526_1003124 3300003771 Bacteria 10726
22 Ga0055526_1006755 3300003771 Bacteria 6139
23 Ga0055524_1000931 3300003775 Bacteria 18815
24 Ga0055524_1000937 3300003775 Bacteria 18722
25 Ga0055524_1006544 3300003775 Bacteria 5043
26 Ga0055524_1044661 3300003775 Bacteria 1075
27 Ga0055536_1006463 3300003781 Bacteria 5464
28 Ga0055528_1000538 3300003790 Bacteria 28947
29 Ga0055528_1004930 3300003790 Bacteria 6305
30 Ga0055528_1011626 3300003790 Bacteria 3479
31 Ga0055528_1021596 3300003790 Bacteria 2036
32 Ga0055540_1001781 3300003792 Bacteria 12268
33 Ga0055540_1008177 3300003792 Bacteria 3806
34 Ga0055540_1027894 3300003792 Bacteria 1342
35 Ga0055531_10019551 3300003794 Bacteria 2733
36 Ga0058692_1009640 3300003856 Bacteria 2422
37 Ga0055543_1000227 3300004625 Bacteria 44640
38 Ga0065165_1000011 3300005262 Bacteria 316465
39 Ga0065165_1008057 3300005262 Bacteria 5029
40 Ga0065165_1008608 3300005262 Bacteria 4736
41 Ga0070666_10024598 3300005335 Bacteria 3925
42 Ga0070680_100010944 3300005336 Bacteria 7012
43 Ga0070668_100034561 3300005347 Bacteria 3853
44 Ga0070667_100428102 3300005367 Bacteria 1207
45 Ga0070703_10001439 3300005406 Bacteria 7173
46 Ga0070714_100306888 3300005435 Bacteria 1481
47 Ga0070713_100123566 3300005436 Bacteria 2273
48 Ga0070705_100000025 3300005440 Bacteria 79976
49 Ga0070700_100143516 3300005441 Bacteria 1625
50 Ga0070694_100002036 3300005444 Bacteria 11993
51 Ga0070694_100111903 3300005444 Unclassified 1946
52 Ga0070708_100015948 3300005445 Bacteria 6219
53 Ga0070663_100069237 3300005455 Bacteria 2563
54 Ga0070681_10016559 3300005458 Bacteria 7361
55 Ga0070681_10108458 3300005458 Bacteria 2716
56 Ga0070706_100049313 3300005467 Bacteria 3886
57 Ga0070707_100647501 3300005468 Bacteria 1019
58 Ga0070699_100001854 3300005518 Bacteria 19167
59 Ga0070699_100014321 3300005518 Bacteria 6819
60 Ga0070699_100063680 3300005518 Bacteria 3197
61 Ga0070679_100122539 3300005530 Bacteria 2584
62 Ga0070697_100016953 3300005536 Bacteria 5727
63 Ga0070672_100590812 3300005543 Bacteria 966
64 Ga0070695_100000678 3300005545 Bacteria 18204
65 Ga0070696_100000311 3300005546 Bacteria 29566
66 Ga0070693_100112167 3300005547 Bacteria 1679
67 Ga0070704_100000267 3300005549 Bacteria 22856
68 Ga0068855_100087968 3300005563 Bacteria 3589
69 Ga0068855_100430723 3300005563 Bacteria 1442
70 Ga0068857_100010521 3300005577 Bacteria 8042
71 Ga0068856_100028797 3300005614 Bacteria 5427
72 Ga0068859_100001168 3300005617 Bacteria 26848
73 Ga0068864_100069763 3300005618 Bacteria 3057
74 Ga0068851_10013459 3300005834 Bacteria 3872
75 Ga0068860_100022962 3300005843 Bacteria 6032
76 Ga0068862_100001629 3300005844 Bacteria 20435
77 Ga0075365_10000097 3300006038 Bacteria 25569
78 Ga0075365_10154314 3300006038 Bacteria 1598
79 Ga0075363_100056385 3300006048 Bacteria 2106
80 Ga0075364_10000009 3300006051 Bacteria 64760
81 Ga0075364_10296966 3300006051 Bacteria 1099
82 Ga0075362_10023126 3300006177 Bacteria 2626
83 Ga0075369_10039597 3300006186 Bacteria 2013
84 Ga0075370_10130209 3300006353 Bacteria 1468
85 Ga0075428_100697674 3300006844 Bacteria 1081
86 Ga0075430_100000293 3300006846 Bacteria 35315
87 Ga0075430_100007646 3300006846 Bacteria 9129
88 Ga0075431_100008005 3300006847 Bacteria 10544
89 Ga0097620_100001168 3300006931 Bacteria 26848
90 Ga0099826_10000054 3300006948 Bacteria 71175
91 Ga0099795_10005958 3300007788 Bacteria 3288
92 Ga0099795_10034940 3300007788 Bacteria 1754
93 Ga0105251_10163709 3300009011 Bacteria 1003
94 Ga0105240_10000348 3300009093 Bacteria 86596
95 Ga0105240_10000976 3300009093 Bacteria 50953
96 Ga0105240_10001003 3300009093 Bacteria 50390
97 Ga0114129_10049133 3300009147 Bacteria 5929
98 Ga0114129_10452712 3300009147 Bacteria 1683
99 Ga0105241_10648295 3300009174 Bacteria 959
100 Ga0105248_10153432 3300009177 Bacteria 2598
101 Ga0105237_10102993 3300009545 Bacteria 2846
102 Ga0105249_10002886 3300009553 Bacteria 14831
103 Ga0123341_1000053 3300009765 Bacteria 49025
104 Ga0123342_1007669 3300009766 Bacteria 14126
105 Ga0123342_1017016 3300009766 Bacteria 6157
106 Ga0099796_10060576 3300010159 Bacteria 1340
107 Ga0105239_10141372 3300010375 Bacteria 2682
108 Ga0105246_10033431 3300011119 Bacteria 3418
109 Ga0157370_10333820 3300013104 Bacteria 1398
110 Ga0171463_1002 3300013249 Bacteria 1274851
111 Ga0171462_1031 3300013250 Bacteria 104981
112 Ga0157374_10648027 3300013296 Bacteria 1068
113 Ga0182007_10085535 3300015262 Bacteria 1036
114 Ga0182005_1016198 3300015265 Bacteria 2075
115 Ga0183363_1016 3300015690 Bacteria 67144
116 Ga0214544_1000419 3300021320 Bacteria 76083
117 Ga0214542_1000027 3300021321 Bacteria 175107
118 Ga0214542_1026066 3300021321 Bacteria 2923
119 Ga0214543_1000023 3300021327 Bacteria 240412
120 Ga0214543_1000047 3300021327 Bacteria 150894
121 Ga0213874_10000152 3300021377 Bacteria 12055
122 Ga0213875_10003167 3300021388 Bacteria 9459
123 Ga0209436_100172 3300025208 Bacteria 31063
124 Ga0209437_100095 3300025233 Bacteria 236997
125 Ga0207425_1000070 3300025245 Bacteria 116438
126 Ga0207425_1006455 3300025245 Bacteria 3205
127 Ga0207425_1011352 3300025245 Bacteria 2130
128 Ga0209677_100248 3300025253 Bacteria 36912
129 Ga0209148_1016097 3300025254 Bacteria 1293
130 Ga0209129_1000080 3300025258 Bacteria 186416
131 Ga0209129_1000232 3300025258 Bacteria 61645
132 Ga0209129_1001831 3300025258 Bacteria 11268
133 Ga0209129_1004393 3300025258 Bacteria 5529
134 Ga0209233_1000117 3300025261 Bacteria 236984
135 Ga0209233_1000340 3300025261 Bacteria 45824
136 Ga0209565_1010287 3300025263 Bacteria 2325
137 Ga0209565_1020788 3300025263 Bacteria 1381
138 Ga0209673_1001128 3300025273 Bacteria 29524
139 Ga0209673_1001602 3300025273 Bacteria 19869
140 Ga0209673_1002326 3300025273 Bacteria 13456
141 Ga0209673_1003780 3300025273 Bacteria 8602
142 Ga0209673_1005642 3300025273 Bacteria 6246
143 Ga0209673_1035993 3300025273 Bacteria 1475
144 Ga0209130_1000033 3300025284 Bacteria 316064
145 Ga0209130_1007133 3300025284 Bacteria 3501
146 Ga0209676_1005876 3300025292 Bacteria 6243
147 Ga0209025_1000032 3300025294 Bacteria 416141
148 Ga0209025_1000083 3300025294 Bacteria 265556
149 Ga0209025_1001681 3300025294 Bacteria 27032
150 Ga0209025_1001950 3300025294 Bacteria 23818
151 Ga0209025_1003226 3300025294 Bacteria 15787
152 Ga0209025_1016642 3300025294 Bacteria 4315
153 Ga0209025_1047950 3300025294 Bacteria 1738
154 Ga0209564_1000147 3300025295 Bacteria 172628
155 Ga0209564_1001203 3300025295 Bacteria 29524
156 Ga0209564_1001863 3300025295 Bacteria 19108
157 Ga0209564_1011173 3300025295 Bacteria 4048
158 Ga0209564_1036666 3300025295 Bacteria 1395
159 Ga0209758_1000090 3300025297 Bacteria 246564
160 Ga0209758_1001508 3300025297 Bacteria 27032
161 Ga0209758_1003633 3300025297 Bacteria 13779
162 Ga0209758_1007916 3300025297 Bacteria 7053
163 Ga0209050_1012350 3300025298 Bacteria 3927
164 Ga0209050_1015795 3300025298 Bacteria 3141
165 Ga0209256_1000064 3300025299 Bacteria 250853
166 Ga0209256_1001204 3300025299 Bacteria 28959
167 Ga0209256_1001765 3300025299 Bacteria 20571
168 Ga0209256_1001807 3300025299 Bacteria 20127
169 Ga0209256_1006696 3300025299 Bacteria 5983
170 Ga0209256_1007129 3300025299 Bacteria 5633
171 Ga0209256_1010922 3300025299 Bacteria 3721
172 Ga0207426_1000078 3300025302 Bacteria 316064
173 Ga0207426_1000863 3300025302 Bacteria 31669
174 Ga0207426_1000984 3300025302 Bacteria 27966
175 Ga0209051_1000848 3300025303 Bacteria 31351
176 Ga0209051_1002732 3300025303 Bacteria 12249
177 Ga0209051_1005677 3300025303 Bacteria 7214
178 Ga0209051_1006312 3300025303 Bacteria 6715
179 Ga0209051_1008453 3300025303 Bacteria 5447
180 Ga0209257_1006322 3300025304 Bacteria 7711
181 Ga0209257_1014826 3300025304 Bacteria 3307
182 Ga0207656_10047898 3300025321 Bacteria 1839
183 Ga0207713_1099416 3300025735 Bacteria 1007
184 Ga0207653_10002071 3300025885 Bacteria 6389
185 Ga0207643_10155572 3300025908 Bacteria 1373
186 Ga0207654_10273041 3300025911 Bacteria 1141
187 Ga0207695_10000853 3300025913 Bacteria 55861
188 Ga0207695_10000948 3300025913 Bacteria 51627
189 Ga0207695_10003329 3300025913 Bacteria 22777
190 Ga0207660_10007001 3300025917 Bacteria 7302
191 Ga0207646_10252492 3300025922 Bacteria 1593
192 Ga0207700_10031337 3300025928 Bacteria 3776
193 Ga0207664_10457455 3300025929 Bacteria 1140
194 Ga0207706_10139867 3300025933 Bacteria 2129
195 Ga0207689_10396411 3300025942 Bacteria 1150
196 Ga0207667_10547329 3300025949 Bacteria 1171
197 Ga0207712_10006755 3300025961 Bacteria 7235
198 Ga0207640_10514252 3300025981 Bacteria 999
199 Ga0207658_10656325 3300025986 Bacteria 946
200 Ga0207678_10023582 3300026067 Bacteria 5381
201 Ga0207708_10002273 3300026075 Bacteria 14166
202 Ga0207702_10007214 3300026078 Bacteria 9510
203 Ga0207676_10111522 3300026095 Bacteria 2289
204 Ga0207674_10003734 3300026116 Bacteria 18581
205 Ga0207698_10895898 3300026142 Bacteria 894
206 Ga0209281_1000190 3300027111 Bacteria 140658
207 Ga0209371_1002509 3300027312 Bacteria 10168
208 Ga0209371_1014700 3300027312 Bacteria 2134
209 Ga0209179_1023858 3300027512 Bacteria 1210
210 Ga0209282_1000140 3300027666 Bacteria 42807
211 Ga0268265_10004355 3300028380 Bacteria 9840
212 Ga0268264_10041690 3300028381 Bacteria 3798
213 Ga0307515_10020346 3300028794 Bacteria 11845
214 Ga0265338_10276610 3300028800 Unclassified 1228
215 Ga0268256_1007353 3300030500 Bacteria 3940
216 Ga0268256_1015716 3300030500 Bacteria 2196
217 Ga0316181_1124615 3300030744 Bacteria 4431
218 Ga0307513_10007331 3300031456 Bacteria 14320
219 Ga0307513_10440600 3300031456 Bacteria 1029
220 Ga0307410_10125074 3300031852 Bacteria 1881
221 Ga0307406_10055075 3300031901 Bacteria 2541
222 Ga0307412_10026555 3300031911 Bacteria 3600
223 Ga0373935_0144311 3300035692 Bacteria 1610
224 Ga0373927_0000791 3300035695 Bacteria 24150
225 Ga0373927_0100848 3300035695 Bacteria 1877
226 Ga0373947_0005829 3300035725 Bacteria 7181
227 Ga0373947_0335150 3300035725 Bacteria 1013
228 Ga0373925_0004861 3300037068 Bacteria 10115
229 Ga0373925_0134136 3300037068 Bacteria 1933
230 Ga0436364_0320847 3300037853 Bacteria 68018
231 Ga0400483_144045 3300039062 Bacteria 3853
232 Ga0436363_1488722 3300039450 Bacteria 18300
233 Ga0436362_0508840 3300039453 Bacteria 9491
234 Ga0436362_0955777 3300039453 Bacteria 1347
235 Ga0439436_0038313 3300041404 Bacteria 1379
