F491142

General Info

Members Datasets Scaffolds Average Seq Length
1170 819 594 235

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100069082|Ga0070665_1000690822
Length 259
Sequence MTARLMRKGLIMTHDDDTGEAAIVADGAADVVGAEPAVFSERQLKEAERIAEALVFASAEPVSVAFIAERLPRGMDVVAILHGLKAAYGERGVNLVQVGGQWAFRTAGDLSFVVHSEEKEPKKLSRAALEVLAIVAYHQPVTRAEIEEIRGVQTSRGTLDVLMEAGWVRFRGRRRTPGRPVTIGTTVEFLDHFGLEELRDLPGLEELKGAGLLSGRIPSNFGVPLPMMSDELREDEDPITQLDLEELGLLAPGGGDGDD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
103 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221558 Rhizobium sp. Root149 Isolate Unclassified
106 2643221568 Rhizobium sp. Root564 Isolate Unclassified
107 2643221582 Rhizobium sp. Root651 Isolate Unclassified
108 2643221599 Rhizobium sp. Root708 Isolate Unclassified
109 2643221607 Rhizobium sp. Root73 Isolate Unclassified
110 2643221610 Ensifer sp. Root74 Isolate Unclassified
111 2643221618 Ensifer sp. Root231 Isolate Unclassified
112 2643221626 Ensifer sp. Root31 Isolate Unclassified
113 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
114 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
115 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
116 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
117 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221659 Ensifer sp. Root127 Isolate Unclassified
120 2643221668 Ensifer sp. Root423 Isolate Unclassified
121 2643221675 Ensifer sp. Root1298 Isolate Unclassified
122 2643221680 Ensifer sp. Root1312 Isolate Unclassified
123 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
124 2643221688 Rhizobium sp. Root482 Isolate Unclassified
125 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
126 2643221693 Rhizobium sp. Root491 Isolate Unclassified
127 2643221698 Ensifer sp. Root142 Isolate Unclassified
128 2643221712 Ensifer sp. Root258 Isolate Unclassified
129 2643221718 Rhizobium sp. Root268 Isolate Unclassified
130 2643221719 Rhizobium sp. Root274 Isolate Unclassified
131 2643221723 Ensifer sp. Root278 Isolate Unclassified
132 2643221726 Ensifer sp. Root954 Isolate Unclassified
133 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
135 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
136 2718217882 Rhizobium sp. N741 Isolate Nodule
137 2718217927 Rhizobium sp. N324 Isolate Nodule
138 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
139 2718218009 Rhizobium sp. N561 Isolate Nodule
140 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
141 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
142 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
143 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
144 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
145 2718218363 Rhizobium sp. N113 Isolate Nodule
146 2718218365 Rhizobium sp. N731 Isolate Nodule
147 2718218366 Rhizobium sp. N621 Isolate Nodule
148 2718218423 Rhizobium sp. N941 Isolate Nodule
149 2721755514 Rhizobium sp. N6212 Isolate Nodule
150 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
151 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
152 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
153 2721755809 Rhizobium sp. N541 Isolate Nodule
154 2721755810 Rhizobium sp. N871 Isolate Nodule
155 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
156 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
157 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
158 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
159 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
160 2728369365 Rhizobium sp. N1341 Isolate Nodule
161 2728369397 Rhizobium sp. N1314 Isolate Nodule
162 2738541293 Rhizobium sp. GV031 Isolate Unclassified
163 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
164 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
165 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
166 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
167 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
168 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
169 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
170 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
171 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
172 2791355256 Rhizobium sp. M10 Isolate Nodule
173 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
174 2791355260 Rhizobium sp. L9 Isolate Nodule
175 2791355261 Rhizobium sp. J15 Isolate Nodule
176 2791355262 Rhizobium sp. M1 Isolate Nodule
177 2791355263 Rhizobium chutanense C5 Isolate Nodule
178 2791355264 Rhizobium sp. S9 Isolate Nodule
179 2791355265 Rhizobium sp. H4 Isolate Nodule
180 2791355266 Rhizobium sp. L43 Isolate Nodule
181 2791355267 Rhizobium sp. L18 Isolate Nodule
182 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
183 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
184 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
185 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
186 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
187 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
188 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
189 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
190 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
191 2802429633 Rhizobium anhuiense J3 Isolate Nodule
192 2802429634 Rhizobium anhuiense S10 Isolate Nodule
193 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
194 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
195 2802429637 Rhizobium anhuiense C15 Isolate Nodule
196 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
197 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
198 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
199 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
200 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
201 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
202 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
203 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
204 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
205 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
206 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
207 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
208 2838048938 Rhizobium pisi 27/80 Isolate Nodule
209 2838061910 Rhizobium phaseoli L15 Isolate Nodule
210 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
211 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
212 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
213 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
214 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
215 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
216 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
217 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
218 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
219 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
220 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
221 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
222 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
223 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
224 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
225 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
226 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
227 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
228 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
229 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
230 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
231 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
232 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
233 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
234 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
235 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
236 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
237 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
238 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
239 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
240 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
241 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
242 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
243 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
244 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
245 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
246 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
247 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
248 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
249 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
250 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
251 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
252 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
253 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
254 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
255 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
256 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
257 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
258 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
259 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
260 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
261 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
262 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
263 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
264 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
265 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
266 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
267 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
268 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
269 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
270 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
271 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
272 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
273 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
274 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
275 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
276 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
277 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
278 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
279 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
280 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
281 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
282 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
283 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
284 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
285 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
286 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
287 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
288 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
289 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
290 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
291 2844163670 Ensifer sp. 1H6 Isolate Unclassified
292 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
293 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
294 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
295 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
296 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
297 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
298 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
299 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
300 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
301 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
302 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
303 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
304 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
305 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
306 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
307 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
308 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
309 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
310 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
313 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
314 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
315 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
316 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
317 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
318 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
319 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
320 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
321 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
322 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
323 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
324 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
325 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
326 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
327 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
328 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
329 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
330 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
331 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
332 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
333 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
334 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
335 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
336 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
337 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
338 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
339 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
340 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
341 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
342 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
343 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
344 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
345 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
346 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
347 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
348 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
349 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
350 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
351 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
352 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
353 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
354 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
355 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
356 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
357 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
358 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
359 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
360 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
361 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
362 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
363 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
364 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
365 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
366 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
367 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
368 2933599457 Rhizobium phaseoli M3 Isolate Nodule
369 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
370 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
371 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
372 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
373 2936381700 Rhizobium chutanense C16 Isolate Unclassified
374 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
375 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
376 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
377 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
378 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
379 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
380 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
381 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
382 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
383 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
384 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
385 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
386 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
387 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
388 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
389 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
390 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
391 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
392 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
393 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
