F491162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1171 | 309 | 2334 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100084683|Ga0070673_1000846832 |
| Length | 378 |
| Sequence | MAQASKFERVLDLSTGIADVGQCLTEGAPGAAFLPSTCWFSKGGISPAKADMKRRAFITWLGGAAVAWPLAARTQQVAMPVIGFLDGRVPDTLRDRLRAMRRGLQDAGYVEGENVAIVYRYAENQSERLPELAAELVQRRVSVIIASGGPPVTFAAKAATAAIPIVFLISSDPVALGLVTSVARPGGNLTGVNFLNRELTSKRLELLRAMVPAATRLALLVNPKGPWAENMLQDVESAARSLGLQVRVLKATTSAEIDAAFASIAADRPDVLLAAEDPFYNTRRLQLSLLAMRHGIPSAFSGLEYTEAGGLMSYGSDIMEAYRQVGVYAGRILKGAKPAELPVVQLDKFELTINAVTARALGITVPQSMLVAADHVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 309 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0.09 |
| Rhizoplane | 15.54 |
| Rhizosphere | 82.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070673_100084683 | 3300005364 | Bacteria | 2579 |
| 2 | JGI24742J22300_10002891 | 3300002244 | Bacteria | 2775 |
| 3 | JGI25404J52841_10001460 | 3300003659 | Bacteria | 4165 |
| 4 | Ga0070658_10001156 | 3300005327 | Bacteria | 22508 |
| 5 | Ga0070658_10203152 | 3300005327 | Bacteria | 1672 |
| 6 | Ga0070683_100001121 | 3300005329 | Bacteria | 20247 |
| 7 | Ga0070690_100014966 | 3300005330 | Bacteria | 4614 |
| 8 | Ga0070690_100181107 | 3300005330 | Bacteria | 1456 |
| 9 | Ga0070690_100198083 | 3300005330 | Bacteria | 1396 |
| 10 | Ga0070670_100038170 | 3300005331 | Bacteria | 4130 |
| 11 | Ga0070670_100038980 | 3300005331 | Bacteria | 4085 |
| 12 | Ga0070670_100105540 | 3300005331 | Bacteria | 2427 |
| 13 | Ga0070670_100116266 | 3300005331 | Bacteria | 2306 |
| 14 | Ga0070670_100292654 | 3300005331 | Bacteria | 1423 |
| 15 | Ga0070677_10021634 | 3300005333 | Bacteria | 2362 |
| 16 | Ga0068869_100048431 | 3300005334 | Bacteria | 3073 |
| 17 | Ga0070680_100004056 | 3300005336 | Bacteria | 10961 |
| 18 | Ga0070680_100345664 | 3300005336 | Bacteria | 1264 |
| 19 | Ga0068868_100004336 | 3300005338 | Bacteria | 9945 |
| 20 | Ga0068868_100255064 | 3300005338 | Unclassified | 1477 |
| 21 | Ga0070689_100001947 | 3300005340 | Bacteria | 13379 |
| 22 | Ga0070689_100007629 | 3300005340 | Bacteria | 7577 |
| 23 | Ga0070689_100092967 | 3300005340 | Bacteria | 2380 |
| 24 | Ga0070689_100123346 | 3300005340 | Bacteria | 2071 |
| 25 | Ga0070691_10010850 | 3300005341 | Bacteria | 4158 |
| 26 | Ga0070691_10029146 | 3300005341 | Bacteria | 2582 |
| 27 | Ga0070692_10017241 | 3300005345 | Bacteria | 3449 |
| 28 | Ga0070668_100010746 | 3300005347 | Bacteria | 6806 |
| 29 | Ga0070668_100265956 | 3300005347 | Bacteria | 1428 |
| 30 | Ga0070669_100078563 | 3300005353 | Bacteria | 2453 |
| 31 | Ga0070669_100121516 | 3300005353 | Bacteria | 1993 |
| 32 | Ga0070671_100011715 | 3300005355 | Bacteria | 7053 |
| 33 | Ga0070671_100014073 | 3300005355 | Bacteria | 6459 |
| 34 | Ga0070671_100104104 | 3300005355 | Bacteria | 2382 |
| 35 | Ga0070671_100205505 | 3300005355 | Bacteria | 1670 |
| 36 | Ga0070674_100008989 | 3300005356 | Bacteria | 5970 |
| 37 | Ga0070674_100107278 | 3300005356 | Bacteria | 2045 |
| 38 | Ga0070673_100026029 | 3300005364 | Bacteria | 4315 |
| 39 | Ga0070673_100298816 | 3300005364 | Bacteria | 1417 |
| 40 | Ga0070673_100327612 | 3300005364 | Unclassified | 1354 |
| 41 | Ga0070688_100068399 | 3300005365 | Bacteria | 2264 |
| 42 | Ga0070659_100246676 | 3300005366 | Bacteria | 1479 |
| 43 | Ga0070667_100030347 | 3300005367 | Bacteria | 4509 |
| 44 | Ga0070667_100267262 | 3300005367 | Unclassified | 1533 |
| 45 | Ga0070667_100299333 | 3300005367 | Bacteria | 1448 |
| 46 | Ga0070667_100415011 | 3300005367 | Bacteria | 1226 |
| 47 | Ga0070709_10009597 | 3300005434 | Bacteria | 5343 |
| 48 | Ga0070709_10047860 | 3300005434 | Bacteria | 2665 |
| 49 | Ga0070709_10107228 | 3300005434 | Unclassified | 1872 |
| 50 | Ga0070714_100033286 | 3300005435 | Bacteria | 4308 |
| 51 | Ga0070714_100042466 | 3300005435 | Bacteria | 3842 |
| 52 | Ga0070714_100058556 | 3300005435 | Bacteria | 3301 |
| 53 | Ga0070714_100087270 | 3300005435 | Unclassified | 2728 |
| 54 | Ga0070714_100138572 | 3300005435 | Bacteria | 2181 |
| 55 | Ga0070714_100166783 | 3300005435 | Bacteria | 1996 |
| 56 | Ga0070714_100199349 | 3300005435 | Unclassified | 1830 |
| 57 | Ga0070713_100016710 | 3300005436 | Bacteria | 5524 |
| 58 | Ga0070713_100086205 | 3300005436 | Bacteria | 2692 |
| 59 | Ga0070713_100091571 | 3300005436 | Bacteria | 2616 |
| 60 | Ga0070713_100130165 | 3300005436 | Bacteria | 2218 |
| 61 | Ga0070713_100160272 | 3300005436 | Bacteria | 2007 |
| 62 | Ga0070713_100179742 | 3300005436 | Bacteria | 1900 |
| 63 | Ga0070713_100180445 | 3300005436 | Bacteria | 1897 |
| 64 | Ga0070713_100241688 | 3300005436 | Unclassified | 1644 |
| 65 | Ga0070713_100261208 | 3300005436 | Bacteria | 1582 |
| 66 | Ga0070713_100278304 | 3300005436 | Unclassified | 1534 |
| 67 | Ga0070710_10010563 | 3300005437 | Bacteria | 4538 |
| 68 | Ga0070710_10039165 | 3300005437 | Bacteria | 2607 |
| 69 | Ga0070710_10068382 | 3300005437 | Bacteria | 2040 |
| 70 | Ga0070710_10125366 | 3300005437 | Bacteria | 1559 |
| 71 | Ga0070701_10005306 | 3300005438 | Bacteria | 5308 |
| 72 | Ga0070711_100017236 | 3300005439 | Bacteria | 4596 |
| 73 | Ga0070711_100031700 | 3300005439 | Bacteria | 3511 |
| 74 | Ga0070711_100068411 | 3300005439 | Bacteria | 2495 |
| 75 | Ga0070711_100100062 | 3300005439 | Unclassified | 2107 |
| 76 | Ga0070711_100233530 | 3300005439 | Bacteria | 1435 |
| 77 | Ga0070700_100009528 | 3300005441 | Bacteria | 5337 |
| 78 | Ga0070708_100082719 | 3300005445 | Bacteria | 2909 |
| 79 | Ga0070708_100141481 | 3300005445 | Bacteria | 2231 |
| 80 | Ga0070708_100153488 | 3300005445 | Bacteria | 2143 |
| 81 | Ga0070708_100158872 | 3300005445 | Bacteria | 2105 |
| 82 | Ga0070708_100182039 | 3300005445 | Bacteria | 1964 |
| 83 | Ga0070663_100038713 | 3300005455 | Bacteria | 3328 |
| 84 | Ga0070663_100265792 | 3300005455 | Unclassified | 1362 |
| 85 | Ga0070678_100002315 | 3300005456 | Bacteria | 10400 |
| 86 | Ga0070678_100012089 | 3300005456 | Bacteria | 5351 |
| 87 | Ga0070678_100018294 | 3300005456 | Bacteria | 4541 |
| 88 | Ga0070678_100036574 | 3300005456 | Bacteria | 3438 |
| 89 | Ga0070678_100067407 | 3300005456 | Bacteria | 2664 |
| 90 | Ga0070678_100070372 | 3300005456 | Bacteria | 2615 |
| 91 | Ga0070662_100027861 | 3300005457 | Bacteria | 3928 |
| 92 | Ga0070681_10005593 | 3300005458 | Bacteria | 12141 |
| 93 | Ga0070681_10034420 | 3300005458 | Bacteria | 5086 |
| 94 | Ga0068867_100264261 | 3300005459 | Bacteria | 1404 |
| 95 | Ga0070685_10012015 | 3300005466 | Bacteria | 4540 |
| 96 | Ga0070685_10053136 | 3300005466 | Bacteria | 2346 |
| 97 | Ga0070706_100011324 | 3300005467 | Bacteria | 8287 |
| 98 | Ga0070706_100031497 | 3300005467 | Bacteria | 4890 |
| 99 | Ga0070706_100044768 | 3300005467 | Bacteria | 4087 |
| 100 | Ga0070706_100050361 | 3300005467 | Bacteria | 3843 |
| 101 | Ga0070706_100060695 | 3300005467 | Bacteria | 3490 |
| 102 | Ga0070706_100083775 | 3300005467 | Bacteria | 2954 |
| 103 | Ga0070706_100102371 | 3300005467 | Bacteria | 2662 |
| 104 | Ga0070706_100161466 | 3300005467 | Bacteria | 2092 |
| 105 | Ga0070706_100173473 | 3300005467 | Bacteria | 2013 |
| 106 | Ga0070706_100208347 | 3300005467 | Bacteria | 1825 |
| 107 | Ga0070706_100279925 | 3300005467 | Bacteria | 1557 |
| 108 | Ga0070706_100612309 | 3300005467 | Bacteria | 1012 |
| 109 | Ga0070707_100056720 | 3300005468 | Bacteria | 3757 |
| 110 | Ga0070707_100244412 | 3300005468 | Bacteria | 1746 |
| 111 | Ga0070698_100009485 | 3300005471 | Bacteria | 10426 |
| 112 | Ga0070698_100026486 | 3300005471 | Bacteria | 6036 |
| 113 | Ga0070698_100052361 | 3300005471 | Bacteria | 4153 |
| 114 | Ga0070698_100080771 | 3300005471 | Bacteria | 3246 |
| 115 | Ga0070698_100091231 | 3300005471 | Unclassified | 3029 |
| 116 | Ga0070698_100144197 | 3300005471 | Unclassified | 2331 |
| 117 | Ga0070698_100175925 | 3300005471 | Unclassified | 2079 |
| 118 | Ga0070698_100176117 | 3300005471 | Bacteria | 2078 |
| 119 | Ga0070698_100390553 | 3300005471 | Bacteria | 1324 |
| 120 | Ga0070699_100003490 | 3300005518 | Bacteria | 13901 |
| 121 | Ga0070699_100004179 | 3300005518 | Bacteria | 12774 |
| 122 | Ga0070699_100005289 | 3300005518 | Bacteria | 11323 |
| 123 | Ga0070699_100006194 | 3300005518 | Bacteria | 10453 |
| 124 | Ga0070699_100021079 | 3300005518 | Bacteria | 5618 |
| 125 | Ga0070699_100030200 | 3300005518 | Bacteria | 4678 |
| 126 | Ga0070699_100036560 | 3300005518 | Bacteria | 4248 |
| 127 | Ga0070699_100043112 | 3300005518 | Bacteria | 3906 |
| 128 | Ga0070699_100083001 | 3300005518 | Bacteria | 2794 |
| 129 | Ga0070699_100102660 | 3300005518 | Bacteria | 2507 |
| 130 | Ga0070699_100105707 | 3300005518 | Bacteria | 2469 |
| 131 | Ga0070699_100109724 | 3300005518 | Bacteria | 2422 |
| 132 | Ga0070699_100115741 | 3300005518 | Bacteria | 2356 |
| 133 | Ga0070699_100192646 | 3300005518 | Bacteria | 1811 |
| 134 | Ga0070699_100309292 | 3300005518 | Bacteria | 1418 |
| 135 | Ga0070699_100434467 | 3300005518 | Bacteria | 1189 |
| 136 | Ga0070679_100008810 | 3300005530 | Bacteria | 9517 |
| 137 | Ga0070679_100029991 | 3300005530 | Bacteria | 5368 |
| 138 | Ga0070679_100145703 | 3300005530 | Bacteria | 2346 |
| 139 | Ga0070679_100470275 | 3300005530 | Bacteria | 1201 |
| 140 | Ga0070684_100008126 | 3300005535 | Bacteria | 8190 |
| 141 | Ga0070697_100008185 | 3300005536 | Bacteria | 8162 |
| 142 | Ga0070697_100016831 | 3300005536 | Bacteria | 5749 |
| 143 | Ga0070697_100024500 | 3300005536 | Bacteria | 4803 |
| 144 | Ga0070697_100048043 | 3300005536 | Bacteria | 3460 |
| 145 | Ga0070697_100074218 | 3300005536 | Bacteria | 2794 |
| 146 | Ga0070697_100117046 | 3300005536 | Bacteria | 2226 |
| 147 | Ga0070697_100135814 | 3300005536 | Unclassified | 2065 |
| 148 | Ga0070697_100165930 | 3300005536 | Bacteria | 1867 |
| 149 | Ga0070697_100193541 | 3300005536 | Bacteria | 1726 |
| 150 | Ga0070697_100277395 | 3300005536 | Bacteria | 1438 |
| 151 | Ga0070697_100450920 | 3300005536 | Bacteria | 1120 |
| 152 | Ga0068853_100380246 | 3300005539 | Bacteria | 1318 |
| 153 | Ga0070672_100268100 | 3300005543 | Bacteria | 1441 |
| 154 | Ga0070686_100003143 | 3300005544 | Bacteria | 9041 |
| 155 | Ga0070693_100045456 | 3300005547 | Unclassified | 2489 |
| 156 | Ga0070665_100520421 | 3300005548 | Bacteria | 1201 |
| 157 | Ga0068855_100128460 | 3300005563 | Bacteria | 2896 |
| 158 | Ga0068855_100166678 | 3300005563 | Bacteria | 2497 |
| 159 | Ga0070664_100011613 | 3300005564 | Bacteria | 7146 |
| 160 | Ga0070664_100210559 | 3300005564 | Unclassified | 1737 |
| 161 | Ga0070664_100241099 | 3300005564 | Bacteria | 1623 |
| 162 | Ga0068857_100160311 | 3300005577 | Bacteria | 2041 |
| 163 | Ga0068856_100054081 | 3300005614 | Bacteria | 3959 |
| 164 | Ga0068856_100085045 | 3300005614 | Bacteria | 3142 |
| 165 | Ga0068856_100120182 | 3300005614 | Bacteria | 2629 |
| 166 | Ga0068856_100234095 | 3300005614 | Bacteria | 1852 |
| 167 | Ga0070702_100004162 | 3300005615 | Bacteria | 6578 |
| 168 | Ga0068859_100033904 | 3300005617 | Bacteria | 5125 |
| 169 | Ga0068859_100090857 | 3300005617 | Bacteria | 3104 |
| 170 | Ga0068864_100006897 | 3300005618 | Bacteria | 9311 |
| 171 | Ga0068864_100032912 | 3300005618 | Bacteria | 4406 |
| 172 | Ga0068864_100267480 | 3300005618 | Bacteria | 1592 |
| 173 | Ga0068866_10002593 | 3300005718 | Bacteria | 7463 |
| 174 | Ga0068861_100006324 | 3300005719 | Bacteria | 8060 |
| 175 | Ga0068861_100083593 | 3300005719 | Bacteria | 2504 |
| 176 | Ga0068870_10005165 | 3300005840 | Bacteria | 5684 |
| 177 | Ga0068863_100032962 | 3300005841 | Bacteria | 4936 |
| 178 | Ga0068858_100009104 | 3300005842 | Bacteria | 9493 |
| 179 | Ga0068858_100165745 | 3300005842 | Bacteria | 2082 |
| 180 | Ga0068858_100269592 | 3300005842 | Unclassified | 1620 |
| 181 | Ga0068860_100030590 | 3300005843 | Bacteria | 5177 |
| 182 | Ga0068862_100006330 | 3300005844 | Bacteria | 9842 |
| 183 | Ga0068862_100112744 | 3300005844 | Bacteria | 2388 |
| 184 | Ga0068862_100198161 | 3300005844 | Bacteria | 1809 |
| 185 | Ga0081455_10008747 | 3300005937 | Bacteria | 10479 |
| 186 | Ga0081455_10016524 | 3300005937 | Bacteria | 7121 |
| 187 | Ga0081455_10019101 | 3300005937 | Bacteria | 6496 |
| 188 | Ga0081455_10023698 | 3300005937 | Bacteria | 5706 |
| 189 | Ga0081455_10027072 | 3300005937 | Bacteria | 5259 |
| 190 | Ga0081455_10027473 | 3300005937 | Bacteria | 5215 |
| 191 | Ga0081455_10031742 | 3300005937 | Bacteria | 4772 |
| 192 | Ga0081455_10040091 | 3300005937 | Bacteria | 4133 |
| 193 | Ga0081455_10040565 | 3300005937 | Bacteria | 4103 |
| 194 | Ga0081455_10061773 | 3300005937 | Bacteria | 3152 |
| 195 | Ga0081455_10062684 | 3300005937 | Bacteria | 3124 |
| 196 | Ga0081455_10063467 | 3300005937 | Bacteria | 3100 |
| 197 | Ga0081455_10064449 | 3300005937 | Bacteria | 3068 |
| 198 | Ga0081455_10082171 | 3300005937 | Bacteria | 2636 |
| 199 | Ga0081455_10105278 | 3300005937 | Bacteria | 2255 |
| 200 | Ga0081455_10116681 | 3300005937 | Bacteria | 2111 |
| 201 | Ga0081455_10118023 | 3300005937 | Bacteria | 2096 |
| 202 | Ga0081455_10133923 | 3300005937 | Bacteria | 1934 |
| 203 | Ga0081455_10137423 | 3300005937 | Bacteria | 1902 |
| 204 | Ga0081455_10224805 | 3300005937 | Bacteria | 1389 |
| 205 | Ga0081455_10257225 | 3300005937 | Bacteria | 1273 |
| 206 | Ga0081455_10309385 | 3300005937 | Bacteria | 1130 |
| 207 | Ga0081455_10337979 | 3300005937 | Bacteria | 1067 |
| 208 | Ga0081538_10008403 | 3300005981 | Bacteria | 8772 |
| 209 | Ga0081538_10034821 | 3300005981 | Bacteria | 3321 |
| 210 | Ga0081540_1003391 | 3300005983 | Bacteria | 12635 |
| 211 | Ga0081540_1019499 | 3300005983 | Bacteria | 4117 |
| 212 | Ga0081540_1033202 | 3300005983 | Bacteria | 2806 |
| 213 | Ga0081540_1033572 | 3300005983 | Unclassified | 2784 |
| 214 | Ga0081540_1044016 | 3300005983 | Bacteria | 2283 |
| 215 | Ga0081540_1101525 | 3300005983 | Bacteria | 1238 |
| 216 | Ga0081539_10055010 | 3300005985 | Bacteria | 2217 |
| 217 | Ga0070717_10012611 | 3300006028 | Bacteria | 6447 |
| 218 | Ga0070717_10016828 | 3300006028 | Bacteria | 5675 |
| 219 | Ga0070717_10020266 | 3300006028 | Bacteria | 5226 |