236 Ga0439465_0002303 3300041413 Bacteria 6268
237 Ga0439465_0052380 3300041413 Bacteria 1339
238 Ga0451833_1356226 3300041491 Bacteria 2522
239 Ga0451835_1146146 3300041492 Bacteria 2953
240 Ga0451839_0565953 3300041496 Bacteria 1967
241 Ga0451840_19101 3300041497 Bacteria 902
242 Ga0451841_0332374 3300041498 Bacteria 1633
243 Ga0451845_0560206 3300041501 Bacteria 3163
244 Ga0451847_0093541 3300041503 Bacteria 1218
245 Ga0451847_0695760 3300041503 Bacteria 4229
246 Ga0451851_0198849 3300041507 Bacteria 1549
247 Ga0451851_0309227 3300041507 Bacteria 1225
248 Ga0451853_2319332 3300041512 Bacteria 1159
249 Ga0439449_0009140 3300042007 Bacteria 3757
250 Ga0439449_0068031 3300042007 Bacteria 1313
251 Ga0466972_0138564 3300044658 Bacteria 1145
252 Ga0466966_0080079 3300044684 Bacteria 2035
253 Ga0466964_0000216 3300044706 Bacteria 16394
254 Ga0453684_0008390 3300044712 Bacteria 18539
255 Ga0466968_0000034 3300044735 Bacteria 38405
256 Ga0466970_0001277 3300044765 Bacteria 12174
257 Ga0466959_0299416 3300045049 Bacteria 1101
258 Ga0466967_0789901 3300045976 Bacteria 942
259 Ga0495617_066014 3300046452 Bacteria 1193
260 Ga0495592_0068539 3300046454 Bacteria 2590
261 Ga0495592_0098220 3300046454 Bacteria 2090
262 Ga0495629_0022307 3300046459 Bacteria 4514
263 Ga0495638_0019601 3300046460 Bacteria 4474
264 Ga0495653_0246493 3300046463 Bacteria 1188
265 Ga0495650_0042950 3300046471 Bacteria 1922
266 Ga0495605_0052088 3300046474 Bacteria 1990
267 Ga0495605_0120377 3300046474 Bacteria 1190
268 Ga0495662_0008536 3300046476 Bacteria 5035
269 Ga0495585_0013550 3300046492 Bacteria 4765
270 Ga0495585_0049658 3300046492 Bacteria 2329
271 Ga0495607_0013702 3300046501 Bacteria 5300
272 Ga0495607_0090783 3300046501 Bacteria 1655
273 Ga0495583_0042245 3300046506 Bacteria 2130
274 Ga0495583_0168385 3300046506 Bacteria 901
275 Ga0495606_0012251 3300046507 Bacteria 6897
276 Ga0495606_0237566 3300046507 Bacteria 1018
277 Ga0495610_0001475 3300046512 Bacteria 20721
278 Ga0495610_0013733 3300046512 Bacteria 4795
279 Ga0495616_0010845 3300046513 Bacteria 5251
280 Ga0495620_0006147 3300046515 Bacteria 6623
281 Ga0495620_0008772 3300046515 Bacteria 5411
282 Ga0495620_0056845 3300046515 Bacteria 1644
283 Ga0495620_0059829 3300046515 Bacteria 1591
284 Ga0495631_0001365 3300046518 Bacteria 14903
285 Ga0495631_0015282 3300046518 Bacteria 3681
286 Ga0495632_0007666 3300046519 Bacteria 6741
287 Ga0495632_0010708 3300046519 Bacteria 5405
288 Ga0495632_0018155 3300046519 Bacteria 3866
289 Ga0495632_0068948 3300046519 Bacteria 1703
290 Ga0495643_0021589 3300046522 Bacteria 3691
291 Ga0495643_0162952 3300046522 Bacteria 1096
292 Ga0495644_0090891 3300046523 Bacteria 1152
293 Ga0495648_0036560 3300046524 Bacteria 3166
294 Ga0495648_0073053 3300046524 Bacteria 1982
295 Ga0495652_0029055 3300046529 Bacteria 4858
296 Ga0495654_0000997 3300046530 Bacteria 20843
297 Ga0495654_0010648 3300046530 Bacteria 4996
298 Ga0495587_0013348 3300046536 Bacteria 5164
299 Ga0495587_0128839 3300046536 Bacteria 1447
300 Ga0495622_0022522 3300046557 Bacteria 2936
301 Ga0495633_0042272 3300046558 Bacteria 2165
302 Ga0495633_0103092 3300046558 Bacteria 1324
303 Ga0495633_0116291 3300046558 Bacteria 1239
304 Ga0495633_0228366 3300046558 Bacteria 851
305 Ga0495656_0112183 3300046615 Bacteria 1277
306 Ga0495668_0012249 3300046616 Bacteria 5091
307 Ga0495668_0015025 3300046616 Bacteria 4529
308 Ga0495668_0059605 3300046616 Bacteria 2106
309 Ga0495611_0076951 3300046648 Bacteria 1530
310 Ga0495625_0005333 3300046660 Bacteria 11777
311 Ga0495625_0010708 3300046660 Bacteria 7551
312 Ga0495625_0142948 3300046660 Bacteria 1613
313 Ga0495625_0167711 3300046660 Bacteria 1467
314 Ga0495625_0178173 3300046660 Bacteria 1415
315 Ga0495635_0032933 3300046663 Bacteria 3595
316 Ga0495661_0046235 3300046665 Bacteria 2659
317 Ga0495588_0011344 3300046674 Bacteria 4178
318 Ga0495588_0100440 3300046674 Bacteria 1520
319 Ga0495588_0353472 3300046674 Bacteria 772
320 Ga0495623_0079985 3300046679 Bacteria 2024
321 Ga0495658_0010868 3300046683 Bacteria 4561
322 Ga0495670_0004613 3300046691 Bacteria 6756
323 Ga0495671_0045382 3300046692 Bacteria 2200
324 Ga0495649_0015885 3300046694 Bacteria 4277
325 Ga0495600_0015203 3300046809 Bacteria 4862
326 Ga0495660_0010090 3300046810 Bacteria 5492
327 Ga0495604_0068405 3300047317 Bacteria 2695
328 Ga0495636_0014471 3300047318 Bacteria 3137
329 Ga0495680_0011608 3300047322 Bacteria 7785
330 Ga0495685_030140 3300047447 Bacteria 1866
331 Ga0495681_0000886 3300047470 Bacteria 23149
332 Ga0495681_0052176 3300047470 Bacteria 1920
333 Ga0495681_0160326 3300047470 Bacteria 937
334 Ga0495686_0015171 3300047472 Bacteria 5275
335 Ga0495686_0056339 3300047472 Bacteria 2456
336 Ga0495626_0020888 3300048091 Bacteria 3258
337 Ga0496100_0037922 3300048903 Bacteria 3051
338 Ga0496100_0283290 3300048903 Bacteria 1236
339 Ga0496101_0585259 3300048904 Bacteria 882
340 Ga0496102_0020429 3300048905 Bacteria 5852
341 Ga0496102_0203338 3300048905 Bacteria 1867
342 Ga0496103_0072147 3300048906 Bacteria 2162
343 Ga0496106_0003381 3300048909 Bacteria 11886
344 Ga0496107_0013701 3300048910 Bacteria 5670
345 Ga0496109_0440016 3300048912 Unclassified 1231
346 Ga0496111_0010102 3300048914 Bacteria 6319
347 Ga0496115_0036814 3300048918 Bacteria 3876
348 Ga0496115_0102443 3300048918 Bacteria 2348
349 Ga0496116_0007605 3300048919 Bacteria 9573
350 Ga0496116_0029830 3300048919 Bacteria 3925
351 Ga0496116_0033555 3300048919 Bacteria 3641
352 Ga0496116_0059466 3300048919 Bacteria 2485
353 Ga0496116_0063587 3300048919 Bacteria 2376
354 Ga0496116_0161862 3300048919 Bacteria 1227
355 Ga0496117_0013781 3300048920 Bacteria 7020
356 Ga0496117_0022286 3300048920 Bacteria 5085
357 Ga0496117_0033094 3300048920 Bacteria 3914
358 Ga0496117_0033151 3300048920 Bacteria 3909
359 Ga0496117_0138461 3300048920 Bacteria 1462
360 Ga0496118_0017759 3300048921 Bacteria 6457
361 Ga0496118_0036725 3300048921 Bacteria 3955
362 Ga0496118_0037294 3300048921 Bacteria 3914
363 Ga0496118_0043018 3300048921 Bacteria 3556
364 Ga0496118_0043408 3300048921 Bacteria 3535
365 Ga0496118_0078868 3300048921 Bacteria 2327
366 Ga0496119_0019866 3300048922 Bacteria 4924
367 Ga0496119_0020292 3300048922 Bacteria 4853
368 Ga0496119_0021558 3300048922 Bacteria 4651
369 Ga0496120_0004705 3300048923 Bacteria 11251
370 Ga0496120_0045466 3300048923 Bacteria 2543
371 Ga0496120_0052351 3300048923 Bacteria 2326
372 Ga0496121_0002413 3300048924 Bacteria 28637
373 Ga0496121_0015646 3300048924 Bacteria 7915
374 Ga0496121_0015859 3300048924 Bacteria 7833
375 Ga0496121_0023490 3300048924 Bacteria 5936
376 Ga0496121_0179947 3300048924 Bacteria 1527
377 Ga0496121_0299993 3300048924 Bacteria 1091
378 Ga0496122_0022627 3300048925 Bacteria 5579
379 Ga0496122_0032355 3300048925 Bacteria 4327
380 Ga0496122_0038204 3300048925 Bacteria 3851
381 Ga0496122_0063268 3300048925 Bacteria 2701
382 Ga0496122_0064711 3300048925 Bacteria 2658
383 Ga0496122_0122352 3300048925 Bacteria 1674
384 Ga0496123_0009360 3300048926 Bacteria 8833
385 Ga0496123_0034129 3300048926 Bacteria 3649
386 Ga0496123_0034806 3300048926 Bacteria 3600
387 Ga0496123_0039823 3300048926 Bacteria 3282
388 Ga0496123_0220882 3300048926 Bacteria 956
389 Ga0496124_0000091 3300048927 Bacteria 189706
390 Ga0496124_0011091 3300048927 Bacteria 9041
391 Ga0496124_0019729 3300048927 Bacteria 6260
392 Ga0496124_0023919 3300048927 Bacteria 5564
393 Ga0496124_0080259 3300048927 Bacteria 2685
394 Ga0496124_0183051 3300048927 Bacteria 1610
395 Ga0496124_0319484 3300048927 Bacteria 1112
396 Ga0496125_0025949 3300048928 Bacteria 5353
397 Ga0496125_0036052 3300048928 Bacteria 4326
398 Ga0496125_0066917 3300048928 Bacteria 2835
399 Ga0496125_0205378 3300048928 Bacteria 1285
400 Ga0496126_0070196 3300048929 Bacteria 3121
401 Ga0501032_0001267 3300049569 Bacteria 20244
402 Ga0501034_0000001 3300049571 Bacteria 2184493
403 Ga0501036_0417586 3300049572 Bacteria 1119
404 Ga0501039_0000029 3300049575 Bacteria 131786
405 Ga0501042_0278121 3300049578 Bacteria 1209
406 Ga0501046_0013075 3300049580 Bacteria 7046
407 Ga0501079_0114537 3300049741 Bacteria 2096
408 Ga0501081_0060141 3300049743 Bacteria 2631
409 nmdc:mga03683_72308_c1 3300050489 Bacteria 1477
410 nmdc:mga00v17_278527_c1 3300050491 Bacteria 1086
411 nmdc:mga00v17_566582_c1 3300050491 Bacteria 734
412 nmdc:mga00v17_715_c1 3300050491 Bacteria 18144
413 nmdc:mga0yw44_45486_c1 3300050492 Bacteria 2632
414 nmdc:mga0k408_6362_c1 3300050493 Bacteria 6303
415 nmdc:mga07m45_120082_c1 3300050496 Bacteria 1518
416 nmdc:mga05p37_61814_c1 3300050507 Bacteria 4610
417 nmdc:mga05p37_792075_c1 3300050507 Bacteria 1038
418 nmdc:mga0qj67_37_c1 3300050509 Bacteria 92978
419 nmdc:mga0qj67_6784_c1 3300050509 Bacteria 8417
420 nmdc:mga06r32_9264_c1 3300050510 Bacteria 8874
421 nmdc:mga0sz30_11253_c1 3300050516 Bacteria 3450
422 nmdc:mga0sz30_16814_c1 3300050516 Bacteria 2910
423 Ga0500610_0110854 3300053079 Bacteria 1411
424 Ga0495619_0114384 3300053085 Bacteria 1846
425 Ga0500560_015340 3300053107 Bacteria 2064
426 Ga0500569_002172 3300053109 Bacteria 3824
427 Ga0500569_005302 3300053109 Bacteria 2763
428 Ga0500594_0005305 3300053118 Bacteria 2856
429 Ga0500618_001169 3300053125 Bacteria 12682
430 Ga0500618_002367 3300053125 Bacteria 7190
431 Ga0500658_0001338 3300053134 Bacteria 9968
432 Ga0500590_000052 3300053148 Bacteria 27619
433 Ga0500604_0103905 3300053151 Bacteria 939
434 Ga0500622_0020047 3300053156 Bacteria 3551
435 Ga0500624_000733 3300053157 Bacteria 8098
436 Ga0500634_0007864 3300053161 Bacteria 5293
437 Ga0500636_0003250 3300053177 Bacteria 9109
438 Ga0501084_0253892 3300054114 Bacteria 1484

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10440600 Ga0307513_104406002 175
2 iso_pu_bacteria 2643221643 2644241813 200
3 3300031901 Ga0307406_10055075 Ga0307406_100550752 204
4 3300048904 Ga0496101_0585259 Ga0496101_0585259_64_816 204
5 3300048919 Ga0496116_0063587 Ga0496116_0063587_1453_2205 204
6 3300048920 Ga0496117_0022286 Ga0496117_0022286_1010_1762 204
7 3300048921 Ga0496118_0043408 Ga0496118_0043408_571_1323 204
8 3300048925 Ga0496122_0038204 Ga0496122_0038204_571_1323 204
9 3300048926 Ga0496123_0220882 Ga0496123_0220882_133_885 204
10 3300048927 Ga0496124_0023919 Ga0496124_0023919_1467_2219 204
11 3300046507 Ga0495606_0237566 Ga0495606_0237566_141_875 208
