F491126
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1169 | 328 | 2338 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300010159|Ga0099796_10186542|Ga0099796_101865422 |
| Length | 106 |
| Sequence | VFSRQNWNLETRYWKQTLIAFLTLELHIEAAQSLKDRRQVVLRASFNVSVAELDASGLWNRATVGVVSVSDSRDYLDGLMKNVERQATRIANNHGADLADSFVEYF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 134 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 135 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 136 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 137 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 257 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.82 |
| Rhizosphere | 93.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099796_10186542 | 3300010159 | Unclassified | 835 |
| 2 | MRS1b_contig_6382803 | 2162886011 | Unclassified | 903 |
| 3 | MRS1b_contig_9171898 | 2162886011 | Unclassified | 1374 |
| 4 | MBSR1b_contig_9749820 | 2162886012 | Bacteria | 1872 |
| 5 | LJNas_1001079 | 3300000546 | Bacteria | 4237 |
| 6 | LJNas_1001135 | 3300000546 | Bacteria | 4059 |
| 7 | JGI24741J21665_1044410 | 3300001915 | Bacteria | 654 |
| 8 | JGI24752J21851_1013055 | 3300001976 | Bacteria | 1085 |
| 9 | JGI24034J26672_10123497 | 3300002239 | Unclassified | 503 |
| 10 | JGI24751J29686_10005033 | 3300002459 | Bacteria | 2694 |
| 11 | rootH1_10193919 | 3300003323 | Unclassified | 1216 |
| 12 | rootH1_10326518 | 3300003323 | Unclassified | 1158 |
| 13 | Ga0058863_10016641 | 3300004799 | Bacteria | 3138 |
| 14 | Ga0065712_10008743 | 3300005290 | Bacteria | 3949 |
| 15 | Ga0065712_10058536 | 3300005290 | Unclassified | 615 |
| 16 | Ga0065712_10082582 | 3300005290 | Bacteria | 2904 |
| 17 | Ga0065712_10246720 | 3300005290 | Unclassified | 970 |
| 18 | Ga0065715_11044722 | 3300005293 | Bacteria | 533 |
| 19 | Ga0065707_10461869 | 3300005295 | Unclassified | 790 |
| 20 | Ga0070658_10144456 | 3300005327 | Bacteria | 1989 |
| 21 | Ga0070658_10175172 | 3300005327 | Bacteria | 1803 |
| 22 | Ga0070676_10002636 | 3300005328 | Bacteria | 9235 |
| 23 | Ga0070683_100024239 | 3300005329 | Bacteria | 5433 |
| 24 | Ga0070683_100051208 | 3300005329 | Unclassified | 3823 |
| 25 | Ga0070683_100083853 | 3300005329 | Unclassified | 2985 |
| 26 | Ga0070683_100121497 | 3300005329 | Bacteria | 2468 |
| 27 | Ga0070683_100262019 | 3300005329 | Bacteria | 1644 |
| 28 | Ga0070683_100366069 | 3300005329 | Unclassified | 1373 |
| 29 | Ga0070690_100121027 | 3300005330 | Bacteria | 1756 |
| 30 | Ga0070690_100733087 | 3300005330 | Unclassified | 761 |
| 31 | Ga0070670_100002163 | 3300005331 | Bacteria | 16137 |
| 32 | Ga0070670_100189664 | 3300005331 | Unclassified | 1785 |
| 33 | Ga0070670_100614349 | 3300005331 | Unclassified | 973 |
| 34 | Ga0070670_101462411 | 3300005331 | Unclassified | 627 |
| 35 | Ga0070670_101562141 | 3300005331 | Bacteria | 606 |
| 36 | Ga0070677_10059096 | 3300005333 | Bacteria | 1576 |
| 37 | Ga0070677_10728922 | 3300005333 | Unclassified | 560 |
| 38 | Ga0070677_10824694 | 3300005333 | Unclassified | 531 |
| 39 | Ga0068869_100043195 | 3300005334 | Unclassified | 3236 |
| 40 | Ga0068869_100078820 | 3300005334 | Bacteria | 2454 |
| 41 | Ga0068869_100151067 | 3300005334 | Bacteria | 1801 |
| 42 | Ga0068869_100224084 | 3300005334 | Bacteria | 1491 |
| 43 | Ga0068869_100489353 | 3300005334 | Bacteria | 1025 |
| 44 | Ga0068869_101772911 | 3300005334 | Unclassified | 552 |
| 45 | Ga0070666_10010515 | 3300005335 | Bacteria | 5790 |
| 46 | Ga0070666_10163128 | 3300005335 | Bacteria | 1558 |
| 47 | Ga0070666_10260841 | 3300005335 | Unclassified | 1228 |
| 48 | Ga0070680_100012730 | 3300005336 | Bacteria | 6540 |
| 49 | Ga0070680_100017979 | 3300005336 | Bacteria | 5582 |
| 50 | Ga0070680_100069074 | 3300005336 | Bacteria | 2901 |
| 51 | Ga0070680_100144923 | 3300005336 | Bacteria | 1992 |
| 52 | Ga0070680_100227758 | 3300005336 | Unclassified | 1574 |
| 53 | Ga0070682_100020940 | 3300005337 | Bacteria | 3853 |
| 54 | Ga0070682_100084027 | 3300005337 | Bacteria | 2068 |
| 55 | Ga0070682_100101201 | 3300005337 | Bacteria | 1902 |
| 56 | Ga0070682_101365466 | 3300005337 | Unclassified | 604 |
| 57 | Ga0068868_100004608 | 3300005338 | Bacteria | 9669 |
| 58 | Ga0068868_100005733 | 3300005338 | Bacteria | 8738 |
| 59 | Ga0068868_100019713 | 3300005338 | Bacteria | 5057 |
| 60 | Ga0068868_100046519 | 3300005338 | Unclassified | 3397 |
| 61 | Ga0068868_100101109 | 3300005338 | Bacteria | 2333 |
| 62 | Ga0068868_100144690 | 3300005338 | Unclassified | 1954 |
| 63 | Ga0068868_100612571 | 3300005338 | Bacteria | 966 |
| 64 | Ga0068868_100693154 | 3300005338 | Bacteria | 911 |
| 65 | Ga0070660_100003269 | 3300005339 | Bacteria | 11126 |
| 66 | Ga0070660_100065897 | 3300005339 | Bacteria | 2819 |
| 67 | Ga0070689_100001444 | 3300005340 | Bacteria | 15164 |
| 68 | Ga0070689_100157841 | 3300005340 | Unclassified | 1832 |
| 69 | Ga0070689_101292351 | 3300005340 | Bacteria | 657 |
| 70 | Ga0070691_10417278 | 3300005341 | Bacteria | 760 |
| 71 | Ga0070661_100005865 | 3300005344 | Bacteria | 8447 |
| 72 | Ga0070661_100041016 | 3300005344 | Bacteria | 3377 |
| 73 | Ga0070661_100058538 | 3300005344 | Bacteria | 2824 |
| 74 | Ga0070661_100088315 | 3300005344 | Bacteria | 2294 |
| 75 | Ga0070668_100007447 | 3300005347 | Bacteria | 8122 |
| 76 | Ga0070668_100045126 | 3300005347 | Unclassified | 3381 |
| 77 | Ga0070669_100103155 | 3300005353 | Unclassified | 2154 |
| 78 | Ga0070669_100358117 | 3300005353 | Bacteria | 1186 |
| 79 | Ga0070669_100540975 | 3300005353 | Unclassified | 970 |
| 80 | Ga0070675_100272534 | 3300005354 | Bacteria | 1485 |
| 81 | Ga0070671_100227900 | 3300005355 | Bacteria | 1581 |
| 82 | Ga0070671_100266764 | 3300005355 | Bacteria | 1455 |
| 83 | Ga0070671_101355495 | 3300005355 | Unclassified | 628 |
| 84 | Ga0070671_101450296 | 3300005355 | Unclassified | 607 |
| 85 | Ga0070674_100049601 | 3300005356 | Bacteria | 2887 |
| 86 | Ga0070674_100443076 | 3300005356 | Unclassified | 1070 |
| 87 | Ga0070673_100046972 | 3300005364 | Bacteria | 3357 |
| 88 | Ga0070673_100053292 | 3300005364 | Bacteria | 3176 |
| 89 | Ga0070673_100385715 | 3300005364 | Bacteria | 1250 |
| 90 | Ga0070673_101742590 | 3300005364 | Unclassified | 590 |
| 91 | Ga0070688_100010943 | 3300005365 | Bacteria | 5024 |
| 92 | Ga0070688_100191835 | 3300005365 | Bacteria | 1424 |
| 93 | Ga0070688_100216208 | 3300005365 | Bacteria | 1348 |
| 94 | Ga0070659_100220425 | 3300005366 | Bacteria | 1565 |
| 95 | Ga0070659_101470904 | 3300005366 | Bacteria | 606 |
| 96 | Ga0070667_100090690 | 3300005367 | Bacteria | 2627 |
| 97 | Ga0070667_100468531 | 3300005367 | Bacteria | 1152 |
| 98 | Ga0070667_100695718 | 3300005367 | Unclassified | 940 |
| 99 | Ga0070667_101213544 | 3300005367 | Bacteria | 706 |
| 100 | Ga0070667_101699206 | 3300005367 | Bacteria | 594 |
| 101 | Ga0070709_10000423 | 3300005434 | Bacteria | 25611 |
| 102 | Ga0070709_10020249 | 3300005434 | Bacteria | 3857 |
| 103 | Ga0070709_10135876 | 3300005434 | Archaea | 1684 |
| 104 | Ga0070709_10140106 | 3300005434 | Bacteria | 1661 |
| 105 | Ga0070709_10279073 | 3300005434 | Unclassified | 1213 |
| 106 | Ga0070709_10287034 | 3300005434 | Bacteria | 1198 |
| 107 | Ga0070709_10836005 | 3300005434 | Bacteria | 725 |
| 108 | Ga0070714_100000096 | 3300005435 | Bacteria | 74616 |
| 109 | Ga0070714_100002108 | 3300005435 | Bacteria | 14594 |
| 110 | Ga0070714_100017874 | 3300005435 | Bacteria | 5750 |
| 111 | Ga0070714_100117686 | 3300005435 | Bacteria | 2360 |
| 112 | Ga0070714_100132009 | 3300005435 | Bacteria | 2233 |
| 113 | Ga0070714_100209199 | 3300005435 | Bacteria | 1787 |
| 114 | Ga0070714_100295570 | 3300005435 | Bacteria | 1508 |
| 115 | Ga0070714_100391089 | 3300005435 | Bacteria | 1313 |
| 116 | Ga0070714_100467245 | 3300005435 | Unclassified | 1200 |
| 117 | Ga0070714_100767236 | 3300005435 | Bacteria | 933 |
| 118 | Ga0070714_100955642 | 3300005435 | Unclassified | 833 |
| 119 | Ga0070714_101105700 | 3300005435 | Bacteria | 772 |
| 120 | Ga0070714_101617003 | 3300005435 | Bacteria | 633 |
| 121 | Ga0070714_102165016 | 3300005435 | Unclassified | 542 |
| 122 | Ga0070713_100000134 | 3300005436 | Bacteria | 48639 |
| 123 | Ga0070713_100000364 | 3300005436 | Bacteria | 29177 |
| 124 | Ga0070713_100063451 | 3300005436 | Bacteria | 3097 |
| 125 | Ga0070713_100095501 | 3300005436 | Unclassified | 2564 |
| 126 | Ga0070713_100550144 | 3300005436 | Unclassified | 1093 |
| 127 | Ga0070713_101018410 | 3300005436 | Unclassified | 799 |
| 128 | Ga0070713_101969707 | 3300005436 | Unclassified | 567 |
| 129 | Ga0070710_10004596 | 3300005437 | Bacteria | 6523 |
| 130 | Ga0070710_10005846 | 3300005437 | Bacteria | 5871 |
| 131 | Ga0070710_10065925 | 3300005437 | Bacteria | 2075 |
| 132 | Ga0070710_10102051 | 3300005437 | Bacteria | 1710 |
| 133 | Ga0070710_10212509 | 3300005437 | Unclassified | 1227 |
| 134 | Ga0070710_10551691 | 3300005437 | Bacteria | 796 |
| 135 | Ga0070710_11470547 | 3300005437 | Unclassified | 511 |
| 136 | Ga0070701_10137393 | 3300005438 | Unclassified | 1394 |
| 137 | Ga0070701_10210443 | 3300005438 | Bacteria | 1154 |
| 138 | Ga0070711_100000271 | 3300005439 | Bacteria | 26787 |
| 139 | Ga0070711_100005922 | 3300005439 | Bacteria | 7340 |
| 140 | Ga0070711_100064787 | 3300005439 | Unclassified | 2554 |
| 141 | Ga0070711_100142088 | 3300005439 | Bacteria | 1801 |
| 142 | Ga0070711_100393545 | 3300005439 | Bacteria | 1123 |
| 143 | Ga0070711_100480998 | 3300005439 | Bacteria | 1021 |
| 144 | Ga0070711_100647232 | 3300005439 | Bacteria | 886 |
| 145 | Ga0070711_100710313 | 3300005439 | Unclassified | 847 |
| 146 | Ga0070711_102015255 | 3300005439 | Bacteria | 508 |
| 147 | Ga0070705_100106655 | 3300005440 | Unclassified | 1781 |
| 148 | Ga0070700_100335038 | 3300005441 | Bacteria | 1116 |
| 149 | Ga0070694_101897467 | 3300005444 | Unclassified | 509 |
| 150 | Ga0070708_100000459 | 3300005445 | Bacteria | 30632 |
| 151 | Ga0070708_100037092 | 3300005445 | Bacteria | 4251 |
| 152 | Ga0070708_100093222 | 3300005445 | Bacteria | 2745 |
| 153 | Ga0070708_100120147 | 3300005445 | Bacteria | 2423 |