| 220 | Ga0070717_10020508 | 3300006028 | Bacteria | 5200 |
| 221 | Ga0070717_10025932 | 3300006028 | Bacteria | 4671 |
| 222 | Ga0070717_10037808 | 3300006028 | Bacteria | 3920 |
| 223 | Ga0070717_10042714 | 3300006028 | Bacteria | 3698 |
| 224 | Ga0070717_10070950 | 3300006028 | Bacteria | 2904 |
| 225 | Ga0070717_10104963 | 3300006028 | Bacteria | 2404 |
| 226 | Ga0070717_10123222 | 3300006028 | Bacteria | 2223 |
| 227 | Ga0070717_10138114 | 3300006028 | Bacteria | 2100 |
| 228 | Ga0070717_10149568 | 3300006028 | Unclassified | 2019 |
| 229 | Ga0070717_10248567 | 3300006028 | Bacteria | 1570 |
| 230 | Ga0070717_10282626 | 3300006028 | Bacteria | 1472 |
| 231 | Ga0070717_10285154 | 3300006028 | Bacteria | 1465 |
| 232 | Ga0070717_10313493 | 3300006028 | Bacteria | 1396 |
| 233 | Ga0070717_10383820 | 3300006028 | Bacteria | 1260 |
| 234 | Ga0075365_10015874 | 3300006038 | Bacteria | 4564 |
| 235 | Ga0075365_10025586 | 3300006038 | Bacteria | 3738 |
| 236 | Ga0075365_10032283 | 3300006038 | Bacteria | 3364 |
| 237 | Ga0075365_10033692 | 3300006038 | Bacteria | 3303 |
| 238 | Ga0075363_100154931 | 3300006048 | Bacteria | 1295 |
| 239 | Ga0075432_10008469 | 3300006058 | Bacteria | 3508 |
| 240 | Ga0070715_10000242 | 3300006163 | Bacteria | 13075 |
| 241 | Ga0070715_10022869 | 3300006163 | Bacteria | 2442 |
| 242 | Ga0070715_10029990 | 3300006163 | Bacteria | 2195 |
| 243 | Ga0070715_10033608 | 3300006163 | Bacteria | 2097 |
| 244 | Ga0070715_10099976 | 3300006163 | Bacteria | 1351 |
| 245 | Ga0070716_100011802 | 3300006173 | Bacteria | 4407 |
| 246 | Ga0070716_100052321 | 3300006173 | Bacteria | 2324 |
| 247 | Ga0070716_100110360 | 3300006173 | Bacteria | 1703 |
| 248 | Ga0070716_100268203 | 3300006173 | Bacteria | 1171 |
| 249 | Ga0070712_100034004 | 3300006175 | Bacteria | 3453 |
| 250 | Ga0070712_100047291 | 3300006175 | Bacteria | 2977 |
| 251 | Ga0070712_100049393 | 3300006175 | Bacteria | 2921 |
| 252 | Ga0070712_100072272 | 3300006175 | Unclassified | 2470 |
| 253 | Ga0070712_100074712 | 3300006175 | Bacteria | 2436 |
| 254 | Ga0070712_100080220 | 3300006175 | Bacteria | 2361 |
| 255 | Ga0070712_100205137 | 3300006175 | Bacteria | 1551 |
| 256 | Ga0070712_100295344 | 3300006175 | Bacteria | 1309 |
| 257 | Ga0070712_100303730 | 3300006175 | Bacteria | 1292 |
| 258 | Ga0075367_10021398 | 3300006178 | Bacteria | 3614 |
| 259 | Ga0075366_10057977 | 3300006195 | Bacteria | 2301 |
| 260 | Ga0097621_100173906 | 3300006237 | Bacteria | 1858 |
| 261 | Ga0097621_100215058 | 3300006237 | Unclassified | 1673 |
| 262 | Ga0068871_100009772 | 3300006358 | Bacteria | 6963 |
| 263 | Ga0068871_100014704 | 3300006358 | Bacteria | 5840 |
| 264 | Ga0075428_100035506 | 3300006844 | Bacteria | 5496 |
| 265 | Ga0075428_100057281 | 3300006844 | Bacteria | 4266 |
| 266 | Ga0075428_100058330 | 3300006844 | Bacteria | 4226 |
| 267 | Ga0075428_100064188 | 3300006844 | Bacteria | 4021 |
| 268 | Ga0075428_100103051 | 3300006844 | Bacteria | 3112 |
| 269 | Ga0075428_100117010 | 3300006844 | Bacteria | 2903 |
| 270 | Ga0075428_100122107 | 3300006844 | Unclassified | 2836 |
| 271 | Ga0075428_100157279 | 3300006844 | Bacteria | 2468 |
| 272 | Ga0075428_100176373 | 3300006844 | Bacteria | 2314 |
| 273 | Ga0075428_100203895 | 3300006844 | Bacteria | 2137 |
| 274 | Ga0075428_100268035 | 3300006844 | Bacteria | 1838 |
| 275 | Ga0075428_100269297 | 3300006844 | Bacteria | 1833 |
| 276 | Ga0075428_100321541 | 3300006844 | Bacteria | 1663 |
| 277 | Ga0075428_100393891 | 3300006844 | Bacteria | 1484 |
| 278 | Ga0075428_100394921 | 3300006844 | Unclassified | 1482 |
| 279 | Ga0075428_100451742 | 3300006844 | Bacteria | 1376 |
| 280 | Ga0075428_100483389 | 3300006844 | Bacteria | 1325 |
| 281 | Ga0075428_100531644 | 3300006844 | Bacteria | 1257 |
| 282 | Ga0075428_100593737 | 3300006844 | Bacteria | 1183 |
| 283 | Ga0075428_100743190 | 3300006844 | Bacteria | 1044 |
| 284 | Ga0075430_100029679 | 3300006846 | Bacteria | 4641 |
| 285 | Ga0075430_100041368 | 3300006846 | Bacteria | 3899 |
| 286 | Ga0075430_100080238 | 3300006846 | Bacteria | 2733 |
| 287 | Ga0075430_100115009 | 3300006846 | Bacteria | 2241 |
| 288 | Ga0075430_100134879 | 3300006846 | Unclassified | 2057 |
| 289 | Ga0075430_100298446 | 3300006846 | Bacteria | 1333 |
| 290 | Ga0075430_100332371 | 3300006846 | Bacteria | 1255 |
| 291 | Ga0075431_100021708 | 3300006847 | Bacteria | 6564 |
| 292 | Ga0075431_100028014 | 3300006847 | Bacteria | 5783 |
| 293 | Ga0075431_100166571 | 3300006847 | Bacteria | 2265 |
| 294 | Ga0075431_100221718 | 3300006847 | Bacteria | 1929 |
| 295 | Ga0075431_100226620 | 3300006847 | Bacteria | 1905 |
| 296 | Ga0075431_100377389 | 3300006847 | Bacteria | 1422 |
| 297 | Ga0075431_100454194 | 3300006847 | Bacteria | 1277 |
| 298 | Ga0075431_100474855 | 3300006847 | Unclassified | 1244 |
| 299 | Ga0075431_100548217 | 3300006847 | Bacteria | 1144 |
| 300 | Ga0075431_100585521 | 3300006847 | Bacteria | 1101 |
| 301 | Ga0075431_100656552 | 3300006847 | Bacteria | 1029 |
| 302 | Ga0075431_100657810 | 3300006847 | Bacteria | 1028 |
| 303 | Ga0075433_10084172 | 3300006852 | Bacteria | 2807 |
| 304 | Ga0075433_10153334 | 3300006852 | Bacteria | 2049 |
| 305 | Ga0075433_10266432 | 3300006852 | Bacteria | 1518 |
| 306 | Ga0075433_10507728 | 3300006852 | Bacteria | 1061 |
| 307 | Ga0075434_100037214 | 3300006871 | Bacteria | 4817 |
| 308 | Ga0075434_100079649 | 3300006871 | Bacteria | 3272 |
| 309 | Ga0075434_100259843 | 3300006871 | Bacteria | 1755 |
| 310 | Ga0075434_100270401 | 3300006871 | Bacteria | 1719 |
| 311 | Ga0075434_100457966 | 3300006871 | Unclassified | 1297 |
| 312 | Ga0075429_100042654 | 3300006880 | Bacteria | 3947 |
| 313 | Ga0075429_100088905 | 3300006880 | Bacteria | 2693 |
| 314 | Ga0075429_100138764 | 3300006880 | Bacteria | 2128 |
| 315 | Ga0075429_100168494 | 3300006880 | Bacteria | 1919 |
| 316 | Ga0075429_100247590 | 3300006880 | Bacteria | 1561 |
| 317 | Ga0068865_100073832 | 3300006881 | Bacteria | 2427 |
| 318 | Ga0075436_100100912 | 3300006914 | Unclassified | 2010 |
| 319 | Ga0075436_100250236 | 3300006914 | Unclassified | 1262 |
| 320 | Ga0097620_100033904 | 3300006931 | Bacteria | 5125 |
| 321 | Ga0097620_100090862 | 3300006931 | Bacteria | 3104 |
| 322 | Ga0075435_100068979 | 3300007076 | Bacteria | 2881 |
| 323 | Ga0075435_100100318 | 3300007076 | Bacteria | 2398 |
| 324 | Ga0075435_100106430 | 3300007076 | Bacteria | 2329 |
| 325 | Ga0099795_10003360 | 3300007788 | Bacteria | 3948 |
| 326 | Ga0099795_10042773 | 3300007788 | Bacteria | 1618 |
| 327 | Ga0105240_10026900 | 3300009093 | Bacteria | 7542 |
| 328 | Ga0105240_10098213 | 3300009093 | Bacteria | 3566 |
| 329 | Ga0111539_10024858 | 3300009094 | Bacteria | 7345 |
| 330 | Ga0111539_10132062 | 3300009094 | Bacteria | 2924 |
| 331 | Ga0111539_10222300 | 3300009094 | Bacteria | 2199 |
| 332 | Ga0111539_10225838 | 3300009094 | Bacteria | 2181 |
| 333 | Ga0111539_10268074 | 3300009094 | Bacteria | 1988 |
| 334 | Ga0111539_10570456 | 3300009094 | Bacteria | 1318 |
| 335 | Ga0111539_10589956 | 3300009094 | Bacteria | 1294 |
| 336 | Ga0105245_10004865 | 3300009098 | Bacteria | 11827 |
| 337 | Ga0105245_10232506 | 3300009098 | Bacteria | 1784 |
| 338 | Ga0105245_10339894 | 3300009098 | Bacteria | 1484 |
| 339 | Ga0105247_10103385 | 3300009101 | Bacteria | 1824 |
| 340 | Ga0114129_10008935 | 3300009147 | Bacteria | 14275 |
| 341 | Ga0114129_10040328 | 3300009147 | Bacteria | 6582 |
| 342 | Ga0114129_10105981 | 3300009147 | Bacteria | 3884 |
| 343 | Ga0114129_10110662 | 3300009147 | Bacteria | 3791 |
| 344 | Ga0114129_10163348 | 3300009147 | Bacteria | 3040 |
| 345 | Ga0114129_10187116 | 3300009147 | Bacteria | 2813 |
| 346 | Ga0114129_10192625 | 3300009147 | Bacteria | 2767 |
| 347 | Ga0114129_10278513 | 3300009147 | Bacteria | 2235 |
| 348 | Ga0114129_10422720 | 3300009147 | Bacteria | 1752 |
| 349 | Ga0114129_10506751 | 3300009147 | Bacteria | 1575 |
| 350 | Ga0114129_10540298 | 3300009147 | Bacteria | 1517 |
| 351 | Ga0114129_10789765 | 3300009147 | Bacteria | 1212 |
| 352 | Ga0114129_10810439 | 3300009147 | Bacteria | 1194 |
| 353 | Ga0114129_10934330 | 3300009147 | Bacteria | 1097 |
| 354 | Ga0105243_10001839 | 3300009148 | Bacteria | 18151 |
| 355 | Ga0105243_10484255 | 3300009148 | Bacteria | 1168 |
| 356 | Ga0105242_10020765 | 3300009176 | Bacteria | 5151 |
| 357 | Ga0105242_10044693 | 3300009176 | Bacteria | 3588 |
| 358 | Ga0105242_10542892 | 3300009176 | Bacteria | 1113 |
| 359 | Ga0105248_10008067 | 3300009177 | Bacteria | 11558 |
| 360 | Ga0105248_10058373 | 3300009177 | Bacteria | 4334 |
| 361 | Ga0105248_10145644 | 3300009177 | Bacteria | 2673 |
| 362 | Ga0105248_10194810 | 3300009177 | Bacteria | 2283 |
| 363 | Ga0105237_10041340 | 3300009545 | Bacteria | 4650 |
| 364 | Ga0105237_10425677 | 3300009545 | Bacteria | 1333 |
| 365 | Ga0105238_10041895 | 3300009551 | Bacteria | 4637 |
| 366 | Ga0105238_10564739 | 3300009551 | Bacteria | 1143 |
| 367 | Ga0105249_10016552 | 3300009553 | Bacteria | 6543 |
| 368 | Ga0105249_10041634 | 3300009553 | Bacteria | 4177 |
| 369 | Ga0105249_10582580 | 3300009553 | Bacteria | 1172 |
| 370 | Ga0099796_10049890 | 3300010159 | Bacteria | 1449 |
| 371 | Ga0099796_10061728 | 3300010159 | Bacteria | 1330 |
| 372 | Ga0105239_10003524 | 3300010375 | Bacteria | 19165 |
| 373 | Ga0105239_10098495 | 3300010375 | Bacteria | 3232 |
| 374 | Ga0105239_10420144 | 3300010375 | Bacteria | 1515 |
| 375 | Ga0105239_10572805 | 3300010375 | Bacteria | 1287 |
| 376 | Ga0105239_10830277 | 3300010375 | Bacteria | 1059 |
| 377 | Ga0105246_10198625 | 3300011119 | Bacteria | 1557 |
| 378 | Ga0105246_10279048 | 3300011119 | Bacteria | 1339 |
| 379 | Ga0105246_10313025 | 3300011119 | Bacteria | 1272 |
| 380 | Ga0157369_10563441 | 3300013105 | Bacteria | 1177 |
| 381 | Ga0157374_10018968 | 3300013296 | Bacteria | 6084 |
| 382 | Ga0157374_10021300 | 3300013296 | Bacteria | 5766 |
| 383 | Ga0157374_10057134 | 3300013296 | Bacteria | 3644 |
| 384 | Ga0157374_10541829 | 3300013296 | Bacteria | 1171 |
| 385 | Ga0157378_10045594 | 3300013297 | Bacteria | 3896 |
| 386 | Ga0157378_10081442 | 3300013297 | Bacteria | 2926 |
| 387 | Ga0157378_10479698 | 3300013297 | Unclassified | 1239 |
| 388 | Ga0163162_10029971 | 3300013306 | Bacteria | 5387 |
| 389 | Ga0163162_10091589 | 3300013306 | Bacteria | 3123 |
| 390 | Ga0163162_10119045 | 3300013306 | Bacteria | 2743 |
| 391 | Ga0163162_10139216 | 3300013306 | Bacteria | 2539 |
| 392 | Ga0163162_10168632 | 3300013306 | Bacteria | 2313 |
| 393 | Ga0163162_10214979 | 3300013306 | Bacteria | 2053 |
| 394 | Ga0163162_10316760 | 3300013306 | Bacteria | 1692 |
| 395 | Ga0163162_10385615 | 3300013306 | Unclassified | 1534 |
| 396 | Ga0163162_10440575 | 3300013306 | Bacteria | 1435 |
| 397 | Ga0163162_10619712 | 3300013306 | Unclassified | 1207 |
| 398 | Ga0157372_10837193 | 3300013307 | Bacteria | 1068 |
| 399 | Ga0157375_10001511 | 3300013308 | Bacteria | 19994 |
| 400 | Ga0157375_10097217 | 3300013308 | Bacteria | 3018 |
| 401 | Ga0157375_10378208 | 3300013308 | Bacteria | 1583 |
| 402 | Ga0157375_10552218 | 3300013308 | Bacteria | 1313 |
| 403 | Ga0157375_10727725 | 3300013308 | Bacteria | 1145 |
| 404 | Ga0163163_10006830 | 3300014325 | Bacteria | 10013 |
| 405 | Ga0163163_10141483 | 3300014325 | Bacteria | 2448 |
| 406 | Ga0157380_10007419 | 3300014326 | Bacteria | 7787 |
| 407 | Ga0157380_10252227 | 3300014326 | Bacteria | 1598 |
| 408 | Ga0182008_10030771 | 3300014497 | Bacteria | 2705 |
| 409 | Ga0182008_10134012 | 3300014497 | Bacteria | 1237 |
| 410 | Ga0157377_10296023 | 3300014745 | Bacteria | 1066 |
| 411 | Ga0157379_10006607 | 3300014968 | Bacteria | 10005 |
| 412 | Ga0157379_10156660 | 3300014968 | Unclassified | 2055 |
| 413 | Ga0157379_10344012 | 3300014968 | Bacteria | 1364 |
| 414 | Ga0157379_10420898 | 3300014968 | Bacteria | 1230 |
| 415 | Ga0157379_10613068 | 3300014968 | Unclassified | 1017 |
| 416 | Ga0157376_10009851 | 3300014969 | Bacteria | 6964 |
| 417 | Ga0157376_10015168 | 3300014969 | Bacteria | 5812 |
| 418 | Ga0157376_10109421 | 3300014969 | Unclassified | 2429 |
| 419 | Ga0157376_10110819 | 3300014969 | Bacteria | 2416 |
| 420 | Ga0157376_10196657 | 3300014969 | Bacteria | 1853 |
| 421 | Ga0163161_10040508 | 3300017792 | Bacteria | 3346 |
| 422 | Ga0213876_10037297 | 3300021384 | Bacteria | 2564 |
| 423 | Ga0207697_10070750 | 3300025315 | Bacteria | 1462 |
| 424 | Ga0207692_10006066 | 3300025898 | Bacteria | 4887 |
| 425 | Ga0207692_10028855 | 3300025898 | Bacteria | 2630 |
| 426 | Ga0207692_10047782 | 3300025898 | Bacteria | 2151 |
| 427 | Ga0207692_10068960 | 3300025898 | Bacteria | 1857 |
| 428 | Ga0207692_10154885 | 3300025898 | Unclassified | 1315 |
| 429 | Ga0207692_10203006 | 3300025898 | Bacteria | 1166 |
| 430 | Ga0207642_10058766 | 3300025899 | Bacteria | 1775 |
| 431 | Ga0207642_10173716 | 3300025899 | Unclassified | 1168 |
| 432 | Ga0207710_10098843 | 3300025900 | Bacteria | 1374 |
| 433 | Ga0207688_10015626 | 3300025901 | Bacteria | 4117 |
| 434 | Ga0207688_10068503 | 3300025901 | Bacteria | 2010 |
| 435 | Ga0207688_10102240 | 3300025901 | Unclassified | 1656 |
| 436 | Ga0207688_10217706 | 3300025901 | Bacteria | 1149 |
| 437 | Ga0207647_10030576 | 3300025904 | Bacteria | 3471 |
| 438 | Ga0207685_10032558 | 3300025905 | Bacteria | 1877 |
| 439 | Ga0207685_10060364 | 3300025905 | Bacteria | 1499 |
| 440 | Ga0207685_10082709 | 3300025905 | Bacteria | 1333 |
| 441 | Ga0207685_10085581 | 3300025905 | Bacteria | 1315 |
| 442 | Ga0207699_10023709 | 3300025906 | Bacteria | 3343 |
| 443 | Ga0207699_10148497 | 3300025906 | Unclassified | 1548 |
| 444 | Ga0207705_10006857 | 3300025909 | Bacteria | 8419 |
| 445 | Ga0207684_10012347 | 3300025910 | Bacteria | 7433 |
| 446 | Ga0207684_10035941 | 3300025910 | Bacteria | 4205 |
| 447 | Ga0207684_10050911 | 3300025910 | Bacteria | 3513 |
| 448 | Ga0207684_10060328 | 3300025910 | Bacteria | 3221 |
| 449 | Ga0207684_10062560 | 3300025910 | Bacteria | 3160 |
| 450 | Ga0207684_10064479 | 3300025910 | Bacteria | 3110 |