12 3300046512 Ga0495610_0001475 Ga0495610_0001475_14820_15554 208
13 3300046515 Ga0495620_0006147 Ga0495620_0006147_704_1438 208
14 3300046519 Ga0495632_0068948 Ga0495632_0068948_213_947 208
15 3300046522 Ga0495643_0162952 Ga0495643_0162952_35_769 208
16 3300047472 Ga0495686_0056339 Ga0495686_0056339_1042_1776 208
17 3300046660 Ga0495625_0142948 Ga0495625_0142948_350_1018 214
18 3300050491 nmdc:mga00v17_566582_c1 nmdc:mga00v17_566582_c1_18_698 214
19 iso_pu_bacteria 2885326080 2885333967 214
20 iso_pu_bacteria 2917699015 2917700616 216
21 3300005436 Ga0070713_100123566 Ga0070713_1001235663 218
22 3300025928 Ga0207700_10031337 Ga0207700_100313374 218
23 3300025929 Ga0207664_10457455 Ga0207664_104574552 218
24 3300005435 Ga0070714_100306888 Ga0070714_1003068882 219
25 3300025297 Ga0209758_1007916 Ga0209758_10079167 219
26 3300003354 JGI25160J50197_1012499 JGI25160J50197_10124992 220
27 3300003775 Ga0055524_1006544 Ga0055524_10065444 220
28 3300003790 Ga0055528_1011626 Ga0055528_10116265 220
29 3300003792 Ga0055540_1027894 Ga0055540_10278942 220
30 3300005335 Ga0070666_10024598 Ga0070666_100245983 220
31 3300005347 Ga0070668_100034561 Ga0070668_1000345612 220
32 3300005367 Ga0070667_100428102 Ga0070667_1004281022 220
33 3300005455 Ga0070663_100069237 Ga0070663_1000692373 220
34 3300006038 Ga0075365_10000097 Ga0075365_1000009720 220
35 3300006038 Ga0075365_10154314 Ga0075365_101543142 220
36 3300006177 Ga0075362_10023126 Ga0075362_100231263 220
37 3300009011 Ga0105251_10163709 Ga0105251_101637092 220
38 3300025245 Ga0207425_1011352 Ga0207425_10113523 220
39 3300025258 Ga0209129_1004393 Ga0209129_10043933 220
40 3300025273 Ga0209673_1002326 Ga0209673_100232612 220
41 3300025273 Ga0209673_1035993 Ga0209673_10359932 220
42 3300025295 Ga0209564_1011173 Ga0209564_10111733 220
43 3300025299 Ga0209256_1006696 Ga0209256_10066965 220
44 3300025299 Ga0209256_1010922 Ga0209256_10109225 220
45 3300025302 Ga0207426_1000984 Ga0207426_100098411 220
46 3300025303 Ga0209051_1002732 Ga0209051_100273210 220
47 3300025735 Ga0207713_1099416 Ga0207713_10994162 220
48 3300009093 Ga0105240_10000348 Ga0105240_1000034837 223
49 3300025913 Ga0207695_10000853 Ga0207695_1000085341 223
50 3300048919 Ga0496116_0033555 Ga0496116_0033555_2344_3075 223
51 3300048927 Ga0496124_0183051 Ga0496124_0183051_273_1004 223
52 3300002774 JGI25150J39212_1000142 JGI25150J39212_100014211 224
53 3300003187 JGI25151J46595_10000031 JGI25151J46595_10000031119 224
54 3300003215 JGI25153J46596_10031260 JGI25153J46596_100312603 224
55 3300006353 Ga0075370_10130209 Ga0075370_101302093 224
56 3300025245 Ga0207425_1000070 Ga0207425_1000070100 224
57 3300025258 Ga0209129_1000232 Ga0209129_100023259 224
58 3300025294 Ga0209025_1000083 Ga0209025_1000083163 224
59 3300025297 Ga0209758_1000090 Ga0209758_1000090100 224
60 3300031911 Ga0307412_10026555 Ga0307412_100265551 224
61 3300048919 Ga0496116_0007605 Ga0496116_0007605_5476_6207 224
62 3300048919 Ga0496116_0029830 Ga0496116_0029830_853_1584 224
63 3300048919 Ga0496116_0059466 Ga0496116_0059466_1094_1825 224
64 3300048920 Ga0496117_0013781 Ga0496117_0013781_541_1272 224
65 3300048921 Ga0496118_0078868 Ga0496118_0078868_1074_1805 224
66 3300048924 Ga0496121_0015646 Ga0496121_0015646_1328_2059 224
67 3300048924 Ga0496121_0023490 Ga0496121_0023490_1334_2065 224
68 3300048925 Ga0496122_0032355 Ga0496122_0032355_2127_2858 224
69 3300048925 Ga0496122_0063268 Ga0496122_0063268_692_1423 224
70 3300048926 Ga0496123_0009360 Ga0496123_0009360_2085_2816 224
71 3300048926 Ga0496123_0034806 Ga0496123_0034806_2140_2871 224
72 3300048927 Ga0496124_0019729 Ga0496124_0019729_3360_4091 224
73 3300048928 Ga0496125_0025949 Ga0496125_0025949_2403_3134 224
74 3300003775 Ga0055524_1000931 Ga0055524_10009314 225
75 3300025294 Ga0209025_1047950 Ga0209025_10479503 225
76 3300025299 Ga0209256_1000064 Ga0209256_1000064153 225
77 3300044712 Ga0453684_0008390 Ga0453684_0008390_15346_16071 225
78 3300009093 Ga0105240_10001003 Ga0105240_1000100324 226
79 3300009147 Ga0114129_10049133 Ga0114129_100491334 226
80 3300013296 Ga0157374_10648027 Ga0157374_106480272 226
81 3300025913 Ga0207695_10003329 Ga0207695_1000332924 226
82 3300048927 Ga0496124_0000091 Ga0496124_0000091_61396_62133 226
83 3300050507 nmdc:mga05p37_61814_c1 nmdc:mga05p37_61814_c1_1858_2589 226
84 3300005518 Ga0070699_100014321 Ga0070699_1000143216 227
85 3300025258 Ga0209129_1000080 Ga0209129_1000080104 227
86 3300025294 Ga0209025_1003226 Ga0209025_10032267 227
87 3300053177 Ga0500636_0003250 Ga0500636_0003250_5687_6454 227
88 iso_pu_bacteria 2903521522 2903525036 227
89 3300005262 Ga0065165_1008608 Ga0065165_10086083 228
90 3300007788 Ga0099795_10034940 Ga0099795_100349402 228
91 3300009766 Ga0123342_1007669 Ga0123342_100766911 228
92 3300046530 Ga0495654_0000997 Ga0495654_0000997_6875_7609 228
93 3300005518 Ga0070699_100063680 Ga0070699_1000636803 229
94 3300006051 Ga0075364_10296966 Ga0075364_102969662 229
95 3300050491 nmdc:mga00v17_278527_c1 nmdc:mga00v17_278527_c1_68_787 229
96 3300005563 Ga0068855_100087968 Ga0068855_1000879683 230
97 3300044658 Ga0466972_0138564 Ga0466972_0138564_42_767 230
98 3300044684 Ga0466966_0080079 Ga0466966_0080079_88_813 230
99 3300044706 Ga0466964_0000216 Ga0466964_0000216_9538_10263 230
100 3300044735 Ga0466968_0000034 Ga0466968_0000034_12160_12885 230
101 3300044765 Ga0466970_0001277 Ga0466970_0001277_1923_2648 230
102 3300045049 Ga0466959_0299416 Ga0466959_0299416_129_854 230
103 3300048905 Ga0496102_0203338 Ga0496102_0203338_579_1310 230
104 3300039062 Ga0400483_144045 Ga0400483_144045_2311_3006 231
105 3300053125 Ga0500618_001169 Ga0500618_001169_4499_5227 231
106 iso_pu_bacteria 2869162929 2869167648 231
107 iso_pu_bacteria 2876363079 2876363088 231
108 iso_pu_bacteria 2903528002 2903531543 231
109 iso_pu_bacteria 3000405567 3000408769 231
110 3300005336 Ga0070680_100010944 Ga0070680_1000109446 232
111 3300005406 Ga0070703_10001439 Ga0070703_100014394 232
112 3300005440 Ga0070705_100000025 Ga0070705_10000002544 232
113 3300005441 Ga0070700_100143516 Ga0070700_1001435161 232
114 3300005444 Ga0070694_100002036 Ga0070694_1000020366 232
115 3300005445 Ga0070708_100015948 Ga0070708_1000159485 232
116 3300005458 Ga0070681_10016559 Ga0070681_100165599 232
117 3300005467 Ga0070706_100049313 Ga0070706_1000493133 232
118 3300005468 Ga0070707_100647501 Ga0070707_1006475012 232
119 3300005518 Ga0070699_100001854 Ga0070699_10000185410 232
120 3300005530 Ga0070679_100122539 Ga0070679_1001225393 232
121 3300005536 Ga0070697_100016953 Ga0070697_1000169533 232
122 3300005545 Ga0070695_100000678 Ga0070695_1000006787 232
123 3300005546 Ga0070696_100000311 Ga0070696_1000003117 232
124 3300005547 Ga0070693_100112167 Ga0070693_1001121672 232
125 3300005549 Ga0070704_100000267 Ga0070704_10000026717 232
126 3300005577 Ga0068857_100010521 Ga0068857_1000105217 232
127 3300005617 Ga0068859_100001168 Ga0068859_1000011688 232
128 3300005618 Ga0068864_100069763 Ga0068864_1000697632 232
129 3300005843 Ga0068860_100022962 Ga0068860_1000229627 232
130 3300005844 Ga0068862_100001629 Ga0068862_1000016295 232
131 3300006931 Ga0097620_100001168 Ga0097620_10000116819 232
132 3300009174 Ga0105241_10648295 Ga0105241_106482952 232
133 3300009553 Ga0105249_10002886 Ga0105249_100028867 232
134 3300011119 Ga0105246_10033431 Ga0105246_100334314 232
135 3300025885 Ga0207653_10002071 Ga0207653_100020713 232
136 3300025908 Ga0207643_10155572 Ga0207643_101555722 232
137 3300025911 Ga0207654_10273041 Ga0207654_102730411 232
138 3300025917 Ga0207660_10007001 Ga0207660_100070016 232
139 3300025922 Ga0207646_10252492 Ga0207646_102524922 232
140 3300025933 Ga0207706_10139867 Ga0207706_101398673 232
141 3300025942 Ga0207689_10396411 Ga0207689_103964112 232
142 3300025961 Ga0207712_10006755 Ga0207712_100067555 232
143 3300026067 Ga0207678_10023582 Ga0207678_100235822 232
144 3300026075 Ga0207708_10002273 Ga0207708_1000227316 232
145 3300026095 Ga0207676_10111522 Ga0207676_101115222 232
146 3300026116 Ga0207674_10003734 Ga0207674_100037344 232
147 3300028380 Ga0268265_10004355 Ga0268265_100043557 232
148 3300028381 Ga0268264_10041690 Ga0268264_100416902 232
149 3300046454 Ga0495592_0098220 Ga0495592_0098220_110_841 232
150 3300046536 Ga0495587_0013348 Ga0495587_0013348_2560_3291 232
151 3300047322 Ga0495680_0011608 Ga0495680_0011608_4495_5226 232
152 3300048903 Ga0496100_0283290 Ga0496100_0283290_115_846 232
153 3300048905 Ga0496102_0020429 Ga0496102_0020429_2347_3078 232
154 3300048909 Ga0496106_0003381 Ga0496106_0003381_8619_9350 232
155 3300048910 Ga0496107_0013701 Ga0496107_0013701_53_784 232
156 3300048912 Ga0496109_0440016 Ga0496109_0440016_86_817 232
157 3300048918 Ga0496115_0102443 Ga0496115_0102443_290_1021 232
158 3300049578 Ga0501042_0278121 Ga0501042_0278121_24_755 232
159 3300049580 Ga0501046_0013075 Ga0501046_0013075_2116_2847 232
160 3300049741 Ga0501079_0114537 Ga0501079_0114537_1319_2050 232
161 3300049743 Ga0501081_0060141 Ga0501081_0060141_724_1455 232
162 3300053151 Ga0500604_0103905 Ga0500604_0103905_68_766 232
163 3300054114 Ga0501084_0253892 Ga0501084_0253892_331_1062 232
164 3300002739 JGI25158J39367_1004730 JGI25158J39367_10047301 233
165 3300002987 JGI25159J45721_1000038 JGI25159J45721_100003857 233
166 3300002987 JGI25159J45721_1000110 JGI25159J45721_100011031 233
167 3300003354 JGI25160J50197_1000007 JGI25160J50197_100000732 233
168 3300003374 JGI25161J50226_1000651 JGI25161J50226_10006515 233
169 3300003771 Ga0055526_1006755 Ga0055526_10067558 233
170 3300003775 Ga0055524_1044661 Ga0055524_10446611 233
171 3300003781 Ga0055536_1006463 Ga0055536_10064636 233
172 3300003794 Ga0055531_10019551 Ga0055531_100195513 233
173 3300004625 Ga0055543_1000227 Ga0055543_100022714 233
174 3300005262 Ga0065165_1000011 Ga0065165_1000011261 233
175 3300006844 Ga0075428_100697674 Ga0075428_1006976742 233
176 3300006846 Ga0075430_100007646 Ga0075430_1000076465 233
177 3300006847 Ga0075431_100008005 Ga0075431_1000080059 233
178 3300025208 Ga0209436_100172 Ga0209436_1001729 233
179 3300025263 Ga0209565_1010287 Ga0209565_10102873 233
180 3300025284 Ga0209130_1000033 Ga0209130_1000033258 233
181 3300025292 Ga0209676_1005876 Ga0209676_10058764 233
182 3300025294 Ga0209025_1000032 Ga0209025_100003232 233
183 3300025294 Ga0209025_1016642 Ga0209025_10166422 233