| 154 | Ga0070708_100443273 | 3300005445 | Bacteria | 1225 |
| 155 | Ga0070708_100521978 | 3300005445 | Unclassified | 1120 |
| 156 | Ga0070708_100765105 | 3300005445 | Bacteria | 908 |
| 157 | Ga0070663_100054294 | 3300005455 | Bacteria | 2863 |
| 158 | Ga0070663_100147626 | 3300005455 | Unclassified | 1800 |
| 159 | Ga0070663_100768922 | 3300005455 | Bacteria | 824 |
| 160 | Ga0070678_100054773 | 3300005456 | Bacteria | 2908 |
| 161 | Ga0070678_100835215 | 3300005456 | Bacteria | 838 |
| 162 | Ga0070678_101101583 | 3300005456 | Unclassified | 733 |
| 163 | Ga0070678_101574786 | 3300005456 | Unclassified | 616 |
| 164 | Ga0070662_100008601 | 3300005457 | Bacteria | 6659 |
| 165 | Ga0070662_100015770 | 3300005457 | Bacteria | 5066 |
| 166 | Ga0070662_100221260 | 3300005457 | Unclassified | 1511 |
| 167 | Ga0070681_10002834 | 3300005458 | Bacteria | 16024 |
| 168 | Ga0070681_10005694 | 3300005458 | Bacteria | 12043 |
| 169 | Ga0070681_10050021 | 3300005458 | Bacteria | 4171 |
| 170 | Ga0070681_10151119 | 3300005458 | Bacteria | 2248 |
| 171 | Ga0070681_10572937 | 3300005458 | Bacteria | 1043 |
| 172 | Ga0070681_10971602 | 3300005458 | Unclassified | 769 |
| 173 | Ga0070681_11300974 | 3300005458 | Bacteria | 650 |
| 174 | Ga0068867_100003049 | 3300005459 | Bacteria | 11813 |
| 175 | Ga0068867_100040462 | 3300005459 | Bacteria | 3402 |
| 176 | Ga0068867_100197290 | 3300005459 | Bacteria | 1609 |
| 177 | Ga0070685_10004878 | 3300005466 | Bacteria | 6784 |
| 178 | Ga0070685_10307117 | 3300005466 | Bacteria | 1071 |
| 179 | Ga0070706_100002982 | 3300005467 | Bacteria | 16776 |
| 180 | Ga0070706_100096996 | 3300005467 | Bacteria | 2738 |
| 181 | Ga0070706_100136757 | 3300005467 | Bacteria | 2287 |
| 182 | Ga0070707_100003948 | 3300005468 | Bacteria | 13962 |
| 183 | Ga0070707_100163640 | 3300005468 | Unclassified | 2168 |
| 184 | Ga0070707_100172790 | 3300005468 | Bacteria | 2106 |
| 185 | Ga0070707_100597797 | 3300005468 | Bacteria | 1066 |
| 186 | Ga0070707_101237034 | 3300005468 | Bacteria | 713 |
| 187 | Ga0070707_102159041 | 3300005468 | Unclassified | 524 |
| 188 | Ga0070698_100002043 | 3300005471 | Bacteria | 22426 |
| 189 | Ga0070698_100071081 | 3300005471 | Bacteria | 3491 |
| 190 | Ga0070699_100000441 | 3300005518 | Bacteria | 39851 |
| 191 | Ga0070699_100243307 | 3300005518 | Bacteria | 1607 |
| 192 | Ga0070699_100312649 | 3300005518 | Bacteria | 1411 |
| 193 | Ga0070679_100005583 | 3300005530 | Bacteria | 11655 |
| 194 | Ga0070679_100060422 | 3300005530 | Bacteria | 3777 |
| 195 | Ga0070679_100062432 | 3300005530 | Bacteria | 3714 |
| 196 | Ga0070679_100115288 | 3300005530 | Bacteria | 2672 |
| 197 | Ga0070679_100153230 | 3300005530 | Bacteria | 2281 |
| 198 | Ga0070679_100196193 | 3300005530 | Bacteria | 1986 |
| 199 | Ga0070679_100563428 | 3300005530 | Bacteria | 1083 |
| 200 | Ga0070679_100674712 | 3300005530 | Unclassified | 976 |
| 201 | Ga0070684_100040330 | 3300005535 | Bacteria | 4020 |
| 202 | Ga0070684_100333499 | 3300005535 | Bacteria | 1394 |
| 203 | Ga0070684_100363259 | 3300005535 | Bacteria | 1332 |
| 204 | Ga0070697_100000158 | 3300005536 | Bacteria | 55228 |
| 205 | Ga0070697_100170418 | 3300005536 | Unclassified | 1842 |
| 206 | Ga0068853_100037836 | 3300005539 | Unclassified | 4107 |
| 207 | Ga0068853_100426744 | 3300005539 | Unclassified | 1244 |
| 208 | Ga0068853_100478685 | 3300005539 | Unclassified | 1173 |
| 209 | Ga0068853_101139439 | 3300005539 | Unclassified | 752 |
| 210 | Ga0070672_100119703 | 3300005543 | Unclassified | 2154 |
| 211 | Ga0070672_100516993 | 3300005543 | Unclassified | 1034 |
| 212 | Ga0070686_100046794 | 3300005544 | Unclassified | 2732 |
| 213 | Ga0070686_100062150 | 3300005544 | Bacteria | 2415 |
| 214 | Ga0070695_100304858 | 3300005545 | Bacteria | 1179 |
| 215 | Ga0070695_101296992 | 3300005545 | Unclassified | 601 |
| 216 | Ga0070695_101464005 | 3300005545 | Unclassified | 568 |
| 217 | Ga0070696_100064452 | 3300005546 | Bacteria | 2567 |
| 218 | Ga0070693_100022453 | 3300005547 | Bacteria | 3356 |
| 219 | Ga0070693_100028327 | 3300005547 | Bacteria | 3044 |
| 220 | Ga0070693_100325725 | 3300005547 | Unclassified | 1044 |
| 221 | Ga0070693_100669660 | 3300005547 | Unclassified | 757 |
| 222 | Ga0070693_100978931 | 3300005547 | Bacteria | 639 |
| 223 | Ga0070665_100235175 | 3300005548 | Bacteria | 1833 |
| 224 | Ga0070665_100408666 | 3300005548 | Unclassified | 1366 |
| 225 | Ga0070665_100491383 | 3300005548 | Unclassified | 1238 |
| 226 | Ga0070704_102180424 | 3300005549 | Unclassified | 515 |
| 227 | Ga0070704_102216403 | 3300005549 | Bacteria | 511 |
| 228 | Ga0068855_100002637 | 3300005563 | Bacteria | 22119 |
| 229 | Ga0068855_100005367 | 3300005563 | Bacteria | 15634 |
| 230 | Ga0068855_100015827 | 3300005563 | Bacteria | 9073 |
| 231 | Ga0068855_100129933 | 3300005563 | Bacteria | 2877 |
| 232 | Ga0068855_100212104 | 3300005563 | Bacteria | 2175 |
| 233 | Ga0068855_100361189 | 3300005563 | Bacteria | 1598 |
| 234 | Ga0068855_100506310 | 3300005563 | Unclassified | 1311 |
| 235 | Ga0068855_100667396 | 3300005563 | Bacteria | 1115 |
| 236 | Ga0068855_100932764 | 3300005563 | Bacteria | 915 |
| 237 | Ga0068855_101010547 | 3300005563 | Bacteria | 873 |
| 238 | Ga0070664_100000368 | 3300005564 | Bacteria | 33302 |
| 239 | Ga0070664_100013863 | 3300005564 | Bacteria | 6571 |
| 240 | Ga0070664_100047104 | 3300005564 | Bacteria | 3642 |
| 241 | Ga0070664_100093232 | 3300005564 | Unclassified | 2609 |
| 242 | Ga0070664_101385912 | 3300005564 | Unclassified | 665 |
| 243 | Ga0068857_100002526 | 3300005577 | Bacteria | 14975 |
| 244 | Ga0068857_100003416 | 3300005577 | Bacteria | 13240 |
| 245 | Ga0068857_100019188 | 3300005577 | Bacteria | 6002 |
| 246 | Ga0068857_100046744 | 3300005577 | Bacteria | 3841 |
| 247 | Ga0068857_100208270 | 3300005577 | Bacteria | 1784 |
| 248 | Ga0068857_100483235 | 3300005577 | Bacteria | 1161 |
| 249 | Ga0068854_100008180 | 3300005578 | Bacteria | 6709 |
| 250 | Ga0068854_100028356 | 3300005578 | Bacteria | 3868 |
| 251 | Ga0068854_100156966 | 3300005578 | Bacteria | 1759 |
| 252 | Ga0068854_100377284 | 3300005578 | Bacteria | 1167 |
| 253 | Ga0068854_100563792 | 3300005578 | Unclassified | 968 |
| 254 | Ga0068854_100755841 | 3300005578 | Bacteria | 844 |
| 255 | Ga0068854_101246911 | 3300005578 | Unclassified | 668 |
| 256 | Ga0068856_100001843 | 3300005614 | Bacteria | 22170 |
| 257 | Ga0068856_100003176 | 3300005614 | Bacteria | 16724 |
| 258 | Ga0068856_100006401 | 3300005614 | Bacteria | 11552 |
| 259 | Ga0068856_100010274 | 3300005614 | Bacteria | 9098 |
| 260 | Ga0068856_100117286 | 3300005614 | Bacteria | 2662 |
| 261 | Ga0068856_100130865 | 3300005614 | Bacteria | 2514 |
| 262 | Ga0068856_100163906 | 3300005614 | Unclassified | 2234 |
| 263 | Ga0068856_100201185 | 3300005614 | Bacteria | 2006 |
| 264 | Ga0068856_100390989 | 3300005614 | Bacteria | 1410 |
| 265 | Ga0068856_100409019 | 3300005614 | Bacteria | 1376 |
| 266 | Ga0068856_101103241 | 3300005614 | Unclassified | 811 |
| 267 | Ga0068856_101920204 | 3300005614 | Unclassified | 603 |
| 268 | Ga0070702_100018406 | 3300005615 | Bacteria | 3624 |
| 269 | Ga0070702_100276386 | 3300005615 | Unclassified | 1151 |
| 270 | Ga0068852_100013961 | 3300005616 | Bacteria | 6162 |
| 271 | Ga0068852_100091062 | 3300005616 | Bacteria | 2728 |
| 272 | Ga0068852_100095008 | 3300005616 | Unclassified | 2676 |
| 273 | Ga0068852_100101898 | 3300005616 | Unclassified | 2593 |
| 274 | Ga0068852_100130290 | 3300005616 | Bacteria | 2315 |
| 275 | Ga0068852_100483508 | 3300005616 | Bacteria | 1231 |
| 276 | Ga0068859_100000701 | 3300005617 | Bacteria | 33613 |
| 277 | Ga0068859_100041442 | 3300005617 | Unclassified | 4624 |
| 278 | Ga0068859_100460849 | 3300005617 | Unclassified | 1367 |
| 279 | Ga0068864_100000898 | 3300005618 | Bacteria | 25059 |
| 280 | Ga0068864_100004265 | 3300005618 | Bacteria | 11763 |
| 281 | Ga0068864_100033118 | 3300005618 | Bacteria | 4392 |
| 282 | Ga0068864_100444896 | 3300005618 | Bacteria | 1238 |
| 283 | Ga0068864_101172263 | 3300005618 | Bacteria | 766 |
| 284 | Ga0068866_10003082 | 3300005718 | Bacteria | 6871 |
| 285 | Ga0068866_10004230 | 3300005718 | Bacteria | 5896 |
| 286 | Ga0068866_10025202 | 3300005718 | Bacteria | 2793 |
| 287 | Ga0068866_10173257 | 3300005718 | Bacteria | 1268 |
| 288 | Ga0068866_10336810 | 3300005718 | Bacteria | 954 |
| 289 | Ga0068861_100015560 | 3300005719 | Bacteria | 5363 |
| 290 | Ga0068861_100271795 | 3300005719 | Bacteria | 1456 |
| 291 | Ga0068861_102459930 | 3300005719 | Bacteria | 524 |
| 292 | Ga0068851_10003628 | 3300005834 | Bacteria | 6885 |
| 293 | Ga0068851_10005203 | 3300005834 | Bacteria | 5902 |
| 294 | Ga0068851_10296451 | 3300005834 | Unclassified | 929 |
| 295 | Ga0068851_10420709 | 3300005834 | Bacteria | 789 |
| 296 | Ga0068870_10007715 | 3300005840 | Bacteria | 4809 |
| 297 | Ga0068870_10053961 | 3300005840 | Unclassified | 2136 |
| 298 | Ga0068863_100015433 | 3300005841 | Bacteria | 7343 |
| 299 | Ga0068863_100027051 | 3300005841 | Bacteria | 5471 |
| 300 | Ga0068863_101089966 | 3300005841 | Unclassified | 803 |
| 301 | Ga0068863_101132770 | 3300005841 | Unclassified | 787 |
| 302 | Ga0068863_101602181 | 3300005841 | Bacteria | 660 |
| 303 | Ga0068858_100004311 | 3300005842 | Bacteria | 13975 |
| 304 | Ga0068858_100007568 | 3300005842 | Bacteria | 10492 |
| 305 | Ga0068858_100027352 | 3300005842 | Bacteria | 5299 |
| 306 | Ga0068858_100040178 | 3300005842 | Unclassified | 4337 |
| 307 | Ga0068858_100089158 | 3300005842 | Unclassified | 2870 |
| 308 | Ga0068858_100347177 | 3300005842 | Bacteria | 1421 |
| 309 | Ga0068858_100950185 | 3300005842 | Bacteria | 841 |
| 310 | Ga0068858_101378231 | 3300005842 | Unclassified | 694 |
| 311 | Ga0068860_100009860 | 3300005843 | Bacteria | 9474 |
| 312 | Ga0068860_100017458 | 3300005843 | Bacteria | 6991 |
| 313 | Ga0068860_100035297 | 3300005843 | Bacteria | 4797 |
| 314 | Ga0068860_100145127 | 3300005843 | Bacteria | 2283 |
| 315 | Ga0068860_100332877 | 3300005843 | Bacteria | 1492 |