| 451 | Ga0207684_10074179 | 3300025910 | Bacteria | 2890 |
| 452 | Ga0207684_10086212 | 3300025910 | Bacteria | 2674 |
| 453 | Ga0207684_10231022 | 3300025910 | Bacteria | 1596 |
| 454 | Ga0207684_10417039 | 3300025910 | Bacteria | 1154 |
| 455 | Ga0207684_10549638 | 3300025910 | Bacteria | 988 |
| 456 | Ga0207695_10067069 | 3300025913 | Bacteria | 3682 |
| 457 | Ga0207695_10271404 | 3300025913 | Bacteria | 1592 |
| 458 | Ga0207693_10001676 | 3300025915 | Bacteria | 19527 |
| 459 | Ga0207693_10034307 | 3300025915 | Bacteria | 4003 |
| 460 | Ga0207693_10046549 | 3300025915 | Bacteria | 3407 |
| 461 | Ga0207693_10053214 | 3300025915 | Bacteria | 3177 |
| 462 | Ga0207693_10062806 | 3300025915 | Bacteria | 2910 |
| 463 | Ga0207693_10063876 | 3300025915 | Bacteria | 2884 |
| 464 | Ga0207693_10065631 | 3300025915 | Bacteria | 2842 |
| 465 | Ga0207693_10065961 | 3300025915 | Bacteria | 2834 |
| 466 | Ga0207693_10087335 | 3300025915 | Bacteria | 2443 |
| 467 | Ga0207693_10099444 | 3300025915 | Bacteria | 2281 |
| 468 | Ga0207693_10202676 | 3300025915 | Unclassified | 1560 |
| 469 | Ga0207693_10348458 | 3300025915 | Unclassified | 1159 |
| 470 | Ga0207663_10000334 | 3300025916 | Bacteria | 20607 |
| 471 | Ga0207663_10019908 | 3300025916 | Bacteria | 3791 |
| 472 | Ga0207663_10132898 | 3300025916 | Bacteria | 1722 |
| 473 | Ga0207663_10148422 | 3300025916 | Bacteria | 1642 |
| 474 | Ga0207663_10197847 | 3300025916 | Unclassified | 1448 |
| 475 | Ga0207663_10236413 | 3300025916 | Bacteria | 1338 |
| 476 | Ga0207663_10239667 | 3300025916 | Bacteria | 1330 |
| 477 | Ga0207660_10007261 | 3300025917 | Bacteria | 7169 |
| 478 | Ga0207662_10055511 | 3300025918 | Bacteria | 2364 |
| 479 | Ga0207662_10118490 | 3300025918 | Bacteria | 1658 |
| 480 | Ga0207662_10124364 | 3300025918 | Bacteria | 1620 |
| 481 | Ga0207662_10133862 | 3300025918 | Bacteria | 1565 |
| 482 | Ga0207649_10297172 | 3300025920 | Bacteria | 1179 |
| 483 | Ga0207652_10025727 | 3300025921 | Bacteria | 4896 |
| 484 | Ga0207652_10442825 | 3300025921 | Bacteria | 1171 |
| 485 | Ga0207646_10020409 | 3300025922 | Bacteria | 6140 |
| 486 | Ga0207646_10211740 | 3300025922 | Bacteria | 1750 |
| 487 | Ga0207646_10212265 | 3300025922 | Bacteria | 1748 |
| 488 | Ga0207646_10254765 | 3300025922 | Bacteria | 1586 |
| 489 | Ga0207646_10427557 | 3300025922 | Bacteria | 1195 |
| 490 | Ga0207646_10466712 | 3300025922 | Bacteria | 1138 |
| 491 | Ga0207681_10030837 | 3300025923 | Bacteria | 3498 |
| 492 | Ga0207694_10053761 | 3300025924 | Bacteria | 3123 |
| 493 | Ga0207650_10032775 | 3300025925 | Bacteria | 3759 |
| 494 | Ga0207650_10134841 | 3300025925 | Bacteria | 1936 |
| 495 | Ga0207650_10235519 | 3300025925 | Bacteria | 1478 |
| 496 | Ga0207659_10445346 | 3300025926 | Bacteria | 1090 |
| 497 | Ga0207659_10511869 | 3300025926 | Unclassified | 1017 |
| 498 | Ga0207687_10002430 | 3300025927 | Bacteria | 12648 |
| 499 | Ga0207700_10014496 | 3300025928 | Bacteria | 5167 |
| 500 | Ga0207700_10017803 | 3300025928 | Bacteria | 4754 |
| 501 | Ga0207700_10017847 | 3300025928 | Bacteria | 4749 |
| 502 | Ga0207700_10091597 | 3300025928 | Bacteria | 2402 |
| 503 | Ga0207700_10136441 | 3300025928 | Bacteria | 2010 |
| 504 | Ga0207700_10220113 | 3300025928 | Unclassified | 1609 |
| 505 | Ga0207700_10367691 | 3300025928 | Unclassified | 1255 |
| 506 | Ga0207700_10372546 | 3300025928 | Unclassified | 1247 |
| 507 | Ga0207700_10445483 | 3300025928 | Bacteria | 1141 |
| 508 | Ga0207664_10023114 | 3300025929 | Bacteria | 4653 |
| 509 | Ga0207664_10024484 | 3300025929 | Bacteria | 4536 |
| 510 | Ga0207664_10054321 | 3300025929 | Bacteria | 3173 |
| 511 | Ga0207664_10126206 | 3300025929 | Bacteria | 2148 |
| 512 | Ga0207664_10202452 | 3300025929 | Unclassified | 1714 |
| 513 | Ga0207664_10232025 | 3300025929 | Unclassified | 1604 |
| 514 | Ga0207644_10007156 | 3300025931 | Bacteria | 7268 |
| 515 | Ga0207644_10019169 | 3300025931 | Bacteria | 4638 |
| 516 | Ga0207644_10045740 | 3300025931 | Bacteria | 3115 |
| 517 | Ga0207644_10060004 | 3300025931 | Bacteria | 2752 |
| 518 | Ga0207644_10150693 | 3300025931 | Bacteria | 1799 |
| 519 | Ga0207644_10416394 | 3300025931 | Unclassified | 1100 |
| 520 | Ga0207690_10029741 | 3300025932 | Bacteria | 3476 |
| 521 | Ga0207706_10006318 | 3300025933 | Bacteria | 11007 |
| 522 | Ga0207706_10032900 | 3300025933 | Bacteria | 4613 |
| 523 | Ga0207686_10033306 | 3300025934 | Bacteria | 3075 |
| 524 | Ga0207709_10006419 | 3300025935 | Bacteria | 6599 |
| 525 | Ga0207709_10276572 | 3300025935 | Bacteria | 1238 |
| 526 | Ga0207670_10001485 | 3300025936 | Bacteria | 12315 |
| 527 | Ga0207670_10006892 | 3300025936 | Bacteria | 6323 |
| 528 | Ga0207670_10013693 | 3300025936 | Bacteria | 4791 |
| 529 | Ga0207669_10004628 | 3300025937 | Bacteria | 6075 |
| 530 | Ga0207669_10072814 | 3300025937 | Bacteria | 2165 |
| 531 | Ga0207704_10002263 | 3300025938 | Bacteria | 8652 |
| 532 | Ga0207704_10157190 | 3300025938 | Bacteria | 1613 |
| 533 | Ga0207665_10001766 | 3300025939 | Bacteria | 14525 |
| 534 | Ga0207665_10062052 | 3300025939 | Bacteria | 2535 |
| 535 | Ga0207665_10081027 | 3300025939 | Bacteria | 2233 |
| 536 | Ga0207665_10259085 | 3300025939 | Bacteria | 1288 |
| 537 | Ga0207665_10306944 | 3300025939 | Bacteria | 1188 |
| 538 | Ga0207691_10267118 | 3300025940 | Bacteria | 1474 |
| 539 | Ga0207711_10016927 | 3300025941 | Bacteria | 6055 |
| 540 | Ga0207689_10058259 | 3300025942 | Bacteria | 3177 |
| 541 | Ga0207661_10001392 | 3300025944 | Bacteria | 16248 |
| 542 | Ga0207679_10015509 | 3300025945 | Bacteria | 5037 |
| 543 | Ga0207679_10232062 | 3300025945 | Bacteria | 1559 |
| 544 | Ga0207667_10022750 | 3300025949 | Bacteria | 6914 |
| 545 | Ga0207667_10096891 | 3300025949 | Bacteria | 3045 |
| 546 | Ga0207651_10016512 | 3300025960 | Bacteria | 4327 |
| 547 | Ga0207651_10260441 | 3300025960 | Bacteria | 1424 |
| 548 | Ga0207651_10300166 | 3300025960 | Unclassified | 1335 |
| 549 | Ga0207712_10028339 | 3300025961 | Bacteria | 3745 |
| 550 | Ga0207712_10452363 | 3300025961 | Unclassified | 1089 |
| 551 | Ga0207668_10119760 | 3300025972 | Unclassified | 1991 |
| 552 | Ga0207668_10269359 | 3300025972 | Bacteria | 1392 |
| 553 | Ga0207658_10055262 | 3300025986 | Bacteria | 2942 |
| 554 | Ga0207677_10073882 | 3300026023 | Bacteria | 2417 |
| 555 | Ga0207677_10434822 | 3300026023 | Unclassified | 1121 |
| 556 | Ga0207677_10445517 | 3300026023 | Bacteria | 1108 |
| 557 | Ga0207703_10006828 | 3300026035 | Bacteria | 9088 |
| 558 | Ga0207703_10335432 | 3300026035 | Bacteria | 1388 |
| 559 | Ga0207703_10406016 | 3300026035 | Bacteria | 1265 |
| 560 | Ga0207678_10048959 | 3300026067 | Bacteria | 3652 |
| 561 | Ga0207708_10002907 | 3300026075 | Bacteria | 12632 |
| 562 | Ga0207708_10104189 | 3300026075 | Bacteria | 2198 |
| 563 | Ga0207708_10126289 | 3300026075 | Unclassified | 1997 |
| 564 | Ga0207708_10320722 | 3300026075 | Bacteria | 1264 |
| 565 | Ga0207708_10397816 | 3300026075 | Bacteria | 1139 |
| 566 | Ga0207702_10015138 | 3300026078 | Bacteria | 6395 |
| 567 | Ga0207702_10048214 | 3300026078 | Bacteria | 3592 |
| 568 | Ga0207702_10149874 | 3300026078 | Bacteria | 2120 |
| 569 | Ga0207676_10005283 | 3300026095 | Bacteria | 9145 |
| 570 | Ga0207676_10013424 | 3300026095 | Bacteria | 5884 |
| 571 | Ga0207676_10090117 | 3300026095 | Bacteria | 2516 |
| 572 | Ga0207676_10314052 | 3300026095 | Bacteria | 1436 |
| 573 | Ga0207676_10366024 | 3300026095 | Bacteria | 1338 |
| 574 | Ga0207676_10575643 | 3300026095 | Unclassified | 1079 |
| 575 | Ga0207674_10340709 | 3300026116 | Bacteria | 1450 |
| 576 | Ga0207683_10007329 | 3300026121 | Bacteria | 9453 |
| 577 | Ga0207683_10029218 | 3300026121 | Bacteria | 4772 |
| 578 | Ga0207683_10046005 | 3300026121 | Bacteria | 3817 |
| 579 | Ga0207683_10157636 | 3300026121 | Bacteria | 2051 |
| 580 | Ga0207683_10194422 | 3300026121 | Bacteria | 1843 |
| 581 | Ga0207683_10522518 | 3300026121 | Bacteria | 1097 |
| 582 | Ga0207428_10002358 | 3300027907 | Bacteria | 18868 |
| 583 | Ga0207428_10011030 | 3300027907 | Bacteria | 8032 |
| 584 | Ga0207428_10076802 | 3300027907 | Unclassified | 2615 |
| 585 | Ga0265357_1000606 | 3300028023 | Bacteria | 2206 |
| 586 | Ga0268265_10024047 | 3300028380 | Bacteria | 4304 |
| 587 | Ga0268264_10004719 | 3300028381 | Bacteria | 11577 |
| 588 | Ga0268264_10115199 | 3300028381 | Bacteria | 2361 |
| 589 | Ga0268264_10237460 | 3300028381 | Unclassified | 1687 |
| 590 | Ga0268264_10463421 | 3300028381 | Bacteria | 1230 |
| 591 | Ga0265763_1000127 | 3300030763 | Bacteria | 3678 |
| 592 | Ga0265325_10000420 | 3300031241 | Bacteria | 30388 |
| 593 | Ga0373926_0010082 | 3300035083 | Bacteria | 3163 |
| 594 | Ga0373926_0077031 | 3300035083 | Bacteria | 1230 |
| 595 | Ga0373934_0008847 | 3300035086 | Bacteria | 3762 |
| 596 | Ga0373944_0003375 | 3300035089 | Bacteria | 4118 |
| 597 | Ga0373923_0040853 | 3300035111 | Bacteria | 1910 |
| 598 | Ga0373936_0101348 | 3300035113 | Bacteria | 1215 |
| 599 | Ga0373936_0256457 | 3300035113 | Unclassified | 782 |
| 600 | Ga0373939_0074516 | 3300035114 | Bacteria | 1113 |
| 601 | Ga0373945_0018746 | 3300035116 | Bacteria | 2356 |
| 602 | Ga0373945_0038771 | 3300035116 | Bacteria | 1715 |
| 603 | Ga0373945_0047746 | 3300035116 | Bacteria | 1566 |
| 604 | Ga0373953_0025942 | 3300035117 | Unclassified | 2243 |
| 605 | Ga0373953_0026802 | 3300035117 | Bacteria | 2210 |
| 606 | Ga0373953_0044874 | 3300035117 | Bacteria | 1769 |
| 607 | Ga0373953_0072921 | 3300035117 | Bacteria | 1418 |
| 608 | Ga0373954_0002909 | 3300035118 | Bacteria | 7225 |
| 609 | Ga0373954_0111136 | 3300035118 | Unclassified | 1325 |
| 610 | Ga0373954_0117708 | 3300035118 | Bacteria | 1288 |
| 611 | Ga0373954_0162082 | 3300035118 | Bacteria | 1094 |
| 612 | Ga0373943_0013500 | 3300035170 | Bacteria | 3690 |
| 613 | Ga0373943_0025659 | 3300035170 | Bacteria | 2755 |
| 614 | Ga0373943_0037945 | 3300035170 | Bacteria | 2314 |
| 615 | Ga0373943_0041205 | 3300035170 | Bacteria | 2232 |
| 616 | Ga0373946_0016012 | 3300035171 | Bacteria | 2852 |
| 617 | Ga0373946_0025447 | 3300035171 | Bacteria | 2327 |
| 618 | Ga0373946_0027233 | 3300035171 | Bacteria | 2259 |
| 619 | Ga0373955_0151388 | 3300035172 | Unclassified | 1366 |
| 620 | Ga0373931_0033842 | 3300035691 | Bacteria | 2650 |
| 621 | Ga0373931_0034133 | 3300035691 | Bacteria | 2639 |
| 622 | Ga0373935_0031497 | 3300035692 | Bacteria | 3292 |
| 623 | Ga0373935_0047077 | 3300035692 | Bacteria | 2725 |
| 624 | Ga0373935_0056467 | 3300035692 | Bacteria | 2503 |
| 625 | Ga0373935_0075452 | 3300035692 | Bacteria | 2181 |
| 626 | Ga0373935_0247716 | 3300035692 | Bacteria | 1246 |
| 627 | Ga0373935_0276747 | 3300035692 | Bacteria | 1181 |
| 628 | Ga0373927_0009628 | 3300035695 | Bacteria | 6481 |
| 629 | Ga0373927_0010177 | 3300035695 | Bacteria | 6286 |
| 630 | Ga0373927_0023691 | 3300035695 | Bacteria | 4019 |
| 631 | Ga0373927_0187288 | 3300035695 | Bacteria | 1358 |
| 632 | Ga0373927_0227183 | 3300035695 | Bacteria | 1226 |
| 633 | Ga0373927_0272734 | 3300035695 | Bacteria | 1112 |
| 634 | Ga0373927_0294354 | 3300035695 | Bacteria | 1068 |
| 635 | Ga0373927_0350311 | 3300035695 | Bacteria | 973 |
| 636 | Ga0373933_0003527 | 3300035724 | Bacteria | 8709 |
| 637 | Ga0373933_0017698 | 3300035724 | Bacteria | 3998 |
| 638 | Ga0373933_0046437 | 3300035724 | Bacteria | 2579 |
| 639 | Ga0373933_0101233 | 3300035724 | Bacteria | 1788 |
| 640 | Ga0373933_0114208 | 3300035724 | Bacteria | 1687 |
| 641 | Ga0373933_0194802 | 3300035724 | Bacteria | 1295 |
| 642 | Ga0373933_0238209 | 3300035724 | Unclassified | 1170 |
| 643 | Ga0373947_0014698 | 3300035725 | Bacteria | 4490 |
| 644 | Ga0373947_0024305 | 3300035725 | Bacteria | 3530 |
| 645 | Ga0373947_0049770 | 3300035725 | Bacteria | 2517 |
| 646 | Ga0373947_0057715 | 3300035725 | Bacteria | 2350 |
| 647 | Ga0373947_0081459 | 3300035725 | Bacteria | 2004 |
| 648 | Ga0373937_0008429 | 3300036401 | Bacteria | 8960 |
| 649 | Ga0373937_0012005 | 3300036401 | Bacteria | 7605 |
| 650 | Ga0373937_0035308 | 3300036401 | Bacteria | 4550 |
| 651 | Ga0373937_0055701 | 3300036401 | Bacteria | 3630 |
| 652 | Ga0373937_0067180 | 3300036401 | Bacteria | 3303 |
| 653 | Ga0373937_0081320 | 3300036401 | Bacteria | 2997 |
| 654 | Ga0373937_0112637 | 3300036401 | Bacteria | 2531 |
| 655 | Ga0373937_0141704 | 3300036401 | Bacteria | 2249 |
| 656 | Ga0373937_0147413 | 3300036401 | Bacteria | 2203 |
| 657 | Ga0373937_0373717 | 3300036401 | Bacteria | 1351 |
| 658 | Ga0373937_0527350 | 3300036401 | Unclassified | 1122 |
| 659 | Ga0373925_0017340 | 3300037068 | Bacteria | 5219 |
| 660 | Ga0373925_0021907 | 3300037068 | Bacteria | 4658 |
| 661 | Ga0373925_0037762 | 3300037068 | Bacteria | 3567 |
| 662 | Ga0373925_0116697 | 3300037068 | Bacteria | 2068 |
| 663 | Ga0373925_0314905 | 3300037068 | Bacteria | 1265 |
| 664 | Ga0373925_0322997 | 3300037068 | Bacteria | 1249 |
| 665 | Ga0395898_0200351 | 3300037466 | Bacteria | 1906 |
| 666 | Ga0395898_0250058 | 3300037466 | Bacteria | 1691 |
| 667 | Ga0395905_0304740 | 3300037471 | Bacteria | 1481 |
| 668 | Ga0436364_0184300 | 3300037853 | Unclassified | 1325 |
| 669 | Ga0395901_0646105 | 3300038443 | Bacteria | 1062 |
| 670 | Ga0395901_0691884 | 3300038443 | Bacteria | 1018 |
| 671 | Ga0436365_1594359 | 3300039437 | Bacteria | 20612 |
| 672 | Ga0436360_0429114 | 3300039438 | Unclassified | 1245 |
| 673 | Ga0436360_0869868 | 3300039438 | Bacteria | 1503 |
| 674 | Ga0436360_0979666 | 3300039438 | Bacteria | 1871 |
| 675 | Ga0436361_0046162 | 3300039447 | Unclassified | 1543 |
| 676 | Ga0436363_0817093 | 3300039450 | Bacteria | 1844 |
| 677 | Ga0451853_3142187 | 3300041512 | Bacteria | 1399 |
| 678 | Ga0439456_012256 | 3300042013 | Bacteria | 1777 |
| 679 | Ga0439435_0040770 | 3300042436 | Bacteria | 1298 |
| 680 | Ga0439464_0034698 | 3300042439 | Unclassified | 1423 |
| 681 | Ga0451577_0015350 | 3300042876 | Bacteria | 7127 |
| 682 | Ga0453684_0386056 | 3300044712 | Bacteria | 1571 |
| 683 | Ga0451576_0003339 | 3300045051 | Bacteria | 22230 |
| 684 | Ga0495592_0028552 | 3300046454 | Bacteria | 4225 |