184 3300025295 Ga0209564_1000147 Ga0209564_1000147121 233
185 3300025298 Ga0209050_1012350 Ga0209050_10123504 233
186 3300025299 Ga0209256_1001807 Ga0209256_10018079 233
187 3300025302 Ga0207426_1000078 Ga0207426_1000078258 233
188 3300025303 Ga0209051_1005677 Ga0209051_10056777 233
189 3300025304 Ga0209257_1014826 Ga0209257_10148263 233
190 3300046691 Ga0495670_0004613 Ga0495670_0004613_5740_6474 233
191 3300048920 Ga0496117_0138461 Ga0496117_0138461_667_1419 233
192 3300048927 Ga0496124_0319484 Ga0496124_0319484_183_938 233
193 3300050509 nmdc:mga0qj67_6784_c1 nmdc:mga0qj67_6784_c1_3405_4145 233
194 3300050510 nmdc:mga06r32_9264_c1 nmdc:mga06r32_9264_c1_4021_4761 233
195 3300002774 JGI25150J39212_1013108 JGI25150J39212_10131083 234
196 3300003187 JGI25151J46595_10000656 JGI25151J46595_100006566 234
197 3300003187 JGI25151J46595_10019595 JGI25151J46595_100195951 234
198 3300003215 JGI25153J46596_10004354 JGI25153J46596_100043544 234
199 3300003771 Ga0055526_1001177 Ga0055526_100117716 234
200 3300003775 Ga0055524_1000937 Ga0055524_10009378 234
201 3300003790 Ga0055528_1004930 Ga0055528_10049304 234
202 3300003790 Ga0055528_1021596 Ga0055528_10215963 234
203 3300003792 Ga0055540_1001781 Ga0055540_10017815 234
204 3300003792 Ga0055540_1008177 Ga0055540_10081773 234
205 3300003856 Ga0058692_1009640 Ga0058692_10096404 234
206 3300005262 Ga0065165_1008057 Ga0065165_10080574 234
207 3300006048 Ga0075363_100056385 Ga0075363_1000563852 234
208 3300006051 Ga0075364_10000009 Ga0075364_1000000938 234
209 3300006186 Ga0075369_10039597 Ga0075369_100395973 234
210 3300006948 Ga0099826_10000054 Ga0099826_1000005425 234
211 3300009765 Ga0123341_1000053 Ga0123341_100005344 234
212 3300009766 Ga0123342_1017016 Ga0123342_10170164 234
213 3300013249 Ga0171463_1002 Ga0171463_1002141 234
214 3300015690 Ga0183363_1016 Ga0183363_101614 234
215 3300025245 Ga0207425_1006455 Ga0207425_10064553 234
216 3300025258 Ga0209129_1001831 Ga0209129_10018317 234
217 3300025263 Ga0209565_1020788 Ga0209565_10207883 234
218 3300025273 Ga0209673_1001602 Ga0209673_100160216 234
219 3300025273 Ga0209673_1003780 Ga0209673_10037805 234
220 3300025273 Ga0209673_1005642 Ga0209673_10056424 234
221 3300025284 Ga0209130_1007133 Ga0209130_10071333 234
222 3300025294 Ga0209025_1001681 Ga0209025_10016816 234
223 3300025294 Ga0209025_1001950 Ga0209025_100195015 234
224 3300025295 Ga0209564_1001863 Ga0209564_100186315 234
225 3300025297 Ga0209758_1001508 Ga0209758_100150821 234
226 3300025298 Ga0209050_1015795 Ga0209050_10157952 234
227 3300025299 Ga0209256_1001765 Ga0209256_10017658 234
228 3300025299 Ga0209256_1007129 Ga0209256_10071293 234
229 3300025302 Ga0207426_1000863 Ga0207426_10008635 234
230 3300025303 Ga0209051_1000848 Ga0209051_10008485 234
231 3300025303 Ga0209051_1006312 Ga0209051_10063122 234
232 3300025303 Ga0209051_1008453 Ga0209051_10084535 234
233 3300025304 Ga0209257_1006322 Ga0209257_10063224 234
234 3300027312 Ga0209371_1002509 Ga0209371_10025092 234
235 3300027312 Ga0209371_1014700 Ga0209371_10147003 234
236 3300027666 Ga0209282_1000140 Ga0209282_10001407 234
237 3300028794 Ga0307515_10020346 Ga0307515_1002034610 234
238 3300030500 Ga0268256_1007353 Ga0268256_10073536 234
239 3300030500 Ga0268256_1015716 Ga0268256_10157162 234
240 3300030744 Ga0316181_1124615 Ga0316181_11246156 234
241 3300031456 Ga0307513_10007331 Ga0307513_1000733116 234
242 3300041404 Ga0439436_0038313 Ga0439436_0038313_286_1023 234
243 3300041413 Ga0439465_0002303 Ga0439465_0002303_4285_5013 234
244 3300041492 Ga0451835_1146146 Ga0451835_1146146_380_1126 234
245 3300041497 Ga0451840_19101 Ga0451840_19101_71_799 234
246 3300041498 Ga0451841_0332374 Ga0451841_0332374_107_835 234
247 3300041501 Ga0451845_0560206 Ga0451845_0560206_129_875 234
248 3300041503 Ga0451847_0093541 Ga0451847_0093541_243_971 234
249 3300041507 Ga0451851_0198849 Ga0451851_0198849_574_1302 234
250 3300041507 Ga0451851_0309227 Ga0451851_0309227_244_972 234
251 3300041512 Ga0451853_2319332 Ga0451853_2319332_77_805 234
252 3300042007 Ga0439449_0068031 Ga0439449_0068031_283_1011 234
253 3300046452 Ga0495617_066014 Ga0495617_066014_52_786 234
254 3300046460 Ga0495638_0019601 Ga0495638_0019601_2271_2999 234
255 3300046471 Ga0495650_0042950 Ga0495650_0042950_1000_1728 234
256 3300046474 Ga0495605_0052088 Ga0495605_0052088_573_1301 234
257 3300046492 Ga0495585_0013550 Ga0495585_0013550_850_1587 234
258 3300046492 Ga0495585_0049658 Ga0495585_0049658_782_1519 234
259 3300046501 Ga0495607_0013702 Ga0495607_0013702_1807_2535 234
260 3300046501 Ga0495607_0090783 Ga0495607_0090783_274_1008 234
261 3300046506 Ga0495583_0042245 Ga0495583_0042245_903_1640 234
262 3300046506 Ga0495583_0168385 Ga0495583_0168385_63_797 234
263 3300046507 Ga0495606_0012251 Ga0495606_0012251_2997_3725 234
264 3300046512 Ga0495610_0013733 Ga0495610_0013733_1983_2711 234
265 3300046515 Ga0495620_0008772 Ga0495620_0008772_2750_3478 234
266 3300046515 Ga0495620_0056845 Ga0495620_0056845_240_977 234
267 3300046515 Ga0495620_0059829 Ga0495620_0059829_567_1301 234
268 3300046518 Ga0495631_0001365 Ga0495631_0001365_12188_12922 234
269 3300046518 Ga0495631_0015282 Ga0495631_0015282_1127_1855 234
270 3300046519 Ga0495632_0007666 Ga0495632_0007666_5836_6573 234
271 3300046519 Ga0495632_0010708 Ga0495632_0010708_1804_2532 234
272 3300046519 Ga0495632_0018155 Ga0495632_0018155_1174_1908 234
273 3300046522 Ga0495643_0021589 Ga0495643_0021589_2866_3594 234
274 3300046523 Ga0495644_0090891 Ga0495644_0090891_361_1098 234
275 3300046524 Ga0495648_0036560 Ga0495648_0036560_607_1335 234
276 3300046530 Ga0495654_0010648 Ga0495654_0010648_2798_3526 234
277 3300046558 Ga0495633_0042272 Ga0495633_0042272_809_1555 234
278 3300046558 Ga0495633_0103092 Ga0495633_0103092_389_1162 234
279 3300046558 Ga0495633_0116291 Ga0495633_0116291_53_790 234
280 3300046558 Ga0495633_0228366 Ga0495633_0228366_58_813 234
281 3300046616 Ga0495668_0012249 Ga0495668_0012249_2743_3471 234
282 3300046616 Ga0495668_0015025 Ga0495668_0015025_1163_1897 234
283 3300046616 Ga0495668_0059605 Ga0495668_0059605_935_1672 234
284 3300046648 Ga0495611_0076951 Ga0495611_0076951_166_900 234
285 3300046660 Ga0495625_0005333 Ga0495625_0005333_2948_3676 234
286 3300046660 Ga0495625_0010708 Ga0495625_0010708_866_1600 234
287 3300046660 Ga0495625_0178173 Ga0495625_0178173_12_740 234
288 3300046665 Ga0495661_0046235 Ga0495661_0046235_1031_1759 234
289 3300046674 Ga0495588_0011344 Ga0495588_0011344_173_928 234
290 3300046674 Ga0495588_0100440 Ga0495588_0100440_764_1501 234
291 3300046674 Ga0495588_0353472 Ga0495588_0353472_17_754 234
292 3300046692 Ga0495671_0045382 Ga0495671_0045382_285_1013 234
293 3300046694 Ga0495649_0015885 Ga0495649_0015885_97_825 234
294 3300046810 Ga0495660_0010090 Ga0495660_0010090_2745_3473 234
295 3300047318 Ga0495636_0014471 Ga0495636_0014471_1333_2061 234
296 3300047447 Ga0495685_030140 Ga0495685_030140_232_960 234
297 3300047470 Ga0495681_0000886 Ga0495681_0000886_4407_5162 234
298 3300047470 Ga0495681_0052176 Ga0495681_0052176_816_1544 234
299 3300047470 Ga0495681_0160326 Ga0495681_0160326_66_803 234
300 3300047472 Ga0495686_0015171 Ga0495686_0015171_1803_2531 234
301 3300048091 Ga0495626_0020888 Ga0495626_0020888_1286_2014 234
302 3300048914 Ga0496111_0010102 Ga0496111_0010102_5314_6048 234
303 3300048919 Ga0496116_0161862 Ga0496116_0161862_97_825 234
304 3300048921 Ga0496118_0036725 Ga0496118_0036725_2717_3445 234
305 3300048921 Ga0496118_0043018 Ga0496118_0043018_347_1102 234
306 3300048922 Ga0496119_0021558 Ga0496119_0021558_402_1157 234
307 3300048923 Ga0496120_0052351 Ga0496120_0052351_1167_1922 234
308 3300048924 Ga0496121_0002413 Ga0496121_0002413_16972_17718 234
309 3300048924 Ga0496121_0179947 Ga0496121_0179947_167_895 234
310 3300048924 Ga0496121_0299993 Ga0496121_0299993_94_843 234
311 3300048925 Ga0496122_0022627 Ga0496122_0022627_1221_1955 234
312 3300048926 Ga0496123_0039823 Ga0496123_0039823_659_1393 234
313 3300048927 Ga0496124_0080259 Ga0496124_0080259_702_1436 234
314 3300048928 Ga0496125_0036052 Ga0496125_0036052_667_1422 234
315 3300049569 Ga0501032_0001267 Ga0501032_0001267_10925_11644 234
316 3300049571 Ga0501034_0000001 Ga0501034_0000001_119595_120314 234
317 3300049572 Ga0501036_0417586 Ga0501036_0417586_223_942 234
318 3300049575 Ga0501039_0000029 Ga0501039_0000029_120143_120862 234
319 3300050489 nmdc:mga03683_72308_c1 nmdc:mga03683_72308_c1_499_1227 234
320 3300050491 nmdc:mga00v17_715_c1 nmdc:mga00v17_715_c1_6605_7351 234
321 3300050492 nmdc:mga0yw44_45486_c1 nmdc:mga0yw44_45486_c1_1714_2442 234
322 3300050493 nmdc:mga0k408_6362_c1 nmdc:mga0k408_6362_c1_2817_3545 234
323 3300050496 nmdc:mga07m45_120082_c1 nmdc:mga07m45_120082_c1_499_1227 234
324 3300050516 nmdc:mga0sz30_11253_c1 nmdc:mga0sz30_11253_c1_551_1306 234
325 3300050516 nmdc:mga0sz30_16814_c1 nmdc:mga0sz30_16814_c1_509_1237 234
326 3300053079 Ga0500610_0110854 Ga0500610_0110854_661_1395 234
327 3300053107 Ga0500560_015340 Ga0500560_015340_265_1020 234
328 3300053109 Ga0500569_002172 Ga0500569_002172_1929_2657 234
329 3300053109 Ga0500569_005302 Ga0500569_005302_1461_2195 234
330 3300053118 Ga0500594_0005305 Ga0500594_0005305_899_1633 234
331 3300053125 Ga0500618_002367 Ga0500618_002367_5858_6667 234
332 3300053134 Ga0500658_0001338 Ga0500658_0001338_2719_3447 234
333 3300053156 Ga0500622_0020047 Ga0500622_0020047_1460_2206 234
334 3300053157 Ga0500624_000733 Ga0500624_000733_2856_3611 234
335 3300053161 Ga0500634_0007864 Ga0500634_0007864_4497_5234 234
336 iso_pu_bacteria 2773857925 2774870595 234
337 iso_pu_bacteria 2871495908 2871497308 234
338 iso_pu_bacteria 2878760144 2878761526 234
339 iso_pu_bacteria 2878767105 2878768493 234
340 iso_pu_bacteria 2882456835 2882463769 234
341 iso_pu_bacteria 2882456835 2882463879 234
342 iso_pu_bacteria 2885305155 2885305994 234
343 iso_pu_bacteria 2885334103 2885334922 234
344 iso_pu_bacteria 2903540706 2903542103 234
345 iso_pu_bacteria 2937994558 2937995958 234
346 iso_pu_bacteria 2958165035 2958166429 234
347 iso_pu_bacteria 2961163497 2961164894 234
348 iso_pu_bacteria 2965018300 2965019719 234
349 iso_pu_bacteria 2968171901 2968173294 234
350 iso_pu_bacteria 2970554993 2970556383 234
351 iso_pu_bacteria 2987659509 2987660901 234
352 iso_pu_bacteria 3004188549 3004189951 234