| 316 | Ga0068860_100350467 | 3300005843 | Bacteria | 1453 |
| 317 | Ga0068862_100115022 | 3300005844 | Bacteria | 2365 |
| 318 | Ga0068862_100126513 | 3300005844 | Unclassified | 2256 |
| 319 | Ga0068862_100166702 | 3300005844 | Bacteria | 1969 |
| 320 | Ga0081540_1029989 | 3300005983 | Bacteria | 3019 |
| 321 | Ga0070717_10001624 | 3300006028 | Bacteria | 15590 |
| 322 | Ga0070717_10021380 | 3300006028 | Bacteria | 5098 |
| 323 | Ga0070717_10021949 | 3300006028 | Bacteria | 5037 |
| 324 | Ga0070717_10046559 | 3300006028 | Unclassified | 3549 |
| 325 | Ga0070717_10062672 | 3300006028 | Bacteria | 3084 |
| 326 | Ga0070717_10068572 | 3300006028 | Bacteria | 2952 |
| 327 | Ga0070717_10083898 | 3300006028 | Bacteria | 2680 |
| 328 | Ga0070717_10124061 | 3300006028 | Bacteria | 2215 |
| 329 | Ga0070717_10140175 | 3300006028 | Bacteria | 2085 |
| 330 | Ga0070717_10361126 | 3300006028 | Bacteria | 1300 |
| 331 | Ga0070717_10683162 | 3300006028 | Bacteria | 932 |
| 332 | Ga0070717_10728881 | 3300006028 | Bacteria | 901 |
| 333 | Ga0070717_10786156 | 3300006028 | Bacteria | 866 |
| 334 | Ga0070715_10002746 | 3300006163 | Bacteria | 5462 |
| 335 | Ga0070715_10145704 | 3300006163 | Bacteria | 1155 |
| 336 | Ga0070715_10351178 | 3300006163 | Unclassified | 805 |
| 337 | Ga0070715_10497835 | 3300006163 | Bacteria | 697 |
| 338 | Ga0070716_100006183 | 3300006173 | Bacteria | 5846 |
| 339 | Ga0070716_100010270 | 3300006173 | Bacteria | 4691 |
| 340 | Ga0070716_100017856 | 3300006173 | Bacteria | 3687 |
| 341 | Ga0070716_100035542 | 3300006173 | Bacteria | 2740 |
| 342 | Ga0070716_100040078 | 3300006173 | Unclassified | 2604 |
| 343 | Ga0070716_100097023 | 3300006173 | Unclassified | 1798 |
| 344 | Ga0070716_100135725 | 3300006173 | Bacteria | 1562 |
| 345 | Ga0070716_100194494 | 3300006173 | Unclassified | 1343 |
| 346 | Ga0070716_100574404 | 3300006173 | Bacteria | 844 |
| 347 | Ga0070716_100643141 | 3300006173 | Bacteria | 803 |
| 348 | Ga0070716_100662576 | 3300006173 | Unclassified | 793 |
| 349 | Ga0070716_100727090 | 3300006173 | Unclassified | 761 |
| 350 | Ga0070712_100000262 | 3300006175 | Bacteria | 29465 |
| 351 | Ga0070712_100000618 | 3300006175 | Bacteria | 20900 |
| 352 | Ga0070712_100014067 | 3300006175 | Bacteria | 5131 |
| 353 | Ga0070712_100021621 | 3300006175 | Unclassified | 4227 |
| 354 | Ga0070712_100198500 | 3300006175 | Bacteria | 1574 |
| 355 | Ga0070712_100489788 | 3300006175 | Bacteria | 1029 |
| 356 | Ga0070712_100516188 | 3300006175 | Bacteria | 1003 |
| 357 | Ga0070712_100628293 | 3300006175 | Unclassified | 911 |
| 358 | Ga0070712_101611585 | 3300006175 | Unclassified | 568 |
| 359 | Ga0097621_100000395 | 3300006237 | Bacteria | 30394 |
| 360 | Ga0097621_100002712 | 3300006237 | Bacteria | 12122 |
| 361 | Ga0097621_100003022 | 3300006237 | Bacteria | 11552 |
| 362 | Ga0097621_100079134 | 3300006237 | Bacteria | 2732 |
| 363 | Ga0097621_100079567 | 3300006237 | Bacteria | 2725 |
| 364 | Ga0097621_100429914 | 3300006237 | Bacteria | 1186 |
| 365 | Ga0097621_100533616 | 3300006237 | Bacteria | 1066 |
| 366 | Ga0068871_100002563 | 3300006358 | Bacteria | 12410 |
| 367 | Ga0068871_100003240 | 3300006358 | Bacteria | 11162 |
| 368 | Ga0068871_100004336 | 3300006358 | Bacteria | 9854 |
| 369 | Ga0068871_100013189 | 3300006358 | Bacteria | 6129 |
| 370 | Ga0068871_100160110 | 3300006358 | Bacteria | 1925 |
| 371 | Ga0068871_100602234 | 3300006358 | Bacteria | 999 |
| 372 | Ga0068871_100855222 | 3300006358 | Bacteria | 841 |
| 373 | Ga0068871_100913868 | 3300006358 | Unclassified | 814 |
| 374 | Ga0068871_102348984 | 3300006358 | Bacteria | 508 |
| 375 | Ga0075434_100040746 | 3300006871 | Bacteria | 4600 |
| 376 | Ga0068865_100056677 | 3300006881 | Unclassified | 2731 |
| 377 | Ga0068865_100153636 | 3300006881 | Bacteria | 1748 |
| 378 | Ga0068865_100223121 | 3300006881 | Unclassified | 1474 |
| 379 | Ga0075436_100043910 | 3300006914 | Bacteria | 3081 |
| 380 | Ga0075436_100255810 | 3300006914 | Bacteria | 1248 |
| 381 | Ga0075436_100504967 | 3300006914 | Bacteria | 885 |
| 382 | Ga0097620_100000701 | 3300006931 | Bacteria | 33613 |
| 383 | Ga0097620_100041447 | 3300006931 | Unclassified | 4624 |
| 384 | Ga0097620_100460909 | 3300006931 | Unclassified | 1367 |
| 385 | Ga0075435_100002238 | 3300007076 | Bacteria | 12768 |
| 386 | Ga0075435_100020692 | 3300007076 | Bacteria | 5049 |
| 387 | Ga0099794_10299963 | 3300007265 | Unclassified | 832 |
| 388 | Ga0099795_10071509 | 3300007788 | Bacteria | 1310 |
| 389 | Ga0099795_10537264 | 3300007788 | Unclassified | 549 |
| 390 | Ga0105250_10030931 | 3300009092 | Bacteria | 2151 |
| 391 | Ga0105250_10143281 | 3300009092 | Bacteria | 991 |
| 392 | Ga0105240_10004122 | 3300009093 | Bacteria | 22309 |
| 393 | Ga0105240_10028901 | 3300009093 | Bacteria | 7232 |
| 394 | Ga0105240_10043903 | 3300009093 | Bacteria | 5685 |
| 395 | Ga0105240_10053354 | 3300009093 | Bacteria | 5074 |
| 396 | Ga0105240_10063666 | 3300009093 | Bacteria | 4586 |
| 397 | Ga0105240_10115193 | 3300009093 | Bacteria | 3246 |
| 398 | Ga0105240_10213366 | 3300009093 | Bacteria | 2254 |
| 399 | Ga0105240_10317271 | 3300009093 | Bacteria | 1777 |
| 400 | Ga0105240_10835130 | 3300009093 | Unclassified | 996 |
| 401 | Ga0105240_12136897 | 3300009093 | Unclassified | 581 |
| 402 | Ga0105240_12473754 | 3300009093 | Unclassified | 537 |
| 403 | Ga0105245_10003672 | 3300009098 | Bacteria | 13701 |
| 404 | Ga0105245_10004606 | 3300009098 | Bacteria | 12176 |
| 405 | Ga0105245_10087165 | 3300009098 | Bacteria | 2865 |
| 406 | Ga0105245_10125943 | 3300009098 | Bacteria | 2398 |
| 407 | Ga0105245_10588375 | 3300009098 | Bacteria | 1138 |
| 408 | Ga0105245_11463057 | 3300009098 | Unclassified | 734 |
| 409 | Ga0105247_10039588 | 3300009101 | Bacteria | 2880 |
| 410 | Ga0105247_10078286 | 3300009101 | Bacteria | 2079 |
| 411 | Ga0105247_10534222 | 3300009101 | Unclassified | 860 |
| 412 | Ga0105247_10566286 | 3300009101 | Unclassified | 837 |
| 413 | Ga0105247_11087198 | 3300009101 | Bacteria | 630 |
| 414 | Ga0105243_10443582 | 3300009148 | Bacteria | 1216 |
| 415 | Ga0105241_10027499 | 3300009174 | Bacteria | 4236 |
| 416 | Ga0105241_10030638 | 3300009174 | Unclassified | 4022 |
| 417 | Ga0105241_10031395 | 3300009174 | Bacteria | 3978 |
| 418 | Ga0105241_10034345 | 3300009174 | Bacteria | 3809 |
| 419 | Ga0105241_10068487 | 3300009174 | Unclassified | 2750 |
| 420 | Ga0105241_10120553 | 3300009174 | Bacteria | 2111 |
| 421 | Ga0105241_10273178 | 3300009174 | Bacteria | 1441 |
| 422 | Ga0105241_10576705 | 3300009174 | Unclassified | 1013 |
| 423 | Ga0105241_10602600 | 3300009174 | Bacteria | 992 |
| 424 | Ga0105241_11411019 | 3300009174 | Unclassified | 667 |
| 425 | Ga0105242_10057049 | 3300009176 | Bacteria | 3197 |
| 426 | Ga0105242_10113431 | 3300009176 | Bacteria | 2314 |
| 427 | Ga0105242_10114162 | 3300009176 | Bacteria | 2307 |
| 428 | Ga0105242_10134757 | 3300009176 | Bacteria | 2136 |
| 429 | Ga0105242_10267583 | 3300009176 | Unclassified | 1547 |
| 430 | Ga0105242_10692683 | 3300009176 | Unclassified | 996 |
| 431 | Ga0105248_10004109 | 3300009177 | Bacteria | 16097 |
| 432 | Ga0105248_10116785 | 3300009177 | Bacteria | 3009 |
| 433 | Ga0105248_10119865 | 3300009177 | Bacteria | 2968 |
| 434 | Ga0105248_10168973 | 3300009177 | Bacteria | 2465 |
| 435 | Ga0105248_10286340 | 3300009177 | Bacteria | 1855 |
| 436 | Ga0105248_10313783 | 3300009177 | Bacteria | 1766 |
| 437 | Ga0105248_10437215 | 3300009177 | Bacteria | 1474 |
| 438 | Ga0105237_10039282 | 3300009545 | Unclassified | 4778 |
| 439 | Ga0105237_10043379 | 3300009545 | Unclassified | 4531 |
| 440 | Ga0105237_10106206 | 3300009545 | Bacteria | 2800 |
| 441 | Ga0105237_10119405 | 3300009545 | Bacteria | 2630 |
| 442 | Ga0105237_10154158 | 3300009545 | Bacteria | 2294 |
| 443 | Ga0105237_10381271 | 3300009545 | Unclassified | 1415 |
| 444 | Ga0105237_10582395 | 3300009545 | Bacteria | 1126 |
| 445 | Ga0105237_10769833 | 3300009545 | Unclassified | 969 |
| 446 | Ga0105238_10000860 | 3300009551 | Bacteria | 31345 |
| 447 | Ga0105238_10017227 | 3300009551 | Bacteria | 7341 |
| 448 | Ga0105238_10033615 | 3300009551 | Bacteria | 5219 |
| 449 | Ga0105238_10246160 | 3300009551 | Bacteria | 1766 |
| 450 | Ga0105238_10724070 | 3300009551 | Bacteria | 1008 |
| 451 | Ga0105238_10983331 | 3300009551 | Bacteria | 864 |
| 452 | Ga0105238_11214246 | 3300009551 | Bacteria | 779 |
| 453 | Ga0105238_11482996 | 3300009551 | Bacteria | 707 |
| 454 | Ga0105238_11552187 | 3300009551 | Unclassified | 691 |
| 455 | Ga0105238_11624012 | 3300009551 | Unclassified | 677 |
| 456 | Ga0105238_12436512 | 3300009551 | Unclassified | 559 |
| 457 | Ga0105249_10047876 | 3300009553 | Bacteria | 3897 |
| 458 | Ga0105249_10976651 | 3300009553 | Unclassified | 915 |
| 459 | Ga0105249_11924854 | 3300009553 | Unclassified | 664 |
| 460 | Ga0099796_10228722 | 3300010159 | Unclassified | 765 |
| 461 | Ga0105239_10016353 | 3300010375 | Bacteria | 8204 |
| 462 | Ga0105239_10018909 | 3300010375 | Bacteria | 7612 |
| 463 | Ga0105239_10031708 | 3300010375 | Bacteria | 5808 |
| 464 | Ga0105239_10069561 | 3300010375 | Bacteria | 3867 |
| 465 | Ga0105239_10303205 | 3300010375 | Bacteria | 1799 |
| 466 | Ga0105239_10446041 | 3300010375 | Bacteria | 1468 |
| 467 | Ga0105239_11100898 | 3300010375 | Bacteria | 914 |
| 468 | Ga0105239_12149753 | 3300010375 | Unclassified | 649 |
| 469 | Ga0105246_10020423 | 3300011119 | Bacteria | 4247 |
| 470 | Ga0105246_10100687 | 3300011119 | Bacteria | 2103 |
| 471 | Ga0105246_10308167 | 3300011119 | Bacteria | 1281 |
| 472 | Ga0105246_10446110 | 3300011119 | Bacteria | 1086 |
| 473 | Ga0157373_10048030 | 3300013100 | Bacteria | 3043 |
| 474 | Ga0157373_10075386 | 3300013100 | Bacteria | 2380 |
| 475 | Ga0157373_10090064 | 3300013100 | Bacteria | 2160 |
| 476 | Ga0157373_10118108 | 3300013100 | Bacteria | 1864 |
| 477 | Ga0157373_10246714 | 3300013100 | Unclassified | 1263 |
| 478 | Ga0157373_10926960 | 3300013100 | Bacteria | 647 |
| 479 | Ga0157373_10983103 | 3300013100 | Unclassified | 629 |
| 480 | Ga0157373_11177364 | 3300013100 | Bacteria | 577 |