| 685 | Ga0495592_0038971 | 3300046454 | Bacteria | 3572 |
| 686 | Ga0495592_0047607 | 3300046454 | Bacteria | 3193 |
| 687 | Ga0495592_0085533 | 3300046454 | Bacteria | 2273 |
| 688 | Ga0495592_0235053 | 3300046454 | Bacteria | 1218 |
| 689 | Ga0495603_0032639 | 3300046455 | Bacteria | 3132 |
| 690 | Ga0495603_0032953 | 3300046455 | Bacteria | 3117 |
| 691 | Ga0495603_0041376 | 3300046455 | Bacteria | 2755 |
| 692 | Ga0495603_0111187 | 3300046455 | Unclassified | 1598 |
| 693 | Ga0495603_0219036 | 3300046455 | Bacteria | 1098 |
| 694 | Ga0495629_0012093 | 3300046459 | Bacteria | 6256 |
| 695 | Ga0495629_0072702 | 3300046459 | Bacteria | 2401 |
| 696 | Ga0495629_0120851 | 3300046459 | Bacteria | 1825 |
| 697 | Ga0495641_0031054 | 3300046461 | Bacteria | 2555 |
| 698 | Ga0495641_0035336 | 3300046461 | Bacteria | 2357 |
| 699 | Ga0495641_0053790 | 3300046461 | Bacteria | 1830 |
| 700 | Ga0495641_0060427 | 3300046461 | Bacteria | 1712 |
| 701 | Ga0495641_0105159 | 3300046461 | Bacteria | 1259 |
| 702 | Ga0495651_0010457 | 3300046462 | Bacteria | 7130 |
| 703 | Ga0495651_0121735 | 3300046462 | Bacteria | 1916 |
| 704 | Ga0495651_0155528 | 3300046462 | Bacteria | 1644 |
| 705 | Ga0495653_0035258 | 3300046463 | Bacteria | 3949 |
| 706 | Ga0495653_0048036 | 3300046463 | Bacteria | 3297 |
| 707 | Ga0495580_0026159 | 3300046472 | Bacteria | 4257 |
| 708 | Ga0495580_0072767 | 3300046472 | Bacteria | 2400 |
| 709 | Ga0495580_0238448 | 3300046472 | Bacteria | 1247 |
| 710 | Ga0495582_0037769 | 3300046473 | Bacteria | 2656 |
| 711 | Ga0495582_0043443 | 3300046473 | Bacteria | 2476 |
| 712 | Ga0495605_0111774 | 3300046474 | Bacteria | 1246 |
| 713 | Ga0495605_0129880 | 3300046474 | Unclassified | 1137 |
| 714 | Ga0495639_0011489 | 3300046475 | Bacteria | 3818 |
| 715 | Ga0495639_0053844 | 3300046475 | Bacteria | 1833 |
| 716 | Ga0495639_0061868 | 3300046475 | Bacteria | 1717 |
| 717 | Ga0495639_0110557 | 3300046475 | Unclassified | 1304 |
| 718 | Ga0495662_0002723 | 3300046476 | Bacteria | 8930 |
| 719 | Ga0495662_0004267 | 3300046476 | Bacteria | 7189 |
| 720 | Ga0495662_0035106 | 3300046476 | Bacteria | 2420 |
| 721 | Ga0495662_0076593 | 3300046476 | Bacteria | 1624 |
| 722 | Ga0495662_0110665 | 3300046476 | Unclassified | 1346 |
| 723 | Ga0495664_0000470 | 3300046477 | Bacteria | 19968 |
| 724 | Ga0495664_0013414 | 3300046477 | Unclassified | 4647 |
| 725 | Ga0495585_0079110 | 3300046492 | Bacteria | 1783 |
| 726 | Ga0495594_0007318 | 3300046499 | Bacteria | 5677 |
| 727 | Ga0495594_0025686 | 3300046499 | Bacteria | 3166 |
| 728 | Ga0495594_0130563 | 3300046499 | Bacteria | 1423 |
| 729 | Ga0495594_0139483 | 3300046499 | Bacteria | 1375 |
| 730 | Ga0495594_0173122 | 3300046499 | Unclassified | 1228 |
| 731 | Ga0495608_0002502 | 3300046511 | Bacteria | 13180 |
| 732 | Ga0495608_0157895 | 3300046511 | Bacteria | 1443 |
| 733 | Ga0495618_0009546 | 3300046514 | Bacteria | 5859 |
| 734 | Ga0495618_0038493 | 3300046514 | Bacteria | 3006 |
| 735 | Ga0495618_0047436 | 3300046514 | Bacteria | 2711 |
| 736 | Ga0495618_0059271 | 3300046514 | Bacteria | 2426 |
| 737 | Ga0495618_0093690 | 3300046514 | Bacteria | 1921 |
| 738 | Ga0495618_0135123 | 3300046514 | Bacteria | 1578 |
| 739 | Ga0495628_0058484 | 3300046516 | Bacteria | 3028 |
| 740 | Ga0495628_0072080 | 3300046516 | Bacteria | 2692 |
| 741 | Ga0495630_0014620 | 3300046517 | Bacteria | 5720 |
| 742 | Ga0495630_0108439 | 3300046517 | Bacteria | 2103 |
| 743 | Ga0495630_0123742 | 3300046517 | Bacteria | 1962 |
| 744 | Ga0495630_0263421 | 3300046517 | Bacteria | 1317 |
| 745 | Ga0495631_0123923 | 3300046518 | Bacteria | 1111 |
| 746 | Ga0495644_0012160 | 3300046523 | Unclassified | 3308 |
| 747 | Ga0495644_0069816 | 3300046523 | Unclassified | 1320 |
| 748 | Ga0495663_0014942 | 3300046525 | Bacteria | 2183 |
| 749 | Ga0495666_0006834 | 3300046526 | Bacteria | 5728 |
| 750 | Ga0495666_0022559 | 3300046526 | Unclassified | 3118 |
| 751 | Ga0495666_0070543 | 3300046526 | Bacteria | 1661 |
| 752 | Ga0495666_0074920 | 3300046526 | Bacteria | 1605 |
| 753 | Ga0495652_0009487 | 3300046529 | Bacteria | 8839 |
| 754 | Ga0495652_0028774 | 3300046529 | Bacteria | 4885 |
| 755 | Ga0495652_0033594 | 3300046529 | Bacteria | 4477 |
| 756 | Ga0495640_0012234 | 3300046533 | Bacteria | 6566 |
| 757 | Ga0495640_0022551 | 3300046533 | Bacteria | 4598 |
| 758 | Ga0495640_0118657 | 3300046533 | Bacteria | 1721 |
| 759 | Ga0495640_0169181 | 3300046533 | Bacteria | 1397 |
| 760 | Ga0495640_0177640 | 3300046533 | Unclassified | 1358 |
| 761 | Ga0495586_0035395 | 3300046535 | Bacteria | 2683 |
| 762 | Ga0495586_0068065 | 3300046535 | Bacteria | 1942 |
| 763 | Ga0495586_0141104 | 3300046535 | Bacteria | 1352 |
| 764 | Ga0495586_0143151 | 3300046535 | Bacteria | 1342 |
| 765 | Ga0495586_0165497 | 3300046535 | Bacteria | 1248 |
| 766 | Ga0495587_0115684 | 3300046536 | Bacteria | 1538 |
| 767 | Ga0495598_0028551 | 3300046537 | Bacteria | 1548 |
| 768 | Ga0495598_0044343 | 3300046537 | Bacteria | 1313 |
| 769 | Ga0495598_0058475 | 3300046537 | Bacteria | 1182 |
| 770 | Ga0495609_0167560 | 3300046538 | Unclassified | 929 |
| 771 | Ga0495621_0077323 | 3300046539 | Bacteria | 1236 |
| 772 | Ga0495645_0206444 | 3300046543 | Unclassified | 1329 |
| 773 | Ga0495622_0008840 | 3300046557 | Bacteria | 4663 |
| 774 | Ga0495633_0112738 | 3300046558 | Bacteria | 1261 |
| 775 | Ga0495633_0186597 | 3300046558 | Unclassified | 954 |
| 776 | Ga0495667_0008485 | 3300046559 | Bacteria | 6975 |
| 777 | Ga0495667_0008637 | 3300046559 | Bacteria | 6917 |
| 778 | Ga0495667_0009304 | 3300046559 | Bacteria | 6661 |
| 779 | Ga0495667_0010627 | 3300046559 | Bacteria | 6225 |
| 780 | Ga0495667_0030501 | 3300046559 | Bacteria | 3622 |
| 781 | Ga0495667_0041683 | 3300046559 | Bacteria | 3044 |
| 782 | Ga0495656_0001752 | 3300046615 | Bacteria | 7115 |
| 783 | Ga0495656_0020184 | 3300046615 | Bacteria | 2582 |
| 784 | Ga0495656_0151734 | 3300046615 | Bacteria | 1120 |
| 785 | Ga0495634_0011131 | 3300046642 | Bacteria | 6561 |
| 786 | Ga0495634_0022945 | 3300046642 | Bacteria | 4394 |
| 787 | Ga0495634_0023212 | 3300046642 | Bacteria | 4362 |
| 788 | Ga0495634_0028656 | 3300046642 | Bacteria | 3864 |
| 789 | Ga0495634_0039483 | 3300046642 | Bacteria | 3214 |
| 790 | Ga0495634_0086975 | 3300046642 | Bacteria | 2035 |
| 791 | Ga0495611_0119224 | 3300046648 | Bacteria | 1230 |
| 792 | Ga0495635_0000867 | 3300046663 | Bacteria | 19857 |
| 793 | Ga0495635_0003614 | 3300046663 | Bacteria | 10712 |
| 794 | Ga0495635_0045149 | 3300046663 | Bacteria | 3040 |
| 795 | Ga0495635_0059343 | 3300046663 | Bacteria | 2630 |
| 796 | Ga0495635_0062367 | 3300046663 | Bacteria | 2560 |
| 797 | Ga0495635_0218829 | 3300046663 | Bacteria | 1288 |
| 798 | Ga0495659_0135618 | 3300046664 | Bacteria | 979 |
| 799 | Ga0495661_0250176 | 3300046665 | Bacteria | 905 |
| 800 | Ga0495588_0253959 | 3300046674 | Unclassified | 927 |
| 801 | Ga0495657_0060503 | 3300046675 | Bacteria | 2509 |
| 802 | Ga0495657_0082903 | 3300046675 | Bacteria | 2071 |
| 803 | Ga0495657_0170662 | 3300046675 | Bacteria | 1340 |
| 804 | Ga0495657_0185468 | 3300046675 | Bacteria | 1274 |
| 805 | Ga0495599_0012841 | 3300046678 | Bacteria | 5169 |
| 806 | Ga0495599_0170476 | 3300046678 | Bacteria | 1343 |
| 807 | Ga0495623_0115054 | 3300046679 | Bacteria | 1626 |
| 808 | Ga0495646_0037285 | 3300046680 | Bacteria | 3008 |
| 809 | Ga0495646_0056004 | 3300046680 | Bacteria | 2365 |
| 810 | Ga0495647_0003721 | 3300046681 | Bacteria | 4899 |
| 811 | Ga0495647_0016387 | 3300046681 | Bacteria | 2608 |
| 812 | Ga0495647_0060660 | 3300046681 | Bacteria | 1492 |
| 813 | Ga0495658_0044362 | 3300046683 | Unclassified | 2491 |
| 814 | Ga0495658_0044652 | 3300046683 | Bacteria | 2484 |
| 815 | Ga0495658_0063021 | 3300046683 | Bacteria | 2132 |
| 816 | Ga0495613_0020301 | 3300046689 | Unclassified | 4954 |
| 817 | Ga0495613_0069050 | 3300046689 | Bacteria | 2577 |
| 818 | Ga0495613_0074787 | 3300046689 | Bacteria | 2467 |
| 819 | Ga0495613_0146926 | 3300046689 | Bacteria | 1682 |
| 820 | Ga0495624_0006737 | 3300046690 | Bacteria | 8117 |
| 821 | Ga0495624_0022791 | 3300046690 | Bacteria | 4132 |
| 822 | Ga0495624_0029029 | 3300046690 | Bacteria | 3611 |
| 823 | Ga0495624_0032989 | 3300046690 | Bacteria | 3355 |
| 824 | Ga0495624_0037679 | 3300046690 | Bacteria | 3109 |
| 825 | Ga0495670_0105346 | 3300046691 | Bacteria | 1456 |
| 826 | Ga0495670_0192799 | 3300046691 | Bacteria | 1078 |
| 827 | Ga0495670_0208248 | 3300046691 | Bacteria | 1037 |
| 828 | Ga0495670_0265219 | 3300046691 | Bacteria | 917 |
| 829 | Ga0495671_0155462 | 3300046692 | Bacteria | 1113 |
| 830 | Ga0495600_0002129 | 3300046809 | Bacteria | 11214 |
| 831 | Ga0495600_0019215 | 3300046809 | Bacteria | 4361 |
| 832 | Ga0495600_0023067 | 3300046809 | Bacteria | 4002 |
| 833 | Ga0495600_0092540 | 3300046809 | Bacteria | 1972 |
| 834 | Ga0495600_0119813 | 3300046809 | Bacteria | 1712 |
| 835 | Ga0495581_0033643 | 3300047315 | Bacteria | 2967 |
| 836 | Ga0495581_0053423 | 3300047315 | Unclassified | 2334 |
| 837 | Ga0495581_0078644 | 3300047315 | Bacteria | 1909 |
| 838 | Ga0495581_0097985 | 3300047315 | Bacteria | 1703 |
| 839 | Ga0495604_0018656 | 3300047317 | Bacteria | 5557 |
| 840 | Ga0495604_0037904 | 3300047317 | Bacteria | 3794 |
| 841 | Ga0495604_0057485 | 3300047317 | Bacteria | 2990 |
| 842 | Ga0495604_0094660 | 3300047317 | Bacteria | 2208 |
| 843 | Ga0495674_0007508 | 3300047319 | Bacteria | 10408 |
| 844 | Ga0495674_0015284 | 3300047319 | Bacteria | 7180 |
| 845 | Ga0495674_0029108 | 3300047319 | Bacteria | 5031 |
| 846 | Ga0495674_0152864 | 3300047319 | Bacteria | 1934 |
| 847 | Ga0495674_0260802 | 3300047319 | Bacteria | 1424 |
| 848 | Ga0495672_0062248 | 3300047320 | Bacteria | 2147 |
| 849 | Ga0495676_0039159 | 3300047321 | Bacteria | 3929 |
| 850 | Ga0495676_0108777 | 3300047321 | Bacteria | 2038 |
| 851 | Ga0495676_0113297 | 3300047321 | Bacteria | 1986 |
| 852 | Ga0495676_0165404 | 3300047321 | Bacteria | 1561 |
| 853 | Ga0495676_0282114 | 3300047321 | Bacteria | 1124 |
| 854 | Ga0495680_0013037 | 3300047322 | Bacteria | 7271 |
| 855 | Ga0495680_0020500 | 3300047322 | Bacteria | 5560 |
| 856 | Ga0495680_0051003 | 3300047322 | Bacteria | 3233 |
| 857 | Ga0495680_0058035 | 3300047322 | Bacteria | 2992 |
| 858 | Ga0495680_0130092 | 3300047322 | Bacteria | 1851 |
| 859 | Ga0495680_0248961 | 3300047322 | Bacteria | 1260 |
| 860 | Ga0495680_0301217 | 3300047322 | Bacteria | 1125 |
| 861 | Ga0495675_0052980 | 3300047444 | Bacteria | 2576 |
| 862 | Ga0495684_0000858 | 3300047471 | Bacteria | 24643 |
| 863 | Ga0495684_0001336 | 3300047471 | Bacteria | 19848 |
| 864 | Ga0495684_0016299 | 3300047471 | Bacteria | 5721 |
| 865 | Ga0495684_0030563 | 3300047471 | Bacteria | 4135 |
| 866 | Ga0495684_0091011 | 3300047471 | Unclassified | 2311 |
| 867 | Ga0495593_0016040 | 3300047673 | Bacteria | 4229 |
| 868 | Ga0495614_0013228 | 3300048089 | Bacteria | 3620 |
| 869 | Ga0496100_0001472 | 3300048903 | Bacteria | 11526 |
| 870 | Ga0496100_0088254 | 3300048903 | Bacteria | 2110 |
| 871 | Ga0496100_0101086 | 3300048903 | Bacteria | 1987 |
| 872 | Ga0496100_0161551 | 3300048903 | Bacteria | 1606 |
| 873 | Ga0496100_0263024 | 3300048903 | Bacteria | 1280 |
| 874 | Ga0496100_0284158 | 3300048903 | Bacteria | 1234 |
| 875 | Ga0496100_0313926 | 3300048903 | Bacteria | 1176 |
| 876 | Ga0496101_0000630 | 3300048904 | Bacteria | 21384 |
| 877 | Ga0496101_0017030 | 3300048904 | Bacteria | 4921 |
| 878 | Ga0496101_0028944 | 3300048904 | Bacteria | 3872 |
| 879 | Ga0496101_0068642 | 3300048904 | Bacteria | 2592 |
| 880 | Ga0496101_0136346 | 3300048904 | Unclassified | 1868 |
| 881 | Ga0496101_0153253 | 3300048904 | Unclassified | 1764 |
| 882 | Ga0496101_0190682 | 3300048904 | Bacteria | 1582 |
| 883 | Ga0496101_0251720 | 3300048904 | Bacteria | 1376 |
| 884 | Ga0496101_0260879 | 3300048904 | Bacteria | 1351 |
| 885 | Ga0496102_0006285 | 3300048905 | Bacteria | 10127 |
| 886 | Ga0496102_0024115 | 3300048905 | Bacteria | 5406 |
| 887 | Ga0496102_0034738 | 3300048905 | Bacteria | 4536 |
| 888 | Ga0496102_0086796 | 3300048905 | Bacteria | 2890 |
| 889 | Ga0496102_0123861 | 3300048905 | Bacteria | 2415 |
| 890 | Ga0496102_0128844 | 3300048905 | Bacteria | 2367 |
| 891 | Ga0496102_0152362 | 3300048905 | Bacteria | 2173 |
| 892 | Ga0496102_0316247 | 3300048905 | Bacteria | 1471 |
| 893 | Ga0496102_0348349 | 3300048905 | Bacteria | 1395 |
| 894 | Ga0496102_0367913 | 3300048905 | Bacteria | 1353 |
| 895 | Ga0496102_0370244 | 3300048905 | Bacteria | 1348 |
| 896 | Ga0496102_0375897 | 3300048905 | Bacteria | 1337 |
| 897 | Ga0496102_0460836 | 3300048905 | Bacteria | 1192 |
| 898 | Ga0496102_0488923 | 3300048905 | Bacteria | 1152 |
| 899 | Ga0496102_0516876 | 3300048905 | Bacteria | 1116 |
| 900 | Ga0496102_0526352 | 3300048905 | Bacteria | 1105 |
| 901 | Ga0496102_0560403 | 3300048905 | Bacteria | 1065 |
| 902 | Ga0496103_0001536 | 3300048906 | Bacteria | 15403 |
| 903 | Ga0496103_0012629 | 3300048906 | Bacteria | 5010 |
| 904 | Ga0496103_0108202 | 3300048906 | Unclassified | 1764 |
| 905 | Ga0496103_0145521 | 3300048906 | Unclassified | 1517 |
| 906 | Ga0496104_0000806 | 3300048907 | Bacteria | 26954 |
| 907 | Ga0496104_0003227 | 3300048907 | Bacteria | 14035 |
| 908 | Ga0496104_0003394 | 3300048907 | Bacteria | 13750 |
| 909 | Ga0496104_0003907 | 3300048907 | Bacteria | 12904 |
| 910 | Ga0496104_0004332 | 3300048907 | Bacteria | 12345 |
| 911 | Ga0496104_0008035 | 3300048907 | Bacteria | 9356 |
| 912 | Ga0496104_0009557 | 3300048907 | Bacteria | 8631 |
| 913 | Ga0496104_0016803 | 3300048907 | Bacteria | 6650 |
| 914 | Ga0496104_0016937 | 3300048907 | Bacteria | 6630 |
| 915 | Ga0496104_0020548 | 3300048907 | Bacteria | 6053 |
| 916 | Ga0496104_0022488 | 3300048907 | Bacteria | 5792 |
| 917 | Ga0496104_0028285 | 3300048907 | Bacteria | 5196 |
| 918 | Ga0496104_0028661 | 3300048907 | Bacteria | 5161 |
| 919 | Ga0496104_0032162 | 3300048907 | Bacteria | 4882 |
| 920 | Ga0496104_0033233 | 3300048907 | Bacteria | 4804 |
| 921 | Ga0496104_0044886 | 3300048907 | Bacteria | 4154 |