353 3300021320 Ga0214544_1000419 Ga0214544_10004191 235
354 3300021321 Ga0214542_1000027 Ga0214542_1000027135 235
355 3300021327 Ga0214543_1000047 Ga0214543_1000047109 235
356 3300046474 Ga0495605_0120377 Ga0495605_0120377_97_825 235
357 3300046513 Ga0495616_0010845 Ga0495616_0010845_1798_2526 235
358 3300046524 Ga0495648_0073053 Ga0495648_0073053_1238_1966 235
359 3300046660 Ga0495625_0167711 Ga0495625_0167711_124_852 235
360 3300028800 Ga0265338_10276610 Ga0265338_102766102 236
361 iso_pu_bacteria 2854911287 2854913570 236
362 iso_pu_bacteria 2871444079 2871448513 237
363 iso_pu_bacteria 8018176218 8018181049 237
364 3300005458 Ga0070681_10108458 Ga0070681_101084583 238
365 3300006846 Ga0075430_100000293 Ga0075430_10000029325 238
366 3300007788 Ga0099795_10005958 Ga0099795_100059582 238
367 3300009147 Ga0114129_10452712 Ga0114129_104527121 238
368 3300010159 Ga0099796_10060576 Ga0099796_100605763 238
369 3300013250 Ga0171462_1031 Ga0171462_1031104 238
370 3300027512 Ga0209179_1023858 Ga0209179_10238581 238
371 3300035695 Ga0373927_0100848 Ga0373927_0100848_237_968 238
372 3300035725 Ga0373947_0005829 Ga0373947_0005829_2106_2837 238
373 3300037068 Ga0373925_0134136 Ga0373925_0134136_224_955 238
374 3300048918 Ga0496115_0036814 Ga0496115_0036814_467_1198 238
375 3300050507 nmdc:mga05p37_792075_c1 nmdc:mga05p37_792075_c1_18_749 238
376 3300050509 nmdc:mga0qj67_37_c1 nmdc:mga0qj67_37_c1_65296_66021 238
377 iso_pu_bacteria 2509276021 2509389689 238
378 iso_pu_bacteria 2509276033 2509445878 238
379 iso_pu_bacteria 2510065019 2510134976 238
380 iso_pu_bacteria 2510461076 2510896399 238
381 iso_pu_bacteria 2513237084 2513574193 238
382 iso_pu_bacteria 2513237085 2513581170 238
383 iso_pu_bacteria 2513237093 2513636444 238
384 iso_pu_bacteria 2513237103 2513714077 238
385 iso_pu_bacteria 2513237162 2514024581 238
386 iso_pu_bacteria 2515075009 2515114062 238
387 iso_pu_bacteria 2515154113 2515638740 238
388 iso_pu_bacteria 2515154114 2515646103 238
389 iso_pu_bacteria 2515154116 2515661741 238
390 iso_pu_bacteria 2515154134 2515744296 238
391 iso_pu_bacteria 2516653077 2517037699 238
392 iso_pu_bacteria 2516653085 2517077987 238
393 iso_pu_bacteria 2517093000 2517096781 238
394 iso_pu_bacteria 2517287029 2517410488 238
395 iso_pu_bacteria 2519899620 2520381288 238
396 iso_pu_bacteria 2529292951 2530647112 238
397 iso_pu_bacteria 2558860983 2561468147 238
398 iso_pu_bacteria 2582581307 2585272210 238
399 iso_pu_bacteria 2582581315 2585327833 238
400 iso_pu_bacteria 2582581316 2585335728 238
401 iso_pu_bacteria 2585427526 2585530037 238
402 iso_pu_bacteria 2585427527 2585536843 238
403 iso_pu_bacteria 2585427528 2585543801 238
404 iso_pu_bacteria 2585427530 2585555558 238
405 iso_pu_bacteria 2585427593 2585842157 238
406 iso_pu_bacteria 2585427594 2585845289 238
407 iso_pu_bacteria 2615840624 2616298295 238
408 iso_pu_bacteria 2615840626 2616310197 238
409 iso_pu_bacteria 2615840698 2616551357 238
410 iso_pu_bacteria 2643221558 2643813210 238
411 iso_pu_bacteria 2643221618 2644110433 238
412 iso_pu_bacteria 2643221626 2644144971 238
413 iso_pu_bacteria 2643221655 2644307185 238
414 iso_pu_bacteria 2643221659 2644337068 238
415 iso_pu_bacteria 2643221712 2644613265 238
416 iso_pu_bacteria 2667528174 2671114979 238
417 iso_pu_bacteria 2718217927 2719387391 238
418 iso_pu_bacteria 2718217997 2719667050 238
419 iso_pu_bacteria 2718218199 2720493470 238
420 iso_pu_bacteria 2718218232 2720614927 238
421 iso_pu_bacteria 2718218233 2720621698 238
422 iso_pu_bacteria 2718218235 2720633026 238
423 iso_pu_bacteria 2718218269 2720776750 238
424 iso_pu_bacteria 2718218365 2721160220 238
425 iso_pu_bacteria 2718218423 2721401026 238
426 iso_pu_bacteria 2721755556 2723028341 238
427 iso_pu_bacteria 2721755684 2723561968 238
428 iso_pu_bacteria 2721755685 2723568598 238
429 iso_pu_bacteria 2721755809 2724039839 238
430 iso_pu_bacteria 2721755819 2724091357 238
431 iso_pu_bacteria 2721755822 2724105863 238
432 iso_pu_bacteria 2721755823 2724111691 238
433 iso_pu_bacteria 2724679232 2725952194 238
434 iso_pu_bacteria 2728369352 2730109277 238
435 iso_pu_bacteria 2728369397 2730299852 238
436 iso_pu_bacteria 2738541333 2739039002 238
437 iso_pu_bacteria 2765235942 2766065182 238
438 iso_pu_bacteria 2791355123 2792751589 238
439 iso_pu_bacteria 2791355256 2793299736 238
440 iso_pu_bacteria 2791355259 2793318348 238
441 iso_pu_bacteria 2791355260 2793325389 238
442 iso_pu_bacteria 2791355261 2793331588 238
443 iso_pu_bacteria 2791355262 2793338504 238
444 iso_pu_bacteria 2791355263 2793344347 238
445 iso_pu_bacteria 2791355265 2793356429 238
446 iso_pu_bacteria 2791355266 2793364277 238
447 iso_pu_bacteria 2791355267 2793371134 238
448 iso_pu_bacteria 2802429605 2805931953 238
449 iso_pu_bacteria 2802429606 2805938183 238
450 iso_pu_bacteria 2802429633 2806049478 238
451 iso_pu_bacteria 2802429634 2806056538 238
452 iso_pu_bacteria 2802429635 2806063611 238
453 iso_pu_bacteria 2802429636 2806071110 238
454 iso_pu_bacteria 2802429637 2806077914 238
455 iso_pu_bacteria 2818991453 2819644390 238
456 iso_pu_bacteria 2838016132 2838022425 238
457 iso_pu_bacteria 2838022645 2838024176 238
458 iso_pu_bacteria 2838042994 2838048496 238
459 iso_pu_bacteria 2838048938 2838054559 238
460 iso_pu_bacteria 2838061910 2838068291 238
461 iso_pu_bacteria 2838068647 2838074671 238
462 iso_pu_bacteria 2838668709 2838675131 238
463 iso_pu_bacteria 2838680041 2838686473 238
464 iso_pu_bacteria 2838686498 2838693775 238
465 iso_pu_bacteria 2838694306 2838700978 238
466 iso_pu_bacteria 2838701080 2838707468 238
467 iso_pu_bacteria 2838707686 2838714184 238
468 iso_pu_bacteria 2838729681 2838736451 238
469 iso_pu_bacteria 2838742623 2838749227 238
470 iso_pu_bacteria 2841851746 2841858996 238
471 iso_pu_bacteria 2841864319 2841868024 238
472 iso_pu_bacteria 2842077413 2842083760 238
473 iso_pu_bacteria 2842110456 2842117774 238
474 iso_pu_bacteria 2842118031 2842124796 238
475 iso_pu_bacteria 2842146304 2842152040 238
476 iso_pu_bacteria 2842156927 2842163384 238
477 iso_pu_bacteria 2842163707 2842170297 238
478 iso_pu_bacteria 2842180545 2842187012 238
479 iso_pu_bacteria 2842192696 2842198764 238
480 iso_pu_bacteria 2842198810 2842205283 238
481 iso_pu_bacteria 2842205361 2842211432 238
482 iso_pu_bacteria 2842217011 2842223748 238
483 iso_pu_bacteria 2842229732 2842236428 238
484 iso_pu_bacteria 2842237096 2842243596 238
485 iso_pu_bacteria 2842243621 2842250126 238
486 iso_pu_bacteria 2842250916 2842257292 238
487 iso_pu_bacteria 2842257432 2842264136 238
488 iso_pu_bacteria 2842264693 2842269953 238
489 iso_pu_bacteria 2842271015 2842278269 238
490 iso_pu_bacteria 2842278818 2842284880 238
491 iso_pu_bacteria 2842285085 2842290965 238
492 iso_pu_bacteria 2842291075 2842297908 238
493 iso_pu_bacteria 2842304105 2842310397 238
494 iso_pu_bacteria 2842311132 2842317378 238
495 iso_pu_bacteria 2842317721 2842324274 238
496 iso_pu_bacteria 2842341865 2842348608 238
497 iso_pu_bacteria 2842363717 2842370341 238
498 iso_pu_bacteria 2842370503 2842377286 238
499 iso_pu_bacteria 2842377471 2842384380 238
500 iso_pu_bacteria 2842384541 2842391399 238
501 iso_pu_bacteria 2842395702 2842402040 238
502 iso_pu_bacteria 2842402390 2842408856 238
503 iso_pu_bacteria 2842409023 2842415537 238
504 iso_pu_bacteria 2842415677 2842422121 238
505 iso_pu_bacteria 2842422224 2842428277 238
506 iso_pu_bacteria 2842428310 2842433802 238
507 iso_pu_bacteria 2842434925 2842440166 238
508 iso_pu_bacteria 2842441272 2842446823 238
509 iso_pu_bacteria 2842447887 2842453598 238
510 iso_pu_bacteria 2842462802 2842468249 238
511 iso_pu_bacteria 2842469257 2842474775 238
512 iso_pu_bacteria 2842489311 2842495716 238
513 iso_pu_bacteria 2842495871 2842502482 238
514 iso_pu_bacteria 2844163670 2844167878 238
515 iso_pu_bacteria 2844454524 2844457351 238
516 iso_pu_bacteria 2857516855 2857524413 238
517 iso_pu_bacteria 2919408235 2919411889 238
518 iso_pu_bacteria 2933570622 2933576838 238
519 iso_pu_bacteria 2933599457 2933605125 238
520 iso_pu_bacteria 2935894831 2935901312 238
521 iso_pu_bacteria 2935901341 2935908020 238
522 iso_pu_bacteria 2936367885 2936370899 238
523 iso_pu_bacteria 2936375103 2936379975 238
524 iso_pu_bacteria 2936381700 2936387773 238
525 iso_pu_bacteria 2941499720 2941503017 238
526 iso_pu_bacteria 2996893221 2996897147 238
527 iso_pu_bacteria 639633055 639650135 238
528 iso_pu_bacteria 643692032 643823671 238
529 iso_pu_bacteria 8005275841 8005282138 238
530 iso_pu_bacteria 8005282627 8005286999 238
531 iso_pu_bacteria 8005289223 8005293121 238
532 iso_pu_bacteria 8005301065 8005303818 238
533 iso_pu_bacteria 8005307578 8005311393 238
534 iso_pu_bacteria 8005376324 8005378490 238
535 iso_pu_bacteria 8005382845 8005386396 238
536 iso_pu_bacteria 8005395548 8005399401 238
537 iso_pu_bacteria 8005430974 8005435428 238
538 iso_pu_bacteria 8005460587 8005464750 238
539 iso_pu_bacteria 8005497431 8005501788 238
540 iso_pu_bacteria 8005556819 8005560805 238
541 iso_pu_bacteria 8005563573 8005566952 238
542 iso_pu_bacteria 8005570704 8005571009 238
543 iso_pu_bacteria 8005619151 8005623144 238
544 iso_pu_bacteria 8005626139 8005628975 238
545 iso_pu_bacteria 8005668836 8005673212 238
546 iso_pu_bacteria 8005682033 8005688243 238
547 iso_pu_bacteria 8005688590 8005691497 238
548 iso_pu_bacteria 8005695170 8005699109 238
549 iso_pu_bacteria 8018127388 8018131675 238
550 iso_pu_bacteria 8018163183 8018169476 238
551 iso_pu_bacteria 8023680758 8023683691 238
552 iso_pu_bacteria 8024479707 8024482576 238
553 iso_pu_bacteria 8024501048 8024504910 238
554 iso_pu_bacteria 8056375014 8056379724 238
555 iso_pu_bacteria 8056382006 8056385722 238
556 iso_pu_bacteria 8057874678 8057880418 238
557 3300021377 Ga0213874_10000152 Ga0213874_100001527 239
558 3300039450 Ga0436363_1488722 Ga0436363_1488722_3267_4010 239
559 3300039453 Ga0436362_0508840 Ga0436362_0508840_5385_6128 239
560 3300039453 Ga0436362_0955777 Ga0436362_0955777_56_832 239
561 iso_pu_bacteria 2582581304 2585257762 239
562 iso_pu_bacteria 2738541293 2738800505 239
563 iso_pu_bacteria 2915650412 2915650448 239
564 iso_pu_bacteria 2503198000 2503204202 240
565 iso_pu_bacteria 2509276018 2509373266 240
566 iso_pu_bacteria 2509276022 2509398537 240
567 iso_pu_bacteria 2510065059 2510319633 240