394 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
395 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
396 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
397 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
398 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
399 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
400 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
401 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
402 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
403 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
404 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
405 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
406 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
407 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
408 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
409 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
410 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
411 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
412 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
413 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
414 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
415 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
416 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
417 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
418 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
419 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
420 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
421 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
422 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
423 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
424 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
425 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
426 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
427 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
428 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
429 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
430 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
431 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
432 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
433 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
434 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
435 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
436 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
437 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
438 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
439 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
440 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
441 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
442 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
443 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
444 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
445 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
446 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
447 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
448 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
449 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
450 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
451 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
452 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
453 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
454 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
455 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
456 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
457 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
458 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
459 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
460 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
461 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
462 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
463 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
464 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
465 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
466 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
467 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
468 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
469 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
470 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
471 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
472 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
473 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
474 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
475 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
476 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
477 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
478 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
479 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
480 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
481 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
482 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
483 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
484 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
485 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
486 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
487 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
488 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
489 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
490 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
491 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
492 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
493 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
494 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
495 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
496 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
497 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
498 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
499 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
500 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
501 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
502 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
503 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
504 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
505 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
506 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
507 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
508 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
509 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
510 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
511 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
512 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
513 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
514 2996887358 Rhizobium sp. R711 Isolate Nodule
515 2996893221 Rhizobium sp. R635 Isolate Nodule
516 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
517 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
518 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
519 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
520 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
521 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
522 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
523 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
524 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
525 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
526 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
527 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
528 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
529 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
530 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
531 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
532 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
533 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
534 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
535 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
536 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
537 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
538 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
539 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
540 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
541 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
542 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
543 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
544 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
545 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
546 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
547 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
548 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
549 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
550 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
551 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
552 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
553 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
554 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
555 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
556 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
557 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
558 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
559 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
560 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
561 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
562 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
563 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
564 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
565 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
566 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
567 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
568 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
569 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
570 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
571 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
572 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
573 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
574 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
575 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
576 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
577 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
578 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
579 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
580 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
581 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
582 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
583 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
584 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
585 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
586 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
587 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
589 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
590 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
591 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
592 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
593 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
594 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
596 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
598 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
599 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
600 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
601 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
602 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
603 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
608 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
609 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
610 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
611 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
613 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
614 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
615 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
616 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
617 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
618 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
619 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
620 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
621 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
622 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
623 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
624 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
625 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
626 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
627 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
628 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
629 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
630 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
631 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
632 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
633 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
634 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
635 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
636 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
637 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
638 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
639 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
640 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
641 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
642 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
643 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
644 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
645 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
646 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
647 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
648 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
649 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
650 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
651 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
652 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
653 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
654 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
655 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
656 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
657 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
658 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
659 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
660 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
661 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
662 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
663 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
664 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
665 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
666 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
667 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
668 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
669 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
670 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
671 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
672 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
673 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
674 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
675 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
676 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
677 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
678 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
679 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
680 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
681 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
682 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
683 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
684 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
685 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
686 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
687 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
688 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
689 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
690 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
691 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