| 922 | Ga0496104_0051223 | 3300048907 | Bacteria | 3896 |
| 923 | Ga0496104_0069657 | 3300048907 | Bacteria | 3343 |
| 924 | Ga0496104_0122678 | 3300048907 | Bacteria | 2495 |
| 925 | Ga0496104_0124649 | 3300048907 | Bacteria | 2473 |
| 926 | Ga0496104_0145702 | 3300048907 | Bacteria | 2274 |
| 927 | Ga0496104_0152493 | 3300048907 | Unclassified | 2217 |
| 928 | Ga0496104_0162305 | 3300048907 | Bacteria | 2143 |
| 929 | Ga0496104_0264829 | 3300048907 | Bacteria | 1631 |
| 930 | Ga0496104_0302128 | 3300048907 | Bacteria | 1513 |
| 931 | Ga0496104_0306298 | 3300048907 | Unclassified | 1501 |
| 932 | Ga0496104_0324451 | 3300048907 | Bacteria | 1453 |
| 933 | Ga0496104_0439609 | 3300048907 | Bacteria | 1216 |
| 934 | Ga0496105_0003690 | 3300048908 | Bacteria | 11395 |
| 935 | Ga0496105_0009467 | 3300048908 | Bacteria | 7623 |
| 936 | Ga0496105_0011508 | 3300048908 | Bacteria | 6993 |
| 937 | Ga0496105_0012429 | 3300048908 | Bacteria | 6740 |
| 938 | Ga0496105_0054674 | 3300048908 | Bacteria | 3296 |
| 939 | Ga0496105_0100412 | 3300048908 | Bacteria | 2389 |
| 940 | Ga0496105_0102244 | 3300048908 | Bacteria | 2366 |
| 941 | Ga0496105_0116495 | 3300048908 | Unclassified | 2204 |
| 942 | Ga0496105_0130238 | 3300048908 | Unclassified | 2074 |
| 943 | Ga0496105_0137348 | 3300048908 | Bacteria | 2013 |
| 944 | Ga0496105_0141920 | 3300048908 | Unclassified | 1977 |
| 945 | Ga0496105_0166633 | 3300048908 | Unclassified | 1808 |
| 946 | Ga0496105_0185994 | 3300048908 | Bacteria | 1700 |
| 947 | Ga0496105_0213728 | 3300048908 | Unclassified | 1571 |
| 948 | Ga0496105_0467469 | 3300048908 | Unclassified | 994 |
| 949 | Ga0496106_0000996 | 3300048909 | Bacteria | 20689 |
| 950 | Ga0496106_0002576 | 3300048909 | Bacteria | 13500 |
| 951 | Ga0496106_0002834 | 3300048909 | Bacteria | 12861 |
| 952 | Ga0496106_0123686 | 3300048909 | Bacteria | 2024 |
| 953 | Ga0496106_0142470 | 3300048909 | Bacteria | 1886 |
| 954 | Ga0496106_0195642 | 3300048909 | Bacteria | 1608 |
| 955 | Ga0496106_0196253 | 3300048909 | Bacteria | 1606 |
| 956 | Ga0496106_0200467 | 3300048909 | Bacteria | 1588 |
| 957 | Ga0496106_0225326 | 3300048909 | Bacteria | 1495 |
| 958 | Ga0496106_0268353 | 3300048909 | Bacteria | 1366 |
| 959 | Ga0496107_0004543 | 3300048910 | Bacteria | 9398 |
| 960 | Ga0496107_0005545 | 3300048910 | Bacteria | 8640 |
| 961 | Ga0496107_0018111 | 3300048910 | Bacteria | 4955 |
| 962 | Ga0496107_0193407 | 3300048910 | Unclassified | 1512 |
| 963 | Ga0496107_0211503 | 3300048910 | Bacteria | 1442 |
| 964 | Ga0496108_0006956 | 3300048911 | Bacteria | 9155 |
| 965 | Ga0496108_0020901 | 3300048911 | Bacteria | 5383 |
| 966 | Ga0496108_0036856 | 3300048911 | Bacteria | 4070 |
| 967 | Ga0496108_0037163 | 3300048911 | Unclassified | 4055 |
| 968 | Ga0496108_0086172 | 3300048911 | Bacteria | 2667 |
| 969 | Ga0496108_0115671 | 3300048911 | Bacteria | 2297 |
| 970 | Ga0496108_0132734 | 3300048911 | Bacteria | 2140 |
| 971 | Ga0496108_0175084 | 3300048911 | Bacteria | 1857 |
| 972 | Ga0496108_0221359 | 3300048911 | Bacteria | 1644 |
| 973 | Ga0496108_0441312 | 3300048911 | Bacteria | 1137 |
| 974 | Ga0496109_0001183 | 3300048912 | Bacteria | 21670 |
| 975 | Ga0496109_0004095 | 3300048912 | Bacteria | 12185 |
| 976 | Ga0496109_0011707 | 3300048912 | Bacteria | 7545 |
| 977 | Ga0496109_0031572 | 3300048912 | Bacteria | 4754 |
| 978 | Ga0496109_0061077 | 3300048912 | Bacteria | 3445 |
| 979 | Ga0496109_0064888 | 3300048912 | Bacteria | 3342 |
| 980 | Ga0496109_0064966 | 3300048912 | Bacteria | 3340 |
| 981 | Ga0496109_0083578 | 3300048912 | Bacteria | 2944 |
| 982 | Ga0496109_0085333 | 3300048912 | Bacteria | 2914 |
| 983 | Ga0496109_0122038 | 3300048912 | Bacteria | 2428 |
| 984 | Ga0496109_0533471 | 3300048912 | Bacteria | 1107 |
| 985 | Ga0496109_0569876 | 3300048912 | Unclassified | 1067 |
| 986 | Ga0496109_0571087 | 3300048912 | Bacteria | 1066 |
| 987 | Ga0496109_0586156 | 3300048912 | Unclassified | 1051 |
| 988 | Ga0496110_0001511 | 3300048913 | Bacteria | 16883 |
| 989 | Ga0496110_0002003 | 3300048913 | Bacteria | 15155 |
| 990 | Ga0496110_0004229 | 3300048913 | Bacteria | 11111 |
| 991 | Ga0496110_0009122 | 3300048913 | Bacteria | 8008 |
| 992 | Ga0496110_0026724 | 3300048913 | Bacteria | 4943 |
| 993 | Ga0496110_0057194 | 3300048913 | Bacteria | 3433 |
| 994 | Ga0496110_0089968 | 3300048913 | Bacteria | 2744 |
| 995 | Ga0496110_0125824 | 3300048913 | Bacteria | 2312 |
| 996 | Ga0496110_0186965 | 3300048913 | Bacteria | 1881 |
| 997 | Ga0496110_0222911 | 3300048913 | Bacteria | 1715 |
| 998 | Ga0496110_0243496 | 3300048913 | Bacteria | 1636 |
| 999 | Ga0496110_0438072 | 3300048913 | Bacteria | 1191 |
| 1000 | Ga0496110_0495273 | 3300048913 | Bacteria | 1113 |
| 1001 | Ga0496111_0000686 | 3300048914 | Bacteria | 17848 |
| 1002 | Ga0496111_0003279 | 3300048914 | Bacteria | 9998 |
| 1003 | Ga0496111_0004052 | 3300048914 | Bacteria | 9205 |
| 1004 | Ga0496111_0097901 | 3300048914 | Bacteria | 2154 |
| 1005 | Ga0496111_0159450 | 3300048914 | Bacteria | 1675 |
| 1006 | Ga0496111_0172576 | 3300048914 | Bacteria | 1607 |
| 1007 | Ga0496111_0256622 | 3300048914 | Bacteria | 1297 |
| 1008 | Ga0496111_0294152 | 3300048914 | Unclassified | 1204 |
| 1009 | Ga0496111_0301343 | 3300048914 | Bacteria | 1188 |
| 1010 | Ga0496111_0305228 | 3300048914 | Bacteria | 1180 |
| 1011 | Ga0496111_0307956 | 3300048914 | Bacteria | 1174 |
| 1012 | Ga0496112_0011921 | 3300048915 | Bacteria | 7963 |
| 1013 | Ga0496112_0041245 | 3300048915 | Unclassified | 4515 |
| 1014 | Ga0496112_0090030 | 3300048915 | Bacteria | 3037 |
| 1015 | Ga0496112_0096509 | 3300048915 | Bacteria | 2926 |
| 1016 | Ga0496112_0165468 | 3300048915 | Bacteria | 2178 |
| 1017 | Ga0496112_0203119 | 3300048915 | Bacteria | 1940 |
| 1018 | Ga0496112_0222213 | 3300048915 | Bacteria | 1844 |
| 1019 | Ga0496112_0236485 | 3300048915 | Bacteria | 1780 |
| 1020 | Ga0496112_0299073 | 3300048915 | Bacteria | 1555 |
| 1021 | Ga0496113_0001474 | 3300048916 | Bacteria | 13127 |
| 1022 | Ga0496113_0038255 | 3300048916 | Bacteria | 3526 |
| 1023 | Ga0496113_0051062 | 3300048916 | Bacteria | 3085 |
| 1024 | Ga0496113_0070518 | 3300048916 | Bacteria | 2657 |
| 1025 | Ga0496113_0077773 | 3300048916 | Bacteria | 2537 |
| 1026 | Ga0496113_0082513 | 3300048916 | Unclassified | 2466 |
| 1027 | Ga0496113_0131648 | 3300048916 | Bacteria | 1963 |
| 1028 | Ga0496113_0149297 | 3300048916 | Bacteria | 1843 |
| 1029 | Ga0496113_0267876 | 3300048916 | Bacteria | 1365 |
| 1030 | Ga0496113_0325097 | 3300048916 | Bacteria | 1233 |
| 1031 | Ga0496114_0008474 | 3300048917 | Bacteria | 8147 |
| 1032 | Ga0496114_0029523 | 3300048917 | Bacteria | 4508 |
| 1033 | Ga0496114_0053992 | 3300048917 | Bacteria | 3350 |
| 1034 | Ga0496114_0055628 | 3300048917 | Bacteria | 3300 |
| 1035 | Ga0496114_0063385 | 3300048917 | Bacteria | 3095 |
| 1036 | Ga0496114_0119423 | 3300048917 | Bacteria | 2266 |
| 1037 | Ga0496114_0150461 | 3300048917 | Bacteria | 2019 |
| 1038 | Ga0496114_0151136 | 3300048917 | Bacteria | 2014 |
| 1039 | Ga0496114_0251790 | 3300048917 | Bacteria | 1554 |
| 1040 | Ga0496114_0431799 | 3300048917 | Bacteria | 1167 |
| 1041 | Ga0496114_0482666 | 3300048917 | Bacteria | 1097 |
| 1042 | Ga0496115_0001086 | 3300048918 | Bacteria | 19681 |
| 1043 | Ga0496115_0002436 | 3300048918 | Bacteria | 13364 |
| 1044 | Ga0496115_0021666 | 3300048918 | Bacteria | 4967 |
| 1045 | Ga0496115_0027672 | 3300048918 | Bacteria | 4437 |
| 1046 | Ga0496115_0044471 | 3300048918 | Bacteria | 3542 |
| 1047 | Ga0496115_0104142 | 3300048918 | Bacteria | 2328 |
| 1048 | Ga0496115_0162136 | 3300048918 | Bacteria | 1848 |
| 1049 | Ga0496115_0337215 | 3300048918 | Unclassified | 1231 |
| 1050 | Ga0496115_0426986 | 3300048918 | Bacteria | 1073 |
| 1051 | Ga0496121_0150807 | 3300048924 | Bacteria | 1711 |
| 1052 | Ga0501034_0004656 | 3300049571 | Bacteria | 15194 |
| 1053 | Ga0501036_0196333 | 3300049572 | Bacteria | 1698 |
| 1054 | Ga0501076_0057256 | 3300049592 | Bacteria | 3095 |
| 1055 | nmdc:mga00v17_90451_c1 | 3300050491 | Bacteria | 1922 |
| 1056 | nmdc:mga0yw44_124312_c1 | 3300050492 | Unclassified | 1664 |
| 1057 | nmdc:mga0yw44_247340_c1 | 3300050492 | Bacteria | 1186 |
| 1058 | nmdc:mga0yw44_25013_c1 | 3300050492 | Bacteria | 3388 |
| 1059 | nmdc:mga0yw44_2753_c1 | 3300050492 | Bacteria | 7609 |
| 1060 | nmdc:mga0yw44_29583_c1 | 3300050492 | Bacteria | 3163 |
| 1061 | nmdc:mga0yw44_4191_c1 | 3300050492 | Bacteria | 5636 |
| 1062 | nmdc:mga0yw44_9268_c1 | 3300050492 | Bacteria | 4961 |
| 1063 | nmdc:mga0yw44_92790_c1 | 3300050492 | Bacteria | 1911 |
| 1064 | nmdc:mga0yw44_98077_c1 | 3300050492 | Bacteria | 1862 |
| 1065 | nmdc:mga0k408_41568_c1 | 3300050493 | Bacteria | 2647 |
| 1066 | nmdc:mga06z11_12463_c1 | 3300050494 | Bacteria | 3699 |
| 1067 | nmdc:mga05p37_105494_c1 | 3300050507 | Bacteria | 3467 |
| 1068 | nmdc:mga05p37_12398_c1 | 3300050507 | Bacteria | 10179 |
| 1069 | nmdc:mga05p37_134637_c1 | 3300050507 | Bacteria | 3032 |
| 1070 | nmdc:mga05p37_138062_c1 | 3300050507 | Bacteria | 2988 |
| 1071 | nmdc:mga05p37_177848_c1 | 3300050507 | Bacteria | 2591 |
| 1072 | nmdc:mga05p37_209306_c1 | 3300050507 | Bacteria | 2358 |
| 1073 | nmdc:mga05p37_24432_c1 | 3300050507 | Bacteria | 7345 |
| 1074 | nmdc:mga05p37_298327_c1 | 3300050507 | Bacteria | 1916 |
| 1075 | nmdc:mga05p37_453824_c1 | 3300050507 | Bacteria | 1483 |
| 1076 | nmdc:mga05p37_501490_c1 | 3300050507 | Bacteria | 1393 |
| 1077 | nmdc:mga05p37_5228_c1 | 3300050507 | Bacteria | 15231 |
| 1078 | nmdc:mga05p37_668621_c1 | 3300050507 | Bacteria | 1160 |
| 1079 | nmdc:mga05p37_97517_c1 | 3300050507 | Bacteria | 3621 |
| 1080 | nmdc:mga09592_10210_c1 | 3300050508 | Bacteria | 7641 |
| 1081 | nmdc:mga09592_151287_c1 | 3300050508 | Bacteria | 2002 |
| 1082 | nmdc:mga09592_186706_c1 | 3300050508 | Bacteria | 1794 |
| 1083 | nmdc:mga09592_42124_c1 | 3300050508 | Bacteria | 3840 |
| 1084 | nmdc:mga09592_43809_c1 | 3300050508 | Bacteria | 3764 |
| 1085 | nmdc:mga0qj67_13333_c1 | 3300050509 | Bacteria | 6204 |
| 1086 | nmdc:mga0qj67_144063_c1 | 3300050509 | Bacteria | 1932 |
| 1087 | nmdc:mga0qj67_322385_c1 | 3300050509 | Bacteria | 1251 |
| 1088 | nmdc:mga0qj67_425056_c1 | 3300050509 | Unclassified | 1071 |
| 1089 | nmdc:mga0qj67_44477_c1 | 3300050509 | Bacteria | 3500 |
| 1090 | nmdc:mga06r32_112573_c1 | 3300050510 | Bacteria | 2678 |
| 1091 | nmdc:mga06r32_122967_c1 | 3300050510 | Bacteria | 2561 |
| 1092 | nmdc:mga06r32_157068_c1 | 3300050510 | Bacteria | 2256 |
| 1093 | nmdc:mga06r32_16971_c1 | 3300050510 | Bacteria | 6643 |
| 1094 | nmdc:mga06r32_26160_c1 | 3300050510 | Bacteria | 5437 |
| 1095 | nmdc:mga06r32_416560_c1 | 3300050510 | Bacteria | 1325 |
| 1096 | nmdc:mga06r32_430648_c1 | 3300050510 | Bacteria | 1300 |
| 1097 | nmdc:mga06r32_580589_c1 | 3300050510 | Bacteria | 1093 |
| 1098 | nmdc:mga06r32_85469_c1 | 3300050510 | Bacteria | 3076 |
| 1099 | nmdc:mga06r32_96353_c1 | 3300050510 | Bacteria | 2897 |
| 1100 | nmdc:mga08y16_154535_c1 | 3300050511 | Bacteria | 2385 |
| 1101 | nmdc:mga08y16_304708_c1 | 3300050511 | Unclassified | 1641 |
| 1102 | nmdc:mga08y16_51314_c1 | 3300050511 | Bacteria | 4316 |
| 1103 | nmdc:mga0n895_167498_c1 | 3300050512 | Unclassified | 2229 |
| 1104 | nmdc:mga0n895_17646_c1 | 3300050512 | Bacteria | 6585 |
| 1105 | nmdc:mga0n895_304899_c1 | 3300050512 | Bacteria | 1614 |
| 1106 | nmdc:mga0n895_525623_c1 | 3300050512 | Bacteria | 1190 |
| 1107 | nmdc:mga0n895_59582_c1 | 3300050512 | Bacteria | 3766 |
| 1108 | nmdc:mga0n895_698849_c1 | 3300050512 | Bacteria | 1010 |
| 1109 | nmdc:mga0n895_97552_c1 | 3300050512 | Bacteria | 2945 |
| 1110 | nmdc:mga0rr50_113310_c1 | 3300050513 | Bacteria | 2149 |
| 1111 | nmdc:mga0rr50_123083_c1 | 3300050513 | Bacteria | 2067 |
| 1112 | nmdc:mga0rr50_297701_c1 | 3300050513 | Bacteria | 1349 |
| 1113 | nmdc:mga0rr50_417275_c1 | 3300050513 | Unclassified | 1135 |
| 1114 | nmdc:mga0rr50_8302_c1 | 3300050513 | Bacteria | 6459 |
| 1115 | nmdc:mga08x19_87446_c1 | 3300050514 | Unclassified | 2053 |
| 1116 | nmdc:mga0a205_12697_c1 | 3300050515 | Bacteria | 7805 |
| 1117 | nmdc:mga0a205_251191_c1 | 3300050515 | Bacteria | 1648 |
| 1118 | nmdc:mga0a205_287417_c1 | 3300050515 | Bacteria | 1519 |
| 1119 | nmdc:mga0a205_31051_c1 | 3300050515 | Bacteria | 5117 |
| 1120 | nmdc:mga0a205_337033_c1 | 3300050515 | Bacteria | 1377 |
| 1121 | nmdc:mga0a205_34598_c1 | 3300050515 | Unclassified | 4847 |
| 1122 | Ga0495601_0006044 | 3300053077 | Bacteria | 7062 |
| 1123 | Ga0495601_0006137 | 3300053077 | Bacteria | 7008 |
| 1124 | Ga0495601_0012121 | 3300053077 | Bacteria | 5168 |
| 1125 | Ga0495601_0013146 | 3300053077 | Bacteria | 4977 |
| 1126 | Ga0495601_0013361 | 3300053077 | Bacteria | 4936 |
| 1127 | Ga0495601_0019934 | 3300053077 | Bacteria | 4093 |
| 1128 | Ga0495601_0022522 | 3300053077 | Bacteria | 3868 |
| 1129 | Ga0495601_0030524 | 3300053077 | Bacteria | 3347 |
| 1130 | Ga0495601_0032069 | 3300053077 | Bacteria | 3269 |
| 1131 | Ga0495601_0042922 | 3300053077 | Unclassified | 2839 |
| 1132 | Ga0495601_0084445 | 3300053077 | Bacteria | 2039 |
| 1133 | Ga0495601_0114230 | 3300053077 | Bacteria | 1750 |
| 1134 | Ga0495601_0124596 | 3300053077 | Bacteria | 1676 |
| 1135 | Ga0495601_0144627 | 3300053077 | Bacteria | 1552 |
| 1136 | Ga0495612_0009023 | 3300053078 | Bacteria | 4044 |
| 1137 | Ga0495612_0022096 | 3300053078 | Bacteria | 2550 |
| 1138 | Ga0495612_0025308 | 3300053078 | Bacteria | 2383 |
| 1139 | Ga0495612_0061305 | 3300053078 | Bacteria | 1558 |
| 1140 | Ga0495612_0175124 | 3300053078 | Bacteria | 941 |
| 1141 | Ga0495655_0045928 | 3300053083 | Bacteria | 1136 |
| 1142 | Ga0495655_0047526 | 3300053083 | Unclassified | 1123 |
| 1143 | Ga0495595_0000705 | 3300053084 | Bacteria | 12726 |
| 1144 | Ga0495595_0008407 | 3300053084 | Bacteria | 4233 |
| 1145 | Ga0495595_0014589 | 3300053084 | Bacteria | 3337 |
| 1146 | Ga0495595_0016280 | 3300053084 | Bacteria | 3178 |
| 1147 | Ga0495595_0027540 | 3300053084 | Bacteria | 2533 |
| 1148 | Ga0495595_0070341 | 3300053084 | Bacteria | 1653 |