| 481 | Ga0157371_10024160 | 3300013102 | Bacteria | 4440 |
| 482 | Ga0157371_10097970 | 3300013102 | Bacteria | 2079 |
| 483 | Ga0157371_10173764 | 3300013102 | Bacteria | 1540 |
| 484 | Ga0157370_10024789 | 3300013104 | Bacteria | 5939 |
| 485 | Ga0157370_10359451 | 3300013104 | Bacteria | 1342 |
| 486 | Ga0157370_10471765 | 3300013104 | Bacteria | 1153 |
| 487 | Ga0157370_12045484 | 3300013104 | Unclassified | 513 |
| 488 | Ga0157369_10000323 | 3300013105 | Bacteria | 64226 |
| 489 | Ga0157369_10037380 | 3300013105 | Bacteria | 5315 |
| 490 | Ga0157369_10065338 | 3300013105 | Unclassified | 3915 |
| 491 | Ga0157369_10086306 | 3300013105 | Bacteria | 3351 |
| 492 | Ga0157369_10143297 | 3300013105 | Unclassified | 2527 |
| 493 | Ga0157369_10209826 | 3300013105 | Bacteria | 2042 |
| 494 | Ga0157369_10213639 | 3300013105 | Bacteria | 2021 |
| 495 | Ga0157369_10217087 | 3300013105 | Bacteria | 2003 |
| 496 | Ga0157369_10223974 | 3300013105 | Unclassified | 1968 |
| 497 | Ga0157369_10508345 | 3300013105 | Bacteria | 1246 |
| 498 | Ga0157369_10985600 | 3300013105 | Bacteria | 863 |
| 499 | Ga0157369_11822404 | 3300013105 | Unclassified | 618 |
| 500 | Ga0157374_10000131 | 3300013296 | Bacteria | 68526 |
| 501 | Ga0157374_10000690 | 3300013296 | Bacteria | 29745 |
| 502 | Ga0157374_10003128 | 3300013296 | Bacteria | 13904 |
| 503 | Ga0157374_10003490 | 3300013296 | Bacteria | 13213 |
| 504 | Ga0157374_10051976 | 3300013296 | Bacteria | 3814 |
| 505 | Ga0157374_10166811 | 3300013296 | Bacteria | 2146 |
| 506 | Ga0157374_10235785 | 3300013296 | Bacteria | 1798 |
| 507 | Ga0157374_10494743 | 3300013296 | Bacteria | 1227 |
| 508 | Ga0157374_10696778 | 3300013296 | Bacteria | 1029 |
| 509 | Ga0157374_10913654 | 3300013296 | Bacteria | 896 |
| 510 | Ga0157374_11784568 | 3300013296 | Bacteria | 640 |
| 511 | Ga0157374_12743912 | 3300013296 | Unclassified | 520 |
| 512 | Ga0157378_10000388 | 3300013297 | Bacteria | 43382 |
| 513 | Ga0157378_10000924 | 3300013297 | Bacteria | 27038 |
| 514 | Ga0157378_10001041 | 3300013297 | Bacteria | 25328 |
| 515 | Ga0157378_10024596 | 3300013297 | Bacteria | 5302 |
| 516 | Ga0157378_10052176 | 3300013297 | Bacteria | 3639 |
| 517 | Ga0157378_10382487 | 3300013297 | Unclassified | 1382 |
| 518 | Ga0157378_11048948 | 3300013297 | Bacteria | 851 |
| 519 | Ga0163162_10002555 | 3300013306 | Bacteria | 17229 |
| 520 | Ga0163162_10023203 | 3300013306 | Bacteria | 6121 |
| 521 | Ga0163162_10223794 | 3300013306 | Bacteria | 2011 |
| 522 | Ga0163162_10226750 | 3300013306 | Bacteria | 1998 |
| 523 | Ga0163162_10677033 | 3300013306 | Unclassified | 1154 |
| 524 | Ga0163162_12103384 | 3300013306 | Unclassified | 647 |
| 525 | Ga0157372_10004337 | 3300013307 | Bacteria | 15162 |
| 526 | Ga0157372_10005053 | 3300013307 | Bacteria | 14015 |
| 527 | Ga0157372_10005073 | 3300013307 | Bacteria | 13996 |
| 528 | Ga0157372_10013765 | 3300013307 | Bacteria | 8644 |
| 529 | Ga0157372_10027852 | 3300013307 | Bacteria | 6159 |
| 530 | Ga0157372_10029627 | 3300013307 | Bacteria | 5979 |
| 531 | Ga0157372_10034206 | 3300013307 | Bacteria | 5586 |
| 532 | Ga0157372_10042655 | 3300013307 | Bacteria | 5019 |
| 533 | Ga0157372_10168594 | 3300013307 | Bacteria | 2533 |
| 534 | Ga0157372_10204928 | 3300013307 | Bacteria | 2285 |
| 535 | Ga0157372_10225186 | 3300013307 | Bacteria | 2174 |
| 536 | Ga0157372_12882713 | 3300013307 | Unclassified | 551 |
| 537 | Ga0157372_13391512 | 3300013307 | Unclassified | 507 |
| 538 | Ga0157375_10046025 | 3300013308 | Bacteria | 4250 |
| 539 | Ga0157375_10486576 | 3300013308 | Bacteria | 1399 |
| 540 | Ga0157375_12440078 | 3300013308 | Unclassified | 624 |
| 541 | Ga0157375_13353177 | 3300013308 | Unclassified | 534 |
| 542 | Ga0163163_10013744 | 3300014325 | Bacteria | 7419 |
| 543 | Ga0163163_10086425 | 3300014325 | Bacteria | 3145 |
| 544 | Ga0163163_10219353 | 3300014325 | Bacteria | 1950 |
| 545 | Ga0163163_10223620 | 3300014325 | Bacteria | 1931 |
| 546 | Ga0163163_10520580 | 3300014325 | Bacteria | 1252 |
| 547 | Ga0163163_10626428 | 3300014325 | Bacteria | 1139 |
| 548 | Ga0163163_11219014 | 3300014325 | Unclassified | 815 |
| 549 | Ga0157380_10657044 | 3300014326 | Bacteria | 1047 |
| 550 | Ga0182008_10022568 | 3300014497 | Bacteria | 3222 |
| 551 | Ga0182008_10401928 | 3300014497 | Bacteria | 736 |
| 552 | Ga0182008_10984684 | 3300014497 | Bacteria | 502 |
| 553 | Ga0157377_10000553 | 3300014745 | Bacteria | 15748 |
| 554 | Ga0157379_10020013 | 3300014968 | Bacteria | 5914 |
| 555 | Ga0157379_10129018 | 3300014968 | Bacteria | 2275 |
| 556 | Ga0157379_10212150 | 3300014968 | Bacteria | 1753 |
| 557 | Ga0157379_10351645 | 3300014968 | Bacteria | 1349 |
| 558 | Ga0157379_10983689 | 3300014968 | Bacteria | 804 |
| 559 | Ga0157376_10024322 | 3300014969 | Bacteria | 4753 |
| 560 | Ga0157376_10026459 | 3300014969 | Unclassified | 4586 |
| 561 | Ga0157376_10098234 | 3300014969 | Bacteria | 2552 |
| 562 | Ga0157376_12868544 | 3300014969 | Unclassified | 522 |
| 563 | Ga0182007_10005999 | 3300015262 | Bacteria | 5266 |
| 564 | Ga0182005_1089711 | 3300015265 | Unclassified | 854 |
| 565 | Ga0182005_1131068 | 3300015265 | Unclassified | 719 |
| 566 | Ga0182005_1176412 | 3300015265 | Bacteria | 633 |
| 567 | Ga0163161_10052956 | 3300017792 | Unclassified | 2942 |
| 568 | Ga0213873_10053011 | 3300021358 | Bacteria | 1079 |
| 569 | Ga0213876_10543186 | 3300021384 | Bacteria | 618 |
| 570 | Ga0213871_10030876 | 3300021441 | Unclassified | 1396 |
| 571 | Ga0224569_100415 | 3300022732 | Bacteria | 3632 |
| 572 | Ga0224569_104886 | 3300022732 | Unclassified | 1004 |
| 573 | Ga0224571_100576 | 3300022734 | Unclassified | 2080 |
| 574 | Ga0224571_105902 | 3300022734 | Bacteria | 809 |
| 575 | Ga0224572_1010953 | 3300024225 | Bacteria | 1712 |
| 576 | Ga0224572_1034169 | 3300024225 | Unclassified | 966 |
| 577 | Ga0224572_1046485 | 3300024225 | Unclassified | 813 |
| 578 | Ga0228598_1004427 | 3300024227 | Bacteria | 2975 |
| 579 | Ga0228598_1037914 | 3300024227 | Bacteria | 950 |
| 580 | Ga0207697_10011415 | 3300025315 | Bacteria | 3757 |
| 581 | Ga0207656_10018748 | 3300025321 | Unclassified | 2728 |
| 582 | Ga0207656_10098824 | 3300025321 | Unclassified | 1335 |
| 583 | Ga0207656_10307005 | 3300025321 | Bacteria | 786 |
| 584 | Ga0207696_1049382 | 3300025711 | Bacteria | 1207 |
| 585 | Ga0207682_10152652 | 3300025893 | Bacteria | 1042 |
| 586 | Ga0207682_10498100 | 3300025893 | Unclassified | 577 |
| 587 | Ga0207692_10005687 | 3300025898 | Bacteria | 5008 |
| 588 | Ga0207692_10040412 | 3300025898 | Bacteria | 2301 |
| 589 | Ga0207692_10178878 | 3300025898 | Unclassified | 1234 |
| 590 | Ga0207692_10315219 | 3300025898 | Unclassified | 956 |
| 591 | Ga0207692_10504790 | 3300025898 | Bacteria | 768 |
| 592 | Ga0207642_10034045 | 3300025899 | Bacteria | 2162 |
| 593 | Ga0207642_10048007 | 3300025899 | Bacteria | 1912 |
| 594 | Ga0207642_10059580 | 3300025899 | Unclassified | 1766 |
| 595 | Ga0207642_10074477 | 3300025899 | Bacteria | 1627 |
| 596 | Ga0207642_10134282 | 3300025899 | Bacteria | 1296 |
| 597 | Ga0207710_10006323 | 3300025900 | Bacteria | 5064 |
| 598 | Ga0207710_10059872 | 3300025900 | Unclassified | 1725 |
| 599 | Ga0207688_10012092 | 3300025901 | Bacteria | 4695 |
| 600 | Ga0207680_10012624 | 3300025903 | Bacteria | 4309 |
| 601 | Ga0207680_10026106 | 3300025903 | Bacteria | 3233 |
| 602 | Ga0207680_10852426 | 3300025903 | Unclassified | 653 |
| 603 | Ga0207647_10006337 | 3300025904 | Bacteria | 8607 |
| 604 | Ga0207647_10008116 | 3300025904 | Bacteria | 7543 |
| 605 | Ga0207647_10400539 | 3300025904 | Unclassified | 773 |
| 606 | Ga0207647_10480216 | 3300025904 | Bacteria | 694 |
| 607 | Ga0207685_10097593 | 3300025905 | Archaea | 1250 |
| 608 | Ga0207699_10000209 | 3300025906 | Bacteria | 34945 |
| 609 | Ga0207699_10029486 | 3300025906 | Bacteria | 3060 |
| 610 | Ga0207699_10144010 | 3300025906 | Bacteria | 1569 |
| 611 | Ga0207699_10155059 | 3300025906 | Bacteria | 1519 |
| 612 | Ga0207699_10248059 | 3300025906 | Bacteria | 1226 |
| 613 | Ga0207699_10360745 | 3300025906 | Unclassified | 1027 |
| 614 | Ga0207699_10426331 | 3300025906 | Bacteria | 948 |
| 615 | Ga0207699_10435431 | 3300025906 | Unclassified | 938 |
| 616 | Ga0207699_10641451 | 3300025906 | Unclassified | 775 |
| 617 | Ga0207699_10801201 | 3300025906 | Bacteria | 693 |
| 618 | Ga0207699_11040779 | 3300025906 | Unclassified | 605 |
| 619 | Ga0207699_11458295 | 3300025906 | Unclassified | 506 |
| 620 | Ga0207645_10014919 | 3300025907 | Bacteria | 5182 |
| 621 | Ga0207645_10647076 | 3300025907 | Bacteria | 718 |
| 622 | Ga0207645_11189564 | 3300025907 | Unclassified | 512 |
| 623 | Ga0207643_10000328 | 3300025908 | Bacteria | 32545 |
| 624 | Ga0207643_10037980 | 3300025908 | Unclassified | 2704 |
| 625 | Ga0207705_10081568 | 3300025909 | Bacteria | 2357 |
| 626 | Ga0207684_10001048 | 3300025910 | Bacteria | 30878 |
| 627 | Ga0207684_10016175 | 3300025910 | Bacteria | 6410 |
| 628 | Ga0207684_10140217 | 3300025910 | Bacteria | 2078 |
| 629 | Ga0207654_10014585 | 3300025911 | Unclassified | 4061 |
| 630 | Ga0207654_10016876 | 3300025911 | Bacteria | 3810 |
| 631 | Ga0207654_10360289 | 3300025911 | Bacteria | 1003 |
| 632 | Ga0207654_10439518 | 3300025911 | Unclassified | 913 |
| 633 | Ga0207707_10001653 | 3300025912 | Bacteria | 20580 |
| 634 | Ga0207707_10012547 | 3300025912 | Bacteria | 7366 |
| 635 | Ga0207707_10063871 | 3300025912 | Bacteria | 3204 |
| 636 | Ga0207707_10484957 | 3300025912 | Bacteria | 1056 |
| 637 | Ga0207707_10485236 | 3300025912 | Unclassified | 1055 |
| 638 | Ga0207707_10882496 | 3300025912 | Bacteria | 740 |
| 639 | Ga0207707_11137113 | 3300025912 | Unclassified | 635 |
| 640 | Ga0207695_10041443 | 3300025913 | Bacteria | 4928 |
| 641 | Ga0207695_10055923 | 3300025913 | Bacteria | 4109 |
| 642 | Ga0207695_10190930 | 3300025913 | Bacteria | 1966 |
| 643 | Ga0207695_10266973 | 3300025913 | Bacteria | 1608 |
| 644 | Ga0207695_10330474 | 3300025913 | Bacteria | 1413 |
| 645 | Ga0207695_10409782 | 3300025913 | Unclassified | 1240 |