692 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
693 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
694 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
695 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
696 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
697 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
698 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
699 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
700 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
701 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
702 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
703 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
704 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
705 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
706 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
707 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
708 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
709 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
710 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
711 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
712 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
713 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
714 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
715 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
716 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
717 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
718 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
719 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
720 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
721 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
722 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
724 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
725 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
726 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
727 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
728 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
729 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
730 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
731 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
732 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
733 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
734 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
735 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
736 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
737 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
738 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
739 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
740 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
741 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
742 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
743 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
744 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
745 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
746 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
747 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
748 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
749 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
750 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
751 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
752 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
753 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
754 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
755 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
756 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
757 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
758 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
759 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
760 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
761 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
762 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
763 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
764 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
765 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
766 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
767 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
768 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
769 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
770 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
771 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
772 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
773 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
774 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
775 8005258706 Rhizobium sp. R693 Isolate Nodule
776 8005275841 Rhizobium sp. N4311 Isolate Nodule
777 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
778 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
779 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
780 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
781 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
782 8005321885 Rhizobium sp. R72 Isolate Nodule
783 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
784 8005382845 Rhizobium sp. R634 Isolate Nodule
785 8005395548 Rhizobium sp. R339 Isolate Nodule
786 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
787 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
788 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
789 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
790 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
791 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
792 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
793 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
794 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
795 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
796 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
797 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
798 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
799 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
800 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
801 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
802 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
803 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
804 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
805 8018176218 Rhizobium sp. N122 Isolate Nodule
806 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
807 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
808 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
809 8024501048 Rhizobium sp. H4 Isolate Nodule
810 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
811 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
812 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
813 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
814 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
815 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
816 8056382006 Rhizobium croatiense 13T Isolate Nodule
817 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
818 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
819 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.77
Metatranscriptomes 0
Isolates 49.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 21.37
Nodule 37.69
Rhizoplane 2.22
Rhizosphere 19.74
Stem 0
Stem Tuber 0
Unclassified 18.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000001 3300001979 Bacteria 168537
2 JGI25156J39149_1000027 3300002705 Bacteria 127396
3 JGI25162J39368_1001607 3300002737 Bacteria 11354
4 JGI25162J39368_1001697 3300002737 Bacteria 10732
5 JGI25154J39366_1000181 3300002738 Bacteria 49117
6 JGI25158J39367_1000135 3300002739 Bacteria 17270
7 JGI25158J39367_1002719 3300002739 Bacteria 2822
8 JGI25157J39369_1000010 3300002741 Bacteria 207685
9 JGI25152J39213_1000534 3300002773 Bacteria 21021
10 JGI25152J39213_1004759 3300002773 Bacteria 4173
11 JGI25152J39213_1006755 3300002773 Bacteria 3056
12 JGI25150J39212_1000278 3300002774 Bacteria 26976
13 JGI25150J39212_1007407 3300002774 Bacteria 2207
14 JGI25159J45721_1000006 3300002987 Bacteria 188201
15 JGI25159J45721_1001165 3300002987 Bacteria 11213
16 JGI25159J45721_1001963 3300002987 Bacteria 8198
17 JGI25151J46595_10000126 3300003187 Bacteria 103193
18 JGI25151J46595_10000815 3300003187 Bacteria 24893
19 JGI25151J46595_10006807 3300003187 Bacteria 5687
20 JGI25151J46595_10015949 3300003187 Bacteria 3296
21 JGI25151J46595_10031711 3300003187 Bacteria 2060
22 JGI25151J46595_10033585 3300003187 Bacteria 1974
23 JGI25165J46597_1001556 3300003214 Bacteria 11363
24 JGI25165J46597_1002111 3300003214 Bacteria 7231
25 JGI25153J46596_10001009 3300003215 Bacteria 17129
26 JGI25153J46596_10010532 3300003215 Bacteria 4173
27 JGI25153J46596_10012299 3300003215 Bacteria 3706
28 JGI25153J46596_10015293 3300003215 Bacteria 3135
29 JGI25153J46596_10037690 3300003215 Bacteria 1533
30 rootL2_10078439 3300003322 Bacteria 8311
31 rootH1_10008188 3300003323 Bacteria 8905
32 JGI25160J50197_1000004 3300003354 Bacteria 419797
33 JGI25160J50197_1000019 3300003354 Bacteria 233980
34 JGI25160J50197_1002746 3300003354 Bacteria 8074
35 JGI25160J50197_1003515 3300003354 Bacteria 6989
36 JGI25161J50226_1000003 3300003374 Bacteria 413345
37 JGI25161J50226_1000467 3300003374 Bacteria 18513
38 JGI25161J50226_1000964 3300003374 Bacteria 10215
39 JGI25161J50226_1005882 3300003374 Bacteria 2301
40 Ga0055526_1000462 3300003771 Bacteria 32312
41 Ga0055526_1001096 3300003771 Bacteria 19688
42 Ga0055526_1007466 3300003771 Bacteria 5672
43 Ga0055526_1012068 3300003771 Bacteria 3814
44 Ga0055526_1013553 3300003771 Bacteria 3436
45 Ga0055524_1001017 3300003775 Bacteria 17365
46 Ga0055524_1002645 3300003775 Bacteria 9103
47 Ga0055524_1006222 3300003775 Bacteria 5208
48 Ga0055524_1009498 3300003775 Bacteria 3949
49 Ga0055524_1022848 3300003775 Bacteria 2029
50 Ga0055524_1032285 3300003775 Bacteria 1488
51 Ga0055536_1002249 3300003781 Bacteria 10987
52 Ga0055536_1005470 3300003781 Bacteria 6198
53 Ga0055528_1000448 3300003790 Bacteria 32948
54 Ga0055528_1003583 3300003790 Bacteria 7739
55 Ga0055528_1004819 3300003790 Bacteria 6416
56 Ga0055528_1006740 3300003790 Bacteria 5171
57 Ga0055528_1012766 3300003790 Bacteria 3237
58 Ga0055528_1016752 3300003790 Bacteria 2572
59 Ga0055530_10010741 3300003791 Bacteria 3348
60 Ga0055530_10016849 3300003791 Bacteria 2312
61 Ga0055540_1000686 3300003792 Bacteria 23390
62 Ga0055540_1002249 3300003792 Bacteria 10434
63 Ga0055540_1007390 3300003792 Bacteria 4156
64 Ga0055540_1022749 3300003792 Bacteria 1595
65 Ga0055531_10001580 3300003794 Bacteria 16620
66 Ga0055531_10011759 3300003794 Bacteria 4183
67 Ga0058692_1007736 3300003856 Bacteria 2825
68 Ga0055543_1000001 3300004625 Bacteria 419949
69 Ga0055543_1000019 3300004625 Bacteria 161035
70 Ga0055543_1000275 3300004625 Bacteria 38327
71 Ga0055543_1000697 3300004625 Bacteria 17194
72 Ga0065165_1000149 3300005262 Bacteria 122370
73 Ga0065165_1000272 3300005262 Bacteria 88086
74 Ga0065165_1003401 3300005262 Bacteria 11238
75 Ga0065165_1003644 3300005262 Bacteria 10524
76 Ga0065165_1005539 3300005262 Bacteria 7035
77 Ga0065704_10224171 3300005289 Bacteria 1064
78 Ga0070663_100442331 3300005455 Bacteria 1070
79 Ga0070665_100069082 3300005548 Bacteria 3541
80 Ga0070665_100081481 3300005548 Bacteria 3242
81 Ga0070665_100680142 3300005548 Bacteria 1042
82 Ga0081455_10143117 3300005937 Bacteria 1854
83 Ga0075365_10022518 3300006038 Bacteria 3949
84 Ga0075365_10043817 3300006038 Bacteria 2930
85 Ga0075365_10187024 3300006038 Bacteria 1449
86 Ga0075368_10002406 3300006042 Bacteria 6100
87 Ga0075363_100035621 3300006048 Bacteria 2606
88 Ga0075363_100072259 3300006048 Bacteria 1875
89 Ga0075363_100178632 3300006048 Bacteria 1207
90 Ga0075364_10000507 3300006051 Bacteria 19826
91 Ga0075364_10060068 3300006051 Bacteria 2493
92 Ga0075364_10236470 3300006051 Bacteria 1241
93 Ga0075364_10424198 3300006051 Bacteria 908
94 Ga0075362_10004640 3300006177 Bacteria 4954
95 Ga0075362_10008465 3300006177 Bacteria 3935
96 Ga0075367_10011315 3300006178 Bacteria 4716
97 Ga0075367_10018301 3300006178 Bacteria 3863
98 Ga0075367_10036998 3300006178 Bacteria 2833
99 Ga0075367_10045558 3300006178 Bacteria 2573
100 Ga0075369_10008603 3300006186 Bacteria 3934
101 Ga0075369_10008663 3300006186 Bacteria 3924
102 Ga0075369_10070470 3300006186 Bacteria 1538
103 Ga0075366_10012712 3300006195 Bacteria 4782
104 Ga0075370_10001685 3300006353 Bacteria 9798
105 Ga0075370_10022870 3300006353 Bacteria 3438
106 Ga0075370_10043842 3300006353 Bacteria 2529
107 Ga0075370_10045487 3300006353 Bacteria 2482
108 Ga0075370_10064070 3300006353 Bacteria 2096
109 Ga0075370_10130771 3300006353 Bacteria 1465
110 Ga0079104_1000129 3300006946 Bacteria 108427
111 Ga0079104_1002408 3300006946 Bacteria 10170
112 Ga0079104_1003687 3300006946 Bacteria 6952
113 Ga0099826_10000090 3300006948 Bacteria 44830
114 Ga0105244_10170998 3300009036 Bacteria 1034
115 Ga0105240_10000005 3300009093 Bacteria 702630
116 Ga0105243_10044327 3300009148 Bacteria 3489
117 Ga0105243_10281593 3300009148 Bacteria 1498
118 Ga0105237_10001991 3300009545 Bacteria 25984
119 Ga0123341_1000001 3300009765 Bacteria 314908
120 Ga0123342_1008464 3300009766 Bacteria 12916
121 Ga0123342_1011798 3300009766 Bacteria 9408
122 Ga0105239_10083333 3300010375 Bacteria 3521
123 Ga0105239_10214607 3300010375 Bacteria 2157
124 Ga0157373_10014191 3300013100 Bacteria 5843
125 Ga0157373_10019768 3300013100 Bacteria 4898
126 Ga0157373_10188649 3300013100 Bacteria 1453
127 Ga0157371_10000015 3300013102 Bacteria 339838
128 Ga0157370_10000665 3300013104 Bacteria 42812
129 Ga0157370_10000992 3300013104 Bacteria 35815
130 Ga0157370_10357151 3300013104 Bacteria 1346
131 Ga0157369_10096669 3300013105 Bacteria 3151
132 Ga0157369_10388837 3300013105 Bacteria 1447
133 Ga0171463_1011 3300013249 Bacteria 230603
134 Ga0182007_10001185 3300015262 Bacteria 14171
135 Ga0183363_1143 3300015690 Bacteria 17948
136 Ga0214544_1000024 3300021320 Bacteria 163562
137 Ga0214542_1000015 3300021321 Bacteria 227912
138 Ga0214543_1000011 3300021327 Bacteria 344093
139 Ga0214543_1000064 3300021327 Bacteria 126778
140 Ga0228711_1000528 3300022739 Bacteria 47804
141 Ga0228710_1000006 3300022740 Bacteria 209134
142 Ga0209435_100022 3300025206 Bacteria 207766
143 Ga0209436_100039 3300025208 Bacteria 75732
144 Ga0209436_100390 3300025208 Bacteria 19835
145 Ga0209437_100153 3300025233 Bacteria 154068
146 Ga0209437_100201 3300025233 Bacteria 119080
147 Ga0207425_1000010 3300025245 Bacteria 572898
148 Ga0207425_1001043 3300025245 Bacteria 12850
149 Ga0207425_1012677 3300025245 Bacteria 1968
150 Ga0209646_1000078 3300025246 Bacteria 207766
151 Ga0209646_1007337 3300025246 Bacteria 1803
152 Ga0209026_1000065 3300025250 Bacteria 207766
153 Ga0209677_100572 3300025253 Bacteria 20332
154 Ga0209759_1000055 3300025256 Bacteria 207766
155 Ga0209129_1000034 3300025258 Bacteria 330950
156 Ga0209129_1000140 3300025258 Bacteria 122574
157 Ga0209129_1000470 3300025258 Bacteria 29594
158 Ga0209129_1000569 3300025258 Bacteria 25461
159 Ga0209129_1000947 3300025258 Bacteria 17460
160 Ga0209129_1001001 3300025258 Bacteria 16842
161 Ga0209129_1003318 3300025258 Bacteria 7096
162 Ga0209233_1000175 3300025261 Bacteria 144221
163 Ga0209233_1000226 3300025261 Bacteria 103045
164 Ga0209233_1000248 3300025261 Bacteria 87812
165 Ga0209673_1000068 3300025273 Bacteria 245891
166 Ga0209673_1000230 3300025273 Bacteria 109505
167 Ga0209673_1001478 3300025273 Bacteria 22012
168 Ga0209673_1001650 3300025273 Bacteria 19297
169 Ga0209673_1009548 3300025273 Bacteria 4184
170 Ga0209673_1022783 3300025273 Bacteria 2150
171 Ga0209130_1000006 3300025284 Bacteria 596528
172 Ga0209130_1000007 3300025284 Bacteria 591584
173 Ga0209130_1000012 3300025284 Bacteria 421329
174 Ga0209130_1009150 3300025284 Bacteria 2853
175 Ga0209130_1011278 3300025284 Bacteria 2400
176 Ga0209675_1034570 3300025291 Bacteria 1160
177 Ga0209676_1002990 3300025292 Bacteria 10999
178 Ga0209676_1003915 3300025292 Bacteria 8636
179 Ga0209025_1000022 3300025294 Bacteria 574487
180 Ga0209025_1000033 3300025294 Bacteria 414511
181 Ga0209025_1000097 3300025294 Bacteria 236632
182 Ga0209025_1000320 3300025294 Bacteria 106773
183 Ga0209025_1000702 3300025294 Bacteria 57061
184 Ga0209025_1005878 3300025294 Bacteria 9810
185 Ga0209025_1008956 3300025294 Bacteria 7076
186 Ga0209025_1010533 3300025294 Bacteria 6254
187 Ga0209025_1023435 3300025294 Bacteria 3226
188 Ga0209025_1026526 3300025294 Bacteria 2904
189 Ga0209025_1032230 3300025294 Bacteria 2456
190 Ga0209025_1056823 3300025294 Bacteria 1501
191 Ga0209564_1000137 3300025295 Bacteria 183874
192 Ga0209564_1000373 3300025295 Bacteria 82785
193 Ga0209564_1000740 3300025295 Bacteria 46349