568 iso_pu_bacteria 2510461069 2510842757 240
569 iso_pu_bacteria 2588253730 2588513808 240
570 iso_pu_bacteria 2597489875 2597816361 240
571 iso_pu_bacteria 2599185236 2599724132 240
572 iso_pu_bacteria 2687453392 2688600925 240
573 iso_pu_bacteria 2693429783 2694631395 240
574 iso_pu_bacteria 2693429784 2694636615 240
575 iso_pu_bacteria 2721755686 2723571701 240
576 iso_pu_bacteria 2841734538 2841737759 240
577 iso_pu_bacteria 2844002411 2844002823 240
578 iso_pu_bacteria 2844009547 2844011503 240
579 iso_pu_bacteria 2847670302 2847674004 240
580 iso_pu_bacteria 2847686936 2847689048 240
581 iso_pu_bacteria 2856314179 2856317123 240
582 iso_pu_bacteria 2856320880 2856322339 240
583 iso_pu_bacteria 2856334872 2856340190 240
584 iso_pu_bacteria 2856342000 2856342180 240
585 iso_pu_bacteria 2856342000 2856344738 240
586 iso_pu_bacteria 2856349417 2856350252 240
587 iso_pu_bacteria 2856356410 2856360476 240
588 iso_pu_bacteria 2856364286 2856367723 240
589 iso_pu_bacteria 2857349434 2857349886 240
590 iso_pu_bacteria 2857367948 2857372117 240
591 iso_pu_bacteria 2869169390 2869171862 240
592 iso_pu_bacteria 2869234852 2869236170 240
593 iso_pu_bacteria 2869242130 2869248228 240
594 iso_pu_bacteria 2869249662 2869253057 240
595 iso_pu_bacteria 2869256925 2869261347 240
596 iso_pu_bacteria 2869264136 2869266084 240
597 iso_pu_bacteria 2869271264 2869272012 240
598 iso_pu_bacteria 2869278585 2869282984 240
599 iso_pu_bacteria 2869285874 2869288952 240
600 iso_pu_bacteria 2871435913 2871437135 240
601 iso_pu_bacteria 2871451962 2871453627 240
602 iso_pu_bacteria 2871459585 2871461123 240
603 iso_pu_bacteria 2871466892 2871468878 240
604 iso_pu_bacteria 2871474448 2871479770 240
605 iso_pu_bacteria 2871481445 2871487529 240
606 iso_pu_bacteria 2871488783 2871491667 240
607 iso_pu_bacteria 2871495908 2871499078 240
608 iso_pu_bacteria 2871495908 2871500886 240
609 iso_pu_bacteria 2874102143 2874108573 240
610 iso_pu_bacteria 2874109183 2874112807 240
611 iso_pu_bacteria 2874116593 2874117031 240
612 iso_pu_bacteria 2874123672 2874127421 240
613 iso_pu_bacteria 2874131515 2874132529 240
614 iso_pu_bacteria 2874139085 2874141697 240
615 iso_pu_bacteria 2874146452 2874151082 240
616 iso_pu_bacteria 2874155637 2874158688 240
617 iso_pu_bacteria 2874162495 2874167108 240
618 iso_pu_bacteria 2874168670 2874172774 240
619 iso_pu_bacteria 2876369609 2876375893 240
620 iso_pu_bacteria 2876386047 2876390254 240
621 iso_pu_bacteria 2876392853 2876393221 240
622 iso_pu_bacteria 2876399893 2876405444 240
623 iso_pu_bacteria 2876406927 2876407501 240
624 iso_pu_bacteria 2876413966 2876417104 240
625 iso_pu_bacteria 2876420981 2876424100 240
626 iso_pu_bacteria 2878035449 2878036666 240
627 iso_pu_bacteria 2878730984 2878734859 240
628 iso_pu_bacteria 2878738818 2878741836 240
629 iso_pu_bacteria 2878745973 2878748907 240
630 iso_pu_bacteria 2878753008 2878754912 240
631 iso_pu_bacteria 2878760144 2878763277 240
632 iso_pu_bacteria 2878760144 2878764945 240
633 iso_pu_bacteria 2878767105 2878770265 240
634 iso_pu_bacteria 2878767105 2878772078 240
635 iso_pu_bacteria 2878774303 2878780443 240
636 iso_pu_bacteria 2878788777 2878795642 240
637 iso_pu_bacteria 2881147464 2881148810 240
638 iso_pu_bacteria 2881155292 2881159897 240
639 iso_pu_bacteria 2881161766 2881165587 240
640 iso_pu_bacteria 2881845957 2881850088 240
641 iso_pu_bacteria 2881853255 2881857433 240
642 iso_pu_bacteria 2881861095 2881866387 240
643 iso_pu_bacteria 2881861095 2881866412 240
644 iso_pu_bacteria 2882912400 2882914345 240
645 iso_pu_bacteria 2885305155 2885305620 240
646 iso_pu_bacteria 2885312484 2885314969 240
647 iso_pu_bacteria 2885318864 2885324060 240
648 iso_pu_bacteria 2885326080 2885328177 240
649 iso_pu_bacteria 2885334103 2885340575 240
650 iso_pu_bacteria 2885342637 2885350262 240
651 iso_pu_bacteria 2885350715 2885356544 240
652 iso_pu_bacteria 2888337043 2888337283 240
653 iso_pu_bacteria 2888343758 2888349550 240
654 iso_pu_bacteria 2888350351 2888353802 240
655 iso_pu_bacteria 2889010040 2889015525 240
656 iso_pu_bacteria 2889016732 2889019407 240
657 iso_pu_bacteria 2903448605 2903455821 240
658 iso_pu_bacteria 2903492973 2903505784 240
659 iso_pu_bacteria 2903513507 2903520532 240
660 iso_pu_bacteria 2903540706 2903543880 240
661 iso_pu_bacteria 2903540706 2903545702 240
662 iso_pu_bacteria 2904659560 2904660679 240
663 iso_pu_bacteria 2906308376 2906311349 240
664 iso_pu_bacteria 2906328253 2906330996 240
665 iso_pu_bacteria 2906354277 2906359546 240
666 iso_pu_bacteria 2906363423 2906365590 240
667 iso_pu_bacteria 2906370794 2906375363 240
668 iso_pu_bacteria 2906378014 2906379487 240
669 iso_pu_bacteria 2906386501 2906390495 240
670 iso_pu_bacteria 2906393657 2906396569 240
671 iso_pu_bacteria 2906401398 2906401558 240
672 iso_pu_bacteria 2906408224 2906413531 240
673 iso_pu_bacteria 2906414383 2906417029 240
674 iso_pu_bacteria 2906427513 2906435316 240
675 iso_pu_bacteria 2922130491 2922134716 240
676 iso_pu_bacteria 2922151315 2922156468 240
677 iso_pu_bacteria 2922158528 2922158782 240
678 iso_pu_bacteria 2922172374 2922173885 240
679 iso_pu_bacteria 2922178524 2922181482 240
680 iso_pu_bacteria 2922185730 2922188479 240
681 iso_pu_bacteria 2924710171 2924711701 240
682 iso_pu_bacteria 2924718760 2924719637 240
683 iso_pu_bacteria 2924726620 2924730043 240
684 iso_pu_bacteria 2924733363 2924739756 240
685 iso_pu_bacteria 2924741084 2924745759 240
686 iso_pu_bacteria 2924748358 2924754014 240
687 iso_pu_bacteria 2924754689 2924760918 240
688 iso_pu_bacteria 2924762789 2924767945 240
689 iso_pu_bacteria 2924776078 2924779520 240
690 iso_pu_bacteria 2924784321 2924786943 240
691 iso_pu_bacteria 2937813078 2937816561 240
692 iso_pu_bacteria 2937822353 2937829454 240
693 iso_pu_bacteria 2937836603 2937840643 240
694 iso_pu_bacteria 2937848649 2937854050 240
695 iso_pu_bacteria 2937861824 2937864175 240
696 iso_pu_bacteria 2937868953 2937870026 240
697 iso_pu_bacteria 2937877337 2937881682 240
698 iso_pu_bacteria 2937891427 2937894686 240
699 iso_pu_bacteria 2937972304 2937974128 240
700 iso_pu_bacteria 2937980651 2937988510 240
701 iso_pu_bacteria 2937994558 2937997729 240
702 iso_pu_bacteria 2937994558 2937999553 240
703 iso_pu_bacteria 2958034702 2958039005 240
704 iso_pu_bacteria 2958041894 2958051403 240
705 iso_pu_bacteria 2958071322 2958074239 240
706 iso_pu_bacteria 2958084443 2958085604 240
707 iso_pu_bacteria 2958092219 2958098518 240
708 iso_pu_bacteria 2958100919 2958104656 240
709 iso_pu_bacteria 2958108152 2958110999 240
710 iso_pu_bacteria 2958115193 2958115435 240
711 iso_pu_bacteria 2958115193 2958119951 240
712 iso_pu_bacteria 2958122699 2958124615 240
713 iso_pu_bacteria 2958130278 2958133539 240
714 iso_pu_bacteria 2958137437 2958143096 240
715 iso_pu_bacteria 2958144490 2958144550 240
716 iso_pu_bacteria 2958158011 2958162438 240
717 iso_pu_bacteria 2958165035 2958168202 240
718 iso_pu_bacteria 2958165035 2958170026 240
719 iso_pu_bacteria 2958172287 2958175748 240
720 iso_pu_bacteria 2958179912 2958183103 240
721 iso_pu_bacteria 2961077736 2961080902 240
722 iso_pu_bacteria 2961114664 2961115834 240
723 iso_pu_bacteria 2961127735 2961134451 240
724 iso_pu_bacteria 2961136820 2961139414 240
725 iso_pu_bacteria 2961163497 2961166668 240
726 iso_pu_bacteria 2961163497 2961168483 240
727 iso_pu_bacteria 2961170736 2961172422 240
728 iso_pu_bacteria 2961183825 2961186527 240
729 iso_pu_bacteria 2965018300 2965021491 240
730 iso_pu_bacteria 2965018300 2965023302 240
731 iso_pu_bacteria 2965032056 2965035702 240
732 iso_pu_bacteria 2965040258 2965046930 240
733 iso_pu_bacteria 2965047637 2965049725 240
734 iso_pu_bacteria 2965062239 2965064450 240
735 iso_pu_bacteria 2965062239 2965066251 240
736 iso_pu_bacteria 2965089291 2965094606 240
737 iso_pu_bacteria 2965102966 2965105295 240
738 iso_pu_bacteria 2965110997 2965115199 240
739 iso_pu_bacteria 2965119406 2965121726 240
740 iso_pu_bacteria 2968003550 2968006521 240
741 iso_pu_bacteria 2968016561 2968023305 240
742 iso_pu_bacteria 2968083720 2968085740 240
743 iso_pu_bacteria 2968091066 2968091105 240
744 iso_pu_bacteria 2968097103 2968100484 240
745 iso_pu_bacteria 2968110612 2968111737 240
746 iso_pu_bacteria 2968117919 2968123951 240
747 iso_pu_bacteria 2968128360 2968134354 240
748 iso_pu_bacteria 2968138860 2968140140 240
749 iso_pu_bacteria 2968171901 2968175073 240
750 iso_pu_bacteria 2968171901 2968176888 240
751 iso_pu_bacteria 2970469710 2970475887 240
752 iso_pu_bacteria 2970489779 2970496076 240
753 iso_pu_bacteria 2970503327 2970505015 240
754 iso_pu_bacteria 2970510686 2970516718 240
755 iso_pu_bacteria 2970532167 2970534716 240
756 iso_pu_bacteria 2970547951 2970550918 240
757 iso_pu_bacteria 2970554993 2970558122 240
758 iso_pu_bacteria 2970554993 2970559793 240
759 iso_pu_bacteria 2970593180 2970597602 240
760 iso_pu_bacteria 2970627176 2970634235 240
761 iso_pu_bacteria 2977821940 2977824760 240
762 iso_pu_bacteria 2977828996 2977831550 240
763 iso_pu_bacteria 2977851361 2977852657 240
764 iso_pu_bacteria 2977858184 2977859695 240
765 iso_pu_bacteria 2977864932 2977866274 240
766 iso_pu_bacteria 2977872689 2977879954 240
767 iso_pu_bacteria 2977898635 2977905806 240
768 iso_pu_bacteria 2977907340 2977909562 240
769 iso_pu_bacteria 2977915119 2977920619 240
770 iso_pu_bacteria 2977922695 2977928079 240
771 iso_pu_bacteria 2977935797 2977938756 240
772 iso_pu_bacteria 2977942078 2977946988 240
773 iso_pu_bacteria 2977950692 2977953222 240
774 iso_pu_bacteria 2977957713 2977961032 240
775 iso_pu_bacteria 2977971508 2977977253 240
776 iso_pu_bacteria 2979710463 2979715368 240
777 iso_pu_bacteria 2979742915 2979745936 240
778 iso_pu_bacteria 2979764755 2979767727 240
779 iso_pu_bacteria 2979772303 2979777240 240
780 iso_pu_bacteria 2979779861 2979786159 240
781 iso_pu_bacteria 2979793036 2979795187 240
782 iso_pu_bacteria 2979808191 2979809658 240
783 iso_pu_bacteria 2987636660 2987637217 240
784 iso_pu_bacteria 2987645492 2987649740 240
785 iso_pu_bacteria 2987652177 2987658358 240
786 iso_pu_bacteria 2987659509 2987662680 240
787 iso_pu_bacteria 2987659509 2987664501 240
788 iso_pu_bacteria 2987666974 2987670274 240
789 iso_pu_bacteria 2987673487 2987679143 240
790 iso_pu_bacteria 2996341866 2996345536 240