| 646 | Ga0207695_10475621 | 3300025913 | Bacteria | 1132 |
| 647 | Ga0207695_11140604 | 3300025913 | Unclassified | 660 |
| 648 | Ga0207671_10142949 | 3300025914 | Bacteria | 1845 |
| 649 | Ga0207671_10266988 | 3300025914 | Bacteria | 1348 |
| 650 | Ga0207671_10314424 | 3300025914 | Bacteria | 1238 |
| 651 | Ga0207671_10373263 | 3300025914 | Unclassified | 1133 |
| 652 | Ga0207671_10579127 | 3300025914 | Bacteria | 895 |
| 653 | Ga0207693_10000026 | 3300025915 | Bacteria | 122717 |
| 654 | Ga0207693_10000275 | 3300025915 | Bacteria | 47590 |
| 655 | Ga0207693_10013544 | 3300025915 | Bacteria | 6572 |
| 656 | Ga0207693_10041917 | 3300025915 | Bacteria | 3603 |
| 657 | Ga0207693_10050041 | 3300025915 | Bacteria | 3281 |
| 658 | Ga0207693_10475481 | 3300025915 | Unclassified | 976 |
| 659 | Ga0207693_10487383 | 3300025915 | Bacteria | 963 |
| 660 | Ga0207663_10000479 | 3300025916 | Bacteria | 17384 |
| 661 | Ga0207663_10043172 | 3300025916 | Bacteria | 2759 |
| 662 | Ga0207663_10115065 | 3300025916 | Bacteria | 1832 |
| 663 | Ga0207663_10133191 | 3300025916 | Bacteria | 1720 |
| 664 | Ga0207663_10165415 | 3300025916 | Bacteria | 1566 |
| 665 | Ga0207663_10330785 | 3300025916 | Bacteria | 1148 |
| 666 | Ga0207663_10661459 | 3300025916 | Unclassified | 825 |
| 667 | Ga0207663_11117893 | 3300025916 | Bacteria | 634 |
| 668 | Ga0207663_11189739 | 3300025916 | Unclassified | 613 |
| 669 | Ga0207660_10052201 | 3300025917 | Bacteria | 2910 |
| 670 | Ga0207660_10134124 | 3300025917 | Bacteria | 1888 |
| 671 | Ga0207660_10172760 | 3300025917 | Bacteria | 1674 |
| 672 | Ga0207662_10011391 | 3300025918 | Bacteria | 4931 |
| 673 | Ga0207657_10002285 | 3300025919 | Bacteria | 20778 |
| 674 | Ga0207657_10002326 | 3300025919 | Bacteria | 20596 |
| 675 | Ga0207657_10002602 | 3300025919 | Bacteria | 19525 |
| 676 | Ga0207649_10000612 | 3300025920 | Bacteria | 24135 |
| 677 | Ga0207649_10106961 | 3300025920 | Bacteria | 1862 |
| 678 | Ga0207649_10476179 | 3300025920 | Unclassified | 946 |
| 679 | Ga0207652_10003536 | 3300025921 | Bacteria | 12892 |
| 680 | Ga0207652_10031402 | 3300025921 | Bacteria | 4461 |
| 681 | Ga0207652_10046052 | 3300025921 | Bacteria | 3720 |
| 682 | Ga0207652_10327724 | 3300025921 | Bacteria | 1382 |
| 683 | Ga0207652_10444464 | 3300025921 | Bacteria | 1169 |
| 684 | Ga0207646_10001230 | 3300025922 | Bacteria | 32163 |
| 685 | Ga0207646_10076603 | 3300025922 | Bacteria | 2989 |
| 686 | Ga0207646_10142285 | 3300025922 | Bacteria | 2161 |
| 687 | Ga0207646_10206029 | 3300025922 | Bacteria | 1776 |
| 688 | Ga0207646_10207012 | 3300025922 | Bacteria | 1772 |
| 689 | Ga0207646_10845555 | 3300025922 | Bacteria | 814 |
| 690 | Ga0207681_10021015 | 3300025923 | Bacteria | 4143 |
| 691 | Ga0207681_10255903 | 3300025923 | Bacteria | 1369 |
| 692 | Ga0207694_10002710 | 3300025924 | Bacteria | 14344 |
| 693 | Ga0207694_10038561 | 3300025924 | Bacteria | 3674 |
| 694 | Ga0207694_10056775 | 3300025924 | Bacteria | 3041 |
| 695 | Ga0207694_10145918 | 3300025924 | Bacteria | 1905 |
| 696 | Ga0207694_10208383 | 3300025924 | Bacteria | 1592 |
| 697 | Ga0207694_10287138 | 3300025924 | Unclassified | 1352 |
| 698 | Ga0207650_10000152 | 3300025925 | Bacteria | 83134 |
| 699 | Ga0207650_10002883 | 3300025925 | Bacteria | 11878 |
| 700 | Ga0207650_10805378 | 3300025925 | Bacteria | 796 |
| 701 | Ga0207650_10996740 | 3300025925 | Unclassified | 712 |
| 702 | Ga0207659_11422123 | 3300025926 | Bacteria | 594 |
| 703 | Ga0207687_10002291 | 3300025927 | Bacteria | 13037 |
| 704 | Ga0207687_10018465 | 3300025927 | Bacteria | 4604 |
| 705 | Ga0207687_10020665 | 3300025927 | Bacteria | 4369 |
| 706 | Ga0207687_10412635 | 3300025927 | Bacteria | 1113 |
| 707 | Ga0207687_11466307 | 3300025927 | Bacteria | 586 |
| 708 | Ga0207700_10000306 | 3300025928 | Bacteria | 28993 |
| 709 | Ga0207700_10000979 | 3300025928 | Bacteria | 16486 |
| 710 | Ga0207700_10002156 | 3300025928 | Bacteria | 11277 |
| 711 | Ga0207700_10036292 | 3300025928 | Bacteria | 3558 |
| 712 | Ga0207700_10057403 | 3300025928 | Unclassified | 2935 |
| 713 | Ga0207700_10265343 | 3300025928 | Bacteria | 1472 |
| 714 | Ga0207700_10615410 | 3300025928 | Bacteria | 967 |
| 715 | Ga0207700_10822379 | 3300025928 | Unclassified | 831 |
| 716 | Ga0207700_10873893 | 3300025928 | Unclassified | 805 |
| 717 | Ga0207700_10896078 | 3300025928 | Bacteria | 794 |
| 718 | Ga0207700_11123708 | 3300025928 | Bacteria | 702 |
| 719 | Ga0207700_11741819 | 3300025928 | Unclassified | 549 |
| 720 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 721 | Ga0207664_10002140 | 3300025929 | Bacteria | 13003 |
| 722 | Ga0207664_10032225 | 3300025929 | Bacteria | 4015 |
| 723 | Ga0207664_10042713 | 3300025929 | Bacteria | 3541 |
| 724 | Ga0207664_10120591 | 3300025929 | Bacteria | 2194 |
| 725 | Ga0207664_10138029 | 3300025929 | Bacteria | 2059 |
| 726 | Ga0207664_10245128 | 3300025929 | Bacteria | 1562 |
| 727 | Ga0207664_10345860 | 3300025929 | Bacteria | 1315 |
| 728 | Ga0207664_10561603 | 3300025929 | Unclassified | 1024 |
| 729 | Ga0207664_10586846 | 3300025929 | Unclassified | 1000 |
| 730 | Ga0207664_10684951 | 3300025929 | Unclassified | 922 |
| 731 | Ga0207664_11580792 | 3300025929 | Unclassified | 578 |
| 732 | Ga0207644_10046547 | 3300025931 | Bacteria | 3091 |
| 733 | Ga0207644_10301436 | 3300025931 | Bacteria | 1291 |
| 734 | Ga0207644_10472450 | 3300025931 | Unclassified | 1032 |
| 735 | Ga0207690_10062265 | 3300025932 | Bacteria | 2539 |
| 736 | Ga0207690_10220679 | 3300025932 | Bacteria | 1450 |
| 737 | Ga0207706_10000740 | 3300025933 | Bacteria | 34067 |
| 738 | Ga0207706_10002545 | 3300025933 | Bacteria | 17768 |
| 739 | Ga0207686_10061537 | 3300025934 | Bacteria | 2380 |
| 740 | Ga0207686_10077765 | 3300025934 | Bacteria | 2155 |
| 741 | Ga0207686_10107934 | 3300025934 | Bacteria | 1872 |
| 742 | Ga0207686_10189208 | 3300025934 | Bacteria | 1466 |
| 743 | Ga0207686_10234734 | 3300025934 | Unclassified | 1332 |
| 744 | Ga0207686_10604012 | 3300025934 | Unclassified | 864 |
| 745 | Ga0207709_10870831 | 3300025935 | Unclassified | 731 |
| 746 | Ga0207670_10065300 | 3300025936 | Bacteria | 2497 |
| 747 | Ga0207670_11432283 | 3300025936 | Bacteria | 587 |
| 748 | Ga0207669_10389576 | 3300025937 | Unclassified | 1088 |
| 749 | Ga0207669_10886659 | 3300025937 | Unclassified | 744 |
| 750 | Ga0207704_10050127 | 3300025938 | Bacteria | 2517 |
| 751 | Ga0207704_11241827 | 3300025938 | Bacteria | 636 |
| 752 | Ga0207665_10004916 | 3300025939 | Bacteria | 8908 |
| 753 | Ga0207665_10016139 | 3300025939 | Bacteria | 4905 |
| 754 | Ga0207665_10075882 | 3300025939 | Bacteria | 2303 |
| 755 | Ga0207665_10083911 | 3300025939 | Bacteria | 2198 |
| 756 | Ga0207665_10162389 | 3300025939 | Bacteria | 1608 |
| 757 | Ga0207665_10173358 | 3300025939 | Unclassified | 1559 |
| 758 | Ga0207665_10204113 | 3300025939 | Unclassified | 1441 |
| 759 | Ga0207665_10206920 | 3300025939 | Unclassified | 1432 |
| 760 | Ga0207665_10209987 | 3300025939 | Bacteria | 1422 |
| 761 | Ga0207665_10298961 | 3300025939 | Bacteria | 1203 |
| 762 | Ga0207665_10529123 | 3300025939 | Bacteria | 914 |
| 763 | Ga0207665_11043946 | 3300025939 | Unclassified | 651 |
| 764 | Ga0207665_11626228 | 3300025939 | Unclassified | 512 |
| 765 | Ga0207691_10000308 | 3300025940 | Bacteria | 48637 |
| 766 | Ga0207711_10012353 | 3300025941 | Bacteria | 7097 |
| 767 | Ga0207711_10030535 | 3300025941 | Unclassified | 4546 |
| 768 | Ga0207711_10120261 | 3300025941 | Bacteria | 2344 |
| 769 | Ga0207711_10132547 | 3300025941 | Bacteria | 2236 |
| 770 | Ga0207711_10753334 | 3300025941 | Unclassified | 908 |
| 771 | Ga0207689_10000618 | 3300025942 | Bacteria | 33979 |
| 772 | Ga0207689_10083123 | 3300025942 | Bacteria | 2633 |
| 773 | Ga0207689_10126520 | 3300025942 | Bacteria | 2102 |
| 774 | Ga0207689_10169489 | 3300025942 | Unclassified | 1799 |
| 775 | Ga0207661_10001294 | 3300025944 | Bacteria | 16735 |
| 776 | Ga0207661_10079525 | 3300025944 | Unclassified | 2702 |
| 777 | Ga0207661_10093522 | 3300025944 | Unclassified | 2509 |
| 778 | Ga0207661_10165526 | 3300025944 | Bacteria | 1921 |
| 779 | Ga0207661_10760068 | 3300025944 | Bacteria | 892 |
| 780 | Ga0207661_11924867 | 3300025944 | Unclassified | 537 |
| 781 | Ga0207679_10000298 | 3300025945 | Bacteria | 37205 |
| 782 | Ga0207679_10078451 | 3300025945 | Bacteria | 2516 |
| 783 | Ga0207679_10355093 | 3300025945 | Bacteria | 1279 |
| 784 | Ga0207679_10475074 | 3300025945 | Bacteria | 1112 |
| 785 | Ga0207667_10000802 | 3300025949 | Bacteria | 40809 |
| 786 | Ga0207667_10008703 | 3300025949 | Bacteria | 12029 |
| 787 | Ga0207667_10015779 | 3300025949 | Bacteria | 8566 |
| 788 | Ga0207667_10095689 | 3300025949 | Bacteria | 3065 |
| 789 | Ga0207667_10147641 | 3300025949 | Bacteria | 2420 |
| 790 | Ga0207667_10242636 | 3300025949 | Bacteria | 1844 |
| 791 | Ga0207667_10299668 | 3300025949 | Bacteria | 1642 |
| 792 | Ga0207667_10884280 | 3300025949 | Bacteria | 886 |
| 793 | Ga0207667_11262549 | 3300025949 | Unclassified | 716 |
| 794 | Ga0207667_12174771 | 3300025949 | Unclassified | 512 |
| 795 | Ga0207651_10028023 | 3300025960 | Bacteria | 3546 |
| 796 | Ga0207651_10885775 | 3300025960 | Bacteria | 794 |
| 797 | Ga0207651_11016547 | 3300025960 | Bacteria | 741 |
| 798 | Ga0207712_10013356 | 3300025961 | Bacteria | 5263 |
| 799 | Ga0207712_10527738 | 3300025961 | Bacteria | 1013 |
| 800 | Ga0207712_10732646 | 3300025961 | Unclassified | 865 |
| 801 | Ga0207712_11154393 | 3300025961 | Unclassified | 690 |
| 802 | Ga0207712_11459658 | 3300025961 | Unclassified | 612 |
| 803 | Ga0207668_10253118 | 3300025972 | Bacteria | 1431 |
| 804 | Ga0207668_10875249 | 3300025972 | Bacteria | 798 |
| 805 | Ga0207640_10025994 | 3300025981 | Bacteria | 3551 |
| 806 | Ga0207640_10058926 | 3300025981 | Bacteria | 2532 |
| 807 | Ga0207640_10169301 | 3300025981 | Bacteria | 1626 |
| 808 | Ga0207640_10223881 | 3300025981 | Bacteria | 1442 |
| 809 | Ga0207640_10393682 | 3300025981 | Bacteria | 1126 |
| 810 | Ga0207640_11443187 | 3300025981 | Unclassified | 617 |
| 811 | Ga0207658_10164606 | 3300025986 | Bacteria | 1820 |