194 Ga0209564_1001522 3300025295 Bacteria 23049
195 Ga0209564_1008778 3300025295 Bacteria 4928
196 Ga0209564_1034078 3300025295 Bacteria 1500
197 Ga0209758_1000080 3300025297 Bacteria 261472
198 Ga0209758_1000520 3300025297 Bacteria 61722
199 Ga0209758_1000822 3300025297 Bacteria 43449
200 Ga0209758_1001240 3300025297 Bacteria 31770
201 Ga0209758_1001887 3300025297 Bacteria 22869
202 Ga0209758_1009909 3300025297 Bacteria 5809
203 Ga0209758_1027428 3300025297 Bacteria 2434
204 Ga0209050_1003268 3300025298 Bacteria 12184
205 Ga0209050_1007097 3300025298 Bacteria 6403
206 Ga0209050_1012453 3300025298 Bacteria 3897
207 Ga0209256_1000319 3300025299 Bacteria 82827
208 Ga0209256_1001415 3300025299 Bacteria 24943
209 Ga0209256_1001971 3300025299 Bacteria 18502
210 Ga0209256_1004897 3300025299 Bacteria 8044
211 Ga0209256_1006489 3300025299 Bacteria 6159
212 Ga0209256_1007449 3300025299 Bacteria 5389
213 Ga0209256_1029040 3300025299 Bacteria 1548
214 Ga0209256_1056748 3300025299 Bacteria 925
215 Ga0207426_1000003 3300025302 Bacteria 1063212
216 Ga0207426_1000010 3300025302 Bacteria 796003
217 Ga0207426_1000094 3300025302 Bacteria 275293
218 Ga0207426_1000111 3300025302 Bacteria 234032
219 Ga0207426_1000853 3300025302 Bacteria 32038
220 Ga0209051_1000166 3300025303 Bacteria 120265
221 Ga0209051_1006111 3300025303 Bacteria 6852
222 Ga0209051_1006255 3300025303 Bacteria 6750
223 Ga0209051_1013015 3300025303 Bacteria 3983
224 Ga0209051_1020252 3300025303 Bacteria 2871
225 Ga0209051_1022564 3300025303 Bacteria 2646
226 Ga0209051_1024042 3300025303 Bacteria 2518
227 Ga0209257_1001307 3300025304 Bacteria 30337
228 Ga0209257_1006544 3300025304 Bacteria 7437
229 Ga0209257_1007958 3300025304 Bacteria 6210
230 Ga0207695_10000011 3300025913 Bacteria 910221
231 Ga0207671_10000276 3300025914 Bacteria 76490
232 Ga0207644_10231915 3300025931 Bacteria 1467
233 Ga0207702_10036422 3300026078 Bacteria 4116
234 Ga0209281_1000036 3300027111 Bacteria 369415
235 Ga0209281_1000047 3300027111 Bacteria 326514
236 Ga0209281_1000268 3300027111 Bacteria 100508
237 Ga0209281_1000578 3300027111 Bacteria 43096
238 Ga0209371_1000178 3300027312 Bacteria 93894
239 Ga0209371_1000382 3300027312 Bacteria 47344
240 Ga0209371_1001444 3300027312 Bacteria 16135
241 Ga0209282_1000026 3300027666 Bacteria 166272
242 Ga0209282_1001233 3300027666 Bacteria 13843
243 Ga0209813_10008079 3300027866 Bacteria 2647
244 Ga0268266_10031852 3300028379 Bacteria 4479
245 Ga0268266_10079051 3300028379 Bacteria 2863
246 Ga0268266_10182047 3300028379 Bacteria 1914
247 Ga0307515_10000274 3300028794 Bacteria 126011
248 Ga0307515_10000656 3300028794 Bacteria 79816
249 Ga0307515_10012807 3300028794 Bacteria 15740
250 Ga0307515_10028376 3300028794 Bacteria 9515
251 Ga0307515_10155270 3300028794 Bacteria 2366
252 Ga0268256_1000251 3300030500 Bacteria 56750
253 Ga0268256_1002340 3300030500 Bacteria 9773
254 Ga0316181_1292107 3300030744 Bacteria 2694
255 Ga0307513_10010898 3300031456 Bacteria 11355
256 Ga0307513_10028989 3300031456 Bacteria 6319
257 Ga0307513_10186520 3300031456 Bacteria 1931
258 Ga0307405_10000988 3300031731 Bacteria 11428
259 Ga0307405_10484736 3300031731 Bacteria 988
260 Ga0307406_10035957 3300031901 Bacteria 3049
261 Ga0307406_10050367 3300031901 Bacteria 2640
262 Ga0307412_10005856 3300031911 Bacteria 6919
263 Ga0307412_10149819 3300031911 Bacteria 1720
264 Ga0315914_1000008 3300031967 Bacteria 209133
265 Ga0307409_100052172 3300031995 Bacteria 3134
266 Ga0307416_100609827 3300032002 Bacteria 1172
267 Ga0307414_10019944 3300032004 Bacteria 4167
268 Ga0315913_1000137 3300033430 Bacteria 47802
269 Ga0315915_1000014 3300033464 Bacteria 171068
270 Ga0373927_0002192 3300035695 Bacteria 14352
271 Ga0373925_0007649 3300037068 Bacteria 7871
272 Ga0395905_0000700 3300037471 Bacteria 44432
273 Ga0395905_0020379 3300037471 Bacteria 6282
274 Ga0395905_0031030 3300037471 Bacteria 5033
275 Ga0436365_0596357 3300039437 Bacteria 963
276 Ga0439436_0006610 3300041404 Bacteria 3560
277 Ga0439436_0010458 3300041404 Bacteria 2830
278 Ga0439466_0033713 3300041411 Bacteria 1739
279 Ga0439466_0041282 3300041411 Bacteria 1540
280 Ga0439466_0066400 3300041411 Bacteria 1155
281 Ga0439465_0002648 3300041413 Bacteria 5849
282 Ga0439465_0002752 3300041413 Bacteria 5754
283 Ga0439465_0012104 3300041413 Bacteria 2702
284 Ga0439465_0017104 3300041413 Bacteria 2263
285 Ga0439465_0040462 3300041413 Bacteria 1507
286 Ga0451787_369841 3300041441 Bacteria 1519
287 Ga0451833_0522372 3300041491 Bacteria 3144
288 Ga0451835_0463921 3300041492 Bacteria 1077
289 Ga0451837_0828149 3300041494 Bacteria 1362
290 Ga0451837_1750527 3300041494 Bacteria 1353
291 Ga0451839_0836255 3300041496 Bacteria 1156
292 Ga0451841_0681211 3300041498 Bacteria 2642
293 Ga0451847_0071726 3300041503 Bacteria 2735
294 Ga0451849_0877291 3300041505 Bacteria 2022
295 Ga0451851_0518653 3300041507 Bacteria 1520
296 Ga0451843_1192327 3300041509 Bacteria 1298
297 Ga0451855_1639532 3300041511 Bacteria 1533
298 Ga0451853_3126023 3300041512 Bacteria 4127
299 Ga0439432_072450 3300042006 Bacteria 1049
300 Ga0439449_0004882 3300042007 Bacteria 5168
301 Ga0439449_0020484 3300042007 Bacteria 2478
302 Ga0439449_0050844 3300042007 Bacteria 1533
303 Ga0439462_0007652 3300042015 Bacteria 2709
304 Ga0450918_002717 3300042531 Bacteria 3321
305 Ga0466966_0191833 3300044684 Bacteria 1238
306 Ga0466963_0036076 3300044694 Bacteria 3223
307 Ga0466964_0068753 3300044706 Bacteria 1492
308 Ga0466970_0000494 3300044765 Bacteria 19381
309 Ga0466967_0358140 3300045976 Bacteria 1413
310 Ga0466967_0804345 3300045976 Bacteria 933
311 Ga0495617_014159 3300046452 Bacteria 2711
312 Ga0495627_027031 3300046453 Bacteria 1845
313 Ga0495629_0053403 3300046459 Bacteria 2827
314 Ga0495638_0000687 3300046460 Bacteria 36753
315 Ga0495638_0010984 3300046460 Bacteria 6261
316 Ga0495638_0035043 3300046460 Bacteria 3200
317 Ga0495650_0040269 3300046471 Bacteria 2008
318 Ga0495650_0074104 3300046471 Bacteria 1328
319 Ga0495605_0000460 3300046474 Bacteria 36596
320 Ga0495605_0060324 3300046474 Bacteria 1818
321 Ga0495585_0007121 3300046492 Bacteria 6871
322 Ga0495585_0012342 3300046492 Bacteria 5033
323 Ga0495585_0154377 3300046492 Bacteria 1195
324 Ga0495607_0030149 3300046501 Bacteria 3333
325 Ga0495607_0047769 3300046501 Bacteria 2505
326 Ga0495607_0054177 3300046501 Bacteria 2312
327 Ga0495583_0006923 3300046506 Bacteria 7283
328 Ga0495583_0009458 3300046506 Bacteria 5818
329 Ga0495583_0116291 3300046506 Bacteria 1129
330 Ga0495606_0008208 3300046507 Bacteria 9130
331 Ga0495606_0016864 3300046507 Bacteria 5547
332 Ga0495606_0058674 3300046507 Bacteria 2472
333 Ga0495606_0154450 3300046507 Bacteria 1344
334 Ga0495606_0200068 3300046507 Bacteria 1139
335 Ga0495610_0004461 3300046512 Bacteria 10339
336 Ga0495610_0015334 3300046512 Bacteria 4458
337 Ga0495610_0023054 3300046512 Bacteria 3391
338 Ga0495616_0019776 3300046513 Bacteria 3671
339 Ga0495620_0028354 3300046515 Bacteria 2605
340 Ga0495620_0030783 3300046515 Bacteria 2466
341 Ga0495620_0074080 3300046515 Bacteria 1387
342 Ga0495620_0196587 3300046515 Bacteria 776
343 Ga0495631_0000390 3300046518 Bacteria 30237
344 Ga0495631_0087059 3300046518 Bacteria 1345
345 Ga0495632_0002325 3300046519 Bacteria 14631
346 Ga0495632_0012498 3300046519 Bacteria 4896
347 Ga0495643_0019352 3300046522 Bacteria 3939
348 Ga0495643_0095143 3300046522 Bacteria 1532
349 Ga0495648_0146879 3300046524 Bacteria 1234
350 Ga0495654_0004691 3300046530 Bacteria 8054
351 Ga0495609_0132233 3300046538 Bacteria 1068
352 Ga0495633_0009195 3300046558 Bacteria 5480
353 Ga0495633_0020612 3300046558 Bacteria 3312
354 Ga0495656_0037380 3300046615 Bacteria 2005
355 Ga0495656_0114943 3300046615 Bacteria 1264
356 Ga0495668_0006370 3300046616 Bacteria 7738
357 Ga0495668_0054907 3300046616 Bacteria 2200
358 Ga0495668_0217165 3300046616 Bacteria 1047
359 Ga0495625_0017845 3300046660 Bacteria 5546
360 Ga0495625_0088931 3300046660 Bacteria 2139
361 Ga0495625_0156417 3300046660 Bacteria 1529
362 Ga0495625_0256161 3300046660 Bacteria 1134
363 Ga0495625_0324576 3300046660 Bacteria 979
364 Ga0495625_0433883 3300046660 Bacteria 814
365 Ga0495635_0060715 3300046663 Bacteria 2598
366 Ga0495661_0165581 3300046665 Bacteria 1183
367 Ga0495588_0156476 3300046674 Bacteria 1205
368 Ga0495588_0266034 3300046674 Bacteria 903
369 Ga0495588_0359417 3300046674 Bacteria 765
370 Ga0495657_0096218 3300046675 Bacteria 1892
371 Ga0495658_0151713 3300046683 Bacteria 1424
372 Ga0495624_0107601 3300046690 Bacteria 1715
373 Ga0495649_0039542 3300046694 Bacteria 2586
374 Ga0495649_0109870 3300046694 Bacteria 1462
375 Ga0495649_0135528 3300046694 Bacteria 1298
376 Ga0495660_0016959 3300046810 Bacteria 4194
377 Ga0495660_0087535 3300046810 Bacteria 1624
378 Ga0495636_0163433 3300047318 Bacteria 1004
379 Ga0495687_072679 3300047443 Bacteria 1373
380 Ga0495687_074887 3300047443 Bacteria 1344
381 Ga0495685_075215 3300047447 Bacteria 1128
382 Ga0495681_0007378 3300047470 Bacteria 7033
383 Ga0495681_0128055 3300047470 Bacteria 1083
384 Ga0495681_0134841 3300047470 Bacteria 1048
385 Ga0495681_0137155 3300047470 Bacteria 1036
386 Ga0495686_0000989 3300047472 Bacteria 34642
387 Ga0495686_0005762 3300047472 Bacteria 9683
388 Ga0495686_0018215 3300047472 Bacteria 4717
389 Ga0495686_0042156 3300047472 Bacteria 2903
390 Ga0495686_0071952 3300047472 Bacteria 2127
391 Ga0495686_0220880 3300047472 Bacteria 1078
392 Ga0495615_0006985 3300048090 Bacteria 2122
393 Ga0495626_0114723 3300048091 Bacteria 1163
394 Ga0496100_0113642 3300048903 Bacteria 1885
395 Ga0496101_0158611 3300048904 Bacteria 1734
396 Ga0496102_0758028 3300048905 Bacteria 893
397 Ga0496103_0096498 3300048906 Bacteria 1868
398 Ga0496104_0428031 3300048907 Bacteria 1235
399 Ga0496104_0469847 3300048907 Bacteria 1169
400 Ga0496105_0320235 3300048908 Bacteria 1243
401 Ga0496105_0338040 3300048908 Bacteria 1204
402 Ga0496106_0006863 3300048909 Bacteria 8427
403 Ga0496106_0124733 3300048909 Bacteria 2015
404 Ga0496106_0209380 3300048909 Bacteria 1553
405 Ga0496107_0103494 3300048910 Bacteria 2089
406 Ga0496109_0405465 3300048912 Bacteria 1288
407 Ga0496111_0001309 3300048914 Bacteria 13969
408 Ga0496113_0065466 3300048916 Bacteria 2751
409 Ga0496114_0677192 3300048917 Bacteria 906
410 Ga0496116_0000061 3300048919 Bacteria 271860
411 Ga0496116_0003692 3300048919 Bacteria 14987
412 Ga0496116_0014662 3300048919 Bacteria 6244
413 Ga0496116_0025980 3300048919 Bacteria 4292
414 Ga0496116_0063552 3300048919 Bacteria 2377
415 Ga0496116_0064129 3300048919 Bacteria 2362
416 Ga0496116_0083738 3300048919 Bacteria 1967
417 Ga0496116_0103878 3300048919 Bacteria 1689
418 Ga0496117_0000002 3300048920 Bacteria 2483758
419 Ga0496117_0007804 3300048920 Bacteria 10312
420 Ga0496117_0008320 3300048920 Bacteria 9872
421 Ga0496117_0015204 3300048920 Bacteria 6581
422 Ga0496117_0030584 3300048920 Bacteria 4129
423 Ga0496117_0066946 3300048920 Bacteria 2434
424 Ga0496117_0147783 3300048920 Bacteria 1396
425 Ga0496117_0289765 3300048920 Bacteria 872
426 Ga0496118_0000460 3300048921 Bacteria 67445
427 Ga0496118_0000756 3300048921 Bacteria 52299
428 Ga0496118_0004327 3300048921 Bacteria 16930
429 Ga0496118_0015025 3300048921 Bacteria 7198
430 Ga0496118_0020043 3300048921 Bacteria 5950
431 Ga0496118_0038085 3300048921 Bacteria 3859
432 Ga0496118_0092954 3300048921 Bacteria 2068
433 Ga0496118_0245624 3300048921 Bacteria 1021
434 Ga0496119_0018304 3300048922 Bacteria 5226
435 Ga0496119_0032975 3300048922 Bacteria 3443
436 Ga0496119_0046584 3300048922 Bacteria 2706
437 Ga0496119_0055036 3300048922 Bacteria 2419
438 Ga0496119_0094497 3300048922 Bacteria 1691
439 Ga0496119_0097357 3300048922 Bacteria 1658
440 Ga0496120_0000078 3300048923 Bacteria 162312
441 Ga0496120_0022110 3300048923 Bacteria 4004
442 Ga0496120_0064655 3300048923 Bacteria 2030
443 Ga0496120_0087020 3300048923 Bacteria 1678
444 Ga0496120_0107785 3300048923 Bacteria 1460
445 Ga0496121_0000001 3300048924 Bacteria 1830318
446 Ga0496121_0000182 3300048924 Bacteria 139638
447 Ga0496121_0001247 3300048924 Bacteria 44170
448 Ga0496121_0021365 3300048924 Bacteria 6343
449 Ga0496121_0024322 3300048924 Bacteria 5798
450 Ga0496121_0031739 3300048924 Bacteria 4818
451 Ga0496121_0062983 3300048924 Bacteria 3034
452 Ga0496121_0064191 3300048924 Bacteria 2995
453 Ga0496121_0108884 3300048924 Bacteria 2119
454 Ga0496121_0498166 3300048924 Bacteria 774
455 Ga0496122_0000001 3300048925 Bacteria 1827766
456 Ga0496122_0000179 3300048925 Bacteria 149332
457 Ga0496122_0000651 3300048925 Bacteria 70375
458 Ga0496122_0004590 3300048925 Bacteria 17003
459 Ga0496122_0016237 3300048925 Bacteria 7066
460 Ga0496122_0026243 3300048925 Bacteria 5029
461 Ga0496122_0033272 3300048925 Bacteria 4244
462 Ga0496122_0042322 3300048925 Bacteria 3585
463 Ga0496122_0061405 3300048925 Bacteria 2758
464 Ga0496122_0071268 3300048925 Bacteria 2477
465 Ga0496122_0170819 3300048925 Bacteria 1311
466 Ga0496122_0391887 3300048925 Bacteria 708
467 Ga0496123_0000001 3300048926 Bacteria 1831497
468 Ga0496123_0000043 3300048926 Bacteria 253752
469 Ga0496123_0000768 3300048926 Bacteria 51899
470 Ga0496123_0013112 3300048926 Bacteria 6992
471 Ga0496123_0014366 3300048926 Bacteria 6568
472 Ga0496123_0031183 3300048926 Bacteria 3882
473 Ga0496123_0077358 3300048926 Bacteria 2043
474 Ga0496123_0136438 3300048926 Bacteria 1349
475 Ga0496123_0142564 3300048926 Bacteria 1307
476 Ga0496124_0000112 3300048927 Bacteria 166282
477 Ga0496124_0002868 3300048927 Bacteria 21792
478 Ga0496124_0003625 3300048927 Bacteria 18745
479 Ga0496124_0009455 3300048927 Bacteria 10037
480 Ga0496124_0013774 3300048927 Bacteria 7870
481 Ga0496124_0034713 3300048927 Bacteria 4421
482 Ga0496124_0038929 3300048927 Bacteria 4124
483 Ga0496124_0039034 3300048927 Bacteria 4118
484 Ga0496124_0045797 3300048927 Bacteria 3749
485 Ga0496124_0058197 3300048927 Bacteria 3252
486 Ga0496124_0060067 3300048927 Bacteria 3191
487 Ga0496124_0069588 3300048927 Bacteria 2921
488 Ga0496124_0152976 3300048927 Bacteria 1807
489 Ga0496124_0157201 3300048927 Bacteria 1776
490 Ga0496125_0000001 3300048928 Bacteria 1766138
491 Ga0496125_0000671 3300048928 Bacteria 57108
492 Ga0496125_0004457 3300048928 Bacteria 16168
493 Ga0496125_0017316 3300048928 Bacteria 6879
494 Ga0496125_0024800 3300048928 Bacteria 5506
495 Ga0496125_0045622 3300048928 Bacteria 3686
496 Ga0496125_0087407 3300048928 Bacteria 2354
497 Ga0496126_0000397 3300048929 Bacteria 89305
498 Ga0496126_0004331 3300048929 Bacteria 17035
499 Ga0496126_0007936 3300048929 Bacteria 11539
500 Ga0496126_0034808 3300048929 Bacteria 4726
501 Ga0496126_0222311 3300048929 Bacteria 1585
502 Ga0496126_0287519 3300048929 Bacteria 1360
503 Ga0496126_0805254 3300048929 Bacteria 720
504 Ga0495678_011156 3300049459 Bacteria 4319
505 Ga0501031_0014376 3300049568 Bacteria 5146
506 Ga0501032_0097812 3300049569 Bacteria 1945
507 Ga0501032_0148848 3300049569 Bacteria 1540
508 Ga0501033_0000567 3300049570 Bacteria 34447
509 Ga0501033_0042441 3300049570 Bacteria 3391
510 Ga0501033_0400666 3300049570 Bacteria 957
511 Ga0501034_0261702 3300049571 Bacteria 1672
512 Ga0501034_0263885 3300049571 Bacteria 1664
513 Ga0501036_0082272 3300049572 Bacteria 2721
514 Ga0501036_0166637 3300049572 Bacteria 1857
515 Ga0501037_0048993 3300049573 Bacteria 3094
516 Ga0501037_0117420 3300049573 Bacteria 1914
517 Ga0501038_0135804 3300049574 Bacteria 2015
518 Ga0501043_0011682 3300049579 Bacteria 6874
519 Ga0501047_0144091 3300049581 Bacteria 2260
520 Ga0501068_0149819 3300049584 Bacteria 1466
521 Ga0501083_0053639 3300049744 Bacteria 2706
522 Ga0501280_001530 3300049776 Bacteria 4218
523 Ga0501035_0003382 3300049822 Bacteria 15260
524 nmdc:mga03683_6075_c1 3300050489 Bacteria 4118
525 nmdc:mga03683_87273_c1 3300050489 Bacteria 1356
526 nmdc:mga03n38_63391_c1 3300050490 Bacteria 1689
527 nmdc:mga03n38_85537_c1 3300050490 Bacteria 1491
528 nmdc:mga00v17_222_c2 3300050491 Bacteria 26927
529 nmdc:mga00v17_294417_c1 3300050491 Bacteria 1054
530 nmdc:mga00v17_359833_c1 3300050491 Bacteria 946
531 nmdc:mga00v17_80_c1 3300050491 Bacteria 58183
532 nmdc:mga0yw44_143763_c1 3300050492 Bacteria 1552
533 nmdc:mga0yw44_298958_c1 3300050492 Bacteria 1078
534 nmdc:mga0yw44_47486_c1 3300050492 Bacteria 2585
535 nmdc:mga0k408_150435_c1 3300050493 Bacteria 1386
536 nmdc:mga0k408_18899_c1 3300050493 Bacteria 3847
537 nmdc:mga0k408_21487_c1 3300050493 Bacteria 2684
538 nmdc:mga06z11_12486_c1 3300050494 Bacteria 3697
539 nmdc:mga04h51_8554_c1 3300050495 Bacteria 2741
540 nmdc:mga07m45_104795_c1 3300050496 Bacteria 1626
541 nmdc:mga07m45_114960_c1 3300050496 Bacteria 1552
542 nmdc:mga0sz30_1504_c1 3300050516 Bacteria 8301
543 nmdc:mga0sz30_608_c1 3300050516 Bacteria 13281
544 Ga0500610_0030088 3300053079 Bacteria 2749
545 Ga0500578_0012419 3300053086 Bacteria 5496
546 Ga0500578_0202450 3300053086 Bacteria 1214