791 iso_pu_bacteria 2996348954 2996354442 240
792 iso_pu_bacteria 2996386984 2996391490 240
793 iso_pu_bacteria 3000135777 3000138056 240
794 iso_pu_bacteria 3004167301 3004174950 240
795 iso_pu_bacteria 3004188549 3004191730 240
796 iso_pu_bacteria 3004188549 3004193558 240
797 iso_pu_bacteria 3004195979 3004196347 240
798 iso_pu_bacteria 3004203850 3004203950 240
799 iso_pu_bacteria 3004211236 3004214211 240
800 iso_pu_bacteria 3004218560 3004223593 240
801 iso_pu_bacteria 3004232784 3004232822 240
802 iso_pu_bacteria 3004239961 3004241703 240
803 iso_pu_bacteria 3004248173 3004251460 240
804 iso_pu_bacteria 3004268573 3004271913 240
805 iso_pu_bacteria 3004275668 3004281090 240
806 iso_pu_bacteria 3004289098 3004296357 240
807 iso_pu_bacteria 3004334049 3004341994 240
808 iso_pu_bacteria 649633066 649875413 240
809 iso_pu_bacteria 8004300914 8004302539 240
810 iso_pu_bacteria 8004312739 8004318109 240
811 iso_pu_bacteria 8004361976 8004363686 240
812 iso_pu_bacteria 8004374579 8004376495 240
813 iso_pu_bacteria 8004387939 8004391010 240
814 iso_pu_bacteria 8004395343 8004396750 240
815 iso_pu_bacteria 8004445564 8004447365 240
816 iso_pu_bacteria 8004633249 8004637021 240
817 iso_pu_bacteria 8004695233 8004697825 240
818 iso_pu_bacteria 8004703790 8004705237 240
819 iso_pu_bacteria 8004703790 8004714194 240
820 iso_pu_bacteria 8004714634 8004717686 240
821 iso_pu_bacteria 8004727605 8004730876 240
822 iso_pu_bacteria 8018150411 8018155279 240
823 iso_pu_bacteria 8055431914 8055432073 240
824 iso_pu_bacteria 8055617313 8055624071 240
825 3300003215 JGI25153J46596_10004335 JGI25153J46596_100043354 241
826 3300013104 Ga0157370_10333820 Ga0157370_103338201 241
827 3300021388 Ga0213875_10003167 Ga0213875_100031677 241
828 3300025297 Ga0209758_1003633 Ga0209758_100363310 241
829 3300037853 Ga0436364_0320847 Ga0436364_0320847_4335_5084 241
830 iso_pu_bacteria 2508501122 2509109278 241
831 iso_pu_bacteria 2509276019 2509377774 241
832 iso_pu_bacteria 2510065057 2510302815 241
833 iso_pu_bacteria 2510917028 2511185140 241
834 iso_pu_bacteria 2511231052 2511497872 241
835 iso_pu_bacteria 2512047086 2512529042 241
836 iso_pu_bacteria 2512875016 2512934665 241
837 iso_pu_bacteria 2512875024 2512963018 241
838 iso_pu_bacteria 2513237086 2513584278 241
839 iso_pu_bacteria 2513237088 2513597127 241
840 iso_pu_bacteria 2513237091 2513616510 241
841 iso_pu_bacteria 2513237138 2513870777 241
842 iso_pu_bacteria 2513237140 2513885275 241
843 iso_pu_bacteria 2513237143 2513901921 241
844 iso_pu_bacteria 2513237146 2513923942 241
845 iso_pu_bacteria 2513237159 2513999121 241
846 iso_pu_bacteria 2513237164 2514037833 241
847 iso_pu_bacteria 2515154107 2515610637 241
848 iso_pu_bacteria 2516143018 2516206839 241
849 iso_pu_bacteria 2516653046 2516896484 241
850 iso_pu_bacteria 2524023207 2524451996 241
851 iso_pu_bacteria 2534681796 2535519490 241
852 iso_pu_bacteria 2551306084 2551679688 241
853 iso_pu_bacteria 2551306085 2551684133 241
854 iso_pu_bacteria 2551306086 2551693551 241
855 iso_pu_bacteria 2551306087 2551701169 241
856 iso_pu_bacteria 2551306089 2551710971 241
857 iso_pu_bacteria 2551306091 2551726949 241
858 iso_pu_bacteria 2551306092 2551734766 241
859 iso_pu_bacteria 2551306093 2551741286 241
860 iso_pu_bacteria 2558860100 2558860780 241
861 iso_pu_bacteria 2582581294 2585202521 241
862 iso_pu_bacteria 2582581299 2585227772 241
863 iso_pu_bacteria 2582581306 2585269196 241
864 iso_pu_bacteria 2582581865 2585390808 241
865 iso_pu_bacteria 2582581866 2585396974 241
866 iso_pu_bacteria 2582581867 2585402168 241
867 iso_pu_bacteria 2585427590 2585822532 241
868 iso_pu_bacteria 2585427609 2585906955 241
869 iso_pu_bacteria 2585428125 2587982376 241
870 iso_pu_bacteria 2599185170 2599415985 241
871 iso_pu_bacteria 2643221557 2643804537 241
872 iso_pu_bacteria 2643221599 2644006353 241
873 iso_pu_bacteria 2643221610 2644065504 241
874 iso_pu_bacteria 2643221634 2644195832 241
875 iso_pu_bacteria 2643221668 2644375506 241
876 iso_pu_bacteria 2643221675 2644417106 241
877 iso_pu_bacteria 2643221680 2644448142 241
878 iso_pu_bacteria 2643221723 2644677643 241
879 iso_pu_bacteria 2643221726 2644686705 241
880 iso_pu_bacteria 2657244999 2657685076 241
881 iso_pu_bacteria 2690316117 2692319050 241
882 iso_pu_bacteria 2756170246 2756674747 241
883 iso_pu_bacteria 2791355082 2792583665 241
884 iso_pu_bacteria 2802429268 2804754909 241
885 iso_pu_bacteria 2838035591 2838036101 241
886 iso_pu_bacteria 2838074704 2838079034 241
887 iso_pu_bacteria 2838661181 2838667333 241
888 iso_pu_bacteria 2842521101 2842524865 241
889 iso_pu_bacteria 2847417321 2847422450 241
890 iso_pu_bacteria 2848992105 2848998142 241
891 iso_pu_bacteria 2850079185 2850085027 241
892 iso_pu_bacteria 2855825444 2855828691 241
893 iso_pu_bacteria 2855839649 2855843814 241
894 iso_pu_bacteria 2855872281 2855875787 241
895 iso_pu_bacteria 2858800743 2858806942 241
896 iso_pu_bacteria 2871451962 2871456326 241
897 iso_pu_bacteria 2882632389 2882638010 241
898 iso_pu_bacteria 2896384573 2896386228 241
899 iso_pu_bacteria 2913295892 2913295918 241
900 iso_pu_bacteria 2915986958 2915992544 241
901 iso_pu_bacteria 2915993759 2915996825 241
902 iso_pu_bacteria 2916000859 2916006516 241
903 iso_pu_bacteria 2916007675 2916011016 241
904 iso_pu_bacteria 2916014648 2916016440 241
905 iso_pu_bacteria 2916021584 2916026263 241
906 iso_pu_bacteria 2916028427 2916034917 241
907 iso_pu_bacteria 2916035215 2916036550 241
908 iso_pu_bacteria 2916041962 2916047080 241
909 iso_pu_bacteria 2916048683 2916054603 241
910 iso_pu_bacteria 2916055098 2916056234 241
911 iso_pu_bacteria 2916068649 2916073913 241
912 iso_pu_bacteria 2916076590 2916078095 241
913 iso_pu_bacteria 2920760137 2920766502 241
914 iso_pu_bacteria 2921201388 2921208510 241
915 iso_pu_bacteria 2921208531 2921213992 241
916 iso_pu_bacteria 2921237296 2921242676 241
917 iso_pu_bacteria 2921244191 2921248640 241
918 iso_pu_bacteria 2921257292 2921258945 241
919 iso_pu_bacteria 2921263974 2921264834 241
920 iso_pu_bacteria 2921282425 2921285788 241
921 iso_pu_bacteria 2921289301 2921290397 241
922 iso_pu_bacteria 2923556063 2923562501 241
923 iso_pu_bacteria 2924144063 2924147790 241
924 iso_pu_bacteria 2924150972 2924153341 241
925 iso_pu_bacteria 2924158325 2924165413 241
926 iso_pu_bacteria 2924165586 2924168323 241
927 iso_pu_bacteria 2924172951 2924173230 241
928 iso_pu_bacteria 2924179722 2924179971 241
929 iso_pu_bacteria 2924186466 2924189906 241
930 iso_pu_bacteria 2924193448 2924195879 241
931 iso_pu_bacteria 2924200457 2924203124 241
932 iso_pu_bacteria 2924207177 2924209030 241
933 iso_pu_bacteria 2924214083 2924214516 241
934 iso_pu_bacteria 2924221636 2924228716 241
935 iso_pu_bacteria 2924228884 2924231201 241
936 iso_pu_bacteria 2933016740 2933019326 241
937 iso_pu_bacteria 2937002841 2937004470 241
938 iso_pu_bacteria 2937009748 2937014399 241
939 iso_pu_bacteria 2937016420 2937017681 241
940 iso_pu_bacteria 2937023124 2937024058 241
941 iso_pu_bacteria 2937042894 2937048758 241
942 iso_pu_bacteria 2937049772 2937056315 241
943 iso_pu_bacteria 2937056579 2937060518 241
944 iso_pu_bacteria 2937063883 2937064865 241
945 iso_pu_bacteria 2937071275 2937077286 241
946 iso_pu_bacteria 2937091812 2937092372 241
947 iso_pu_bacteria 2937098957 2937102646 241
948 iso_pu_bacteria 2937106411 2937109533 241
949 iso_pu_bacteria 2937113482 2937118737 241
950 iso_pu_bacteria 2937119839 2937125918 241
951 iso_pu_bacteria 2937126314 2937130955 241
952 iso_pu_bacteria 2957382221 2957383127 241
953 iso_pu_bacteria 2957388812 2957389641 241
954 iso_pu_bacteria 2957395598 2957398123 241
955 iso_pu_bacteria 2957402308 2957404611 241
956 iso_pu_bacteria 2957408893 2957410616 241
957 iso_pu_bacteria 2957415311 2957419854 241
958 iso_pu_bacteria 2957422303 2957429184 241
959 iso_pu_bacteria 2957430029 2957434419 241
960 iso_pu_bacteria 2957443900 2957448963 241
961 iso_pu_bacteria 2957450854 2957451554 241
962 iso_pu_bacteria 2957457609 2957463950 241
963 iso_pu_bacteria 2957464669 2957464737 241
964 iso_pu_bacteria 2957471148 2957472201 241
965 iso_pu_bacteria 2957478035 2957478381 241
966 iso_pu_bacteria 2957484790 2957488766 241
967 iso_pu_bacteria 2957491536 2957491602 241
968 iso_pu_bacteria 2957498199 2957499636 241
969 iso_pu_bacteria 2957505466 2957507190 241
970 iso_pu_bacteria 2960584000 2960584563 241
971 iso_pu_bacteria 2960597568 2960600138 241
972 iso_pu_bacteria 2960603979 2960607052 241
973 iso_pu_bacteria 2960610863 2960613524 241
974 iso_pu_bacteria 2960617483 2960623080 241
975 iso_pu_bacteria 2960624210 2960626979 241
976 iso_pu_bacteria 2960637947 2960641808 241
977 iso_pu_bacteria 2960645483 2960645551 241
978 iso_pu_bacteria 2960652885 2960657423 241
979 iso_pu_bacteria 2960660292 2960666063 241
980 iso_pu_bacteria 2960667422 2960668252 241
981 iso_pu_bacteria 2960674078 2960678469 241
982 iso_pu_bacteria 2960687367 2960692893 241
983 iso_pu_bacteria 2963644680 2963650951 241
984 iso_pu_bacteria 2964607997 2964614601 241
985 iso_pu_bacteria 2964615318 2964621744 241
986 iso_pu_bacteria 2964621998 2964624364 241
987 iso_pu_bacteria 2964628898 2964631701 241
988 iso_pu_bacteria 2964636051 2964639580 241
989 iso_pu_bacteria 2964643177 2964647870 241
990 iso_pu_bacteria 2964649959 2964652898 241
991 iso_pu_bacteria 2964656573 2964657913 241
992 iso_pu_bacteria 2964663802 2964665201 241
993 iso_pu_bacteria 2964670856 2964671466 241
994 iso_pu_bacteria 2964678106 2964680896 241
995 iso_pu_bacteria 2964685014 2964689075 241
996 iso_pu_bacteria 2964691889 2964696517 241
997 iso_pu_bacteria 2964698721 2964703033 241
998 iso_pu_bacteria 2964705432 2964711395 241
999 iso_pu_bacteria 2964712639 2964718475 241
1000 iso_pu_bacteria 2964719344 2964724696 241
1001 iso_pu_bacteria 2967664464 2967665277 241
1002 iso_pu_bacteria 2967671571 2967675967 241
1003 iso_pu_bacteria 2967678726 2967680766 241
1004 iso_pu_bacteria 2967693043 2967697922 241
1005 iso_pu_bacteria 2967699805 2967704683 241
1006 iso_pu_bacteria 2967706974 2967711867 241
1007 iso_pu_bacteria 2967714385 2967720853 241
1008 iso_pu_bacteria 2967721400 2967724886 241
1009 iso_pu_bacteria 2967735183 2967741787 241
1010 iso_pu_bacteria 2967742019 2967743162 241
1011 iso_pu_bacteria 2967748971 2967750949 241