| 812 | Ga0207658_11072761 | 3300025986 | Unclassified | 735 |
| 813 | Ga0207658_11951055 | 3300025986 | Unclassified | 535 |
| 814 | Ga0207677_10002182 | 3300026023 | Bacteria | 10290 |
| 815 | Ga0207677_10050324 | 3300026023 | Unclassified | 2818 |
| 816 | Ga0207677_10055739 | 3300026023 | Unclassified | 2705 |
| 817 | Ga0207677_11204727 | 3300026023 | Bacteria | 693 |
| 818 | Ga0207677_12268125 | 3300026023 | Unclassified | 505 |
| 819 | Ga0207703_10006614 | 3300026035 | Bacteria | 9248 |
| 820 | Ga0207703_10290929 | 3300026035 | Bacteria | 1487 |
| 821 | Ga0207703_10811364 | 3300026035 | Bacteria | 894 |
| 822 | Ga0207703_11339989 | 3300026035 | Unclassified | 688 |
| 823 | Ga0207703_11774022 | 3300026035 | Bacteria | 593 |
| 824 | Ga0207639_10034908 | 3300026041 | Unclassified | 3720 |
| 825 | Ga0207639_10463259 | 3300026041 | Bacteria | 1153 |
| 826 | Ga0207639_10719020 | 3300026041 | Unclassified | 927 |
| 827 | Ga0207678_10001414 | 3300026067 | Bacteria | 22033 |
| 828 | Ga0207678_10006402 | 3300026067 | Bacteria | 10457 |
| 829 | Ga0207678_10087345 | 3300026067 | Bacteria | 2665 |
| 830 | Ga0207678_10536629 | 3300026067 | Bacteria | 1022 |
| 831 | Ga0207708_10281715 | 3300026075 | Bacteria | 1347 |
| 832 | Ga0207702_10001466 | 3300026078 | Bacteria | 23418 |
| 833 | Ga0207702_10006585 | 3300026078 | Bacteria | 9985 |
| 834 | Ga0207702_10007672 | 3300026078 | Bacteria | 9173 |
| 835 | Ga0207702_10030165 | 3300026078 | Bacteria | 4518 |
| 836 | Ga0207702_10220885 | 3300026078 | Bacteria | 1766 |
| 837 | Ga0207702_10256086 | 3300026078 | Bacteria | 1646 |
| 838 | Ga0207702_10786502 | 3300026078 | Bacteria | 940 |
| 839 | Ga0207702_11961894 | 3300026078 | Unclassified | 576 |
| 840 | Ga0207641_10000052 | 3300026088 | Bacteria | 173672 |
| 841 | Ga0207641_10014828 | 3300026088 | Bacteria | 6389 |
| 842 | Ga0207641_10035964 | 3300026088 | Unclassified | 4131 |
| 843 | Ga0207641_10836545 | 3300026088 | Bacteria | 912 |
| 844 | Ga0207641_11090066 | 3300026088 | Unclassified | 797 |
| 845 | Ga0207641_11228068 | 3300026088 | Unclassified | 749 |
| 846 | Ga0207648_10001643 | 3300026089 | Bacteria | 24510 |
| 847 | Ga0207648_10003472 | 3300026089 | Bacteria | 16526 |
| 848 | Ga0207648_10014202 | 3300026089 | Bacteria | 7366 |
| 849 | Ga0207676_10000176 | 3300026095 | Bacteria | 56110 |
| 850 | Ga0207676_10001129 | 3300026095 | Bacteria | 20170 |
| 851 | Ga0207676_10004043 | 3300026095 | Bacteria | 10345 |
| 852 | Ga0207676_10124788 | 3300026095 | Bacteria | 2178 |
| 853 | Ga0207676_10915527 | 3300026095 | Bacteria | 861 |
| 854 | Ga0207674_10000125 | 3300026116 | Bacteria | 89047 |
| 855 | Ga0207674_10000561 | 3300026116 | Bacteria | 48618 |
| 856 | Ga0207674_10005435 | 3300026116 | Bacteria | 15129 |
| 857 | Ga0207674_10026155 | 3300026116 | Bacteria | 6208 |
| 858 | Ga0207674_10122742 | 3300026116 | Bacteria | 2564 |
| 859 | Ga0207674_10123814 | 3300026116 | Bacteria | 2551 |
| 860 | Ga0207674_10413522 | 3300026116 | Bacteria | 1303 |
| 861 | Ga0207675_100027751 | 3300026118 | Bacteria | 5273 |
| 862 | Ga0207675_100163396 | 3300026118 | Bacteria | 2125 |
| 863 | Ga0207675_101574796 | 3300026118 | Bacteria | 678 |
| 864 | Ga0207683_10002524 | 3300026121 | Bacteria | 15984 |
| 865 | Ga0207683_10498632 | 3300026121 | Unclassified | 1124 |
| 866 | Ga0207683_10793578 | 3300026121 | Bacteria | 879 |
| 867 | Ga0207683_10822407 | 3300026121 | Bacteria | 862 |
| 868 | Ga0207683_11768994 | 3300026121 | Unclassified | 567 |
| 869 | Ga0207698_10022855 | 3300026142 | Unclassified | 4358 |
| 870 | Ga0207698_10084521 | 3300026142 | Unclassified | 2573 |
| 871 | Ga0207698_10531712 | 3300026142 | Bacteria | 1149 |
| 872 | Ga0207698_10703927 | 3300026142 | Bacteria | 1005 |
| 873 | Ga0207698_10910326 | 3300026142 | Unclassified | 887 |
| 874 | Ga0207698_11041404 | 3300026142 | Bacteria | 830 |
| 875 | Ga0265356_1000766 | 3300028017 | Bacteria | 5407 |
| 876 | Ga0265356_1011999 | 3300028017 | Bacteria | 954 |
| 877 | Ga0268266_10092603 | 3300028379 | Unclassified | 2652 |
| 878 | Ga0268266_12300064 | 3300028379 | Unclassified | 510 |
| 879 | Ga0268265_10191932 | 3300028380 | Bacteria | 1765 |
| 880 | Ga0268265_10979301 | 3300028380 | Unclassified | 834 |
| 881 | Ga0268264_10006934 | 3300028381 | Bacteria | 9504 |
| 882 | Ga0268264_10011379 | 3300028381 | Bacteria | 7350 |
| 883 | Ga0268264_10106594 | 3300028381 | Unclassified | 2447 |
| 884 | Ga0268264_10259415 | 3300028381 | Unclassified | 1618 |
| 885 | Ga0268264_10595489 | 3300028381 | Bacteria | 1089 |
| 886 | Ga0268264_11065374 | 3300028381 | Bacteria | 816 |
| 887 | Ga0268264_12395624 | 3300028381 | Bacteria | 534 |
| 888 | Ga0268264_12437654 | 3300028381 | Unclassified | 529 |
| 889 | Ga0265338_10011173 | 3300028800 | Bacteria | 10408 |
| 890 | Ga0265338_10061089 | 3300028800 | Bacteria | 3304 |
| 891 | Ga0265338_10119970 | 3300028800 | Unclassified | 2099 |
| 892 | Ga0265338_10177814 | 3300028800 | Bacteria | 1625 |
| 893 | Ga0265338_10680910 | 3300028800 | Unclassified | 711 |
| 894 | Ga0265338_10972356 | 3300028800 | Bacteria | 576 |
| 895 | Ga0265338_11011802 | 3300028800 | Bacteria | 562 |
| 896 | Ga0265324_10153429 | 3300029957 | Bacteria | 782 |
| 897 | Ga0265762_1000401 | 3300030760 | Bacteria | 7442 |
| 898 | Ga0265762_1001210 | 3300030760 | Bacteria | 4680 |
| 899 | Ga0265762_1005514 | 3300030760 | Bacteria | 2270 |
| 900 | Ga0265762_1037256 | 3300030760 | Bacteria | 941 |
| 901 | Ga0265770_1056611 | 3300030878 | Bacteria | 721 |
| 902 | Ga0265760_10023165 | 3300031090 | Bacteria | 1803 |
| 903 | Ga0265760_10336576 | 3300031090 | Unclassified | 539 |
| 904 | Ga0265325_10004543 | 3300031241 | Bacteria | 8747 |
| 905 | Ga0265325_10200013 | 3300031241 | Bacteria | 922 |
| 906 | Ga0265339_10023928 | 3300031249 | Bacteria | 3525 |
| 907 | Ga0265339_10064549 | 3300031249 | Bacteria | 1964 |
| 908 | Ga0265339_10252930 | 3300031249 | Bacteria | 852 |
| 909 | Ga0265339_10411893 | 3300031249 | Bacteria | 631 |
| 910 | Ga0265331_10114238 | 3300031250 | Unclassified | 1237 |
| 911 | Ga0265316_10006220 | 3300031344 | Bacteria | 11445 |
| 912 | Ga0265316_10016491 | 3300031344 | Bacteria | 6403 |
| 913 | Ga0265316_10133418 | 3300031344 | Bacteria | 1869 |
| 914 | Ga0265316_10178274 | 3300031344 | Bacteria | 1583 |
| 915 | Ga0265316_10673412 | 3300031344 | Unclassified | 730 |
| 916 | Ga0265314_10012372 | 3300031711 | Bacteria | 6966 |
| 917 | Ga0265314_10022604 | 3300031711 | Bacteria | 4816 |
| 918 | Ga0265342_10014809 | 3300031712 | Bacteria | 5162 |
| 919 | Ga0316212_1026710 | 3300033547 | Bacteria | 810 |
| 920 | Ga0373948_0100863 | 3300034817 | Unclassified | 680 |
| 921 | Ga0373958_0035263 | 3300034819 | Bacteria | 1001 |
| 922 | Ga0373938_0011890 | 3300034957 | Bacteria | 1626 |
| 923 | Ga0373926_0028827 | 3300035083 | Bacteria | 1950 |
| 924 | Ga0373926_0084906 | 3300035083 | Bacteria | 1174 |
| 925 | Ga0373934_0016874 | 3300035086 | Unclassified | 2780 |
| 926 | Ga0373934_0099393 | 3300035086 | Bacteria | 1176 |
| 927 | Ga0373944_0062344 | 3300035089 | Unclassified | 1199 |
| 928 | Ga0373944_0202982 | 3300035089 | Bacteria | 718 |
| 929 | Ga0373951_0007459 | 3300035091 | Bacteria | 2484 |
| 930 | Ga0373952_0067118 | 3300035092 | Bacteria | 890 |
| 931 | Ga0373923_0002217 | 3300035111 | Bacteria | 5914 |
| 932 | Ga0373923_0159354 | 3300035111 | Bacteria | 1029 |
| 933 | Ga0373923_0555561 | 3300035111 | Unclassified | 563 |
| 934 | Ga0373936_0010297 | 3300035113 | Bacteria | 3529 |
| 935 | Ga0373936_0102688 | 3300035113 | Bacteria | 1207 |
| 936 | Ga0373936_0292886 | 3300035113 | Unclassified | 733 |
| 937 | Ga0373939_0165265 | 3300035114 | Bacteria | 815 |
| 938 | Ga0373945_0003343 | 3300035116 | Bacteria | 5042 |
| 939 | Ga0373945_0101339 | 3300035116 | Bacteria | 1127 |
| 940 | Ga0373945_0237635 | 3300035116 | Unclassified | 766 |
| 941 | Ga0373945_0553359 | 3300035116 | Unclassified | 516 |
| 942 | Ga0373953_0105884 | 3300035117 | Bacteria | 1186 |
| 943 | Ga0373954_0188422 | 3300035118 | Unclassified | 1012 |
| 944 | Ga0373956_0056146 | 3300035119 | Bacteria | 1777 |
| 945 | Ga0373960_0064682 | 3300035121 | Bacteria | 1117 |
| 946 | Ga0373943_0001626 | 3300035170 | Bacteria | 10190 |
| 947 | Ga0373943_0344546 | 3300035170 | Bacteria | 853 |
| 948 | Ga0373943_0362979 | 3300035170 | Unclassified | 832 |
| 949 | Ga0373946_0002814 | 3300035171 | Bacteria | 6150 |
| 950 | Ga0373946_0148381 | 3300035171 | Bacteria | 1092 |
| 951 | Ga0373955_0243010 | 3300035172 | Bacteria | 1078 |
| 952 | Ga0373955_0252596 | 3300035172 | Bacteria | 1057 |
| 953 | Ga0373942_0077761 | 3300035207 | Unclassified | 980 |
| 954 | Ga0373962_0062279 | 3300035242 | Bacteria | 1098 |
| 955 | Ga0373924_0040106 | 3300035410 | Bacteria | 1915 |
| 956 | Ga0373931_0034821 | 3300035691 | Bacteria | 2615 |
| 957 | Ga0373931_0100539 | 3300035691 | Bacteria | 1626 |
| 958 | Ga0373931_0318615 | 3300035691 | Bacteria | 965 |
| 959 | Ga0373931_0904073 | 3300035691 | Unclassified | 593 |
| 960 | Ga0373935_0005817 | 3300035692 | Bacteria | 7302 |
| 961 | Ga0373935_0046735 | 3300035692 | Unclassified | 2735 |
| 962 | Ga0373935_0106296 | 3300035692 | Bacteria | 1857 |
| 963 | Ga0373935_1144951 | 3300035692 | Unclassified | 579 |
| 964 | Ga0373935_1422811 | 3300035692 | Unclassified | 518 |
| 965 | Ga0373927_0000747 | 3300035695 | Bacteria | 24845 |
| 966 | Ga0373927_0014065 | 3300035695 | Bacteria | 5305 |
| 967 | Ga0373927_0084648 | 3300035695 | Bacteria | 2057 |
| 968 | Ga0373927_0172697 | 3300035695 | Bacteria | 1417 |
| 969 | Ga0373927_0294472 | 3300035695 | Unclassified | 1068 |
| 970 | Ga0373927_1085632 | 3300035695 | Bacteria | 528 |
| 971 | Ga0373933_0028842 | 3300035724 | Bacteria | 3203 |
| 972 | Ga0373933_0178489 | 3300035724 | Bacteria | 1354 |
| 973 | Ga0373933_0263838 | 3300035724 | Bacteria | 1111 |
| 974 | Ga0373933_0967731 | 3300035724 | Unclassified | 561 |
| 975 | Ga0373933_1166632 | 3300035724 | Bacteria | 508 |
| 976 | Ga0373947_0011342 | 3300035725 | Bacteria | 5116 |
| 977 | Ga0373947_0014094 | 3300035725 | Bacteria | 4583 |