547 Ga0500651_0287298 3300053093 Bacteria 947
548 Ga0500641_0230734 3300053096 Bacteria 782
549 Ga0500650_0098987 3300053098 Bacteria 1365
550 Ga0500556_0026043 3300053104 Bacteria 1939
551 Ga0500556_0027354 3300053104 Bacteria 1904
552 Ga0500556_0110901 3300053104 Bacteria 1064
553 Ga0500557_004940 3300053105 Bacteria 2864
554 Ga0500560_002193 3300053107 Bacteria 3665
555 Ga0500560_017406 3300053107 Bacteria 1983
556 Ga0500569_002509 3300053109 Bacteria 3632
557 Ga0500572_000712 3300053111 Bacteria 10799
558 Ga0500594_0004053 3300053118 Bacteria 3225
559 Ga0500594_0006450 3300053118 Bacteria 2637
560 Ga0500607_133615 3300053121 Bacteria 1179
561 Ga0500608_003611 3300053122 Bacteria 5838
562 Ga0500608_039873 3300053122 Bacteria 2250
563 Ga0500618_000510 3300053125 Bacteria 24654
564 Ga0500618_000871 3300053125 Bacteria 16116
565 Ga0500618_006080 3300053125 Bacteria 3580
566 Ga0500618_008582 3300053125 Bacteria 2842
567 Ga0500655_023103 3300053133 Bacteria 1173
568 Ga0500658_0008546 3300053134 Bacteria 3781
569 Ga0500559_0003485 3300053136 Bacteria 7719
570 Ga0500561_0000062 3300053137 Bacteria 21493
571 Ga0500561_0069769 3300053137 Bacteria 1003
572 Ga0500568_0001356 3300053139 Bacteria 15924
573 Ga0500568_0004078 3300053139 Bacteria 7910
574 Ga0500568_0030014 3300053139 Bacteria 2252
575 Ga0500568_0108497 3300053139 Bacteria 1038
576 Ga0500573_0004460 3300053140 Bacteria 7382
577 Ga0500573_0037067 3300053140 Bacteria 2816
578 Ga0500577_0041426 3300053142 Bacteria 1680
579 Ga0500590_002173 3300053148 Bacteria 8540
580 Ga0500604_0036747 3300053151 Bacteria 1462
581 Ga0500616_0000647 3300053153 Bacteria 41713
582 Ga0500616_0009508 3300053153 Bacteria 5909
583 Ga0500616_0012009 3300053153 Bacteria 5086
584 Ga0500622_0000158 3300053156 Bacteria 71215
585 Ga0500622_0000178 3300053156 Bacteria 69024
586 Ga0500622_0045442 3300053156 Bacteria 2274
587 Ga0500624_000357 3300053157 Bacteria 14815
588 Ga0500634_0003706 3300053161 Bacteria 6888
589 Ga0500634_0014441 3300053161 Bacteria 4168
590 Ga0500636_0000019 3300053177 Bacteria 105042
591 Ga0500636_0021661 3300053177 Bacteria 3805
592 Ga0500636_0130267 3300053177 Bacteria 1402
593 Ga0500645_006311 3300053730 Bacteria 4248
594 Ga0466962_0161383 3300061719 Bacteria 1089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0158611 Ga0496101_0158611_1092_1724 206
2 3300046492 Ga0495585_0154377 Ga0495585_0154377_41_754 207
3 3300046615 Ga0495656_0114943 Ga0495656_0114943_338_1051 207
4 3300047470 Ga0495681_0134841 Ga0495681_0134841_187_900 207
5 3300003792 Ga0055540_1000686 Ga0055540_10006864 211
6 3300025273 Ga0209673_1001650 Ga0209673_10016503 211
7 3300025298 Ga0209050_1012453 Ga0209050_10124534 211
8 3300025303 Ga0209051_1000166 Ga0209051_100016656 211
9 3300025304 Ga0209257_1007958 Ga0209257_10079582 211
10 3300041494 Ga0451837_0828149 Ga0451837_0828149_260_976 211
11 3300041509 Ga0451843_1192327 Ga0451843_1192327_285_1001 211
12 3300046492 Ga0495585_0007121 Ga0495585_0007121_3895_4611 211
13 3300046558 Ga0495633_0009195 Ga0495633_0009195_1027_1743 211
14 3300046615 Ga0495656_0037380 Ga0495656_0037380_1256_1972 211
15 3300046660 Ga0495625_0433883 Ga0495625_0433883_34_750 211
16 3300050496 nmdc:mga07m45_104795_c1 nmdc:mga07m45_104795_c1_428_1144 211
17 3300003354 JGI25160J50197_1003515 JGI25160J50197_10035154 212
18 3300003374 JGI25161J50226_1005882 JGI25161J50226_10058822 212
19 3300004625 Ga0055543_1000697 Ga0055543_10006974 212
20 3300005262 Ga0065165_1005539 Ga0065165_10055398 212
21 3300009765 Ga0123341_1000001 Ga0123341_1000001167 212
22 3300009766 Ga0123342_1011798 Ga0123342_10117984 212
23 3300025284 Ga0209130_1011278 Ga0209130_10112783 212
24 3300025302 Ga0207426_1000094 Ga0207426_1000094133 212
25 3300028794 Ga0307515_10028376 Ga0307515_100283764 212
26 3300041498 Ga0451841_0681211 Ga0451841_0681211_1474_2190 212
27 3300041507 Ga0451851_0518653 Ga0451851_0518653_470_1186 212
28 3300002773 JGI25152J39213_1006755 JGI25152J39213_10067552 213
29 3300003187 JGI25151J46595_10000815 JGI25151J46595_100008154 213
30 3300003215 JGI25153J46596_10012299 JGI25153J46596_100122992 213
31 3300003771 Ga0055526_1001096 Ga0055526_100109615 213
32 3300003775 Ga0055524_1006222 Ga0055524_10062224 213
33 3300003790 Ga0055528_1006740 Ga0055528_10067404 213
34 3300003792 Ga0055540_1022749 Ga0055540_10227492 213
35 3300006038 Ga0075365_10022518 Ga0075365_100225184 213
36 3300006177 Ga0075362_10008465 Ga0075362_100084651 213
37 3300006178 Ga0075367_10018301 Ga0075367_100183014 213
38 3300006186 Ga0075369_10008603 Ga0075369_100086032 213
39 3300006195 Ga0075366_10012712 Ga0075366_100127124 213
40 3300006353 Ga0075370_10001685 Ga0075370_100016854 213
41 3300025258 Ga0209129_1000470 Ga0209129_100047011 213
42 3300025273 Ga0209673_1001478 Ga0209673_100147821 213
43 3300025291 Ga0209675_1034570 Ga0209675_10345701 213
44 3300025294 Ga0209025_1000097 Ga0209025_1000097136 213
45 3300025295 Ga0209564_1001522 Ga0209564_100152222 213
46 3300025297 Ga0209758_1001887 Ga0209758_100188712 213
47 3300025299 Ga0209256_1007449 Ga0209256_10074494 213
48 3300025303 Ga0209051_1022564 Ga0209051_10225641 213
49 3300041441 Ga0451787_369841 Ga0451787_369841_529_1245 213
50 3300041491 Ga0451833_0522372 Ga0451833_0522372_1769_2485 213
51 3300041492 Ga0451835_0463921 Ga0451835_0463921_42_758 213
52 3300041494 Ga0451837_1750527 Ga0451837_1750527_168_884 213
53 3300041496 Ga0451839_0836255 Ga0451839_0836255_322_1038 213
54 3300041503 Ga0451847_0071726 Ga0451847_0071726_1769_2485 213
55 3300041505 Ga0451849_0877291 Ga0451849_0877291_396_1112 213
56 3300041511 Ga0451855_1639532 Ga0451855_1639532_263_979 213
57 3300041512 Ga0451853_3126023 Ga0451853_3126023_1560_2276 213
58 3300046471 Ga0495650_0040269 Ga0495650_0040269_914_1630 213
59 3300046474 Ga0495605_0060324 Ga0495605_0060324_864_1580 213
60 3300046501 Ga0495607_0047769 Ga0495607_0047769_945_1661 213
61 3300046512 Ga0495610_0015334 Ga0495610_0015334_2483_3199 213
62 3300046515 Ga0495620_0196587 Ga0495620_0196587_15_731 213
63 3300046518 Ga0495631_0087059 Ga0495631_0087059_74_790 213
64 3300046524 Ga0495648_0146879 Ga0495648_0146879_125_841 213
65 3300046538 Ga0495609_0132233 Ga0495609_0132233_170_886 213
66 3300046660 Ga0495625_0156417 Ga0495625_0156417_135_851 213
67 3300047447 Ga0495685_075215 Ga0495685_075215_191_907 213
68 3300047472 Ga0495686_0042156 Ga0495686_0042156_1718_2434 213
69 3300050489 nmdc:mga03683_6075_c1 nmdc:mga03683_6075_c1_1248_1964 213
70 3300050491 nmdc:mga00v17_359833_c1 nmdc:mga00v17_359833_c1_52_768 213
71 3300050492 nmdc:mga0yw44_47486_c1 nmdc:mga0yw44_47486_c1_771_1487 213
72 3300050493 nmdc:mga0k408_18899_c1 nmdc:mga0k408_18899_c1_503_1219 213
73 3300050494 nmdc:mga06z11_12486_c1 nmdc:mga06z11_12486_c1_2806_3522 213
74 3300050496 nmdc:mga07m45_114960_c1 nmdc:mga07m45_114960_c1_195_911 213
75 3300050516 nmdc:mga0sz30_608_c1 nmdc:mga0sz30_608_c1_9252_9968 213
76 3300053093 Ga0500651_0287298 Ga0500651_0287298_27_743 213
77 3300053118 Ga0500594_0006450 Ga0500594_0006450_71_787 213
78 3300053134 Ga0500658_0008546 Ga0500658_0008546_1826_2542 213
79 3300003215 JGI25153J46596_10015293 JGI25153J46596_100152934 214
80 3300003790 Ga0055528_1016752 Ga0055528_10167521 214
81 3300025297 Ga0209758_1009909 Ga0209758_10099091 214
82 3300025303 Ga0209051_1020252 Ga0209051_10202522 214
83 3300046506 Ga0495583_0116291 Ga0495583_0116291_134_850 214
84 3300046507 Ga0495606_0008208 Ga0495606_0008208_7092_7808 214
85 3300046512 Ga0495610_0023054 Ga0495610_0023054_342_1058 214
86 3300046513 Ga0495616_0019776 Ga0495616_0019776_2232_2948 214
87 3300046515 Ga0495620_0074080 Ga0495620_0074080_440_1156 214
88 3300046522 Ga0495643_0019352 Ga0495643_0019352_1787_2503 214
89 3300046616 Ga0495668_0054907 Ga0495668_0054907_914_1630 214
90 3300046694 Ga0495649_0039542 Ga0495649_0039542_1455_2171 214
91 3300046810 Ga0495660_0016959 Ga0495660_0016959_28_744 214
92 3300047470 Ga0495681_0128055 Ga0495681_0128055_81_797 214
93 3300048090 Ga0495615_0006985 Ga0495615_0006985_11_727 214
94 3300048091 Ga0495626_0114723 Ga0495626_0114723_291_1007 214
95 3300050490 nmdc:mga03n38_85537_c1 nmdc:mga03n38_85537_c1_484_1200 214
96 3300053086 Ga0500578_0012419 Ga0500578_0012419_2994_3710 214
97 3300053153 Ga0500616_0012009 Ga0500616_0012009_3901_4617 214
98 3300046460 Ga0495638_0000687 Ga0495638_0000687_22182_22901 215
99 3300053098 Ga0500650_0098987 Ga0500650_0098987_462_1181 215
100 3300053730 Ga0500645_006311 Ga0500645_006311_2814_3533 215
101 3300031456 Ga0307513_10010898 Ga0307513_100108982 216
102 3300048925 Ga0496122_0391887 Ga0496122_0391887_15_683 216
103 3300031911 Ga0307412_10005856 Ga0307412_100058565 217
104 3300048919 Ga0496116_0014662 Ga0496116_0014662_482_1213 218
105 3300046507 Ga0495606_0200068 Ga0495606_0200068_199_915 219
106 3300046512 Ga0495610_0004461 Ga0495610_0004461_3169_3885 219
107 3300046515 Ga0495620_0030783 Ga0495620_0030783_1621_2337 219
108 3300047472 Ga0495686_0005762 Ga0495686_0005762_3169_3885 219
109 3300049581 Ga0501047_0144091 Ga0501047_0144091_144_872 219
110 3300049744 Ga0501083_0053639 Ga0501083_0053639_1450_2178 219
111 iso_pu_bacteria 8018150411 8018155727 219
112 iso_pu_bacteria 8056875544 8056876705 219
113 3300048920 Ga0496117_0147783 Ga0496117_0147783_483_1205 220
114 iso_pu_bacteria 2643221558 2643812128 220
115 3300041413 Ga0439465_0012104 Ga0439465_0012104_619_1332 221
116 3300042007 Ga0439449_0050844 Ga0439449_0050844_125_838 221
117 3300046674 Ga0495588_0266034 Ga0495588_0266034_207_893 221
118 iso_pu_bacteria 2510917026 2511171701 221
119 iso_pu_bacteria 2585427633 2585995509 221
120 iso_pu_bacteria 2585427634 2586000111 221
121 iso_pu_bacteria 2818991461 2819683706 221
122 iso_pu_bacteria 2854896431 2854901936 221
123 iso_pu_bacteria 2854916844 2854920297 221
124 iso_pu_bacteria 2919171160 2919175460 221
125 3300047472 Ga0495686_0000989 Ga0495686_0000989_18203_18940 222
126 3300048929 Ga0496126_0805254 Ga0496126_0805254_29_709 222
127 iso_pu_bacteria 2582581307 2585272901 222
128 iso_pu_bacteria 2585427609 2585904821 222
129 iso_pu_bacteria 2585428125 2587980063 222
130 3300003215 JGI25153J46596_10037690 JGI25153J46596_100376902 223
131 3300003781 Ga0055536_1005470 Ga0055536_10054706 223
132 3300003791 Ga0055530_10010741 Ga0055530_100107413 223
133 3300003792 Ga0055540_1007390 Ga0055540_10073905 223
134 3300003794 Ga0055531_10011759 Ga0055531_100117595 223
135 3300025292 Ga0209676_1002990 Ga0209676_10029908 223
136 3300025297 Ga0209758_1000520 Ga0209758_100052048 223
137 3300025298 Ga0209050_1007097 Ga0209050_10070974 223
138 3300025303 Ga0209051_1006111 Ga0209051_10061115 223
139 3300025304 Ga0209257_1006544 Ga0209257_10065444 223
140 3300031731 Ga0307405_10484736 Ga0307405_104847362 223
141 3300037471 Ga0395905_0031030 Ga0395905_0031030_1735_2409 223
142 3300048909 Ga0496106_0209380 Ga0496106_0209380_167_883 223
143 3300053139 Ga0500568_0004078 Ga0500568_0004078_5672_6391 223
144 3300053153 Ga0500616_0000647 Ga0500616_0000647_10844_11560 223
145 3300053153 Ga0500616_0009508 Ga0500616_0009508_3667_4386 223
146 3300005262 Ga0065165_1003401 Ga0065165_10034014 224
147 3300013100 Ga0157373_10019768 Ga0157373_100197681 224
148 3300013105 Ga0157369_10096669 Ga0157369_100966692 224
149 3300046501 Ga0495607_0030149 Ga0495607_0030149_1293_2006 224
150 3300048919 Ga0496116_0083738 Ga0496116_0083738_1142_1861 224
151 3300048926 Ga0496123_0136438 Ga0496123_0136438_489_1208 224
152 3300053104 Ga0500556_0026043 Ga0500556_0026043_541_1248 224
153 3300053104 Ga0500556_0110901 Ga0500556_0110901_78_797 224
154 3300053133 Ga0500655_023103 Ga0500655_023103_336_1043 224
155 iso_pu_bacteria 2600254933 2600375557 224
156 iso_pu_bacteria 2995392953 2995393252 224
157 3300046452 Ga0495617_014159 Ga0495617_014159_958_1677 225
158 3300046474 Ga0495605_0000460 Ga0495605_0000460_13768_14487 225
159 3300046492 Ga0495585_0012342 Ga0495585_0012342_1753_2472 225
160 3300046501 Ga0495607_0054177 Ga0495607_0054177_1003_1722 225
161 3300046506 Ga0495583_0006923 Ga0495583_0006923_5198_5917 225
162 3300046515 Ga0495620_0028354 Ga0495620_0028354_450_1169 225
163 3300046518 Ga0495631_0000390 Ga0495631_0000390_7626_8345 225
164 3300046519 Ga0495632_0012498 Ga0495632_0012498_514_1233 225
165 3300046616 Ga0495668_0006370 Ga0495668_0006370_5464_6183 225
166 3300046660 Ga0495625_0017845 Ga0495625_0017845_2114_2833 225
167 3300046810 Ga0495660_0087535 Ga0495660_0087535_723_1442 225
168 3300047443 Ga0495687_074887 Ga0495687_074887_412_1098 225
169 3300048925 Ga0496122_0000179 Ga0496122_0000179_141930_142646 225
170 3300048926 Ga0496123_0000768 Ga0496123_0000768_44497_45213 225
171 3300048927 Ga0496124_0152976 Ga0496124_0152976_174_890 225
172 3300049459 Ga0495678_011156 Ga0495678_011156_1673_2392 225
173 3300053079 Ga0500610_0030088 Ga0500610_0030088_298_1017 225
174 3300053086 Ga0500578_0202450 Ga0500578_0202450_11_730 225
175 3300053105 Ga0500557_004940 Ga0500557_004940_1738_2457 225
176 3300053109 Ga0500569_002509 Ga0500569_002509_539_1258 225
177 3300053118 Ga0500594_0004053 Ga0500594_0004053_811_1530 225
178 3300053142 Ga0500577_0041426 Ga0500577_0041426_497_1216 225
179 3300006048 Ga0075363_100178632 Ga0075363_1001786322 226
180 3300006353 Ga0075370_10064070 Ga0075370_100640701 226
181 3300047470 Ga0495681_0137155 Ga0495681_0137155_170_868 226
182 iso_pu_bacteria 2509276021 2509387282 226
183 iso_pu_bacteria 2558860983 2561468938 226
184 iso_pu_bacteria 2643221568 2643854467 226
185 iso_pu_bacteria 2841846520 2841848115 226
186 iso_pu_bacteria 2842170452 2842171285 226
187 iso_pu_bacteria 2842187318 2842188150 226
188 iso_pu_bacteria 2842211629 2842212461 226
189 iso_pu_bacteria 2842224351 2842225920 226
190 iso_pu_bacteria 2842341865 2842347054 226
191 iso_pu_bacteria 2919114240 2919115133 226
192 iso_pu_bacteria 2919166419 2919168803 226
193 iso_pu_bacteria 2926754445 2926756178 226
194 iso_pu_bacteria 2978969890 2978971490 226
195 iso_pu_bacteria 2984587000 2984588634 226
196 iso_pu_bacteria 8003570095 8003571231 226
197 iso_pu_bacteria 8054460903 8054462235 226
198 3300003187 JGI25151J46595_10006807 JGI25151J46595_100068077 227
199 3300021320 Ga0214544_1000024 Ga0214544_1000024112 227
200 3300021321 Ga0214542_1000015 Ga0214542_100001597 227
201 3300021327 Ga0214543_1000064 Ga0214543_1000064137 227
202 3300025294 Ga0209025_1000320 Ga0209025_100032065 227
203 3300032004 Ga0307414_10019944 Ga0307414_100199443 227
204 iso_pu_bacteria 2519899620 2520376248 227
205 iso_pu_bacteria 2537561587 2537875963 227
206 iso_pu_bacteria 2582581304 2585254270 227
207 iso_pu_bacteria 2599185210 2599604175 227
208 iso_pu_bacteria 2600255279 2601608032 227
209 iso_pu_bacteria 2600255308 2601744807 227
210 iso_pu_bacteria 2615840624 2616292923 227
211 iso_pu_bacteria 2643221582 2643919405 227
212 iso_pu_bacteria 2718217882 2719180660 227
213 iso_pu_bacteria 2718217997 2719665091 227
214 iso_pu_bacteria 2718218009 2719731409 227
215 iso_pu_bacteria 2718218199 2720491511 227
216 iso_pu_bacteria 2718218232 2720612805 227
217 iso_pu_bacteria 2718218233 2720619656 227
218 iso_pu_bacteria 2718218235 2720631096 227
219 iso_pu_bacteria 2718218269 2720774823 227
220 iso_pu_bacteria 2718218363 2721146754 227
221 iso_pu_bacteria 2718218365 2721158277 227
222 iso_pu_bacteria 2718218366 2721163633 227
223 iso_pu_bacteria 2721755514 2722839803 227
224 iso_pu_bacteria 2721755556 2723026459 227
225 iso_pu_bacteria 2721755684 2723560001 227
226 iso_pu_bacteria 2721755685 2723566622 227
227 iso_pu_bacteria 2721755810 2724044165 227
228 iso_pu_bacteria 2721755819 2724089430 227
229 iso_pu_bacteria 2721755822 2724103887 227
230 iso_pu_bacteria 2721755823 2724109725 227
231 iso_pu_bacteria 2728369352 2730107395 227
232 iso_pu_bacteria 2728369365 2730163897 227
233 iso_pu_bacteria 2728369397 2730297909 227
234 iso_pu_bacteria 2791355253 2793279532 227
235 iso_pu_bacteria 2791355256 2793297039 227
236 iso_pu_bacteria 2791355260 2793321353 227
237 iso_pu_bacteria 2791355261 2793330014 227
238 iso_pu_bacteria 2791355262 2793335233 227
239 iso_pu_bacteria 2791355264 2793350410 227
240 iso_pu_bacteria 2791355265 2793352144 227
241 iso_pu_bacteria 2802429605 2805930050 227
242 iso_pu_bacteria 2802429606 2805934944 227
243 iso_pu_bacteria 2818991439 2819559749 227
244 iso_pu_bacteria 2838016132 2838018618 227
245 iso_pu_bacteria 2838022645 2838022688 227
246 iso_pu_bacteria 2838048938 2838052298 227
247 iso_pu_bacteria 2838061910 2838066467 227
248 iso_pu_bacteria 2838068647 2838071224 227
249 iso_pu_bacteria 2838668709 2838669865 227
250 iso_pu_bacteria 2838675328 2838676160 227
251 iso_pu_bacteria 2838701080 2838702237 227
252 iso_pu_bacteria 2838714209 2838715042 227
253 iso_pu_bacteria 2838719591 2838721158 227
254 iso_pu_bacteria 2838724970 2838725801 227
255 iso_pu_bacteria 2841859092 2841859334 227
256 iso_pu_bacteria 2842124991 2842125855 227
257 iso_pu_bacteria 2842130223 2842131054 227