1012 iso_pu_bacteria 2967755722 2967761777 241
1013 iso_pu_bacteria 2967762386 2967762989 241
1014 iso_pu_bacteria 2967769361 2967772186 241
1015 iso_pu_bacteria 2967775926 2967777663 241
1016 iso_pu_bacteria 2970019648 2970023716 241
1017 iso_pu_bacteria 2970033650 2970034616 241
1018 iso_pu_bacteria 2970040964 2970042845 241
1019 iso_pu_bacteria 2970047711 2970051994 241
1020 iso_pu_bacteria 2970054988 2970057861 241
1021 iso_pu_bacteria 2970061556 2970068318 241
1022 iso_pu_bacteria 2970068827 2970069126 241
1023 iso_pu_bacteria 2970076120 2970077261 241
1024 iso_pu_bacteria 2970088815 2970094650 241
1025 iso_pu_bacteria 2970095765 2970101013 241
1026 iso_pu_bacteria 2970102677 2970105684 241
1027 iso_pu_bacteria 2970109326 2970110614 241
1028 iso_pu_bacteria 2970116247 2970122456 241
1029 iso_pu_bacteria 2970129317 2970134831 241
1030 iso_pu_bacteria 2970136068 2970137483 241
1031 iso_pu_bacteria 2970149975 2970153087 241
1032 iso_pu_bacteria 2970156795 2970157681 241
1033 iso_pu_bacteria 2970164137 2970164745 241
1034 iso_pu_bacteria 2970170962 2970174409 241
1035 iso_pu_bacteria 2970177841 2970179293 241
1036 iso_pu_bacteria 2970184632 2970189920 241
1037 iso_pu_bacteria 2970191845 2970196782 241
1038 iso_pu_bacteria 2977516862 2977520362 241
1039 iso_pu_bacteria 2977523885 2977526679 241
1040 iso_pu_bacteria 2977537788 2977539070 241
1041 iso_pu_bacteria 2977551784 2977555269 241
1042 iso_pu_bacteria 2977558990 2977562035 241
1043 iso_pu_bacteria 2977565890 2977566855 241
1044 iso_pu_bacteria 2977572785 2977574182 241
1045 iso_pu_bacteria 2977579622 2977580761 241
1046 iso_pu_bacteria 2977986579 2977988178 241
1047 iso_pu_bacteria 2996887358 2996890609 241
1048 iso_pu_bacteria 3004211236 3004217384 241
1049 iso_pu_bacteria 3004218560 3004220182 241
1050 iso_pu_bacteria 3005409236 3005413471 241
1051 iso_pu_bacteria 3005452660 3005455497 241
1052 iso_pu_bacteria 637000159 637077865 241
1053 iso_pu_bacteria 648276728 648739032 241
1054 iso_pu_bacteria 8002285264 8002291351 241
1055 iso_pu_bacteria 8003992118 8003996374 241
1056 iso_pu_bacteria 8005258706 8005264272 241
1057 iso_pu_bacteria 8005321885 8005325136 241
1058 iso_pu_bacteria 8005542996 8005547183 241
1059 iso_pu_bacteria 8049293176 8049298032 241
1060 iso_pu_bacteria 8054460903 8054464578 241
1061 iso_pu_bacteria 8054558443 8054562229 241
1062 3300001979 JGI24740J21852_10001752 JGI24740J21852_100017528 242
1063 3300002704 JGI25155J39150_1000047 JGI25155J39150_100004753 242
1064 3300002737 JGI25162J39368_1000184 JGI25162J39368_100018441 242
1065 3300003214 JGI25165J46597_1000163 JGI25165J46597_100016310 242
1066 3300003323 rootH1_10098713 rootH1_100987135 242
1067 3300003771 Ga0055526_1003124 Ga0055526_10031245 242
1068 3300003790 Ga0055528_1000538 Ga0055528_100053823 242
1069 3300005444 Ga0070694_100111903 Ga0070694_1001119033 242
1070 3300005543 Ga0070672_100590812 Ga0070672_1005908122 242
1071 3300005563 Ga0068855_100430723 Ga0068855_1004307233 242
1072 3300005614 Ga0068856_100028797 Ga0068856_1000287974 242
1073 3300005834 Ga0068851_10013459 Ga0068851_100134594 242
1074 3300009093 Ga0105240_10000976 Ga0105240_1000097642 242
1075 3300009177 Ga0105248_10153432 Ga0105248_101534324 242
1076 3300009545 Ga0105237_10102993 Ga0105237_101029935 242
1077 3300010375 Ga0105239_10141372 Ga0105239_101413723 242
1078 3300015262 Ga0182007_10085535 Ga0182007_100855352 242
1079 3300015265 Ga0182005_1016198 Ga0182005_10161981 242
1080 3300021321 Ga0214542_1026066 Ga0214542_10260664 242
1081 3300021327 Ga0214543_1000023 Ga0214543_1000023189 242
1082 3300025233 Ga0209437_100095 Ga0209437_100095198 242
1083 3300025253 Ga0209677_100248 Ga0209677_10024823 242
1084 3300025254 Ga0209148_1016097 Ga0209148_10160972 242
1085 3300025261 Ga0209233_1000117 Ga0209233_1000117198 242
1086 3300025261 Ga0209233_1000340 Ga0209233_100034026 242
1087 3300025273 Ga0209673_1001128 Ga0209673_100112823 242
1088 3300025295 Ga0209564_1001203 Ga0209564_100120323 242
1089 3300025295 Ga0209564_1036666 Ga0209564_10366663 242
1090 3300025299 Ga0209256_1001204 Ga0209256_100120423 242
1091 3300025321 Ga0207656_10047898 Ga0207656_100478983 242
1092 3300025913 Ga0207695_10000948 Ga0207695_1000094841 242
1093 3300025949 Ga0207667_10547329 Ga0207667_105473292 242
1094 3300025981 Ga0207640_10514252 Ga0207640_105142521 242
1095 3300025986 Ga0207658_10656325 Ga0207658_106563251 242
1096 3300026078 Ga0207702_10007214 Ga0207702_100072148 242
1097 3300026142 Ga0207698_10895898 Ga0207698_108958982 242
1098 3300027111 Ga0209281_1000190 Ga0209281_100019033 242
1099 3300031852 Ga0307410_10125074 Ga0307410_101250742 242
1100 3300035692 Ga0373935_0144311 Ga0373935_0144311_232_963 242
1101 3300035695 Ga0373927_0000791 Ga0373927_0000791_19580_20311 242
1102 3300035725 Ga0373947_0335150 Ga0373947_0335150_74_805 242
1103 3300037068 Ga0373925_0004861 Ga0373925_0004861_9180_9911 242
1104 3300041413 Ga0439465_0052380 Ga0439465_0052380_528_1265 242
1105 3300041491 Ga0451833_1356226 Ga0451833_1356226_1130_1876 242
1106 3300041496 Ga0451839_0565953 Ga0451839_0565953_105_851 242
1107 3300041503 Ga0451847_0695760 Ga0451847_0695760_2092_2838 242
1108 3300042007 Ga0439449_0009140 Ga0439449_0009140_1434_2171 242
1109 3300045976 Ga0466967_0789901 Ga0466967_0789901_153_881 242
1110 3300046454 Ga0495592_0068539 Ga0495592_0068539_1163_1900 242
1111 3300046459 Ga0495629_0022307 Ga0495629_0022307_3448_4185 242
1112 3300046463 Ga0495653_0246493 Ga0495653_0246493_54_791 242
1113 3300046476 Ga0495662_0008536 Ga0495662_0008536_3961_4698 242
1114 3300046529 Ga0495652_0029055 Ga0495652_0029055_2532_3269 242
1115 3300046536 Ga0495587_0128839 Ga0495587_0128839_548_1285 242
1116 3300046557 Ga0495622_0022522 Ga0495622_0022522_614_1351 242
1117 3300046615 Ga0495656_0112183 Ga0495656_0112183_138_866 242
1118 3300046663 Ga0495635_0032933 Ga0495635_0032933_471_1208 242
1119 3300046679 Ga0495623_0079985 Ga0495623_0079985_220_957 242
1120 3300046683 Ga0495658_0010868 Ga0495658_0010868_1011_1748 242
1121 3300046809 Ga0495600_0015203 Ga0495600_0015203_521_1258 242
1122 3300047317 Ga0495604_0068405 Ga0495604_0068405_94_831 242
1123 3300048903 Ga0496100_0037922 Ga0496100_0037922_1696_2424 242
1124 3300048906 Ga0496103_0072147 Ga0496103_0072147_1347_2075 242
1125 3300048920 Ga0496117_0033094 Ga0496117_0033094_230_958 242
1126 3300048920 Ga0496117_0033151 Ga0496117_0033151_216_944 242
1127 3300048921 Ga0496118_0017759 Ga0496118_0017759_2764_3492 242
1128 3300048921 Ga0496118_0037294 Ga0496118_0037294_230_958 242
1129 3300048922 Ga0496119_0019866 Ga0496119_0019866_3350_4078 242
1130 3300048922 Ga0496119_0020292 Ga0496119_0020292_3699_4427 242
1131 3300048923 Ga0496120_0004705 Ga0496120_0004705_5945_6673 242
1132 3300048923 Ga0496120_0045466 Ga0496120_0045466_1165_1893 242
1133 3300048924 Ga0496121_0015859 Ga0496121_0015859_5421_6158 242
1134 3300048925 Ga0496122_0064711 Ga0496122_0064711_1441_2169 242
1135 3300048925 Ga0496122_0122352 Ga0496122_0122352_854_1582 242
1136 3300048926 Ga0496123_0034129 Ga0496123_0034129_2096_2824 242
1137 3300048927 Ga0496124_0011091 Ga0496124_0011091_3923_4651 242
1138 3300048928 Ga0496125_0066917 Ga0496125_0066917_1877_2605 242
1139 3300048928 Ga0496125_0205378 Ga0496125_0205378_39_767 242
1140 3300048929 Ga0496126_0070196 Ga0496126_0070196_414_1142 242
1141 3300053085 Ga0495619_0114384 Ga0495619_0114384_266_1003 242
1142 3300053148 Ga0500590_000052 Ga0500590_000052_22418_23155 242
1143 iso_pu_bacteria 2513237305 2514422164 242
1144 iso_pu_bacteria 2534681786 2535485424 242
1145 iso_pu_bacteria 2537561587 2537876828 242
1146 iso_pu_bacteria 2582581283 2585167992 242
1147 iso_pu_bacteria 2600255279 2601610501 242
1148 iso_pu_bacteria 2600255308 2601747169 242
1149 iso_pu_bacteria 2643221607 2644051080 242
1150 iso_pu_bacteria 2643221636 2644205560 242
1151 iso_pu_bacteria 2643221686 2644483984 242
1152 iso_pu_bacteria 2643221689 2644500236 242
1153 iso_pu_bacteria 2838675328 2838677878 242
1154 iso_pu_bacteria 2838714209 2838717217 242
1155 iso_pu_bacteria 2838719591 2838722173 242
1156 iso_pu_bacteria 2838724970 2838727966 242
1157 iso_pu_bacteria 2841846520 2841849625 242
1158 iso_pu_bacteria 2842124991 2842127627 242
1159 iso_pu_bacteria 2842130223 2842132771 242
1160 iso_pu_bacteria 2842152218 2842154764 242
1161 iso_pu_bacteria 2842170452 2842173263 242
1162 iso_pu_bacteria 2842175837 2842178385 242
1163 iso_pu_bacteria 2842187318 2842190325 242
1164 iso_pu_bacteria 2842211629 2842214639 242
1165 iso_pu_bacteria 2842224351 2842227358 242
1166 iso_pu_bacteria 2919114240 2919117475 242
1167 iso_pu_bacteria 2926754445 2926758921 242
1168 iso_pu_bacteria 2933006813 2933009853 242
1169 iso_pu_bacteria 2933586486 2933593838 242
1170 iso_pu_bacteria 2933594066 2933595808 242
1171 iso_pu_bacteria 8005658619 8005662490 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

29

186

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.9183 4 237
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.9168 5 236
5th5-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with 6-carboxypterin-5'-deoxyadenosyl ester bound 0.9127 5 242
5tgs-assembly1.cif.gz_B crystal structure of quee from bacillus subtilis with methionine bound 0.9067 4 237
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.9052 5 236
ID Description Score Start End Superfamily
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9339 6 236 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9299 6 236 3.20.20.70
af_Q58624_1_230_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7859 5 190 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7748 6 232 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.749 6 232 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V6P924-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE (EC 4.3.99.3) 0.998 2 147 GO:0016829
GO:0046872
GO:0051539
AF-A0A528FGE6-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9943 54 126
AF-A0A4V3ME80-F1-model_v4 deleted 0.9939 41 157
AF-A0A7X8HY30-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE (EC 4.3.99.3) 0.9915 5 161 GO:0016829
GO:0046872
GO:0051539
AF-A0A7I0J4I4-F1-model_v4 7-carboxy-7-deazaguanine synthase QueE 0.9895 68 161

Feature Viewer

pLDDT pTM Quality
91.3 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map