| 978 | Ga0373947_0547906 | 3300035725 | Unclassified | 787 |
| 979 | Ga0373937_0198306 | 3300036401 | Bacteria | 1887 |
| 980 | Ga0373937_0304131 | 3300036401 | Bacteria | 1507 |
| 981 | Ga0373937_0513887 | 3300036401 | Bacteria | 1138 |
| 982 | Ga0373937_0669470 | 3300036401 | Unclassified | 984 |
| 983 | Ga0373937_1435735 | 3300036401 | Bacteria | 638 |
| 984 | Ga0373937_1855054 | 3300036401 | Unclassified | 549 |
| 985 | Ga0373937_1922789 | 3300036401 | Bacteria | 538 |
| 986 | Ga0373925_0004658 | 3300037068 | Bacteria | 10348 |
| 987 | Ga0373925_0026245 | 3300037068 | Bacteria | 4262 |
| 988 | Ga0373925_0176237 | 3300037068 | Bacteria | 1690 |
| 989 | Ga0373925_0264800 | 3300037068 | Bacteria | 1381 |
| 990 | Ga0373925_0466103 | 3300037068 | Unclassified | 1035 |
| 991 | Ga0373925_0923190 | 3300037068 | Unclassified | 719 |
| 992 | Ga0373925_1069826 | 3300037068 | Unclassified | 664 |
| 993 | Ga0395900_1301114 | 3300037418 | Unclassified | 641 |
| 994 | Ga0395898_0725081 | 3300037466 | Bacteria | 936 |
| 995 | Ga0436365_0628206 | 3300039437 | Bacteria | 1069 |
| 996 | Ga0436360_0246638 | 3300039438 | Unclassified | 2550 |
| 997 | Ga0436363_0958565 | 3300039450 | Bacteria | 1186 |
| 998 | Ga0436362_0405904 | 3300039453 | Unclassified | 600 |
| 999 | Ga0436362_1033386 | 3300039453 | Bacteria | 2657 |
| 1000 | Ga0451839_0076152 | 3300041496 | Unclassified | 541 |
| 1001 | Ga0451577_1336472 | 3300042876 | Bacteria | 637 |
| 1002 | Ga0466966_0948723 | 3300044684 | Unclassified | 519 |
| 1003 | Ga0466961_0257802 | 3300044693 | Bacteria | 1070 |
| 1004 | Ga0466963_0031366 | 3300044694 | Unclassified | 3435 |
| 1005 | Ga0466963_0165209 | 3300044694 | Bacteria | 1542 |
| 1006 | Ga0466963_0731204 | 3300044694 | Bacteria | 698 |
| 1007 | Ga0466964_0181822 | 3300044706 | Bacteria | 998 |
| 1008 | Ga0466964_0634191 | 3300044706 | Unclassified | 589 |
| 1009 | Ga0466964_0811975 | 3300044706 | Unclassified | 529 |
| 1010 | Ga0453684_1002999 | 3300044712 | Unclassified | 888 |
| 1011 | Ga0466968_0064189 | 3300044735 | Bacteria | 1588 |
| 1012 | Ga0466959_0296843 | 3300045049 | Unclassified | 1107 |
| 1013 | Ga0451576_0080329 | 3300045051 | Bacteria | 3393 |
| 1014 | Ga0451576_0086697 | 3300045051 | Bacteria | 3256 |
| 1015 | Ga0451576_0671549 | 3300045051 | Bacteria | 1089 |
| 1016 | Ga0451576_0717923 | 3300045051 | Bacteria | 1050 |
| 1017 | Ga0451576_1371234 | 3300045051 | Unclassified | 736 |
| 1018 | Ga0466958_0395616 | 3300045836 | Unclassified | 892 |
| 1019 | Ga0466958_1140714 | 3300045836 | Bacteria | 509 |
| 1020 | Ga0466967_0053937 | 3300045976 | Bacteria | 3536 |
| 1021 | Ga0466967_0100894 | 3300045976 | Bacteria | 2637 |
| 1022 | Ga0466967_0735964 | 3300045976 | Bacteria | 978 |
| 1023 | Ga0495592_0744746 | 3300046454 | Bacteria | 586 |
| 1024 | Ga0495603_0373179 | 3300046455 | Bacteria | 818 |
| 1025 | Ga0495603_0487013 | 3300046455 | Unclassified | 706 |
| 1026 | Ga0495629_0545444 | 3300046459 | Unclassified | 779 |
| 1027 | Ga0495651_0440268 | 3300046462 | Unclassified | 844 |
| 1028 | Ga0495651_0939590 | 3300046462 | Bacteria | 527 |
| 1029 | Ga0495653_0679607 | 3300046463 | Bacteria | 627 |
| 1030 | Ga0495580_0000603 | 3300046472 | Bacteria | 30353 |
| 1031 | Ga0495580_0001289 | 3300046472 | Bacteria | 22103 |
| 1032 | Ga0495580_0003921 | 3300046472 | Bacteria | 12557 |
| 1033 | Ga0495580_0009412 | 3300046472 | Bacteria | 7686 |
| 1034 | Ga0495580_0034777 | 3300046472 | Bacteria | 3625 |
| 1035 | Ga0495580_0049839 | 3300046472 | Bacteria | 2962 |
| 1036 | Ga0495580_0175814 | 3300046472 | Unclassified | 1479 |
| 1037 | Ga0495580_0233020 | 3300046472 | Bacteria | 1264 |
| 1038 | Ga0495580_0444425 | 3300046472 | Unclassified | 870 |
| 1039 | Ga0495580_0575513 | 3300046472 | Unclassified | 746 |
| 1040 | Ga0495582_0001718 | 3300046473 | Bacteria | 12359 |
| 1041 | Ga0495582_0002195 | 3300046473 | Bacteria | 10922 |
| 1042 | Ga0495582_0201690 | 3300046473 | Unclassified | 1136 |
| 1043 | Ga0495639_0014516 | 3300046475 | Bacteria | 3411 |
| 1044 | Ga0495662_0066426 | 3300046476 | Bacteria | 1745 |
| 1045 | Ga0495664_0016333 | 3300046477 | Bacteria | 4226 |
| 1046 | Ga0495664_0065861 | 3300046477 | Unclassified | 2160 |
| 1047 | Ga0495594_0395988 | 3300046499 | Unclassified | 786 |
| 1048 | Ga0495608_0315133 | 3300046511 | Bacteria | 967 |
| 1049 | Ga0495618_0645444 | 3300046514 | Unclassified | 626 |
| 1050 | Ga0495630_0100516 | 3300046517 | Bacteria | 2188 |
| 1051 | Ga0495630_0209526 | 3300046517 | Bacteria | 1488 |
| 1052 | Ga0495630_0295296 | 3300046517 | Unclassified | 1238 |
| 1053 | Ga0495630_0346110 | 3300046517 | Bacteria | 1138 |
| 1054 | Ga0495666_0109979 | 3300046526 | Bacteria | 1295 |
| 1055 | Ga0495652_0575471 | 3300046529 | Bacteria | 771 |
| 1056 | Ga0495665_0029765 | 3300046531 | Bacteria | 2924 |
| 1057 | Ga0495665_0190339 | 3300046531 | Unclassified | 1065 |
| 1058 | Ga0495665_0379291 | 3300046531 | Unclassified | 718 |
| 1059 | Ga0495586_0122509 | 3300046535 | Bacteria | 1453 |
| 1060 | Ga0495587_0032512 | 3300046536 | Bacteria | 3154 |
| 1061 | Ga0495587_0580062 | 3300046536 | Unclassified | 618 |
| 1062 | Ga0495667_0175614 | 3300046559 | Unclassified | 1376 |
| 1063 | Ga0495635_0123300 | 3300046663 | Bacteria | 1767 |
| 1064 | Ga0495657_0161318 | 3300046675 | Unclassified | 1387 |
| 1065 | Ga0495623_0303880 | 3300046679 | Bacteria | 881 |
| 1066 | Ga0495623_0378222 | 3300046679 | Bacteria | 766 |
| 1067 | Ga0495623_0687405 | 3300046679 | Unclassified | 525 |
| 1068 | Ga0495623_0703661 | 3300046679 | Bacteria | 517 |
| 1069 | Ga0495646_0378954 | 3300046680 | Bacteria | 738 |
| 1070 | Ga0495658_0114741 | 3300046683 | Bacteria | 1623 |
| 1071 | Ga0495669_0202159 | 3300046684 | Bacteria | 950 |
| 1072 | Ga0495613_0185423 | 3300046689 | Bacteria | 1472 |
| 1073 | Ga0495600_0212828 | 3300046809 | Bacteria | 1238 |
| 1074 | Ga0495581_0016034 | 3300047315 | Bacteria | 4355 |
| 1075 | Ga0495581_0067826 | 3300047315 | Bacteria | 2063 |
| 1076 | Ga0495581_0104136 | 3300047315 | Bacteria | 1649 |
| 1077 | Ga0495581_0113158 | 3300047315 | Bacteria | 1578 |
| 1078 | Ga0495604_0039992 | 3300047317 | Unclassified | 3683 |
| 1079 | Ga0495674_0094012 | 3300047319 | Bacteria | 2558 |
| 1080 | Ga0495674_0186315 | 3300047319 | Bacteria | 1727 |
| 1081 | Ga0495674_0280833 | 3300047319 | Bacteria | 1364 |
| 1082 | Ga0495674_0589143 | 3300047319 | Bacteria | 882 |
| 1083 | Ga0495674_0838568 | 3300047319 | Unclassified | 713 |
| 1084 | Ga0495674_1401102 | 3300047319 | Bacteria | 521 |
| 1085 | Ga0495676_0282386 | 3300047321 | Bacteria | 1124 |
| 1086 | Ga0495675_0665863 | 3300047444 | Unclassified | 585 |
| 1087 | Ga0495685_273547 | 3300047447 | Unclassified | 533 |
| 1088 | Ga0495684_0507009 | 3300047471 | Unclassified | 829 |
| 1089 | Ga0495602_0130451 | 3300048088 | Bacteria | 2006 |
| 1090 | Ga0495602_0476993 | 3300048088 | Bacteria | 876 |
| 1091 | Ga0495614_0189451 | 3300048089 | Bacteria | 928 |
| 1092 | Ga0496100_0348790 | 3300048903 | Bacteria | 1117 |
| 1093 | Ga0496100_0736734 | 3300048903 | Unclassified | 770 |
| 1094 | Ga0496100_1012209 | 3300048903 | Unclassified | 654 |
| 1095 | Ga0496101_0049553 | 3300048904 | Bacteria | 3022 |
| 1096 | Ga0496101_0417595 | 3300048904 | Bacteria | 1057 |
| 1097 | Ga0496101_0535783 | 3300048904 | Bacteria | 925 |
| 1098 | Ga0496101_0753745 | 3300048904 | Unclassified | 768 |
| 1099 | Ga0496101_1001404 | 3300048904 | Bacteria | 657 |
| 1100 | Ga0496102_0309600 | 3300048905 | Bacteria | 1488 |
| 1101 | Ga0496102_0554075 | 3300048905 | Bacteria | 1072 |
| 1102 | Ga0496102_0615511 | 3300048905 | Bacteria | 1009 |
| 1103 | Ga0496102_0900454 | 3300048905 | Bacteria | 806 |
| 1104 | Ga0496102_1634175 | 3300048905 | Unclassified | 562 |
| 1105 | Ga0496103_0201464 | 3300048906 | Unclassified | 1280 |
| 1106 | Ga0496103_0300120 | 3300048906 | Bacteria | 1033 |
| 1107 | Ga0496103_0318699 | 3300048906 | Bacteria | 1000 |
| 1108 | Ga0496103_0862464 | 3300048906 | Bacteria | 569 |
| 1109 | Ga0496104_0058767 | 3300048907 | Bacteria | 3640 |
| 1110 | Ga0496104_0070054 | 3300048907 | Unclassified | 3334 |
| 1111 | Ga0496104_0118656 | 3300048907 | Bacteria | 2540 |
| 1112 | Ga0496104_0146462 | 3300048907 | Unclassified | 2268 |
| 1113 | Ga0496104_0166384 | 3300048907 | Bacteria | 2115 |
| 1114 | Ga0496104_0697285 | 3300048907 | Unclassified | 923 |
| 1115 | Ga0496105_0025317 | 3300048908 | Unclassified | 4830 |
| 1116 | Ga0496105_0185026 | 3300048908 | Bacteria | 1705 |
| 1117 | Ga0496105_0406337 | 3300048908 | Bacteria | 1080 |
| 1118 | Ga0496106_0044811 | 3300048909 | Bacteria | 3322 |
| 1119 | Ga0496106_0233346 | 3300048909 | Bacteria | 1469 |
| 1120 | Ga0496107_0075478 | 3300048910 | Bacteria | 2454 |
| 1121 | Ga0496107_0344390 | 3300048910 | Bacteria | 1109 |
| 1122 | Ga0496107_0570412 | 3300048910 | Unclassified | 837 |
| 1123 | Ga0496108_0000242 | 3300048911 | Bacteria | 48793 |
| 1124 | Ga0496108_0114263 | 3300048911 | Bacteria | 2311 |
| 1125 | Ga0496108_0973288 | 3300048911 | Unclassified | 726 |
| 1126 | Ga0496109_0000120 | 3300048912 | Bacteria | 81828 |
| 1127 | Ga0496109_0051640 | 3300048912 | Bacteria | 3745 |
| 1128 | Ga0496109_0092435 | 3300048912 | Bacteria | 2798 |
| 1129 | Ga0496109_0112074 | 3300048912 | Bacteria | 2537 |
| 1130 | Ga0496109_0449451 | 3300048912 | Bacteria | 1217 |
| 1131 | Ga0496109_1250089 | 3300048912 | Bacteria | 679 |
| 1132 | Ga0496109_1406471 | 3300048912 | Unclassified | 633 |
| 1133 | Ga0496110_0003869 | 3300048913 | Bacteria | 11531 |
| 1134 | Ga0496110_0018359 | 3300048913 | Bacteria | 5865 |
| 1135 | Ga0496110_1208322 | 3300048913 | Unclassified | 665 |
| 1136 | Ga0496111_0013049 | 3300048914 | Bacteria | 5641 |
| 1137 | Ga0496111_0020419 | 3300048914 | Bacteria | 4612 |
| 1138 | Ga0496112_0000198 | 3300048915 | Bacteria | 39413 |
| 1139 | Ga0496112_0024111 | 3300048915 | Bacteria | 5823 |
| 1140 | Ga0496112_0046570 | 3300048915 | Bacteria | 4254 |
| 1141 | Ga0496112_0064520 | 3300048915 | Bacteria | 3614 |
| 1142 | Ga0496112_0080018 | 3300048915 | Unclassified | 3232 |