258 iso_pu_bacteria 2842146304 2842147218 227
259 iso_pu_bacteria 2842152218 2842153776 227
260 iso_pu_bacteria 2842175837 2842177396 227
261 iso_pu_bacteria 2842192696 2842197166 227
262 iso_pu_bacteria 2842198810 2842201485 227
263 iso_pu_bacteria 2842205361 2842206569 227
264 iso_pu_bacteria 2842250916 2842252283 227
265 iso_pu_bacteria 2842264693 2842268593 227
266 iso_pu_bacteria 2842278818 2842280026 227
267 iso_pu_bacteria 2842285085 2842287655 227
268 iso_pu_bacteria 2842311132 2842315282 227
269 iso_pu_bacteria 2842317721 2842318413 227
270 iso_pu_bacteria 2842402390 2842404816 227
271 iso_pu_bacteria 2842409023 2842411399 227
272 iso_pu_bacteria 2842415677 2842418150 227
273 iso_pu_bacteria 2842422224 2842425120 227
274 iso_pu_bacteria 2842428310 2842432726 227
275 iso_pu_bacteria 2842434925 2842439031 227
276 iso_pu_bacteria 2842441272 2842445660 227
277 iso_pu_bacteria 2842447887 2842451597 227
278 iso_pu_bacteria 2842462802 2842466988 227
279 iso_pu_bacteria 2842469257 2842473645 227
280 iso_pu_bacteria 2842489311 2842494455 227
281 iso_pu_bacteria 2842495871 2842500612 227
282 iso_pu_bacteria 2842515876 2842516118 227
283 iso_pu_bacteria 2891373044 2891377374 227
284 iso_pu_bacteria 2899792073 2899794192 227
285 iso_pu_bacteria 2929138655 2929139809 227
286 iso_pu_bacteria 2933006813 2933008422 227
287 iso_pu_bacteria 2933011516 2933013238 227
288 iso_pu_bacteria 2933594066 2933597927 227
289 iso_pu_bacteria 2933599457 2933602023 227
290 iso_pu_bacteria 2979100975 2979103548 227
291 iso_pu_bacteria 2984509177 2984511884 227
292 iso_pu_bacteria 2984518228 2984521756 227
293 iso_pu_bacteria 2984537506 2984541053 227
294 iso_pu_bacteria 2984601300 2984603334 227
295 iso_pu_bacteria 2989349275 2989352858 227
296 iso_pu_bacteria 2996893221 2996893903 227
297 iso_pu_bacteria 3005409236 3005412938 227
298 iso_pu_bacteria 3005445848 3005447097 227
299 iso_pu_bacteria 8005282627 8005284138 227
300 iso_pu_bacteria 8005289223 8005294649 227
301 iso_pu_bacteria 8005301065 8005307177 227
302 iso_pu_bacteria 8005382845 8005384896 227
303 iso_pu_bacteria 8005395548 8005398320 227
304 iso_pu_bacteria 8005430974 8005436255 227
305 iso_pu_bacteria 8005497431 8005499757 227
306 iso_pu_bacteria 8005619151 8005620962 227
307 iso_pu_bacteria 8005626139 8005627436 227
308 iso_pu_bacteria 8005668836 8005671178 227
309 iso_pu_bacteria 8005688590 8005695087 227
310 iso_pu_bacteria 8018127388 8018128214 227
311 iso_pu_bacteria 8024501048 8024505070 227
312 iso_pu_bacteria 8055431914 8055435876 227
313 iso_pu_bacteria 8056382006 8056387701 227
314 3300041411 Ga0439466_0033713 Ga0439466_0033713_985_1689 228
315 3300044706 Ga0466964_0068753 Ga0466964_0068753_761_1453 228
316 3300046660 Ga0495625_0256161 Ga0495625_0256161_248_946 228
317 3300046694 Ga0495649_0135528 Ga0495649_0135528_160_858 228
318 3300053177 Ga0500636_0021661 Ga0500636_0021661_1779_2501 228
319 iso_pu_bacteria 2510065057 2510306260 228
320 iso_pu_bacteria 2511231052 2511501441 228
321 iso_pu_bacteria 2513237086 2513583107 228
322 iso_pu_bacteria 2513237091 2513617895 228
323 iso_pu_bacteria 2513237140 2513884881 228
324 iso_pu_bacteria 2513237143 2513905894 228
325 iso_pu_bacteria 2515154107 2515611419 228
326 iso_pu_bacteria 2516143018 2516209308 228
327 iso_pu_bacteria 2516653046 2516892720 228
328 iso_pu_bacteria 2524023207 2524452939 228
329 iso_pu_bacteria 2551306084 2551674188 228
330 iso_pu_bacteria 2551306084 2551680340 228
331 iso_pu_bacteria 2551306085 2551687051 228
332 iso_pu_bacteria 2551306086 2551696899 228
333 iso_pu_bacteria 2551306087 2551697748 228
334 iso_pu_bacteria 2551306089 2551715366 228
335 iso_pu_bacteria 2551306090 2551720726 228
336 iso_pu_bacteria 2551306091 2551724705 228
337 iso_pu_bacteria 2551306092 2551733230 228
338 iso_pu_bacteria 2551306093 2551740230 228
339 iso_pu_bacteria 2690316117 2692316366 228
340 iso_pu_bacteria 2791355091 2792623142 228
341 iso_pu_bacteria 2791355092 2792626906 228
342 iso_pu_bacteria 2821123053 2821129371 228
343 iso_pu_bacteria 2838736955 2838738596 228
344 iso_pu_bacteria 2841840854 2841841035 228
345 iso_pu_bacteria 2842140634 2842140813 228
346 iso_pu_bacteria 2847417321 2847418565 228
347 iso_pu_bacteria 2848992105 2848993543 228
348 iso_pu_bacteria 2855825444 2855825534 228
349 iso_pu_bacteria 2855839649 2855840912 228
350 iso_pu_bacteria 2855872281 2855873830 228
351 iso_pu_bacteria 2857531043 2857535248 228
352 iso_pu_bacteria 2858800743 2858801451 228
353 iso_pu_bacteria 2915986958 2915990098 228
354 iso_pu_bacteria 2915993759 2915998453 228
355 iso_pu_bacteria 2916000859 2916004402 228
356 iso_pu_bacteria 2916007675 2916012146 228
357 iso_pu_bacteria 2916014648 2916015216 228
358 iso_pu_bacteria 2916021584 2916024683 228
359 iso_pu_bacteria 2916028427 2916033504 228
360 iso_pu_bacteria 2916035215 2916041741 228
361 iso_pu_bacteria 2916041962 2916044145 228
362 iso_pu_bacteria 2916048683 2916054183 228
363 iso_pu_bacteria 2916055098 2916061699 228
364 iso_pu_bacteria 2916068649 2916073976 228
365 iso_pu_bacteria 2916076590 2916079810 228
366 iso_pu_bacteria 2921201388 2921206047 228
367 iso_pu_bacteria 2921208531 2921211642 228
368 iso_pu_bacteria 2921237296 2921242768 228
369 iso_pu_bacteria 2921244191 2921246847 228
370 iso_pu_bacteria 2921257292 2921257445 228
371 iso_pu_bacteria 2921263974 2921264668 228
372 iso_pu_bacteria 2921282425 2921284830 228
373 iso_pu_bacteria 2921289301 2921293285 228
374 iso_pu_bacteria 2921296804 2921297896 228
375 iso_pu_bacteria 2924144063 2924146484 228
376 iso_pu_bacteria 2924150972 2924156046 228
377 iso_pu_bacteria 2924158325 2924158986 228
378 iso_pu_bacteria 2924165586 2924170997 228
379 iso_pu_bacteria 2924172951 2924175511 228
380 iso_pu_bacteria 2924179722 2924182242 228
381 iso_pu_bacteria 2924186466 2924189339 228
382 iso_pu_bacteria 2924193448 2924193963 228
383 iso_pu_bacteria 2924193448 2924194001 228
384 iso_pu_bacteria 2924200457 2924202777 228
385 iso_pu_bacteria 2924207177 2924213871 228
386 iso_pu_bacteria 2924214083 2924219094 228
387 iso_pu_bacteria 2924221636 2924224834 228
388 iso_pu_bacteria 2924228884 2924233181 228
389 iso_pu_bacteria 2936996657 2937001263 228
390 iso_pu_bacteria 2937002841 2937004640 228
391 iso_pu_bacteria 2937009748 2937012583 228
392 iso_pu_bacteria 2937016420 2937017037 228
393 iso_pu_bacteria 2937023124 2937029277 228
394 iso_pu_bacteria 2937042894 2937043139 228
395 iso_pu_bacteria 2937049772 2937055647 228
396 iso_pu_bacteria 2937056579 2937057784 228
397 iso_pu_bacteria 2937063883 2937069595 228
398 iso_pu_bacteria 2937071275 2937073465 228
399 iso_pu_bacteria 2937091812 2937092890 228
400 iso_pu_bacteria 2937098957 2937100193 228
401 iso_pu_bacteria 2937106411 2937107436 228
402 iso_pu_bacteria 2937113482 2937118337 228
403 iso_pu_bacteria 2937119839 2937123095 228
404 iso_pu_bacteria 2937126314 2937127949 228
405 iso_pu_bacteria 2957382221 2957384452 228
406 iso_pu_bacteria 2957388812 2957389764 228
407 iso_pu_bacteria 2957395598 2957402118 228
408 iso_pu_bacteria 2957402308 2957405872 228
409 iso_pu_bacteria 2957408893 2957411179 228
410 iso_pu_bacteria 2957415311 2957421424 228
411 iso_pu_bacteria 2957422303 2957428354 228
412 iso_pu_bacteria 2957430029 2957433110 228
413 iso_pu_bacteria 2957443900 2957445528 228
414 iso_pu_bacteria 2957450854 2957456116 228
415 iso_pu_bacteria 2957457609 2957458063 228
416 iso_pu_bacteria 2957464669 2957469938 228
417 iso_pu_bacteria 2957471148 2957474367 228
418 iso_pu_bacteria 2957478035 2957478545 228
419 iso_pu_bacteria 2957484790 2957486881 228
420 iso_pu_bacteria 2957491536 2957494778 228
421 iso_pu_bacteria 2957498199 2957502513 228
422 iso_pu_bacteria 2957505466 2957511753 228
423 iso_pu_bacteria 2960584000 2960587605 228
424 iso_pu_bacteria 2960597568 2960601328 228
425 iso_pu_bacteria 2960603979 2960605368 228
426 iso_pu_bacteria 2960610863 2960616458 228
427 iso_pu_bacteria 2960617483 2960618810 228
428 iso_pu_bacteria 2960624210 2960628613 228
429 iso_pu_bacteria 2960637947 2960645127 228
430 iso_pu_bacteria 2960645483 2960650436 228
431 iso_pu_bacteria 2960652885 2960657541 228
432 iso_pu_bacteria 2960660292 2960665513 228
433 iso_pu_bacteria 2960667422 2960669526 228
434 iso_pu_bacteria 2960674078 2960679758 228
435 iso_pu_bacteria 2960687367 2960688830 228
436 iso_pu_bacteria 2964607997 2964611655 228
437 iso_pu_bacteria 2964615318 2964617530 228
438 iso_pu_bacteria 2964621998 2964625199 228
439 iso_pu_bacteria 2964628898 2964635125 228
440 iso_pu_bacteria 2964636051 2964642302 228
441 iso_pu_bacteria 2964643177 2964645958 228
442 iso_pu_bacteria 2964649959 2964652155 228
443 iso_pu_bacteria 2964656573 2964657493 228
444 iso_pu_bacteria 2964663802 2964665028 228
445 iso_pu_bacteria 2964670856 2964675224 228
446 iso_pu_bacteria 2964678106 2964682428 228
447 iso_pu_bacteria 2964685014 2964688777 228
448 iso_pu_bacteria 2964691889 2964693773 228
449 iso_pu_bacteria 2964698721 2964702958 228
450 iso_pu_bacteria 2964705432 2964709754 228
451 iso_pu_bacteria 2964712639 2964713978 228
452 iso_pu_bacteria 2964719344 2964720778 228
453 iso_pu_bacteria 2967664464 2967667144 228
454 iso_pu_bacteria 2967671571 2967672981 228
455 iso_pu_bacteria 2967678726 2967683830 228
456 iso_pu_bacteria 2967693043 2967693579 228
457 iso_pu_bacteria 2967699805 2967702182 228
458 iso_pu_bacteria 2967706974 2967711638 228
459 iso_pu_bacteria 2967714385 2967715717 228
460 iso_pu_bacteria 2967721400 2967726860 228
461 iso_pu_bacteria 2967735183 2967736446 228
462 iso_pu_bacteria 2967742019 2967746226 228
463 iso_pu_bacteria 2967748971 2967750030 228
464 iso_pu_bacteria 2967755722 2967758073 228
465 iso_pu_bacteria 2967762386 2967763531 228
466 iso_pu_bacteria 2967769361 2967771546 228
467 iso_pu_bacteria 2967775926 2967782016 228
468 iso_pu_bacteria 2970019648 2970023381 228
469 iso_pu_bacteria 2970033650 2970035589 228
470 iso_pu_bacteria 2970040964 2970046777 228
471 iso_pu_bacteria 2970047711 2970052987 228
472 iso_pu_bacteria 2970054988 2970061367 228
473 iso_pu_bacteria 2970061556 2970062436 228
474 iso_pu_bacteria 2970068827 2970072238 228
475 iso_pu_bacteria 2970076120 2970077395 228
476 iso_pu_bacteria 2970082768 2970085166 228
477 iso_pu_bacteria 2970088815 2970091527 228
478 iso_pu_bacteria 2970095765 2970102406 228
479 iso_pu_bacteria 2970102677 2970104256 228
480 iso_pu_bacteria 2970109326 2970113383 228
481 iso_pu_bacteria 2970129317 2970130278 228
482 iso_pu_bacteria 2970136068 2970138380 228
483 iso_pu_bacteria 2970149975 2970153216 228
484 iso_pu_bacteria 2970156795 2970159788 228
485 iso_pu_bacteria 2970164137 2970170511 228
486 iso_pu_bacteria 2970170962 2970175372 228
487 iso_pu_bacteria 2970177841 2970181232 228
488 iso_pu_bacteria 2970184632 2970191571 228
489 iso_pu_bacteria 2970191845 2970193926 228
490 iso_pu_bacteria 2977516862 2977520866 228
491 iso_pu_bacteria 2977523885 2977527331 228
492 iso_pu_bacteria 2977537788 2977540214 228
493 iso_pu_bacteria 2977551784 2977554905 228
494 iso_pu_bacteria 2977558990 2977562499 228
495 iso_pu_bacteria 2977565890 2977568300 228
496 iso_pu_bacteria 2977572785 2977577315 228
497 iso_pu_bacteria 2977579622 2977583625 228
498 iso_pu_bacteria 648276728 648738878 228
499 iso_pu_bacteria 8003992118 8003993405 228
500 3300010375 Ga0105239_10214607 Ga0105239_102146073 229
501 3300028794 Ga0307515_10155270 Ga0307515_101552703 229
502 3300037471 Ga0395905_0000700 Ga0395905_0000700_26514_27206 229
503 3300037471 Ga0395905_0020379 Ga0395905_0020379_1338_2030 229
504 3300046459 Ga0495629_0053403 Ga0495629_0053403_1237_1947 229
505 3300046460 Ga0495638_0035043 Ga0495638_0035043_2401_3093 229
506 3300046663 Ga0495635_0060715 Ga0495635_0060715_705_1415 229
507 3300046675 Ga0495657_0096218 Ga0495657_0096218_989_1699 229
508 3300046683 Ga0495658_0151713 Ga0495658_0151713_539_1249 229
509 3300046690 Ga0495624_0107601 Ga0495624_0107601_324_1034 229
510 3300048909 Ga0496106_0006863 Ga0496106_0006863_6094_6816 229
511 3300048924 Ga0496121_0108884 Ga0496121_0108884_244_936 229
512 3300048924 Ga0496121_0498166 Ga0496121_0498166_18_740 229
513 3300048927 Ga0496124_0045797 Ga0496124_0045797_1532_2248 229
514 3300049570 Ga0501033_0400666 Ga0501033_0400666_13_705 229
515 3300050493 nmdc:mga0k408_150435_c1 nmdc:mga0k408_150435_c1_291_983 229
516 3300053104 Ga0500556_0027354 Ga0500556_0027354_839_1531 229
517 3300053111 Ga0500572_000712 Ga0500572_000712_5195_5926 229
518 3300053121 Ga0500607_133615 Ga0500607_133615_435_1145 229
519 3300053122 Ga0500608_003611 Ga0500608_003611_1682_2374 229
520 3300053139 Ga0500568_0001356 Ga0500568_0001356_13700_14422 229
521 3300053148 Ga0500590_002173 Ga0500590_002173_5265_5975 229
522 3300053156 Ga0500622_0000158 Ga0500622_0000158_43608_44300 229
523 iso_pu_bacteria 2508501122 2509107798 229
524 iso_pu_bacteria 2509276019 2509376195 229
525 iso_pu_bacteria 2512047086 2512532862 229
526 iso_pu_bacteria 2512875026 2512971810 229
527 iso_pu_bacteria 2513237089 2513605203 229
528 iso_pu_bacteria 2513237144 2513909646 229
529 iso_pu_bacteria 2513237146 2513926390 229
530 iso_pu_bacteria 2513237156 2513986681 229
531 iso_pu_bacteria 2513237160 2514005360 229
532 iso_pu_bacteria 2517487022 2517569532 229
533 iso_pu_bacteria 2558860100 2558863063 229
534 iso_pu_bacteria 2582581299 2585232497 229
535 iso_pu_bacteria 2599185156 2599333374 229
536 iso_pu_bacteria 2599185170 2599418181 229
537 iso_pu_bacteria 2599185236 2599721332 229
538 iso_pu_bacteria 2643221557 2643808477 229
539 iso_pu_bacteria 2643221610 2644066430 229
540 iso_pu_bacteria 2643221618 2644109460 229
541 iso_pu_bacteria 2643221626 2644145145 229
542 iso_pu_bacteria 2643221634 2644193190 229
543 iso_pu_bacteria 2643221637 2644211004 229
544 iso_pu_bacteria 2643221655 2644307725 229
545 iso_pu_bacteria 2643221659 2644332501 229
546 iso_pu_bacteria 2643221668 2644378018 229
547 iso_pu_bacteria 2643221675 2644415357 229
548 iso_pu_bacteria 2643221680 2644450242 229
549 iso_pu_bacteria 2643221698 2644544248 229
550 iso_pu_bacteria 2643221712 2644613814 229
551 iso_pu_bacteria 2643221718 2644654659 229
552 iso_pu_bacteria 2643221726 2644687794 229
553 iso_pu_bacteria 2657244999 2657683641 229
554 iso_pu_bacteria 2791355082 2792581135 229
555 iso_pu_bacteria 2791355263 2793342705 229
556 iso_pu_bacteria 2802428858 2802718806 229
557 iso_pu_bacteria 2802428859 2802726417 229
558 iso_pu_bacteria 2802428860 2802732960 229
559 iso_pu_bacteria 2802428861 2802738315 229
560 iso_pu_bacteria 2802428862 2802744647 229
561 iso_pu_bacteria 2802428863 2802751147 229
562 iso_pu_bacteria 2802429268 2804751921 229
563 iso_pu_bacteria 2838035591 2838041121 229
564 iso_pu_bacteria 2838042994 2838047681 229
565 iso_pu_bacteria 2838074704 2838079389 229
566 iso_pu_bacteria 2838661181 2838663169 229
567 iso_pu_bacteria 2842922631 2842925219 229
568 iso_pu_bacteria 2844163670 2844170335 229
569 iso_pu_bacteria 2850079185 2850080866 229
570 iso_pu_bacteria 2896384573 2896387055 229
571 iso_pu_bacteria 2899845264 2899846509 229
572 iso_pu_bacteria 2913295892 2913300509 229
573 iso_pu_bacteria 2915980308 2915985274 229
574 iso_pu_bacteria 2916061851 2916062383 229
575 iso_pu_bacteria 2920760137 2920765642 229
576 iso_pu_bacteria 2921250672 2921253921 229
577 iso_pu_bacteria 2926760298 2926760410 229
578 iso_pu_bacteria 2933016740 2933021301 229
579 iso_pu_bacteria 2936381700 2936384691 229
580 iso_pu_bacteria 2937029754 2937031249 229
581 iso_pu_bacteria 2937036028 2937038506 229
582 iso_pu_bacteria 2937078374 2937080043 229
583 iso_pu_bacteria 2937084907 2937085395 229
584 iso_pu_bacteria 2941499720 2941499759 229
585 iso_pu_bacteria 2957375807 2957378641 229
586 iso_pu_bacteria 2957437181 2957439221 229
587 iso_pu_bacteria 2960591022 2960596209 229
588 iso_pu_bacteria 2960631154 2960632716 229
589 iso_pu_bacteria 2960680706 2960686905 229
590 iso_pu_bacteria 2960693952 2960695917 229
591 iso_pu_bacteria 2967686174 2967687295 229
592 iso_pu_bacteria 2967728569 2967734346 229
593 iso_pu_bacteria 2970026789 2970029318 229
594 iso_pu_bacteria 2970122695 2970124659 229
595 iso_pu_bacteria 2970143518 2970144161 229
596 iso_pu_bacteria 2977530762 2977534976 229
597 iso_pu_bacteria 2977544691 2977547666 229
598 iso_pu_bacteria 3003930520 3003933290 229
599 iso_pu_bacteria 643692032 643825573 229
600 iso_pu_bacteria 8003999396 8004000662 229
601 iso_pu_bacteria 8049293176 8049294455 229
602 3300028794 Ga0307515_10000656 Ga0307515_1000065659 230
603 3300031456 Ga0307513_10186520 Ga0307513_101865202 230
604 3300046460 Ga0495638_0010984 Ga0495638_0010984_4599_5303 230
605 3300046471 Ga0495650_0074104 Ga0495650_0074104_240_941 230
606 3300046507 Ga0495606_0154450 Ga0495606_0154450_505_1200 230
607 3300048919 Ga0496116_0000061 Ga0496116_0000061_66209_66943 230
608 3300048921 Ga0496118_0245624 Ga0496118_0245624_103_834 230
609 3300048925 Ga0496122_0026243 Ga0496122_0026243_2055_2786 230