| 1149 | Ga0495595_0089008 | 3300053084 | Bacteria | 1479 |
| 1150 | Ga0495595_0124071 | 3300053084 | Bacteria | 1259 |
| 1151 | Ga0495619_0002556 | 3300053085 | Bacteria | 11906 |
| 1152 | Ga0495619_0006681 | 3300053085 | Bacteria | 7296 |
| 1153 | Ga0495619_0010856 | 3300053085 | Bacteria | 5733 |
| 1154 | Ga0495619_0011489 | 3300053085 | Bacteria | 5582 |
| 1155 | Ga0495619_0013391 | 3300053085 | Bacteria | 5168 |
| 1156 | Ga0495619_0013922 | 3300053085 | Bacteria | 5076 |
| 1157 | Ga0495619_0025005 | 3300053085 | Bacteria | 3832 |
| 1158 | Ga0495619_0039728 | 3300053085 | Bacteria | 3072 |
| 1159 | Ga0495619_0048786 | 3300053085 | Bacteria | 2790 |
| 1160 | Ga0495619_0064831 | 3300053085 | Bacteria | 2436 |
| 1161 | Ga0495619_0084144 | 3300053085 | Bacteria | 2146 |
| 1162 | Ga0495619_0098032 | 3300053085 | Bacteria | 1992 |
| 1163 | Ga0495619_0129702 | 3300053085 | Bacteria | 1732 |
| 1164 | Ga0495619_0189366 | 3300053085 | Bacteria | 1424 |
| 1165 | Ga0501082_0308217 | 3300060353 | Bacteria | 1379 |
| 1166 | Ga0530510_0227151 | 3300061734 | Bacteria | 1388 |
| 1167 | 8019642214 | 8019638758 | Bacteria | 9062356 |
| 1168 | Ga0070673_100084683 | |||
| 1169 | JGI24742J22300_10002891 | |||
| 1170 | JGI25404J52841_10001460 | |||
| 1171 | Ga0070658_10001156 | |||
| 1172 | Ga0070658_10203152 | |||
| 1173 | Ga0070683_100001121 | |||
| 1174 | Ga0070690_100014966 | |||
| 1175 | Ga0070690_100181107 | |||
| 1176 | Ga0070690_100198083 | |||
| 1177 | Ga0070670_100038170 | |||
| 1178 | Ga0070670_100038980 | |||
| 1179 | Ga0070670_100105540 | |||
| 1180 | Ga0070670_100116266 | |||
| 1181 | Ga0070670_100292654 | |||
| 1182 | Ga0070677_10021634 | |||
| 1183 | Ga0068869_100048431 | |||
| 1184 | Ga0070680_100004056 | |||
| 1185 | Ga0070680_100345664 | |||
| 1186 | Ga0068868_100004336 | |||
| 1187 | Ga0068868_100255064 | |||
| 1188 | Ga0070689_100001947 | |||
| 1189 | Ga0070689_100007629 | |||
| 1190 | Ga0070689_100092967 | |||
| 1191 | Ga0070689_100123346 | |||
| 1192 | Ga0070691_10010850 | |||
| 1193 | Ga0070691_10029146 | |||
| 1194 | Ga0070692_10017241 | |||
| 1195 | Ga0070668_100010746 | |||
| 1196 | Ga0070668_100265956 | |||
| 1197 | Ga0070669_100078563 | |||
| 1198 | Ga0070669_100121516 | |||
| 1199 | Ga0070671_100011715 | |||
| 1200 | Ga0070671_100014073 | |||
| 1201 | Ga0070671_100104104 | |||
| 1202 | Ga0070671_100205505 | |||
| 1203 | Ga0070674_100008989 | |||
| 1204 | Ga0070674_100107278 | |||
| 1205 | Ga0070673_100026029 | |||
| 1206 | Ga0070673_100298816 | |||
| 1207 | Ga0070673_100327612 | |||
| 1208 | Ga0070688_100068399 | |||
| 1209 | Ga0070659_100246676 | |||
| 1210 | Ga0070667_100030347 | |||
| 1211 | Ga0070667_100267262 | |||
| 1212 | Ga0070667_100299333 | |||
| 1213 | Ga0070667_100415011 | |||
| 1214 | Ga0070709_10009597 | |||
| 1215 | Ga0070709_10047860 | |||
| 1216 | Ga0070709_10107228 | |||
| 1217 | Ga0070714_100033286 | |||
| 1218 | Ga0070714_100042466 | |||
| 1219 | Ga0070714_100058556 | |||
| 1220 | Ga0070714_100087270 | |||
| 1221 | Ga0070714_100138572 | |||
| 1222 | Ga0070714_100166783 | |||
| 1223 | Ga0070714_100199349 | |||
| 1224 | Ga0070713_100016710 | |||
| 1225 | Ga0070713_100086205 | |||
| 1226 | Ga0070713_100091571 | |||
| 1227 | Ga0070713_100130165 | |||
| 1228 | Ga0070713_100160272 | |||
| 1229 | Ga0070713_100179742 | |||
| 1230 | Ga0070713_100180445 | |||
| 1231 | Ga0070713_100241688 | |||
| 1232 | Ga0070713_100261208 | |||
| 1233 | Ga0070713_100278304 | |||
| 1234 | Ga0070710_10010563 | |||
| 1235 | Ga0070710_10039165 | |||
| 1236 | Ga0070710_10068382 | |||
| 1237 | Ga0070710_10125366 | |||
| 1238 | Ga0070701_10005306 | |||
| 1239 | Ga0070711_100017236 | |||
| 1240 | Ga0070711_100031700 | |||
| 1241 | Ga0070711_100068411 | |||
| 1242 | Ga0070711_100100062 | |||
| 1243 | Ga0070711_100233530 | |||
| 1244 | Ga0070700_100009528 | |||
| 1245 | Ga0070708_100082719 | |||
| 1246 | Ga0070708_100141481 | |||
| 1247 | Ga0070708_100153488 | |||
| 1248 | Ga0070708_100158872 | |||
| 1249 | Ga0070708_100182039 | |||
| 1250 | Ga0070663_100038713 | |||
| 1251 | Ga0070663_100265792 | |||
| 1252 | Ga0070678_100002315 | |||
| 1253 | Ga0070678_100012089 | |||
| 1254 | Ga0070678_100018294 | |||
| 1255 | Ga0070678_100036574 | |||
| 1256 | Ga0070678_100067407 | |||
| 1257 | Ga0070678_100070372 | |||
| 1258 | Ga0070662_100027861 | |||
| 1259 | Ga0070681_10005593 | |||
| 1260 | Ga0070681_10034420 | |||
| 1261 | Ga0068867_100264261 | |||
| 1262 | Ga0070685_10012015 | |||
| 1263 | Ga0070685_10053136 | |||
| 1264 | Ga0070706_100011324 | |||
| 1265 | Ga0070706_100031497 | |||
| 1266 | Ga0070706_100044768 | |||
| 1267 | Ga0070706_100050361 | |||
| 1268 | Ga0070706_100060695 | |||
| 1269 | Ga0070706_100083775 | |||
| 1270 | Ga0070706_100102371 | |||
| 1271 | Ga0070706_100161466 | |||
| 1272 | Ga0070706_100173473 | |||
| 1273 | Ga0070706_100208347 | |||
| 1274 | Ga0070706_100279925 | |||
| 1275 | Ga0070706_100612309 | |||
| 1276 | Ga0070707_100056720 | |||
| 1277 | Ga0070707_100244412 | |||
| 1278 | Ga0070698_100009485 | |||
| 1279 | Ga0070698_100026486 | |||
| 1280 | Ga0070698_100052361 | |||
| 1281 | Ga0070698_100080771 | |||
| 1282 | Ga0070698_100091231 | |||
| 1283 | Ga0070698_100144197 | |||
| 1284 | Ga0070698_100175925 | |||
| 1285 | Ga0070698_100176117 | |||
| 1286 | Ga0070698_100390553 | |||
| 1287 | Ga0070699_100003490 | |||
| 1288 | Ga0070699_100004179 | |||
| 1289 | Ga0070699_100005289 | |||
| 1290 | Ga0070699_100006194 | |||
| 1291 | Ga0070699_100021079 | |||
| 1292 | Ga0070699_100030200 | |||
| 1293 | Ga0070699_100036560 | |||
| 1294 | Ga0070699_100043112 | |||
| 1295 | Ga0070699_100083001 | |||
| 1296 | Ga0070699_100102660 | |||
| 1297 | Ga0070699_100105707 | |||
| 1298 | Ga0070699_100109724 | |||
| 1299 | Ga0070699_100115741 | |||
| 1300 | Ga0070699_100192646 | |||
| 1301 | Ga0070699_100309292 | |||
| 1302 | Ga0070699_100434467 | |||
| 1303 | Ga0070679_100008810 | |||
| 1304 | Ga0070679_100029991 | |||
| 1305 | Ga0070679_100145703 | |||
| 1306 | Ga0070679_100470275 | |||
| 1307 | Ga0070684_100008126 | |||
| 1308 | Ga0070697_100008185 | |||
| 1309 | Ga0070697_100016831 | |||
| 1310 | Ga0070697_100024500 | |||
| 1311 | Ga0070697_100048043 | |||
| 1312 | Ga0070697_100074218 | |||
| 1313 | Ga0070697_100117046 | |||
| 1314 | Ga0070697_100135814 | |||
| 1315 | Ga0070697_100165930 | |||
| 1316 | Ga0070697_100193541 | |||
| 1317 | Ga0070697_100277395 | |||
| 1318 | Ga0070697_100450920 | |||
| 1319 | Ga0068853_100380246 | |||
| 1320 | Ga0070672_100268100 | |||
| 1321 | Ga0070686_100003143 | |||
| 1322 | Ga0070693_100045456 | |||
| 1323 | Ga0070665_100520421 | |||
| 1324 | Ga0068855_100128460 | |||
| 1325 | Ga0068855_100166678 | |||
| 1326 | Ga0070664_100011613 | |||
| 1327 | Ga0070664_100210559 | |||
| 1328 | Ga0070664_100241099 | |||
| 1329 | Ga0068857_100160311 | |||
| 1330 | Ga0068856_100054081 | |||
| 1331 | Ga0068856_100085045 | |||
| 1332 | Ga0068856_100120182 | |||
| 1333 | Ga0068856_100234095 | |||
| 1334 | Ga0070702_100004162 | |||
| 1335 | Ga0068859_100033904 | |||
| 1336 | Ga0068859_100090857 | |||
| 1337 | Ga0068864_100006897 | |||
| 1338 | Ga0068864_100032912 | |||
| 1339 | Ga0068864_100267480 | |||
| 1340 | Ga0068866_10002593 | |||
| 1341 | Ga0068861_100006324 | |||
| 1342 | Ga0068861_100083593 | |||
| 1343 | Ga0068870_10005165 | |||
| 1344 | Ga0068863_100032962 | |||
| 1345 | Ga0068858_100009104 | |||
| 1346 | Ga0068858_100165745 | |||
| 1347 | Ga0068858_100269592 | |||
| 1348 | Ga0068860_100030590 | |||
| 1349 | Ga0068862_100006330 | |||
| 1350 | Ga0068862_100112744 | |||
| 1351 | Ga0068862_100198161 | |||
| 1352 | Ga0081455_10008747 | |||
| 1353 | Ga0081455_10016524 | |||
| 1354 | Ga0081455_10019101 | |||
| 1355 | Ga0081455_10023698 | |||
| 1356 | Ga0081455_10027072 | |||
| 1357 | Ga0081455_10027473 | |||
| 1358 | Ga0081455_10031742 | |||
| 1359 | Ga0081455_10040091 | |||
| 1360 | Ga0081455_10040565 | |||
| 1361 | Ga0081455_10061773 | |||
| 1362 | Ga0081455_10062684 | |||
| 1363 | Ga0081455_10063467 | |||
| 1364 | Ga0081455_10064449 | |||
| 1365 | Ga0081455_10082171 | |||
| 1366 | Ga0081455_10105278 | |||
| 1367 | Ga0081455_10116681 | |||
| 1368 | Ga0081455_10118023 | |||
| 1369 | Ga0081455_10133923 | |||
| 1370 | Ga0081455_10137423 | |||
| 1371 | Ga0081455_10224805 | |||
| 1372 | Ga0081455_10257225 | |||
| 1373 | Ga0081455_10309385 | |||
| 1374 | Ga0081455_10337979 | |||
| 1375 | Ga0081538_10008403 | |||
| 1376 | Ga0081538_10034821 | |||
| 1377 | Ga0081540_1003391 | |||
| 1378 | Ga0081540_1019499 | |||
| 1379 | Ga0081540_1033202 | |||
| 1380 | Ga0081540_1033572 | |||
| 1381 | Ga0081540_1044016 | |||
| 1382 | Ga0081540_1101525 | |||
| 1383 | Ga0081539_10055010 | |||
| 1384 | Ga0070717_10012611 | |||
| 1385 | Ga0070717_10016828 | |||
| 1386 | Ga0070717_10020266 | |||
| 1387 | Ga0070717_10020508 | |||
| 1388 | Ga0070717_10025932 | |||
| 1389 | Ga0070717_10037808 | |||
| 1390 | Ga0070717_10042714 | |||
| 1391 | Ga0070717_10070950 | |||
| 1392 | Ga0070717_10104963 | |||
| 1393 | Ga0070717_10123222 | |||
| 1394 | Ga0070717_10138114 | |||
| 1395 | Ga0070717_10149568 | |||
| 1396 | Ga0070717_10248567 | |||
| 1397 | Ga0070717_10282626 | |||
| 1398 | Ga0070717_10285154 | |||
| 1399 | Ga0070717_10313493 | |||
| 1400 | Ga0070717_10383820 | |||
| 1401 | Ga0075365_10015874 | |||
| 1402 | Ga0075365_10025586 | |||
| 1403 | Ga0075365_10032283 | |||
| 1404 | Ga0075365_10033692 | |||
| 1405 | Ga0075363_100154931 | |||
| 1406 | Ga0075432_10008469 | |||
| 1407 | Ga0070715_10000242 | |||
| 1408 | Ga0070715_10022869 | |||
| 1409 | Ga0070715_10029990 | |||
| 1410 | Ga0070715_10033608 | |||
| 1411 | Ga0070715_10099976 | |||
| 1412 | Ga0070716_100011802 | |||
| 1413 | Ga0070716_100052321 | |||
| 1414 | Ga0070716_100110360 | |||
| 1415 | Ga0070716_100268203 | |||
| 1416 | Ga0070712_100034004 | |||
| 1417 | Ga0070712_100047291 | |||
| 1418 | Ga0070712_100049393 | |||
| 1419 | Ga0070712_100072272 | |||
| 1420 | Ga0070712_100074712 | |||
| 1421 | Ga0070712_100080220 | |||
| 1422 | Ga0070712_100205137 | |||
| 1423 | Ga0070712_100295344 | |||
| 1424 | Ga0070712_100303730 | |||
| 1425 | Ga0075367_10021398 | |||
| 1426 | Ga0075366_10057977 | |||
| 1427 | Ga0097621_100173906 | |||
| 1428 | Ga0097621_100215058 | |||
| 1429 | Ga0068871_100009772 | |||
| 1430 | Ga0068871_100014704 | |||
| 1431 | Ga0075428_100035506 | |||
| 1432 | Ga0075428_100057281 | |||
| 1433 | Ga0075428_100058330 | |||
| 1434 | Ga0075428_100064188 | |||
| 1435 | Ga0075428_100103051 | |||
| 1436 | Ga0075428_100117010 | |||
| 1437 | Ga0075428_100122107 | |||
| 1438 | Ga0075428_100157279 | |||
| 1439 | Ga0075428_100176373 | |||
| 1440 | Ga0075428_100203895 | |||
| 1441 | Ga0075428_100268035 | |||
| 1442 | Ga0075428_100269297 | |||
| 1443 | Ga0075428_100321541 | |||
| 1444 | Ga0075428_100393891 | |||
| 1445 | Ga0075428_100394921 | |||
| 1446 | Ga0075428_100451742 | |||
| 1447 | Ga0075428_100483389 | |||
| 1448 | Ga0075428_100531644 | |||
| 1449 | Ga0075428_100593737 | |||
| 1450 | Ga0075428_100743190 | |||
| 1451 | Ga0075430_100029679 | |||
| 1452 | Ga0075430_100041368 | |||
| 1453 | Ga0075430_100080238 | |||
| 1454 | Ga0075430_100115009 | |||
| 1455 | Ga0075430_100134879 | |||
| 1456 | Ga0075430_100298446 | |||
| 1457 | Ga0075430_100332371 | |||
| 1458 | Ga0075431_100021708 | |||
| 1459 | Ga0075431_100028014 | |||
| 1460 | Ga0075431_100166571 | |||
| 1461 | Ga0075431_100221718 | |||
| 1462 | Ga0075431_100226620 | |||
| 1463 | Ga0075431_100377389 | |||
| 1464 | Ga0075431_100454194 | |||
| 1465 | Ga0075431_100474855 | |||
| 1466 | Ga0075431_100548217 | |||
| 1467 | Ga0075431_100585521 | |||
| 1468 | Ga0075431_100656552 | |||
| 1469 | Ga0075431_100657810 | |||
| 1470 | Ga0075433_10084172 | |||
| 1471 | Ga0075433_10153334 | |||
| 1472 | Ga0075433_10266432 | |||
| 1473 | Ga0075433_10507728 | |||
| 1474 | Ga0075434_100037214 | |||
| 1475 | Ga0075434_100079649 | |||
| 1476 | Ga0075434_100259843 | |||
| 1477 | Ga0075434_100270401 | |||
| 1478 | Ga0075434_100457966 | |||
| 1479 | Ga0075429_100042654 | |||
| 1480 | Ga0075429_100088905 | |||
| 1481 | Ga0075429_100138764 | |||
| 1482 | Ga0075429_100168494 | |||
| 1483 | Ga0075429_100247590 | |||
| 1484 | Ga0068865_100073832 | |||
| 1485 | Ga0075436_100100912 | |||
| 1486 | Ga0075436_100250236 | |||
| 1487 | Ga0097620_100033904 | |||
| 1488 | Ga0097620_100090862 | |||
| 1489 | Ga0075435_100068979 | |||
| 1490 | Ga0075435_100100318 | |||
| 1491 | Ga0075435_100106430 | |||
| 1492 | Ga0099795_10003360 | |||
| 1493 | Ga0099795_10042773 | |||
| 1494 | Ga0105240_10026900 | |||
| 1495 | Ga0105240_10098213 | |||
| 1496 | Ga0111539_10024858 | |||
| 1497 | Ga0111539_10132062 | |||
| 1498 | Ga0111539_10222300 | |||
| 1499 | Ga0111539_10225838 | |||
| 1500 | Ga0111539_10268074 | |||
| 1501 | Ga0111539_10570456 | |||
| 1502 | Ga0111539_10589956 | |||
| 1503 | Ga0105245_10004865 | |||
| 1504 | Ga0105245_10232506 | |||
| 1505 | Ga0105245_10339894 | |||
| 1506 | Ga0105247_10103385 | |||
| 1507 | Ga0114129_10008935 | |||
| 1508 | Ga0114129_10040328 | |||
| 1509 | Ga0114129_10105981 | |||
| 1510 | Ga0114129_10110662 | |||
| 1511 | Ga0114129_10163348 | |||
| 1512 | Ga0114129_10187116 | |||
| 1513 | Ga0114129_10192625 | |||
| 1514 | Ga0114129_10278513 | |||
| 1515 | Ga0114129_10422720 | |||
| 1516 | Ga0114129_10506751 | |||
| 1517 | Ga0114129_10540298 | |||
| 1518 | Ga0114129_10789765 | |||
| 1519 | Ga0114129_10810439 | |||
| 1520 | Ga0114129_10934330 | |||
| 1521 | Ga0105243_10001839 | |||
| 1522 | Ga0105243_10484255 | |||
| 1523 | Ga0105242_10020765 | |||
| 1524 | Ga0105242_10044693 | |||
| 1525 | Ga0105242_10542892 | |||
| 1526 | Ga0105248_10008067 | |||
| 1527 | Ga0105248_10058373 | |||
| 1528 | Ga0105248_10145644 | |||
| 1529 | Ga0105248_10194810 | |||
| 1530 | Ga0105237_10041340 | |||
| 1531 | Ga0105237_10425677 | |||
| 1532 | Ga0105238_10041895 | |||
| 1533 | Ga0105238_10564739 | |||
| 1534 | Ga0105249_10016552 | |||
| 1535 | Ga0105249_10041634 | |||
| 1536 | Ga0105249_10582580 | |||
| 1537 | Ga0099796_10049890 | |||
| 1538 | Ga0099796_10061728 | |||
| 1539 | Ga0105239_10003524 | |||
| 1540 | Ga0105239_10098495 | |||
| 1541 | Ga0105239_10420144 | |||
| 1542 | Ga0105239_10572805 | |||
| 1543 | Ga0105239_10830277 | |||
| 1544 | Ga0105246_10198625 | |||
| 1545 | Ga0105246_10279048 | |||
| 1546 | Ga0105246_10313025 | |||
| 1547 | Ga0157369_10563441 | |||
| 1548 | Ga0157374_10018968 | |||
| 1549 | Ga0157374_10021300 | |||
| 1550 | Ga0157374_10057134 | |||
| 1551 | Ga0157374_10541829 | |||
| 1552 | Ga0157378_10045594 | |||
| 1553 | Ga0157378_10081442 | |||
| 1554 | Ga0157378_10479698 | |||
| 1555 | Ga0163162_10029971 | |||
| 1556 | Ga0163162_10091589 | |||
| 1557 | Ga0163162_10119045 | |||
| 1558 | Ga0163162_10139216 | |||
| 1559 | Ga0163162_10168632 | |||
| 1560 | Ga0163162_10214979 | |||
| 1561 | Ga0163162_10316760 | |||
| 1562 | Ga0163162_10385615 | |||
| 1563 | Ga0163162_10440575 | |||
| 1564 | Ga0163162_10619712 | |||
| 1565 | Ga0157372_10837193 | |||
| 1566 | Ga0157375_10001511 | |||
| 1567 | Ga0157375_10097217 | |||
| 1568 | Ga0157375_10378208 | |||
| 1569 | Ga0157375_10552218 | |||
| 1570 | Ga0157375_10727725 | |||
| 1571 | Ga0163163_10006830 | |||
| 1572 | Ga0163163_10141483 | |||
| 1573 | Ga0157380_10007419 | |||
| 1574 | Ga0157380_10252227 | |||
| 1575 | Ga0182008_10030771 | |||
| 1576 | Ga0182008_10134012 | |||
| 1577 | Ga0157377_10296023 | |||
| 1578 | Ga0157379_10006607 | |||
| 1579 | Ga0157379_10156660 | |||
| 1580 | Ga0157379_10344012 | |||
| 1581 | Ga0157379_10420898 | |||
| 1582 | Ga0157379_10613068 | |||
| 1583 | Ga0157376_10009851 | |||
| 1584 | Ga0157376_10015168 | |||
| 1585 | Ga0157376_10109421 | |||
| 1586 | Ga0157376_10110819 | |||
| 1587 | Ga0157376_10196657 | |||
| 1588 | Ga0163161_10040508 | |||
| 1589 | Ga0213876_10037297 | |||
| 1590 | Ga0207697_10070750 | |||
| 1591 | Ga0207692_10006066 | |||
| 1592 | Ga0207692_10028855 | |||
| 1593 | Ga0207692_10047782 | |||
| 1594 | Ga0207692_10068960 | |||
| 1595 | Ga0207692_10154885 | |||
| 1596 | Ga0207692_10203006 | |||
| 1597 | Ga0207642_10058766 | |||
| 1598 | Ga0207642_10173716 | |||
| 1599 | Ga0207710_10098843 | |||
| 1600 | Ga0207688_10015626 | |||
| 1601 | Ga0207688_10068503 | |||
| 1602 | Ga0207688_10102240 | |||
| 1603 | Ga0207688_10217706 | |||
| 1604 | Ga0207647_10030576 | |||
| 1605 | Ga0207685_10032558 | |||
| 1606 | Ga0207685_10060364 | |||
| 1607 | Ga0207685_10082709 | |||
| 1608 | Ga0207685_10085581 | |||
| 1609 | Ga0207699_10023709 | |||
| 1610 | Ga0207699_10148497 | |||
| 1611 | Ga0207705_10006857 | |||
| 1612 | Ga0207684_10012347 | |||
| 1613 | Ga0207684_10035941 | |||
| 1614 | Ga0207684_10050911 | |||
| 1615 | Ga0207684_10060328 | |||
| 1616 | Ga0207684_10062560 | |||
| 1617 | Ga0207684_10064479 | |||
| 1618 | Ga0207684_10074179 | |||
| 1619 | Ga0207684_10086212 | |||
| 1620 | Ga0207684_10231022 | |||
| 1621 | Ga0207684_10417039 | |||
| 1622 | Ga0207684_10549638 | |||
| 1623 | Ga0207695_10067069 | |||
| 1624 | Ga0207695_10271404 | |||
| 1625 | Ga0207693_10001676 | |||
| 1626 | Ga0207693_10034307 | |||
| 1627 | Ga0207693_10046549 | |||
| 1628 | Ga0207693_10053214 | |||
| 1629 | Ga0207693_10062806 | |||
| 1630 | Ga0207693_10063876 | |||
| 1631 | Ga0207693_10065631 | |||
| 1632 | Ga0207693_10065961 | |||
| 1633 | Ga0207693_10087335 | |||
| 1634 | Ga0207693_10099444 | |||
| 1635 | Ga0207693_10202676 | |||
| 1636 | Ga0207693_10348458 | |||
| 1637 | Ga0207663_10000334 | |||
| 1638 | Ga0207663_10019908 | |||
| 1639 | Ga0207663_10132898 | |||
| 1640 | Ga0207663_10148422 | |||
| 1641 | Ga0207663_10197847 | |||
| 1642 | Ga0207663_10236413 | |||
| 1643 | Ga0207663_10239667 | |||
| 1644 | Ga0207660_10007261 | |||
| 1645 | Ga0207662_10055511 | |||
| 1646 | Ga0207662_10118490 | |||
| 1647 | Ga0207662_10124364 | |||
| 1648 | Ga0207662_10133862 | |||
| 1649 | Ga0207649_10297172 | |||
| 1650 | Ga0207652_10025727 | |||
| 1651 | Ga0207652_10442825 | |||
| 1652 | Ga0207646_10020409 | |||
| 1653 | Ga0207646_10211740 | |||
| 1654 | Ga0207646_10212265 | |||
| 1655 | Ga0207646_10254765 | |||
| 1656 | Ga0207646_10427557 | |||
| 1657 | Ga0207646_10466712 | |||
| 1658 | Ga0207681_10030837 | |||
| 1659 | Ga0207694_10053761 | |||
| 1660 | Ga0207650_10032775 | |||
| 1661 | Ga0207650_10134841 | |||
| 1662 | Ga0207650_10235519 | |||
| 1663 | Ga0207659_10445346 | |||
| 1664 | Ga0207659_10511869 | |||
| 1665 | Ga0207687_10002430 | |||
| 1666 | Ga0207700_10014496 | |||
| 1667 | Ga0207700_10017803 | |||
| 1668 | Ga0207700_10017847 | |||
| 1669 | Ga0207700_10091597 | |||
| 1670 | Ga0207700_10136441 | |||
| 1671 | Ga0207700_10220113 | |||
| 1672 | Ga0207700_10367691 | |||
| 1673 | Ga0207700_10372546 | |||
| 1674 | Ga0207700_10445483 | |||
| 1675 | Ga0207664_10023114 | |||
| 1676 | Ga0207664_10024484 | |||
| 1677 | Ga0207664_10054321 | |||
| 1678 | Ga0207664_10126206 | |||
| 1679 | Ga0207664_10202452 | |||
| 1680 | Ga0207664_10232025 | |||
| 1681 | Ga0207644_10007156 | |||
| 1682 | Ga0207644_10019169 | |||
| 1683 | Ga0207644_10045740 | |||
| 1684 | Ga0207644_10060004 | |||
| 1685 | Ga0207644_10150693 | |||
| 1686 | Ga0207644_10416394 | |||
| 1687 | Ga0207690_10029741 | |||
| 1688 | Ga0207706_10006318 | |||
| 1689 | Ga0207706_10032900 | |||
| 1690 | Ga0207686_10033306 | |||
| 1691 | Ga0207709_10006419 | |||
| 1692 | Ga0207709_10276572 | |||
| 1693 | Ga0207670_10001485 | |||
| 1694 | Ga0207670_10006892 | |||
| 1695 | Ga0207670_10013693 | |||
| 1696 | Ga0207669_10004628 | |||
| 1697 | Ga0207669_10072814 | |||
| 1698 | Ga0207704_10002263 | |||
| 1699 | Ga0207704_10157190 | |||
| 1700 | Ga0207665_10001766 | |||
| 1701 | Ga0207665_10062052 | |||
| 1702 | Ga0207665_10081027 | |||
| 1703 | Ga0207665_10259085 | |||
| 1704 | Ga0207665_10306944 | |||
| 1705 | Ga0207691_10267118 | |||
| 1706 | Ga0207711_10016927 | |||
| 1707 | Ga0207689_10058259 | |||
| 1708 | Ga0207661_10001392 | |||
| 1709 | Ga0207679_10015509 | |||
| 1710 | Ga0207679_10232062 | |||
| 1711 | Ga0207667_10022750 | |||
| 1712 | Ga0207667_10096891 | |||
| 1713 | Ga0207651_10016512 | |||
| 1714 | Ga0207651_10260441 | |||
| 1715 | Ga0207651_10300166 | |||
| 1716 | Ga0207712_10028339 | |||
| 1717 | Ga0207712_10452363 | |||
| 1718 | Ga0207668_10119760 | |||
| 1719 | Ga0207668_10269359 | |||
| 1720 | Ga0207658_10055262 | |||
| 1721 | Ga0207677_10073882 | |||
| 1722 | Ga0207677_10434822 | |||
| 1723 | Ga0207677_10445517 | |||
| 1724 | Ga0207703_10006828 | |||
| 1725 | Ga0207703_10335432 | |||
| 1726 | Ga0207703_10406016 | |||
| 1727 | Ga0207678_10048959 | |||
| 1728 | Ga0207708_10002907 | |||
| 1729 | Ga0207708_10104189 | |||
| 1730 | Ga0207708_10126289 | |||
| 1731 | Ga0207708_10320722 | |||
| 1732 | Ga0207708_10397816 | |||
| 1733 | Ga0207702_10015138 | |||
| 1734 | Ga0207702_10048214 | |||
| 1735 | Ga0207702_10149874 | |||
| 1736 | Ga0207676_10005283 | |||
| 1737 | Ga0207676_10013424 | |||
| 1738 | Ga0207676_10090117 | |||
| 1739 | Ga0207676_10314052 | |||
| 1740 | Ga0207676_10366024 | |||
| 1741 | Ga0207676_10575643 | |||
| 1742 | Ga0207674_10340709 | |||
| 1743 | Ga0207683_10007329 | |||
| 1744 | Ga0207683_10029218 | |||
| 1745 | Ga0207683_10046005 | |||
| 1746 | Ga0207683_10157636 | |||
| 1747 | Ga0207683_10194422 | |||
| 1748 | Ga0207683_10522518 | |||
| 1749 | Ga0207428_10002358 | |||
| 1750 | Ga0207428_10011030 | |||
| 1751 | Ga0207428_10076802 | |||
| 1752 | Ga0265357_1000606 | |||
| 1753 | Ga0268265_10024047 | |||
| 1754 | Ga0268264_10004719 | |||
| 1755 | Ga0268264_10115199 | |||
| 1756 | Ga0268264_10237460 | |||
| 1757 | Ga0268264_10463421 | |||
| 1758 | Ga0265763_1000127 | |||
| 1759 | Ga0265325_10000420 | |||
| 1760 | Ga0373926_0010082 | |||
| 1761 | Ga0373926_0077031 | |||
| 1762 | Ga0373934_0008847 | |||
| 1763 | Ga0373944_0003375 | |||
| 1764 | Ga0373923_0040853 | |||
| 1765 | Ga0373936_0101348 | |||
| 1766 | Ga0373936_0256457 | |||
| 1767 | Ga0373939_0074516 | |||
| 1768 | Ga0373945_0018746 | |||
| 1769 | Ga0373945_0038771 | |||
| 1770 | Ga0373945_0047746 | |||
| 1771 | Ga0373953_0025942 | |||
| 1772 | Ga0373953_0026802 | |||
| 1773 | Ga0373953_0044874 | |||
| 1774 | Ga0373953_0072921 | |||
| 1775 | Ga0373954_0002909 | |||
| 1776 | Ga0373954_0111136 | |||
| 1777 | Ga0373954_0117708 | |||
| 1778 | Ga0373954_0162082 | |||
| 1779 | Ga0373943_0013500 | |||
| 1780 | Ga0373943_0025659 | |||
| 1781 | Ga0373943_0037945 | |||
| 1782 | Ga0373943_0041205 | |||
| 1783 | Ga0373946_0016012 | |||
| 1784 | Ga0373946_0025447 | |||
| 1785 | Ga0373946_0027233 | |||
| 1786 | Ga0373955_0151388 | |||
| 1787 | Ga0373931_0033842 | |||
| 1788 | Ga0373931_0034133 | |||
| 1789 | Ga0373935_0031497 | |||
| 1790 | Ga0373935_0047077 | |||
| 1791 | Ga0373935_0056467 | |||
| 1792 | Ga0373935_0075452 | |||
| 1793 | Ga0373935_0247716 | |||
| 1794 | Ga0373935_0276747 | |||
| 1795 | Ga0373927_0009628 | |||
| 1796 | Ga0373927_0010177 | |||
| 1797 | Ga0373927_0023691 | |||
| 1798 | Ga0373927_0187288 | |||
| 1799 | Ga0373927_0227183 | |||
| 1800 | Ga0373927_0272734 | |||
| 1801 | Ga0373927_0294354 | |||
| 1802 | Ga0373927_0350311 | |||
| 1803 | Ga0373933_0003527 | |||
| 1804 | Ga0373933_0017698 | |||
| 1805 | Ga0373933_0046437 | |||
| 1806 | Ga0373933_0101233 | |||
| 1807 | Ga0373933_0114208 | |||
| 1808 | Ga0373933_0194802 | |||
| 1809 | Ga0373933_0238209 | |||
| 1810 | Ga0373947_0014698 | |||
| 1811 | Ga0373947_0024305 | |||
| 1812 | Ga0373947_0049770 | |||
| 1813 | Ga0373947_0057715 | |||
| 1814 | Ga0373947_0081459 | |||
| 1815 | Ga0373937_0008429 | |||
| 1816 | Ga0373937_0012005 | |||
| 1817 | Ga0373937_0035308 | |||
| 1818 | Ga0373937_0055701 | |||
| 1819 | Ga0373937_0067180 | |||
| 1820 | Ga0373937_0081320 | |||
| 1821 | Ga0373937_0112637 | |||
| 1822 | Ga0373937_0141704 | |||
| 1823 | Ga0373937_0147413 | |||
| 1824 | Ga0373937_0373717 | |||
| 1825 | Ga0373937_0527350 | |||
| 1826 | Ga0373925_0017340 | |||
| 1827 | Ga0373925_0021907 | |||
| 1828 | Ga0373925_0037762 | |||
| 1829 | Ga0373925_0116697 | |||
| 1830 | Ga0373925_0314905 | |||
| 1831 | Ga0373925_0322997 | |||
| 1832 | Ga0395898_0200351 | |||
| 1833 | Ga0395898_0250058 | |||
| 1834 | Ga0395905_0304740 | |||
| 1835 | Ga0436364_0184300 | |||
| 1836 | Ga0395901_0646105 | |||
| 1837 | Ga0395901_0691884 | |||
| 1838 | Ga0436365_1594359 | |||
| 1839 | Ga0436360_0429114 | |||
| 1840 | Ga0436360_0869868 | |||
| 1841 | Ga0436360_0979666 | |||
| 1842 | Ga0436361_0046162 | |||
| 1843 | Ga0436363_0817093 | |||
| 1844 | Ga0451853_3142187 | |||
| 1845 | Ga0439456_012256 | |||
| 1846 | Ga0439435_0040770 | |||
| 1847 | Ga0439464_0034698 | |||
| 1848 | Ga0451577_0015350 | |||
| 1849 | Ga0453684_0386056 | |||
| 1850 | Ga0451576_0003339 | |||
| 1851 | Ga0495592_0028552 | |||
| 1852 | Ga0495592_0038971 | |||
| 1853 | Ga0495592_0047607 | |||
| 1854 | Ga0495592_0085533 | |||
| 1855 | Ga0495592_0235053 | |||
| 1856 | Ga0495603_0032639 | |||
| 1857 | Ga0495603_0032953 | |||
| 1858 | Ga0495603_0041376 | |||
| 1859 | Ga0495603_0111187 | |||
| 1860 | Ga0495603_0219036 | |||
| 1861 | Ga0495629_0012093 | |||
| 1862 | Ga0495629_0072702 | |||
| 1863 | Ga0495629_0120851 | |||
| 1864 | Ga0495641_0031054 | |||
| 1865 | Ga0495641_0035336 | |||
| 1866 | Ga0495641_0053790 | |||
| 1867 | Ga0495641_0060427 | |||
| 1868 | Ga0495641_0105159 | |||
| 1869 | Ga0495651_0010457 | |||
| 1870 | Ga0495651_0121735 | |||
| 1871 | Ga0495651_0155528 | |||
| 1872 | Ga0495653_0035258 | |||
| 1873 | Ga0495653_0048036 | |||
| 1874 | Ga0495580_0026159 | |||
| 1875 | Ga0495580_0072767 | |||
| 1876 | Ga0495580_0238448 | |||
| 1877 | Ga0495582_0037769 | |||
| 1878 | Ga0495582_0043443 | |||
| 1879 | Ga0495605_0111774 | |||
| 1880 | Ga0495605_0129880 | |||
| 1881 | Ga0495639_0011489 | |||
| 1882 | Ga0495639_0053844 | |||
| 1883 | Ga0495639_0061868 | |||
| 1884 | Ga0495639_0110557 | |||
| 1885 | Ga0495662_0002723 | |||
| 1886 | Ga0495662_0004267 | |||
| 1887 | Ga0495662_0035106 | |||
| 1888 | Ga0495662_0076593 | |||
| 1889 | Ga0495662_0110665 | |||
| 1890 | Ga0495664_0000470 | |||
| 1891 | Ga0495664_0013414 | |||
| 1892 | Ga0495585_0079110 | |||
| 1893 | Ga0495594_0007318 | |||
| 1894 | Ga0495594_0025686 | |||
| 1895 | Ga0495594_0130563 | |||
| 1896 | Ga0495594_0139483 | |||
| 1897 | Ga0495594_0173122 | |||
| 1898 | Ga0495608_0002502 | |||
| 1899 | Ga0495608_0157895 | |||
| 1900 | Ga0495618_0009546 | |||
| 1901 | Ga0495618_0038493 | |||
| 1902 | Ga0495618_0047436 | |||
| 1903 | Ga0495618_0059271 | |||
| 1904 | Ga0495618_0093690 | |||
| 1905 | Ga0495618_0135123 | |||
| 1906 | Ga0495628_0058484 | |||
| 1907 | Ga0495628_0072080 | |||
| 1908 | Ga0495630_0014620 | |||
| 1909 | Ga0495630_0108439 | |||
| 1910 | Ga0495630_0123742 | |||
| 1911 | Ga0495630_0263421 | |||
| 1912 | Ga0495631_0123923 | |||
| 1913 | Ga0495644_0012160 | |||
| 1914 | Ga0495644_0069816 | |||
| 1915 | Ga0495663_0014942 | |||
| 1916 | Ga0495666_0006834 | |||
| 1917 | Ga0495666_0022559 | |||
| 1918 | Ga0495666_0070543 | |||
| 1919 | Ga0495666_0074920 | |||
| 1920 | Ga0495652_0009487 | |||
| 1921 | Ga0495652_0028774 | |||
| 1922 | Ga0495652_0033594 | |||
| 1923 | Ga0495640_0012234 | |||
| 1924 | Ga0495640_0022551 | |||
| 1925 | Ga0495640_0118657 | |||
| 1926 | Ga0495640_0169181 | |||
| 1927 | Ga0495640_0177640 | |||
| 1928 | Ga0495586_0035395 | |||
| 1929 | Ga0495586_0068065 | |||
| 1930 | Ga0495586_0141104 | |||
| 1931 | Ga0495586_0143151 | |||
| 1932 | Ga0495586_0165497 | |||
| 1933 | Ga0495587_0115684 | |||
| 1934 | Ga0495598_0028551 | |||
| 1935 | Ga0495598_0044343 | |||
| 1936 | Ga0495598_0058475 | |||
| 1937 | Ga0495609_0167560 | |||
| 1938 | Ga0495621_0077323 | |||
| 1939 | Ga0495645_0206444 | |||
| 1940 | Ga0495622_0008840 | |||
| 1941 | Ga0495633_0112738 | |||
| 1942 | Ga0495633_0186597 | |||
| 1943 | Ga0495667_0008485 | |||
| 1944 | Ga0495667_0008637 | |||
| 1945 | Ga0495667_0009304 | |||
| 1946 | Ga0495667_0010627 | |||
| 1947 | Ga0495667_0030501 | |||
| 1948 | Ga0495667_0041683 | |||
| 1949 | Ga0495656_0001752 | |||
| 1950 | Ga0495656_0020184 | |||
| 1951 | Ga0495656_0151734 | |||
| 1952 | Ga0495634_0011131 | |||
| 1953 | Ga0495634_0022945 | |||
| 1954 | Ga0495634_0023212 | |||
| 1955 | Ga0495634_0028656 | |||
| 1956 | Ga0495634_0039483 | |||
| 1957 | Ga0495634_0086975 | |||
| 1958 | Ga0495611_0119224 | |||
| 1959 | Ga0495635_0000867 | |||
| 1960 | Ga0495635_0003614 | |||