610 3300048926 Ga0496123_0142564 Ga0496123_0142564_480_1214 230
611 3300048929 Ga0496126_0000397 Ga0496126_0000397_25953_26684 230
612 3300053096 Ga0500641_0230734 Ga0500641_0230734_15_752 230
613 3300053125 Ga0500618_000510 Ga0500618_000510_10594_11313 230
614 3300053139 Ga0500568_0108497 Ga0500568_0108497_104_808 230
615 3300053177 Ga0500636_0000019 Ga0500636_0000019_75762_76493 230
616 iso_pu_bacteria 2509276033 2509442682 230
617 iso_pu_bacteria 2510065019 2510132773 230
618 iso_pu_bacteria 2510461076 2510894059 230
619 iso_pu_bacteria 2510461076 2510899084 230
620 iso_pu_bacteria 2510917028 2511181966 230
621 iso_pu_bacteria 2513237084 2513570136 230
622 iso_pu_bacteria 2513237085 2513575401 230
623 iso_pu_bacteria 2513237088 2513598050 230
624 iso_pu_bacteria 2513237093 2513632914 230
625 iso_pu_bacteria 2513237103 2513710354 230
626 iso_pu_bacteria 2513237138 2513869895 230
627 iso_pu_bacteria 2513237162 2514019763 230
628 iso_pu_bacteria 2515075009 2515111718 230
629 iso_pu_bacteria 2515154113 2515634792 230
630 iso_pu_bacteria 2515154114 2515642040 230
631 iso_pu_bacteria 2515154116 2515656104 230
632 iso_pu_bacteria 2515154134 2515739195 230
633 iso_pu_bacteria 2516653077 2517040410 230
634 iso_pu_bacteria 2516653085 2517075895 230
635 iso_pu_bacteria 2517093000 2517094481 230
636 iso_pu_bacteria 2517287029 2517406272 230
637 iso_pu_bacteria 2529292951 2530645011 230
638 iso_pu_bacteria 2534681796 2535516078 230
639 iso_pu_bacteria 2582581294 2585199796 230
640 iso_pu_bacteria 2582581867 2585400624 230
641 iso_pu_bacteria 2585427526 2585528835 230
642 iso_pu_bacteria 2585427528 2585540256 230
643 iso_pu_bacteria 2585427590 2585819818 230
644 iso_pu_bacteria 2585427593 2585838454 230
645 iso_pu_bacteria 2585427608 2585897585 230
646 iso_pu_bacteria 2599185352 2600192396 230
647 iso_pu_bacteria 2643221643 2644238204 230
648 iso_pu_bacteria 2643221723 2644677971 230
649 iso_pu_bacteria 2718217927 2719385265 230
650 iso_pu_bacteria 2718218423 2721398986 230
651 iso_pu_bacteria 2721755809 2724037799 230
652 iso_pu_bacteria 2724679232 2725951737 230
653 iso_pu_bacteria 2738541333 2739037896 230
654 iso_pu_bacteria 2765235942 2766068040 230
655 iso_pu_bacteria 2791355259 2793315611 230
656 iso_pu_bacteria 2791355266 2793360494 230
657 iso_pu_bacteria 2791355267 2793366293 230
658 iso_pu_bacteria 2802429633 2806045646 230
659 iso_pu_bacteria 2802429634 2806053700 230
660 iso_pu_bacteria 2802429635 2806060900 230
661 iso_pu_bacteria 2802429636 2806067775 230
662 iso_pu_bacteria 2802429637 2806072873 230
663 iso_pu_bacteria 2838680041 2838682755 230
664 iso_pu_bacteria 2838686498 2838693250 230
665 iso_pu_bacteria 2838694306 2838697389 230
666 iso_pu_bacteria 2838707686 2838709433 230
667 iso_pu_bacteria 2838729681 2838736112 230
668 iso_pu_bacteria 2838742623 2838748895 230
669 iso_pu_bacteria 2841851746 2841858231 230
670 iso_pu_bacteria 2841864319 2841865061 230
671 iso_pu_bacteria 2842077413 2842077544 230
672 iso_pu_bacteria 2842110456 2842111052 230
673 iso_pu_bacteria 2842118031 2842119947 230
674 iso_pu_bacteria 2842156927 2842163070 230
675 iso_pu_bacteria 2842163707 2842165148 230
676 iso_pu_bacteria 2842180545 2842186702 230
677 iso_pu_bacteria 2842217011 2842220476 230
678 iso_pu_bacteria 2842229732 2842235975 230
679 iso_pu_bacteria 2842237096 2842238846 230
680 iso_pu_bacteria 2842243621 2842249834 230
681 iso_pu_bacteria 2842257432 2842263805 230
682 iso_pu_bacteria 2842271015 2842277718 230
683 iso_pu_bacteria 2842291075 2842291206 230
684 iso_pu_bacteria 2842304105 2842310331 230
685 iso_pu_bacteria 2842363717 2842366886 230
686 iso_pu_bacteria 2842370503 2842373385 230
687 iso_pu_bacteria 2842377471 2842377602 230
688 iso_pu_bacteria 2842384541 2842386457 230
689 iso_pu_bacteria 2842395702 2842399646 230
690 iso_pu_bacteria 2844454524 2844454617 230
691 iso_pu_bacteria 2857516855 2857523032 230
692 iso_pu_bacteria 2891048133 2891052294 230
693 iso_pu_bacteria 2899803654 2899807422 230
694 iso_pu_bacteria 2920822456 2920824286 230
695 iso_pu_bacteria 2923556063 2923558244 230
696 iso_pu_bacteria 2933570622 2933576771 230
697 iso_pu_bacteria 2933586486 2933587077 230
698 iso_pu_bacteria 2935894831 2935900477 230
699 iso_pu_bacteria 2935901341 2935904983 230
700 iso_pu_bacteria 2936367885 2936373321 230
701 iso_pu_bacteria 2936375103 2936378587 230
702 iso_pu_bacteria 2996887358 2996892331 230
703 iso_pu_bacteria 639633055 639647927 230
704 iso_pu_bacteria 8005258706 8005259613 230
705 iso_pu_bacteria 8005275841 8005280071 230
706 iso_pu_bacteria 8005307578 8005314777 230
707 iso_pu_bacteria 8005321885 8005326858 230
708 iso_pu_bacteria 8005376324 8005378648 230
709 iso_pu_bacteria 8005460587 8005462374 230
710 iso_pu_bacteria 8005542996 8005544752 230
711 iso_pu_bacteria 8005556819 8005558260 230
712 iso_pu_bacteria 8005563573 8005569441 230
713 iso_pu_bacteria 8005570704 8005575293 230
714 iso_pu_bacteria 8005658619 8005659168 230
715 iso_pu_bacteria 8005695170 8005696316 230
716 iso_pu_bacteria 8018163183 8018167949 230
717 iso_pu_bacteria 8018176218 8018177837 230
718 iso_pu_bacteria 8023680758 8023680827 230
719 iso_pu_bacteria 8024479707 8024485600 230
720 iso_pu_bacteria 8056375014 8056380003 230
721 iso_pu_bacteria 8057874678 8057875640 230
722 3300002773 JGI25152J39213_1004759 JGI25152J39213_10047594 231
723 3300002774 JGI25150J39212_1007407 JGI25150J39212_10074073 231
724 3300003187 JGI25151J46595_10033585 JGI25151J46595_100335852 231
725 3300003215 JGI25153J46596_10010532 JGI25153J46596_100105324 231
726 3300003771 Ga0055526_1013553 Ga0055526_10135534 231
727 3300003775 Ga0055524_1009498 Ga0055524_10094986 231
728 3300003775 Ga0055524_1032285 Ga0055524_10322852 231
729 3300003790 Ga0055528_1003583 Ga0055528_10035835 231
730 3300003790 Ga0055528_1004819 Ga0055528_10048191 231
731 3300003792 Ga0055540_1002249 Ga0055540_10022499 231
732 3300003856 Ga0058692_1007736 Ga0058692_10077361 231
733 3300005548 Ga0070665_100680142 Ga0070665_1006801421 231
734 3300006038 Ga0075365_10187024 Ga0075365_101870242 231
735 3300006051 Ga0075364_10060068 Ga0075364_100600682 231
736 3300006051 Ga0075364_10236470 Ga0075364_102364701 231
737 3300006051 Ga0075364_10424198 Ga0075364_104241982 231
738 3300006178 Ga0075367_10045558 Ga0075367_100455584 231
739 3300006186 Ga0075369_10070470 Ga0075369_100704701 231
740 3300006946 Ga0079104_1000129 Ga0079104_100012994 231
741 3300006948 Ga0099826_10000090 Ga0099826_1000009040 231
742 3300025245 Ga0207425_1001043 Ga0207425_10010439 231
743 3300025258 Ga0209129_1000569 Ga0209129_10005694 231
744 3300025258 Ga0209129_1000947 Ga0209129_100094713 231
745 3300025273 Ga0209673_1000230 Ga0209673_100023023 231
746 3300025294 Ga0209025_1000702 Ga0209025_100070213 231
747 3300025294 Ga0209025_1026526 Ga0209025_10265262 231
748 3300025295 Ga0209564_1000137 Ga0209564_1000137237 231
749 3300025297 Ga0209758_1000822 Ga0209758_10008225 231
750 3300025299 Ga0209256_1001971 Ga0209256_10019715 231
751 3300025303 Ga0209051_1013015 Ga0209051_10130156 231
752 3300027111 Ga0209281_1000036 Ga0209281_1000036155 231
753 3300027111 Ga0209281_1000047 Ga0209281_100004797 231
754 3300027312 Ga0209371_1000178 Ga0209371_100017827 231
755 3300027312 Ga0209371_1000382 Ga0209371_100038231 231
756 3300027666 Ga0209282_1001233 Ga0209282_100123313 231
757 3300028379 Ga0268266_10182047 Ga0268266_101820472 231
758 3300030500 Ga0268256_1000251 Ga0268256_10002513 231
759 3300030500 Ga0268256_1002340 Ga0268256_10023407 231
760 3300030744 Ga0316181_1292107 Ga0316181_12921073 231
761 3300031901 Ga0307406_10035957 Ga0307406_100359572 231
762 3300041411 Ga0439466_0041282 Ga0439466_0041282_350_1054 231
763 3300041413 Ga0439465_0002752 Ga0439465_0002752_3751_4473 231
764 3300041413 Ga0439465_0017104 Ga0439465_0017104_483_1187 231
765 3300042006 Ga0439432_072450 Ga0439432_072450_169_873 231
766 3300046530 Ga0495654_0004691 Ga0495654_0004691_1696_2424 231
767 3300047470 Ga0495681_0007378 Ga0495681_0007378_1613_2347 231
768 3300047472 Ga0495686_0018215 Ga0495686_0018215_2875_3579 231
769 3300048914 Ga0496111_0001309 Ga0496111_0001309_2082_2804 231
770 3300048920 Ga0496117_0007804 Ga0496117_0007804_2066_2770 231
771 3300048920 Ga0496117_0015204 Ga0496117_0015204_298_1029 231
772 3300048920 Ga0496117_0289765 Ga0496117_0289765_115_819 231
773 3300048921 Ga0496118_0004327 Ga0496118_0004327_411_1115 231
774 3300048921 Ga0496118_0038085 Ga0496118_0038085_1654_2388 231
775 3300048922 Ga0496119_0032975 Ga0496119_0032975_71_802 231
776 3300048923 Ga0496120_0022110 Ga0496120_0022110_819_1550 231
777 3300048924 Ga0496121_0000001 Ga0496121_0000001_1189432_1190163 231
778 3300048924 Ga0496121_0021365 Ga0496121_0021365_2164_2892 231
779 3300048925 Ga0496122_0000651 Ga0496122_0000651_19996_20700 231
780 3300048925 Ga0496122_0004590 Ga0496122_0004590_834_1556 231
781 3300048925 Ga0496122_0071268 Ga0496122_0071268_1721_2452 231
782 3300048926 Ga0496123_0000043 Ga0496123_0000043_45256_45960 231
783 3300048926 Ga0496123_0014366 Ga0496123_0014366_1560_2282 231
784 3300048926 Ga0496123_0077358 Ga0496123_0077358_817_1548 231
785 3300048927 Ga0496124_0000112 Ga0496124_0000112_76357_77094 231
786 3300048927 Ga0496124_0002868 Ga0496124_0002868_1140_1844 231
787 3300048927 Ga0496124_0013774 Ga0496124_0013774_1707_2411 231
788 3300048927 Ga0496124_0060067 Ga0496124_0060067_593_1321 231
789 3300048927 Ga0496124_0069588 Ga0496124_0069588_1431_2162 231
790 3300048928 Ga0496125_0000001 Ga0496125_0000001_1347641_1348372 231
791 3300048928 Ga0496125_0000671 Ga0496125_0000671_35765_36469 231
792 3300048929 Ga0496126_0004331 Ga0496126_0004331_11255_11959 231
793 3300048929 Ga0496126_0007936 Ga0496126_0007936_5806_6519 231
794 3300049568 Ga0501031_0014376 Ga0501031_0014376_318_1031 231
795 3300049569 Ga0501032_0097812 Ga0501032_0097812_454_1164 231
796 3300049569 Ga0501032_0148848 Ga0501032_0148848_654_1367 231
797 3300049570 Ga0501033_0000567 Ga0501033_0000567_5097_5807 231
798 3300049570 Ga0501033_0042441 Ga0501033_0042441_2538_3251 231
799 3300049571 Ga0501034_0261702 Ga0501034_0261702_356_1069 231
800 3300049571 Ga0501034_0263885 Ga0501034_0263885_777_1490 231
801 3300049572 Ga0501036_0082272 Ga0501036_0082272_1647_2360 231
802 3300049572 Ga0501036_0166637 Ga0501036_0166637_694_1398 231
803 3300049573 Ga0501037_0048993 Ga0501037_0048993_2297_3001 231
804 3300049573 Ga0501037_0117420 Ga0501037_0117420_1158_1871 231
805 3300049574 Ga0501038_0135804 Ga0501038_0135804_408_1121 231
806 3300049579 Ga0501043_0011682 Ga0501043_0011682_4082_4795 231
807 3300049584 Ga0501068_0149819 Ga0501068_0149819_292_996 231
808 3300049822 Ga0501035_0003382 Ga0501035_0003382_4538_5248 231
809 3300050491 nmdc:mga00v17_294417_c1 nmdc:mga00v17_294417_c1_131_865 231
810 3300050492 nmdc:mga0yw44_298958_c1 nmdc:mga0yw44_298958_c1_229_963 231
811 3300053125 Ga0500618_000871 Ga0500618_000871_1426_2169 231
812 iso_pu_bacteria 2510461069 2510842370 231
813 iso_pu_bacteria 2510917022 2511132488 231
814 iso_pu_bacteria 2513237159 2514000354 231
815 iso_pu_bacteria 2582581283 2585168369 231
816 iso_pu_bacteria 2582581306 2585268996 231
817 iso_pu_bacteria 2582581865 2585389521 231
818 iso_pu_bacteria 2582581866 2585393867 231
819 iso_pu_bacteria 2585427531 2585558191 231
820 iso_pu_bacteria 2643221607 2644049493 231
821 iso_pu_bacteria 2643221636 2644204099 231
822 iso_pu_bacteria 2643221686 2644482527 231
823 iso_pu_bacteria 2643221688 2644494653 231
824 iso_pu_bacteria 2643221689 2644499030 231
825 iso_pu_bacteria 2775507049 2776913189 231
826 iso_pu_bacteria 2842521101 2842526024 231
827 iso_pu_bacteria 2989771324 2989776090 231
828 iso_pu_bacteria 8024486573 8024492428 231
829 iso_pu_bacteria 8054558443 8054562813 231
830 3300006048 Ga0075363_100072259 Ga0075363_1000722592 232
831 3300006051 Ga0075364_10000507 Ga0075364_100005075 232
832 3300006353 Ga0075370_10043842 Ga0075370_100438423 232
833 3300006946 Ga0079104_1003687 Ga0079104_10036875 232
834 3300027111 Ga0209281_1000578 Ga0209281_100057828 232
835 3300031901 Ga0307406_10050367 Ga0307406_100503673 232
836 3300032002 Ga0307416_100609827 Ga0307416_1006098272 232
837 3300035695 Ga0373927_0002192 Ga0373927_0002192_2638_3354 232
838 3300037068 Ga0373925_0007649 Ga0373925_0007649_1252_1968 232
839 3300041404 Ga0439436_0010458 Ga0439436_0010458_474_1199 232
840 3300041413 Ga0439465_0040462 Ga0439465_0040462_691_1449 232
841 3300042007 Ga0439449_0004882 Ga0439449_0004882_4133_4852 232
842 3300042007 Ga0439449_0020484 Ga0439449_0020484_581_1306 232
843 3300048907 Ga0496104_0469847 Ga0496104_0469847_224_976 232
844 3300048919 Ga0496116_0025980 Ga0496116_0025980_1648_2358 232
845 3300048919 Ga0496116_0103878 Ga0496116_0103878_231_983 232
846 3300048920 Ga0496117_0008320 Ga0496117_0008320_4146_4856 232
847 3300048921 Ga0496118_0015025 Ga0496118_0015025_1450_2160 232
848 3300048922 Ga0496119_0018304 Ga0496119_0018304_3255_4007 232
849 3300048923 Ga0496120_0107785 Ga0496120_0107785_312_1064 232
850 3300048924 Ga0496121_0000182 Ga0496121_0000182_123988_124716 232
851 3300048925 Ga0496122_0033272 Ga0496122_0033272_440_1150 232
852 3300048927 Ga0496124_0003625 Ga0496124_0003625_14969_15679 232
853 3300048928 Ga0496125_0017316 Ga0496125_0017316_1221_1973 232
854 3300050490 nmdc:mga03n38_63391_c1 nmdc:mga03n38_63391_c1_878_1582 232
855 3300050491 nmdc:mga00v17_222_c2 nmdc:mga00v17_222_c2_12602_13330 232
856 3300053107 Ga0500560_017406 Ga0500560_017406_193_930 232
857 3300053156 Ga0500622_0045442 Ga0500622_0045442_86_790 232
858 3300053161 Ga0500634_0014441 Ga0500634_0014441_1982_2716 232
859 iso_pu_bacteria 2510917030 2511194150 232
860 iso_pu_bacteria 2582581298 2585226013 232
861 iso_pu_bacteria 2585427529 2585546973 232
862 iso_pu_bacteria 2643221599 2644005973 232
863 iso_pu_bacteria 2791355094 2792642665 232
864 iso_pu_bacteria 2818991448 2819610520 232
865 iso_pu_bacteria 2919100787 2919104243 232
866 iso_pu_bacteria 3005416602 3005420473 232
867 iso_pu_bacteria 3005452660 3005453833 232
868 iso_pu_bacteria 8005314921 8005317424 232
869 iso_pu_bacteria 8005484373 8005486510 232
870 iso_pu_bacteria 8005645114 8005646411 232
871 3300003775 Ga0055524_1001017 Ga0055524_100101718 233
872 3300005289 Ga0065704_10224171 Ga0065704_102241711 233
873 3300006946 Ga0079104_1002408 Ga0079104_10024083 233
874 3300009148 Ga0105243_10044327 Ga0105243_100443272 233
875 3300013100 Ga0157373_10014191 Ga0157373_100141911 233
876 3300013102 Ga0157371_10000015 Ga0157371_10000015222 233
877 3300013104 Ga0157370_10000992 Ga0157370_1000099237 233
878 3300021327 Ga0214543_1000011 Ga0214543_1000011309 233
879 3300022739 Ga0228711_1000528 Ga0228711_100052810 233
880 3300022740 Ga0228710_1000006 Ga0228710_1000006145 233
881 3300025294 Ga0209025_1023435 Ga0209025_10234353 233
882 3300025299 Ga0209256_1000319 Ga0209256_100031955 233
883 3300027111 Ga0209281_1000268 Ga0209281_100026858 233
884 3300027666 Ga0209282_1000026 Ga0209282_1000026129 233
885 3300031967 Ga0315914_1000008 Ga0315914_1000008144 233
886 3300033430 Ga0315913_1000137 Ga0315913_100013734 233
887 3300033464 Ga0315915_1000014 Ga0315915_100001432 233
888 3300046453 Ga0495627_027031 Ga0495627_027031_820_1566 233
889 3300046506 Ga0495583_0009458 Ga0495583_0009458_27_740 233
890 3300046558 Ga0495633_0020612 Ga0495633_0020612_1839_2585 233
891 3300046616 Ga0495668_0217165 Ga0495668_0217165_252_965 233
892 3300047472 Ga0495686_0220880 Ga0495686_0220880_292_1005 233
893 3300048916 Ga0496113_0065466 Ga0496113_0065466_205_951 233
894 3300048917 Ga0496114_0677192 Ga0496114_0677192_172_885 233
895 3300048920 Ga0496117_0000002 Ga0496117_0000002_901338_902084 233
896 3300048921 Ga0496118_0000460 Ga0496118_0000460_27771_28517 233
897 3300048922 Ga0496119_0097357 Ga0496119_0097357_586_1332 233
898 3300048923 Ga0496120_0000078 Ga0496120_0000078_81812_82558 233
899 3300048925 Ga0496122_0000001 Ga0496122_0000001_207771_208517 233
900 3300048926 Ga0496123_0000001 Ga0496123_0000001_211502_212248 233
901 3300048928 Ga0496125_0087407 Ga0496125_0087407_451_1197 233
902 3300048929 Ga0496126_0222311 Ga0496126_0222311_695_1441 233
903 3300049776 Ga0501280_001530 Ga0501280_001530_670_1404 233
904 3300050489 nmdc:mga03683_87273_c1 nmdc:mga03683_87273_c1_145_891 233
905 3300050491 nmdc:mga00v17_80_c1 nmdc:mga00v17_80_c1_16579_17325 233
906 3300050492 nmdc:mga0yw44_143763_c1 nmdc:mga0yw44_143763_c1_586_1332 233
907 3300050493 nmdc:mga0k408_21487_c1 nmdc:mga0k408_21487_c1_896_1642 233
908 3300050495 nmdc:mga04h51_8554_c1 nmdc:mga04h51_8554_c1_1127_1873 233
909 3300050516 nmdc:mga0sz30_1504_c1 nmdc:mga0sz30_1504_c1_3691_4437 233
910 3300053107 Ga0500560_002193 Ga0500560_002193_488_1234 233
911 3300053136 Ga0500559_0003485 Ga0500559_0003485_4693_5415 233
912 3300053137 Ga0500561_0000062 Ga0500561_0000062_6971_7717 233
913 3300053157 Ga0500624_000357 Ga0500624_000357_3660_4406 233
914 3300053161 Ga0500634_0003706 Ga0500634_0003706_2815_3561 233