| 1961 | Ga0495635_0045149 | |||
| 1962 | Ga0495635_0059343 | |||
| 1963 | Ga0495635_0062367 | |||
| 1964 | Ga0495635_0218829 | |||
| 1965 | Ga0495659_0135618 | |||
| 1966 | Ga0495661_0250176 | |||
| 1967 | Ga0495588_0253959 | |||
| 1968 | Ga0495657_0060503 | |||
| 1969 | Ga0495657_0082903 | |||
| 1970 | Ga0495657_0170662 | |||
| 1971 | Ga0495657_0185468 | |||
| 1972 | Ga0495599_0012841 | |||
| 1973 | Ga0495599_0170476 | |||
| 1974 | Ga0495623_0115054 | |||
| 1975 | Ga0495646_0037285 | |||
| 1976 | Ga0495646_0056004 | |||
| 1977 | Ga0495647_0003721 | |||
| 1978 | Ga0495647_0016387 | |||
| 1979 | Ga0495647_0060660 | |||
| 1980 | Ga0495658_0044362 | |||
| 1981 | Ga0495658_0044652 | |||
| 1982 | Ga0495658_0063021 | |||
| 1983 | Ga0495613_0020301 | |||
| 1984 | Ga0495613_0069050 | |||
| 1985 | Ga0495613_0074787 | |||
| 1986 | Ga0495613_0146926 | |||
| 1987 | Ga0495624_0006737 | |||
| 1988 | Ga0495624_0022791 | |||
| 1989 | Ga0495624_0029029 | |||
| 1990 | Ga0495624_0032989 | |||
| 1991 | Ga0495624_0037679 | |||
| 1992 | Ga0495670_0105346 | |||
| 1993 | Ga0495670_0192799 | |||
| 1994 | Ga0495670_0208248 | |||
| 1995 | Ga0495670_0265219 | |||
| 1996 | Ga0495671_0155462 | |||
| 1997 | Ga0495600_0002129 | |||
| 1998 | Ga0495600_0019215 | |||
| 1999 | Ga0495600_0023067 | |||
| 2000 | Ga0495600_0092540 | |||
| 2001 | Ga0495600_0119813 | |||
| 2002 | Ga0495581_0033643 | |||
| 2003 | Ga0495581_0053423 | |||
| 2004 | Ga0495581_0078644 | |||
| 2005 | Ga0495581_0097985 | |||
| 2006 | Ga0495604_0018656 | |||
| 2007 | Ga0495604_0037904 | |||
| 2008 | Ga0495604_0057485 | |||
| 2009 | Ga0495604_0094660 | |||
| 2010 | Ga0495674_0007508 | |||
| 2011 | Ga0495674_0015284 | |||
| 2012 | Ga0495674_0029108 | |||
| 2013 | Ga0495674_0152864 | |||
| 2014 | Ga0495674_0260802 | |||
| 2015 | Ga0495672_0062248 | |||
| 2016 | Ga0495676_0039159 | |||
| 2017 | Ga0495676_0108777 | |||
| 2018 | Ga0495676_0113297 | |||
| 2019 | Ga0495676_0165404 | |||
| 2020 | Ga0495676_0282114 | |||
| 2021 | Ga0495680_0013037 | |||
| 2022 | Ga0495680_0020500 | |||
| 2023 | Ga0495680_0051003 | |||
| 2024 | Ga0495680_0058035 | |||
| 2025 | Ga0495680_0130092 | |||
| 2026 | Ga0495680_0248961 | |||
| 2027 | Ga0495680_0301217 | |||
| 2028 | Ga0495675_0052980 | |||
| 2029 | Ga0495684_0000858 | |||
| 2030 | Ga0495684_0001336 | |||
| 2031 | Ga0495684_0016299 | |||
| 2032 | Ga0495684_0030563 | |||
| 2033 | Ga0495684_0091011 | |||
| 2034 | Ga0495593_0016040 | |||
| 2035 | Ga0495614_0013228 | |||
| 2036 | Ga0496100_0001472 | |||
| 2037 | Ga0496100_0088254 | |||
| 2038 | Ga0496100_0101086 | |||
| 2039 | Ga0496100_0161551 | |||
| 2040 | Ga0496100_0263024 | |||
| 2041 | Ga0496100_0284158 | |||
| 2042 | Ga0496100_0313926 | |||
| 2043 | Ga0496101_0000630 | |||
| 2044 | Ga0496101_0017030 | |||
| 2045 | Ga0496101_0028944 | |||
| 2046 | Ga0496101_0068642 | |||
| 2047 | Ga0496101_0136346 | |||
| 2048 | Ga0496101_0153253 | |||
| 2049 | Ga0496101_0190682 | |||
| 2050 | Ga0496101_0251720 | |||
| 2051 | Ga0496101_0260879 | |||
| 2052 | Ga0496102_0006285 | |||
| 2053 | Ga0496102_0024115 | |||
| 2054 | Ga0496102_0034738 | |||
| 2055 | Ga0496102_0086796 | |||
| 2056 | Ga0496102_0123861 | |||
| 2057 | Ga0496102_0128844 | |||
| 2058 | Ga0496102_0152362 | |||
| 2059 | Ga0496102_0316247 | |||
| 2060 | Ga0496102_0348349 | |||
| 2061 | Ga0496102_0367913 | |||
| 2062 | Ga0496102_0370244 | |||
| 2063 | Ga0496102_0375897 | |||
| 2064 | Ga0496102_0460836 | |||
| 2065 | Ga0496102_0488923 | |||
| 2066 | Ga0496102_0516876 | |||
| 2067 | Ga0496102_0526352 | |||
| 2068 | Ga0496102_0560403 | |||
| 2069 | Ga0496103_0001536 | |||
| 2070 | Ga0496103_0012629 | |||
| 2071 | Ga0496103_0108202 | |||
| 2072 | Ga0496103_0145521 | |||
| 2073 | Ga0496104_0000806 | |||
| 2074 | Ga0496104_0003227 | |||
| 2075 | Ga0496104_0003394 | |||
| 2076 | Ga0496104_0003907 | |||
| 2077 | Ga0496104_0004332 | |||
| 2078 | Ga0496104_0008035 | |||
| 2079 | Ga0496104_0009557 | |||
| 2080 | Ga0496104_0016803 | |||
| 2081 | Ga0496104_0016937 | |||
| 2082 | Ga0496104_0020548 | |||
| 2083 | Ga0496104_0022488 | |||
| 2084 | Ga0496104_0028285 | |||
| 2085 | Ga0496104_0028661 | |||
| 2086 | Ga0496104_0032162 | |||
| 2087 | Ga0496104_0033233 | |||
| 2088 | Ga0496104_0044886 | |||
| 2089 | Ga0496104_0051223 | |||
| 2090 | Ga0496104_0069657 | |||
| 2091 | Ga0496104_0122678 | |||
| 2092 | Ga0496104_0124649 | |||
| 2093 | Ga0496104_0145702 | |||
| 2094 | Ga0496104_0152493 | |||
| 2095 | Ga0496104_0162305 | |||
| 2096 | Ga0496104_0264829 | |||
| 2097 | Ga0496104_0302128 | |||
| 2098 | Ga0496104_0306298 | |||
| 2099 | Ga0496104_0324451 | |||
| 2100 | Ga0496104_0439609 | |||
| 2101 | Ga0496105_0003690 | |||
| 2102 | Ga0496105_0009467 | |||
| 2103 | Ga0496105_0011508 | |||
| 2104 | Ga0496105_0012429 | |||
| 2105 | Ga0496105_0054674 | |||
| 2106 | Ga0496105_0100412 | |||
| 2107 | Ga0496105_0102244 | |||
| 2108 | Ga0496105_0116495 | |||
| 2109 | Ga0496105_0130238 | |||
| 2110 | Ga0496105_0137348 | |||
| 2111 | Ga0496105_0141920 | |||
| 2112 | Ga0496105_0166633 | |||
| 2113 | Ga0496105_0185994 | |||
| 2114 | Ga0496105_0213728 | |||
| 2115 | Ga0496105_0467469 | |||
| 2116 | Ga0496106_0000996 | |||
| 2117 | Ga0496106_0002576 | |||
| 2118 | Ga0496106_0002834 | |||
| 2119 | Ga0496106_0123686 | |||
| 2120 | Ga0496106_0142470 | |||
| 2121 | Ga0496106_0195642 | |||
| 2122 | Ga0496106_0196253 | |||
| 2123 | Ga0496106_0200467 | |||
| 2124 | Ga0496106_0225326 | |||
| 2125 | Ga0496106_0268353 | |||
| 2126 | Ga0496107_0004543 | |||
| 2127 | Ga0496107_0005545 | |||
| 2128 | Ga0496107_0018111 | |||
| 2129 | Ga0496107_0193407 | |||
| 2130 | Ga0496107_0211503 | |||
| 2131 | Ga0496108_0006956 | |||
| 2132 | Ga0496108_0020901 | |||
| 2133 | Ga0496108_0036856 | |||
| 2134 | Ga0496108_0037163 | |||
| 2135 | Ga0496108_0086172 | |||
| 2136 | Ga0496108_0115671 | |||
| 2137 | Ga0496108_0132734 | |||
| 2138 | Ga0496108_0175084 | |||
| 2139 | Ga0496108_0221359 | |||
| 2140 | Ga0496108_0441312 | |||
| 2141 | Ga0496109_0001183 | |||
| 2142 | Ga0496109_0004095 | |||
| 2143 | Ga0496109_0011707 | |||
| 2144 | Ga0496109_0031572 | |||
| 2145 | Ga0496109_0061077 | |||
| 2146 | Ga0496109_0064888 | |||
| 2147 | Ga0496109_0064966 | |||
| 2148 | Ga0496109_0083578 | |||
| 2149 | Ga0496109_0085333 | |||
| 2150 | Ga0496109_0122038 | |||
| 2151 | Ga0496109_0533471 | |||
| 2152 | Ga0496109_0569876 | |||
| 2153 | Ga0496109_0571087 | |||
| 2154 | Ga0496109_0586156 | |||
| 2155 | Ga0496110_0001511 | |||
| 2156 | Ga0496110_0002003 | |||
| 2157 | Ga0496110_0004229 | |||
| 2158 | Ga0496110_0009122 | |||
| 2159 | Ga0496110_0026724 | |||
| 2160 | Ga0496110_0057194 | |||
| 2161 | Ga0496110_0089968 | |||
| 2162 | Ga0496110_0125824 | |||
| 2163 | Ga0496110_0186965 | |||
| 2164 | Ga0496110_0222911 | |||
| 2165 | Ga0496110_0243496 | |||
| 2166 | Ga0496110_0438072 | |||
| 2167 | Ga0496110_0495273 | |||
| 2168 | Ga0496111_0000686 | |||
| 2169 | Ga0496111_0003279 | |||
| 2170 | Ga0496111_0004052 | |||
| 2171 | Ga0496111_0097901 | |||
| 2172 | Ga0496111_0159450 | |||
| 2173 | Ga0496111_0172576 | |||
| 2174 | Ga0496111_0256622 | |||
| 2175 | Ga0496111_0294152 | |||
| 2176 | Ga0496111_0301343 | |||
| 2177 | Ga0496111_0305228 | |||
| 2178 | Ga0496111_0307956 | |||
| 2179 | Ga0496112_0011921 | |||
| 2180 | Ga0496112_0041245 | |||
| 2181 | Ga0496112_0090030 | |||
| 2182 | Ga0496112_0096509 | |||
| 2183 | Ga0496112_0165468 | |||
| 2184 | Ga0496112_0203119 | |||
| 2185 | Ga0496112_0222213 | |||
| 2186 | Ga0496112_0236485 | |||
| 2187 | Ga0496112_0299073 | |||
| 2188 | Ga0496113_0001474 | |||
| 2189 | Ga0496113_0038255 | |||
| 2190 | Ga0496113_0051062 | |||
| 2191 | Ga0496113_0070518 | |||
| 2192 | Ga0496113_0077773 | |||
| 2193 | Ga0496113_0082513 | |||
| 2194 | Ga0496113_0131648 | |||
| 2195 | Ga0496113_0149297 | |||
| 2196 | Ga0496113_0267876 | |||
| 2197 | Ga0496113_0325097 | |||
| 2198 | Ga0496114_0008474 | |||
| 2199 | Ga0496114_0029523 | |||
| 2200 | Ga0496114_0053992 | |||
| 2201 | Ga0496114_0055628 | |||
| 2202 | Ga0496114_0063385 | |||
| 2203 | Ga0496114_0119423 | |||
| 2204 | Ga0496114_0150461 | |||
| 2205 | Ga0496114_0151136 | |||
| 2206 | Ga0496114_0251790 | |||
| 2207 | Ga0496114_0431799 | |||
| 2208 | Ga0496114_0482666 | |||
| 2209 | Ga0496115_0001086 | |||
| 2210 | Ga0496115_0002436 | |||
| 2211 | Ga0496115_0021666 | |||
| 2212 | Ga0496115_0027672 | |||
| 2213 | Ga0496115_0044471 | |||
| 2214 | Ga0496115_0104142 | |||
| 2215 | Ga0496115_0162136 | |||
| 2216 | Ga0496115_0337215 | |||
| 2217 | Ga0496115_0426986 | |||
| 2218 | Ga0496121_0150807 | |||
| 2219 | Ga0501034_0004656 | |||
| 2220 | Ga0501036_0196333 | |||
| 2221 | Ga0501076_0057256 | |||
| 2222 | nmdc:mga00v17_90451_c1 | |||
| 2223 | nmdc:mga0yw44_124312_c1 | |||
| 2224 | nmdc:mga0yw44_247340_c1 | |||
| 2225 | nmdc:mga0yw44_25013_c1 | |||
| 2226 | nmdc:mga0yw44_2753_c1 | |||
| 2227 | nmdc:mga0yw44_29583_c1 | |||
| 2228 | nmdc:mga0yw44_4191_c1 | |||
| 2229 | nmdc:mga0yw44_9268_c1 | |||
| 2230 | nmdc:mga0yw44_92790_c1 | |||
| 2231 | nmdc:mga0yw44_98077_c1 | |||
| 2232 | nmdc:mga0k408_41568_c1 | |||
| 2233 | nmdc:mga06z11_12463_c1 | |||
| 2234 | nmdc:mga05p37_105494_c1 | |||
| 2235 | nmdc:mga05p37_12398_c1 | |||
| 2236 | nmdc:mga05p37_134637_c1 | |||
| 2237 | nmdc:mga05p37_138062_c1 | |||
| 2238 | nmdc:mga05p37_177848_c1 | |||
| 2239 | nmdc:mga05p37_209306_c1 | |||
| 2240 | nmdc:mga05p37_24432_c1 | |||
| 2241 | nmdc:mga05p37_298327_c1 | |||
| 2242 | nmdc:mga05p37_453824_c1 | |||
| 2243 | nmdc:mga05p37_501490_c1 | |||
| 2244 | nmdc:mga05p37_5228_c1 | |||
| 2245 | nmdc:mga05p37_668621_c1 | |||
| 2246 | nmdc:mga05p37_97517_c1 | |||
| 2247 | nmdc:mga09592_10210_c1 | |||
| 2248 | nmdc:mga09592_151287_c1 | |||
| 2249 | nmdc:mga09592_186706_c1 | |||
| 2250 | nmdc:mga09592_42124_c1 | |||
| 2251 | nmdc:mga09592_43809_c1 | |||
| 2252 | nmdc:mga0qj67_13333_c1 | |||
| 2253 | nmdc:mga0qj67_144063_c1 | |||
| 2254 | nmdc:mga0qj67_322385_c1 | |||
| 2255 | nmdc:mga0qj67_425056_c1 | |||
| 2256 | nmdc:mga0qj67_44477_c1 | |||
| 2257 | nmdc:mga06r32_112573_c1 | |||
| 2258 | nmdc:mga06r32_122967_c1 | |||
| 2259 | nmdc:mga06r32_157068_c1 | |||
| 2260 | nmdc:mga06r32_16971_c1 | |||
| 2261 | nmdc:mga06r32_26160_c1 | |||
| 2262 | nmdc:mga06r32_416560_c1 | |||
| 2263 | nmdc:mga06r32_430648_c1 | |||
| 2264 | nmdc:mga06r32_580589_c1 | |||
| 2265 | nmdc:mga06r32_85469_c1 | |||
| 2266 | nmdc:mga06r32_96353_c1 | |||
| 2267 | nmdc:mga08y16_154535_c1 | |||
| 2268 | nmdc:mga08y16_304708_c1 | |||
| 2269 | nmdc:mga08y16_51314_c1 | |||
| 2270 | nmdc:mga0n895_167498_c1 | |||
| 2271 | nmdc:mga0n895_17646_c1 | |||
| 2272 | nmdc:mga0n895_304899_c1 | |||
| 2273 | nmdc:mga0n895_525623_c1 | |||
| 2274 | nmdc:mga0n895_59582_c1 | |||
| 2275 | nmdc:mga0n895_698849_c1 | |||
| 2276 | nmdc:mga0n895_97552_c1 | |||
| 2277 | nmdc:mga0rr50_113310_c1 | |||
| 2278 | nmdc:mga0rr50_123083_c1 | |||
| 2279 | nmdc:mga0rr50_297701_c1 | |||
| 2280 | nmdc:mga0rr50_417275_c1 | |||
| 2281 | nmdc:mga0rr50_8302_c1 | |||
| 2282 | nmdc:mga08x19_87446_c1 | |||
| 2283 | nmdc:mga0a205_12697_c1 | |||
| 2284 | nmdc:mga0a205_251191_c1 | |||
| 2285 | nmdc:mga0a205_287417_c1 | |||
| 2286 | nmdc:mga0a205_31051_c1 | |||
| 2287 | nmdc:mga0a205_337033_c1 | |||
| 2288 | nmdc:mga0a205_34598_c1 | |||
| 2289 | Ga0495601_0006044 | |||
| 2290 | Ga0495601_0006137 | |||
| 2291 | Ga0495601_0012121 | |||
| 2292 | Ga0495601_0013146 | |||
| 2293 | Ga0495601_0013361 | |||
| 2294 | Ga0495601_0019934 | |||
| 2295 | Ga0495601_0022522 | |||
| 2296 | Ga0495601_0030524 | |||
| 2297 | Ga0495601_0032069 | |||
| 2298 | Ga0495601_0042922 | |||
| 2299 | Ga0495601_0084445 | |||
| 2300 | Ga0495601_0114230 | |||
| 2301 | Ga0495601_0124596 | |||
| 2302 | Ga0495601_0144627 | |||
| 2303 | Ga0495612_0009023 | |||
| 2304 | Ga0495612_0022096 | |||
| 2305 | Ga0495612_0025308 | |||
| 2306 | Ga0495612_0061305 | |||
| 2307 | Ga0495612_0175124 | |||
| 2308 | Ga0495655_0045928 | |||
| 2309 | Ga0495655_0047526 | |||
| 2310 | Ga0495595_0000705 | |||
| 2311 | Ga0495595_0008407 | |||
| 2312 | Ga0495595_0014589 | |||
| 2313 | Ga0495595_0016280 | |||
| 2314 | Ga0495595_0027540 | |||
| 2315 | Ga0495595_0070341 | |||
| 2316 | Ga0495595_0089008 | |||
| 2317 | Ga0495595_0124071 | |||
| 2318 | Ga0495619_0002556 | |||
| 2319 | Ga0495619_0006681 | |||
| 2320 | Ga0495619_0010856 | |||
| 2321 | Ga0495619_0011489 | |||
| 2322 | Ga0495619_0013391 | |||
| 2323 | Ga0495619_0013922 | |||
| 2324 | Ga0495619_0025005 | |||
| 2325 | Ga0495619_0039728 | |||
| 2326 | Ga0495619_0048786 | |||
| 2327 | Ga0495619_0064831 | |||
| 2328 | Ga0495619_0084144 | |||
| 2329 | Ga0495619_0098032 | |||
| 2330 | Ga0495619_0129702 | |||
| 2331 | Ga0495619_0189366 | |||
| 2332 | Ga0501082_0308217 | |||
| 2333 | Ga0530510_0227151 | |||
| 2334 | 8019642214 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.9238 | 26 | 313 |
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.9103 | 26 | 314 |
| 3lkv-assembly1.cif.gz_A-2 | crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 | 0.897 | 26 | 313 |
| 3lft-assembly2.cif.gz_B | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.8919 | 30 | 314 |
| 3lft-assembly1.cif.gz_A | the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a | 0.8899 | 26 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9069 | 135 | 314 | 3.40.50.2300 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9026 | 135 | 313 | 3.40.50.2300 |
| 3lftA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.901 | 135 | 314 | 3.40.50.2300 |
| 3lkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8909 | 135 | 313 | 3.40.50.2300 |
| af_P02924_26_131_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7997 | 153 | 237 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537P9Y2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9825 | 180 | 315 |
|
| AF-A0A536Z1U0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9783 | 138 | 315 |
|
| AF-A0A537TUH9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9772 | 158 | 315 |
|
| AF-A0A023XKA0-F1-model_v4 | deleted | 0.9766 | 155 | 315 |
|
| AF-A0A537NRR0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9758 | 142 | 315 |
|