915 iso_pu_bacteria 2524023209 2524461297 233
916 iso_pu_bacteria 2643221653 2644300222 233
917 iso_pu_bacteria 2643221719 2644658448 233
918 iso_pu_bacteria 2818991272 2819242161 233
919 iso_pu_bacteria 2842298080 2842302887 233
920 iso_pu_bacteria 2842357229 2842362563 233
921 iso_pu_bacteria 2842509118 2842510091 233
922 iso_pu_bacteria 2852387548 2852389481 233
923 iso_pu_bacteria 2989776772 2989778562 233
924 iso_pu_bacteria 8005246636 8005250938 233
925 iso_pu_bacteria 8046767195 8046768599 233
926 iso_pu_bacteria 8057575449 8057578134 233
927 3300002739 JGI25158J39367_1002719 JGI25158J39367_10027193 234
928 3300002773 JGI25152J39213_1000534 JGI25152J39213_10005348 234
929 3300002987 JGI25159J45721_1000006 JGI25159J45721_1000006157 234
930 3300003187 JGI25151J46595_10015949 JGI25151J46595_100159494 234
931 3300003187 JGI25151J46595_10031711 JGI25151J46595_100317112 234
932 3300003354 JGI25160J50197_1000019 JGI25160J50197_1000019162 234
933 3300003374 JGI25161J50226_1000467 JGI25161J50226_100046710 234
934 3300003771 Ga0055526_1000462 Ga0055526_100046210 234
935 3300003771 Ga0055526_1012068 Ga0055526_10120685 234
936 3300003775 Ga0055524_1002645 Ga0055524_10026454 234
937 3300003775 Ga0055524_1022848 Ga0055524_10228481 234
938 3300003781 Ga0055536_1002249 Ga0055536_10022498 234
939 3300003790 Ga0055528_1000448 Ga0055528_100044816 234
940 3300003790 Ga0055528_1012766 Ga0055528_10127663 234
941 3300003791 Ga0055530_10016849 Ga0055530_100168493 234
942 3300003794 Ga0055531_10001580 Ga0055531_1000158015 234
943 3300004625 Ga0055543_1000275 Ga0055543_100027528 234
944 3300005262 Ga0065165_1000149 Ga0065165_100014942 234
945 3300006038 Ga0075365_10043817 Ga0075365_100438173 234
946 3300006178 Ga0075367_10036998 Ga0075367_100369981 234
947 3300006186 Ga0075369_10008663 Ga0075369_100086634 234
948 3300006353 Ga0075370_10045487 Ga0075370_100454873 234
949 3300006353 Ga0075370_10130771 Ga0075370_101307712 234
950 3300009036 Ga0105244_10170998 Ga0105244_101709981 234
951 3300009766 Ga0123342_1008464 Ga0123342_10084644 234
952 3300013100 Ga0157373_10188649 Ga0157373_101886492 234
953 3300013104 Ga0157370_10357151 Ga0157370_103571512 234
954 3300013249 Ga0171463_1011 Ga0171463_1011214 234
955 3300015690 Ga0183363_1143 Ga0183363_11432 234
956 3300025208 Ga0209436_100390 Ga0209436_1003909 234
957 3300025258 Ga0209129_1000140 Ga0209129_100014091 234
958 3300025258 Ga0209129_1001001 Ga0209129_10010018 234
959 3300025273 Ga0209673_1000068 Ga0209673_100006866 234
960 3300025284 Ga0209130_1000007 Ga0209130_1000007515 234
961 3300025284 Ga0209130_1009150 Ga0209130_10091503 234
962 3300025292 Ga0209676_1003915 Ga0209676_10039158 234
963 3300025294 Ga0209025_1000033 Ga0209025_1000033342 234
964 3300025294 Ga0209025_1005878 Ga0209025_10058784 234
965 3300025294 Ga0209025_1010533 Ga0209025_10105338 234
966 3300025294 Ga0209025_1032230 Ga0209025_10322302 234
967 3300025294 Ga0209025_1056823 Ga0209025_10568232 234
968 3300025295 Ga0209564_1000740 Ga0209564_100074022 234
969 3300025295 Ga0209564_1008778 Ga0209564_10087783 234
970 3300025295 Ga0209564_1034078 Ga0209564_10340781 234
971 3300025297 Ga0209758_1027428 Ga0209758_10274282 234
972 3300025298 Ga0209050_1003268 Ga0209050_10032684 234
973 3300025299 Ga0209256_1001415 Ga0209256_10014154 234
974 3300025299 Ga0209256_1004897 Ga0209256_10048975 234
975 3300025299 Ga0209256_1029040 Ga0209256_10290402 234
976 3300025299 Ga0209256_1056748 Ga0209256_10567481 234
977 3300025302 Ga0207426_1000111 Ga0207426_1000111156 234
978 3300025302 Ga0207426_1000853 Ga0207426_100085314 234
979 3300025303 Ga0209051_1006255 Ga0209051_10062552 234
980 3300025303 Ga0209051_1024042 Ga0209051_10240424 234
981 3300025304 Ga0209257_1001307 Ga0209257_100130712 234
982 3300025931 Ga0207644_10231915 Ga0207644_102319152 234
983 3300028794 Ga0307515_10000274 Ga0307515_1000027470 234
984 3300031456 Ga0307513_10028989 Ga0307513_100289894 234
985 3300039437 Ga0436365_0596357 Ga0436365_0596357_34_750 234
986 3300046519 Ga0495632_0002325 Ga0495632_0002325_12319_13035 234
987 3300046674 Ga0495588_0359417 Ga0495588_0359417_11_727 234
988 3300047443 Ga0495687_072679 Ga0495687_072679_295_1011 234
989 3300048905 Ga0496102_0758028 Ga0496102_0758028_146_862 234
990 3300048907 Ga0496104_0428031 Ga0496104_0428031_74_790 234
991 3300048908 Ga0496105_0338040 Ga0496105_0338040_440_1156 234
992 3300048909 Ga0496106_0124733 Ga0496106_0124733_253_969 234
993 3300048910 Ga0496107_0103494 Ga0496107_0103494_552_1268 234
994 3300048912 Ga0496109_0405465 Ga0496109_0405465_55_771 234
995 3300048919 Ga0496116_0064129 Ga0496116_0064129_38_754 234
996 3300048927 Ga0496124_0034713 Ga0496124_0034713_2857_3573 234
997 3300048927 Ga0496124_0157201 Ga0496124_0157201_942_1658 234
998 3300048929 Ga0496126_0287519 Ga0496126_0287519_565_1281 234
999 3300053122 Ga0500608_039873 Ga0500608_039873_19_723 234
1000 3300053125 Ga0500618_006080 Ga0500618_006080_1846_2562 234
1001 iso_pu_bacteria 2554235003 2554247781 234
1002 iso_pu_bacteria 2558860242 2559294914 234
1003 iso_pu_bacteria 2582581308 2585276847 234
1004 iso_pu_bacteria 2582581315 2585324154 234
1005 iso_pu_bacteria 2585427527 2585534850 234
1006 iso_pu_bacteria 2585427530 2585551705 234
1007 iso_pu_bacteria 2585427594 2585845730 234
1008 iso_pu_bacteria 2615840626 2616308220 234
1009 iso_pu_bacteria 2615840698 2616556757 234
1010 iso_pu_bacteria 2617270742 2617381575 234
1011 iso_pu_bacteria 2643221693 2644522307 234
1012 iso_pu_bacteria 2667528174 2671115617 234
1013 iso_pu_bacteria 2775507266 2778176362 234
1014 iso_pu_bacteria 2808606387 2808985316 234
1015 iso_pu_bacteria 2818991453 2819638267 234
1016 iso_pu_bacteria 2838029111 2838032293 234
1017 iso_pu_bacteria 2842475841 2842479078 234
1018 iso_pu_bacteria 2842482326 2842483213 234
1019 iso_pu_bacteria 2842502639 2842506202 234
1020 iso_pu_bacteria 2919408235 2919409665 234
1021 iso_pu_bacteria 2979089926 2979094314 234
1022 iso_pu_bacteria 2979095461 2979098305 234
1023 iso_pu_bacteria 650716007 650740170 234
1024 3300028794 Ga0307515_10012807 Ga0307515_1001280714 235
1025 3300031911 Ga0307412_10149819 Ga0307412_101498191 235
1026 3300031995 Ga0307409_100052172 Ga0307409_1000521725 235
1027 3300041404 Ga0439436_0006610 Ga0439436_0006610_85_819 235
1028 3300041411 Ga0439466_0066400 Ga0439466_0066400_403_1137 235
1029 3300041413 Ga0439465_0002648 Ga0439465_0002648_2836_3570 235
1030 3300042015 Ga0439462_0007652 Ga0439462_0007652_1069_1803 235
1031 3300042531 Ga0450918_002717 Ga0450918_002717_2114_2848 235
1032 3300046507 Ga0495606_0016864 Ga0495606_0016864_1048_1767 235
1033 3300046660 Ga0495625_0088931 Ga0495625_0088931_1082_1816 235
1034 3300047318 Ga0495636_0163433 Ga0495636_0163433_263_982 235
1035 3300048903 Ga0496100_0113642 Ga0496100_0113642_297_1016 235
1036 3300048908 Ga0496105_0320235 Ga0496105_0320235_17_736 235
1037 3300053151 Ga0500604_0036747 Ga0500604_0036747_279_1013 235
1038 iso_pu_bacteria 2738541293 2738799344 235
1039 iso_pu_bacteria 2913308742 2913310034 235
1040 iso_pu_bacteria 8005682033 8005686474 235
1041 3300002739 JGI25158J39367_1000135 JGI25158J39367_100013512 236
1042 3300002774 JGI25150J39212_1000278 JGI25150J39212_10002783 236
1043 3300002987 JGI25159J45721_1001165 JGI25159J45721_10011655 236
1044 3300003187 JGI25151J46595_10000126 JGI25151J46595_1000012681 236
1045 3300003215 JGI25153J46596_10001009 JGI25153J46596_1000100911 236
1046 3300003322 rootL2_10078439 rootL2_100784396 236
1047 3300003323 rootH1_10008188 rootH1_100081885 236
1048 3300003354 JGI25160J50197_1002746 JGI25160J50197_10027464 236
1049 3300003374 JGI25161J50226_1000964 JGI25161J50226_10009643 236
1050 3300003771 Ga0055526_1007466 Ga0055526_10074664 236
1051 3300004625 Ga0055543_1000019 Ga0055543_1000019172 236
1052 3300005262 Ga0065165_1003644 Ga0065165_10036443 236
1053 3300025208 Ga0209436_100039 Ga0209436_10003968 236
1054 3300025245 Ga0207425_1000010 Ga0207425_1000010272 236
1055 3300025245 Ga0207425_1012677 Ga0207425_10126772 236
1056 3300025258 Ga0209129_1000034 Ga0209129_100003469 236
1057 3300025258 Ga0209129_1003318 Ga0209129_10033184 236
1058 3300025273 Ga0209673_1009548 Ga0209673_10095484 236
1059 3300025273 Ga0209673_1022783 Ga0209673_10227833 236
1060 3300025284 Ga0209130_1000006 Ga0209130_100000682 236
1061 3300025294 Ga0209025_1000022 Ga0209025_1000022310 236
1062 3300025294 Ga0209025_1008956 Ga0209025_10089565 236
1063 3300025295 Ga0209564_1000373 Ga0209564_100037312 236
1064 3300025297 Ga0209758_1000080 Ga0209758_1000080211 236
1065 3300025297 Ga0209758_1001240 Ga0209758_10012405 236
1066 3300025299 Ga0209256_1006489 Ga0209256_10064896 236
1067 3300025302 Ga0207426_1000003 Ga0207426_1000003945 236
1068 3300031731 Ga0307405_10000988 Ga0307405_1000098811 236
1069 3300046522 Ga0495643_0095143 Ga0495643_0095143_614_1336 236
1070 3300046694 Ga0495649_0109870 Ga0495649_0109870_683_1405 236
1071 3300047472 Ga0495686_0071952 Ga0495686_0071952_1100_1828 236
1072 3300048919 Ga0496116_0003692 Ga0496116_0003692_14150_14881 236
1073 3300048921 Ga0496118_0020043 Ga0496118_0020043_106_837 236
1074 3300048921 Ga0496118_0092954 Ga0496118_0092954_112_834 236
1075 3300048922 Ga0496119_0055036 Ga0496119_0055036_1656_2387 236
1076 3300048924 Ga0496121_0024322 Ga0496121_0024322_1372_2100 236
1077 3300048924 Ga0496121_0031739 Ga0496121_0031739_474_1205 236
1078 3300048924 Ga0496121_0062983 Ga0496121_0062983_1299_2021 236
1079 3300048925 Ga0496122_0061405 Ga0496122_0061405_1886_2617 236
1080 3300048925 Ga0496122_0170819 Ga0496122_0170819_354_1076 236
1081 3300048926 Ga0496123_0031183 Ga0496123_0031183_97_828 236
1082 3300048927 Ga0496124_0009455 Ga0496124_0009455_5100_5831 236
1083 3300048927 Ga0496124_0039034 Ga0496124_0039034_1466_2188 236
1084 3300048928 Ga0496125_0004457 Ga0496125_0004457_10366_11097 236
1085 3300048929 Ga0496126_0034808 Ga0496126_0034808_1039_1770 236
1086 3300053139 Ga0500568_0030014 Ga0500568_0030014_218_940 236
1087 3300053156 Ga0500622_0000178 Ga0500622_0000178_65131_65853 236
1088 iso_pu_bacteria 2582581316 2585333453 236
1089 3300002987 JGI25159J45721_1001963 JGI25159J45721_10019638 237
1090 3300003354 JGI25160J50197_1000004 JGI25160J50197_1000004316 237
1091 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003113 237
1092 3300004625 Ga0055543_1000001 Ga0055543_1000001119 237
1093 3300005262 Ga0065165_1000272 Ga0065165_100027238 237
1094 3300005455 Ga0070663_100442331 Ga0070663_1004423311 237
1095 3300005937 Ga0081455_10143117 Ga0081455_101431172 237
1096 3300025284 Ga0209130_1000012 Ga0209130_1000012309 237
1097 3300025302 Ga0207426_1000010 Ga0207426_1000010668 237
1098 3300044684 Ga0466966_0191833 Ga0466966_0191833_177_896 237
1099 3300044694 Ga0466963_0036076 Ga0466963_0036076_1500_2219 237
1100 3300044765 Ga0466970_0000494 Ga0466970_0000494_5387_6106 237
1101 3300045976 Ga0466967_0358140 Ga0466967_0358140_309_1028 237
1102 3300046507 Ga0495606_0058674 Ga0495606_0058674_542_1267 237
1103 3300046660 Ga0495625_0324576 Ga0495625_0324576_47_772 237
1104 3300046674 Ga0495588_0156476 Ga0495588_0156476_243_968 237
1105 3300048922 Ga0496119_0094497 Ga0496119_0094497_380_1105 237
1106 3300048923 Ga0496120_0087020 Ga0496120_0087020_642_1367 237
1107 3300048924 Ga0496121_0064191 Ga0496121_0064191_855_1580 237
1108 3300053137 Ga0500561_0069769 Ga0500561_0069769_92_817 237
1109 3300061719 Ga0466962_0161383 Ga0466962_0161383_77_796 237
1110 3300001979 JGI24740J21852_10000001 JGI24740J21852_10000001167 238
1111 3300002705 JGI25156J39149_1000027 JGI25156J39149_100002719 238
1112 3300002737 JGI25162J39368_1001607 JGI25162J39368_10016077 238
1113 3300002737 JGI25162J39368_1001697 JGI25162J39368_10016974 238
1114 3300002738 JGI25154J39366_1000181 JGI25154J39366_100018119 238
1115 3300002741 JGI25157J39369_1000010 JGI25157J39369_1000010192 238
1116 3300003214 JGI25165J46597_1001556 JGI25165J46597_10015567 238
1117 3300003214 JGI25165J46597_1002111 JGI25165J46597_10021117 238
1118 3300005548 Ga0070665_100069082 Ga0070665_1000690822 238
1119 3300005548 Ga0070665_100081481 Ga0070665_1000814815 238
1120 3300006042 Ga0075368_10002406 Ga0075368_100024063 238
1121 3300006048 Ga0075363_100035621 Ga0075363_1000356213 238
1122 3300006177 Ga0075362_10004640 Ga0075362_100046403 238
1123 3300006178 Ga0075367_10011315 Ga0075367_100113151 238
1124 3300006353 Ga0075370_10022870 Ga0075370_100228703 238
1125 3300009093 Ga0105240_10000005 Ga0105240_10000005111 238
1126 3300009148 Ga0105243_10281593 Ga0105243_102815932 238
1127 3300009545 Ga0105237_10001991 Ga0105237_100019915 238
1128 3300010375 Ga0105239_10083333 Ga0105239_100833334 238
1129 3300013104 Ga0157370_10000665 Ga0157370_1000066522 238
1130 3300013105 Ga0157369_10388837 Ga0157369_103888372 238
1131 3300015262 Ga0182007_10001185 Ga0182007_100011856 238
1132 3300025206 Ga0209435_100022 Ga0209435_100022191 238
1133 3300025233 Ga0209437_100153 Ga0209437_10015375 238
1134 3300025233 Ga0209437_100201 Ga0209437_10020141 238
1135 3300025246 Ga0209646_1000078 Ga0209646_1000078191 238
1136 3300025246 Ga0209646_1007337 Ga0209646_10073373 238
1137 3300025250 Ga0209026_1000065 Ga0209026_1000065191 238
1138 3300025253 Ga0209677_100572 Ga0209677_10057217 238
1139 3300025256 Ga0209759_1000055 Ga0209759_1000055191 238
1140 3300025261 Ga0209233_1000175 Ga0209233_100017564 238
1141 3300025261 Ga0209233_1000226 Ga0209233_100022622 238
1142 3300025261 Ga0209233_1000248 Ga0209233_100024838 238
1143 3300025913 Ga0207695_10000011 Ga0207695_10000011804 238
1144 3300025914 Ga0207671_10000276 Ga0207671_1000027618 238
1145 3300026078 Ga0207702_10036422 Ga0207702_100364225 238
1146 3300027312 Ga0209371_1001444 Ga0209371_100144412 238
1147 3300027866 Ga0209813_10008079 Ga0209813_100080793 238
1148 3300028379 Ga0268266_10031852 Ga0268266_100318523 238
1149 3300028379 Ga0268266_10079051 Ga0268266_100790514 238
1150 3300045976 Ga0466967_0804345 Ga0466967_0804345_10_732 238
1151 3300046665 Ga0495661_0165581 Ga0495661_0165581_37_816 238
1152 3300048906 Ga0496103_0096498 Ga0496103_0096498_591_1313 238
1153 3300048919 Ga0496116_0063552 Ga0496116_0063552_1600_2322 238
1154 3300048920 Ga0496117_0030584 Ga0496117_0030584_1363_2085 238
1155 3300048920 Ga0496117_0066946 Ga0496117_0066946_1326_2042 238
1156 3300048921 Ga0496118_0000756 Ga0496118_0000756_32713_33435 238
1157 3300048922 Ga0496119_0046584 Ga0496119_0046584_1413_2129 238
1158 3300048923 Ga0496120_0064655 Ga0496120_0064655_957_1673 238
1159 3300048924 Ga0496121_0001247 Ga0496121_0001247_18195_18917 238
1160 3300048925 Ga0496122_0016237 Ga0496122_0016237_921_1637 238
1161 3300048925 Ga0496122_0042322 Ga0496122_0042322_2707_3429 238
1162 3300048926 Ga0496123_0013112 Ga0496123_0013112_4939_5661 238
1163 3300048927 Ga0496124_0038929 Ga0496124_0038929_1764_2486 238
1164 3300048927 Ga0496124_0058197 Ga0496124_0058197_871_1587 238
1165 3300048928 Ga0496125_0024800 Ga0496125_0024800_3241_3963 238
1166 3300048928 Ga0496125_0045622 Ga0496125_0045622_1536_2252 238
1167 3300053125 Ga0500618_008582 Ga0500618_008582_1521_2249 238
1168 3300053140 Ga0500573_0004460 Ga0500573_0004460_178_906 238
1169 3300053140 Ga0500573_0037067 Ga0500573_0037067_1871_2599 238
1170 3300053177 Ga0500636_0130267 Ga0500636_0130267_288_1016 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04079

SMC_ScpB

Segregation and condensation complex subunit ScpB

49

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w6k-assembly2.cif.gz_E crystal structure of dimer of scpb n-terminal domain complexed with scpa peptide 0.8447 25 87
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8099 106 166
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.785 109 174
5vfa-assembly2.cif.gz_B ritr mutant - c128d 0.7488 28 86
4g9y-assembly1.cif.gz_A-2 crystal structure of the pcav transcriptional regulator from streptomyces coelicolor 0.7045 105 182
ID Description Score Start End Superfamily
2z99A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.922 103 175 1.10.10.10
1t6sA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9057 105 174 1.10.10.10
2z99A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8871 103 175 1.10.10.10
af_I6XCB2_106_189_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8517 103 183 1.10.10.10
af_P50456_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8504 108 167 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y1W0D0-F1-model_v4 SMC-Scp complex subunit ScpB 0.786 100 192 GO:0005737
GO:0051301
GO:0051304
AF-A0A440UVC2-F1-model_v4 SMC-Scp complex subunit ScpB 0.7812 103 195 GO:0005737
GO:0051301
GO:0051304
AF-A0A434GEQ7-F1-model_v4 SMC-Scp complex subunit ScpB 0.7733 103 195 GO:0005737
GO:0051301
GO:0051304
AF-A0A531YW26-F1-model_v4 deleted 0.7732 103 195
AF-A0A528HGX2-F1-model_v4 SMC-Scp complex subunit ScpB 0.7672 106 195 GO:0005737
GO:0051301
GO:0051304

Feature Viewer

pLDDT pTM Quality
75.97 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map