| 1143 | Ga0496112_0198584 | 3300048915 | Bacteria | 1966 |
| 1144 | Ga0496112_0275747 | 3300048915 | Bacteria | 1629 |
| 1145 | Ga0496112_0374280 | 3300048915 | Unclassified | 1365 |
| 1146 | Ga0496112_0560108 | 3300048915 | Bacteria | 1076 |
| 1147 | Ga0496112_1526184 | 3300048915 | Unclassified | 582 |
| 1148 | Ga0496113_0000111 | 3300048916 | Bacteria | 35094 |
| 1149 | Ga0496113_0229510 | 3300048916 | Bacteria | 1480 |
| 1150 | Ga0496113_0967228 | 3300048916 | Unclassified | 671 |
| 1151 | Ga0496113_1255283 | 3300048916 | Unclassified | 577 |
| 1152 | Ga0496114_0141388 | 3300048917 | Bacteria | 2084 |
| 1153 | Ga0496114_0236103 | 3300048917 | Bacteria | 1607 |
| 1154 | Ga0496115_0003194 | 3300048918 | Bacteria | 11768 |
| 1155 | Ga0496115_0051792 | 3300048918 | Bacteria | 3291 |
| 1156 | Ga0496115_0161131 | 3300048918 | Unclassified | 1854 |
| 1157 | Ga0496115_0242887 | 3300048918 | Unclassified | 1484 |
| 1158 | Ga0496115_0524973 | 3300048918 | Unclassified | 949 |
| 1159 | Ga0496115_0673134 | 3300048918 | Bacteria | 816 |
| 1160 | nmdc:mga0n895_6611_c1 | 3300050512 | Bacteria | 9870 |
| 1161 | nmdc:mga0rr50_15265_c1 | 3300050513 | Bacteria | 5066 |
| 1162 | nmdc:mga0rr50_2703_c1 | 3300050513 | Bacteria | 10061 |
| 1163 | nmdc:mga08x19_103937_c1 | 3300050514 | Bacteria | 1887 |
| 1164 | nmdc:mga08x19_11637_c1 | 3300050514 | Bacteria | 5296 |
| 1165 | Ga0495601_0723047 | 3300053077 | Bacteria | 634 |
| 1166 | Ga0495612_0512072 | 3300053078 | Bacteria | 551 |
| 1167 | Ga0495619_0256876 | 3300053085 | Bacteria | 1211 |
| 1168 | Ga0495619_1190674 | 3300053085 | Bacteria | 505 |
| 1169 | Ga0466962_0159842 | 3300061719 | Bacteria | 1095 |
| 1170 | Ga0099796_10186542 | |||
| 1171 | MRS1b_contig_6382803 | |||
| 1172 | MRS1b_contig_9171898 | |||
| 1173 | MBSR1b_contig_9749820 | |||
| 1174 | LJNas_1001079 | |||
| 1175 | LJNas_1001135 | |||
| 1176 | JGI24741J21665_1044410 | |||
| 1177 | JGI24752J21851_1013055 | |||
| 1178 | JGI24034J26672_10123497 | |||
| 1179 | JGI24751J29686_10005033 | |||
| 1180 | rootH1_10193919 | |||
| 1181 | rootH1_10326518 | |||
| 1182 | Ga0058863_10016641 | |||
| 1183 | Ga0065712_10008743 | |||
| 1184 | Ga0065712_10058536 | |||
| 1185 | Ga0065712_10082582 | |||
| 1186 | Ga0065712_10246720 | |||
| 1187 | Ga0065715_11044722 | |||
| 1188 | Ga0065707_10461869 | |||
| 1189 | Ga0070658_10144456 | |||
| 1190 | Ga0070658_10175172 | |||
| 1191 | Ga0070676_10002636 | |||
| 1192 | Ga0070683_100024239 | |||
| 1193 | Ga0070683_100051208 | |||
| 1194 | Ga0070683_100083853 | |||
| 1195 | Ga0070683_100121497 | |||
| 1196 | Ga0070683_100262019 | |||
| 1197 | Ga0070683_100366069 | |||
| 1198 | Ga0070690_100121027 | |||
| 1199 | Ga0070690_100733087 | |||
| 1200 | Ga0070670_100002163 | |||
| 1201 | Ga0070670_100189664 | |||
| 1202 | Ga0070670_100614349 | |||
| 1203 | Ga0070670_101462411 | |||
| 1204 | Ga0070670_101562141 | |||
| 1205 | Ga0070677_10059096 | |||
| 1206 | Ga0070677_10728922 | |||
| 1207 | Ga0070677_10824694 | |||
| 1208 | Ga0068869_100043195 | |||
| 1209 | Ga0068869_100078820 | |||
| 1210 | Ga0068869_100151067 | |||
| 1211 | Ga0068869_100224084 | |||
| 1212 | Ga0068869_100489353 | |||
| 1213 | Ga0068869_101772911 | |||
| 1214 | Ga0070666_10010515 | |||
| 1215 | Ga0070666_10163128 | |||
| 1216 | Ga0070666_10260841 | |||
| 1217 | Ga0070680_100012730 | |||
| 1218 | Ga0070680_100017979 | |||
| 1219 | Ga0070680_100069074 | |||
| 1220 | Ga0070680_100144923 | |||
| 1221 | Ga0070680_100227758 | |||
| 1222 | Ga0070682_100020940 | |||
| 1223 | Ga0070682_100084027 | |||
| 1224 | Ga0070682_100101201 | |||
| 1225 | Ga0070682_101365466 | |||
| 1226 | Ga0068868_100004608 | |||
| 1227 | Ga0068868_100005733 | |||
| 1228 | Ga0068868_100019713 | |||
| 1229 | Ga0068868_100046519 | |||
| 1230 | Ga0068868_100101109 | |||
| 1231 | Ga0068868_100144690 | |||
| 1232 | Ga0068868_100612571 | |||
| 1233 | Ga0068868_100693154 | |||
| 1234 | Ga0070660_100003269 | |||
| 1235 | Ga0070660_100065897 | |||
| 1236 | Ga0070689_100001444 | |||
| 1237 | Ga0070689_100157841 | |||
| 1238 | Ga0070689_101292351 | |||
| 1239 | Ga0070691_10417278 | |||
| 1240 | Ga0070661_100005865 | |||
| 1241 | Ga0070661_100041016 | |||
| 1242 | Ga0070661_100058538 | |||
| 1243 | Ga0070661_100088315 | |||
| 1244 | Ga0070668_100007447 | |||
| 1245 | Ga0070668_100045126 | |||
| 1246 | Ga0070669_100103155 | |||
| 1247 | Ga0070669_100358117 | |||
| 1248 | Ga0070669_100540975 | |||
| 1249 | Ga0070675_100272534 | |||
| 1250 | Ga0070671_100227900 | |||
| 1251 | Ga0070671_100266764 | |||
| 1252 | Ga0070671_101355495 | |||
| 1253 | Ga0070671_101450296 | |||
| 1254 | Ga0070674_100049601 | |||
| 1255 | Ga0070674_100443076 | |||
| 1256 | Ga0070673_100046972 | |||
| 1257 | Ga0070673_100053292 | |||
| 1258 | Ga0070673_100385715 | |||
| 1259 | Ga0070673_101742590 | |||
| 1260 | Ga0070688_100010943 | |||
| 1261 | Ga0070688_100191835 | |||
| 1262 | Ga0070688_100216208 | |||
| 1263 | Ga0070659_100220425 | |||
| 1264 | Ga0070659_101470904 | |||
| 1265 | Ga0070667_100090690 | |||
| 1266 | Ga0070667_100468531 | |||
| 1267 | Ga0070667_100695718 | |||
| 1268 | Ga0070667_101213544 | |||
| 1269 | Ga0070667_101699206 | |||
| 1270 | Ga0070709_10000423 | |||
| 1271 | Ga0070709_10020249 | |||
| 1272 | Ga0070709_10135876 | |||
| 1273 | Ga0070709_10140106 | |||
| 1274 | Ga0070709_10279073 | |||
| 1275 | Ga0070709_10287034 | |||
| 1276 | Ga0070709_10836005 | |||
| 1277 | Ga0070714_100000096 | |||
| 1278 | Ga0070714_100002108 | |||
| 1279 | Ga0070714_100017874 | |||
| 1280 | Ga0070714_100117686 | |||
| 1281 | Ga0070714_100132009 | |||
| 1282 | Ga0070714_100209199 | |||
| 1283 | Ga0070714_100295570 | |||
| 1284 | Ga0070714_100391089 | |||
| 1285 | Ga0070714_100467245 | |||
| 1286 | Ga0070714_100767236 | |||
| 1287 | Ga0070714_100955642 | |||
| 1288 | Ga0070714_101105700 | |||
| 1289 | Ga0070714_101617003 | |||
| 1290 | Ga0070714_102165016 | |||
| 1291 | Ga0070713_100000134 | |||
| 1292 | Ga0070713_100000364 | |||
| 1293 | Ga0070713_100063451 | |||
| 1294 | Ga0070713_100095501 | |||
| 1295 | Ga0070713_100550144 | |||
| 1296 | Ga0070713_101018410 | |||
| 1297 | Ga0070713_101969707 | |||
| 1298 | Ga0070710_10004596 | |||
| 1299 | Ga0070710_10005846 | |||
| 1300 | Ga0070710_10065925 | |||
| 1301 | Ga0070710_10102051 | |||
| 1302 | Ga0070710_10212509 | |||
| 1303 | Ga0070710_10551691 | |||
| 1304 | Ga0070710_11470547 | |||
| 1305 | Ga0070701_10137393 | |||
| 1306 | Ga0070701_10210443 | |||
| 1307 | Ga0070711_100000271 | |||
| 1308 | Ga0070711_100005922 | |||
| 1309 | Ga0070711_100064787 | |||
| 1310 | Ga0070711_100142088 | |||
| 1311 | Ga0070711_100393545 | |||
| 1312 | Ga0070711_100480998 | |||
| 1313 | Ga0070711_100647232 | |||
| 1314 | Ga0070711_100710313 | |||
| 1315 | Ga0070711_102015255 | |||
| 1316 | Ga0070705_100106655 | |||
| 1317 | Ga0070700_100335038 | |||
| 1318 | Ga0070694_101897467 | |||
| 1319 | Ga0070708_100000459 | |||
| 1320 | Ga0070708_100037092 | |||
| 1321 | Ga0070708_100093222 | |||
| 1322 | Ga0070708_100120147 | |||
| 1323 | Ga0070708_100443273 | |||
| 1324 | Ga0070708_100521978 | |||
| 1325 | Ga0070708_100765105 | |||
| 1326 | Ga0070663_100054294 | |||
| 1327 | Ga0070663_100147626 | |||
| 1328 | Ga0070663_100768922 | |||
| 1329 | Ga0070678_100054773 | |||
| 1330 | Ga0070678_100835215 | |||
| 1331 | Ga0070678_101101583 | |||
| 1332 | Ga0070678_101574786 | |||
| 1333 | Ga0070662_100008601 | |||
| 1334 | Ga0070662_100015770 | |||
| 1335 | Ga0070662_100221260 | |||
| 1336 | Ga0070681_10002834 | |||
| 1337 | Ga0070681_10005694 | |||
| 1338 | Ga0070681_10050021 | |||
| 1339 | Ga0070681_10151119 | |||
| 1340 | Ga0070681_10572937 | |||
| 1341 | Ga0070681_10971602 | |||
| 1342 | Ga0070681_11300974 | |||
| 1343 | Ga0068867_100003049 | |||
| 1344 | Ga0068867_100040462 | |||
| 1345 | Ga0068867_100197290 | |||
| 1346 | Ga0070685_10004878 | |||
| 1347 | Ga0070685_10307117 | |||
| 1348 | Ga0070706_100002982 | |||
| 1349 | Ga0070706_100096996 | |||
| 1350 | Ga0070706_100136757 | |||
| 1351 | Ga0070707_100003948 | |||
| 1352 | Ga0070707_100163640 | |||
| 1353 | Ga0070707_100172790 | |||
| 1354 | Ga0070707_100597797 | |||
| 1355 | Ga0070707_101237034 | |||
| 1356 | Ga0070707_102159041 | |||
| 1357 | Ga0070698_100002043 | |||
| 1358 | Ga0070698_100071081 | |||
| 1359 | Ga0070699_100000441 | |||
| 1360 | Ga0070699_100243307 | |||
| 1361 | Ga0070699_100312649 | |||
| 1362 | Ga0070679_100005583 | |||
| 1363 | Ga0070679_100060422 | |||
| 1364 | Ga0070679_100062432 | |||
| 1365 | Ga0070679_100115288 | |||
| 1366 | Ga0070679_100153230 | |||
| 1367 | Ga0070679_100196193 | |||
| 1368 | Ga0070679_100563428 | |||
| 1369 | Ga0070679_100674712 | |||
| 1370 | Ga0070684_100040330 | |||
| 1371 | Ga0070684_100333499 | |||
| 1372 | Ga0070684_100363259 | |||
| 1373 | Ga0070697_100000158 | |||
| 1374 | Ga0070697_100170418 | |||
| 1375 | Ga0068853_100037836 | |||
| 1376 | Ga0068853_100426744 | |||
| 1377 | Ga0068853_100478685 | |||
| 1378 | Ga0068853_101139439 | |||
| 1379 | Ga0070672_100119703 | |||
| 1380 | Ga0070672_100516993 | |||
| 1381 | Ga0070686_100046794 | |||
| 1382 | Ga0070686_100062150 | |||
| 1383 | Ga0070695_100304858 | |||
| 1384 | Ga0070695_101296992 | |||
| 1385 | Ga0070695_101464005 | |||
| 1386 | Ga0070696_100064452 | |||
| 1387 | Ga0070693_100022453 | |||
| 1388 | Ga0070693_100028327 | |||
| 1389 | Ga0070693_100325725 | |||
| 1390 | Ga0070693_100669660 | |||
| 1391 | Ga0070693_100978931 | |||
| 1392 | Ga0070665_100235175 | |||
| 1393 | Ga0070665_100408666 | |||
| 1394 | Ga0070665_100491383 | |||
| 1395 | Ga0070704_102180424 | |||
| 1396 | Ga0070704_102216403 | |||
| 1397 | Ga0068855_100002637 | |||
| 1398 | Ga0068855_100005367 | |||
| 1399 | Ga0068855_100015827 | |||
| 1400 | Ga0068855_100129933 | |||
| 1401 | Ga0068855_100212104 | |||
| 1402 | Ga0068855_100361189 | |||
| 1403 | Ga0068855_100506310 | |||
| 1404 | Ga0068855_100667396 | |||
| 1405 | Ga0068855_100932764 | |||
| 1406 | Ga0068855_101010547 | |||
| 1407 | Ga0070664_100000368 | |||
| 1408 | Ga0070664_100013863 | |||
| 1409 | Ga0070664_100047104 | |||
| 1410 | Ga0070664_100093232 | |||
| 1411 | Ga0070664_101385912 | |||
| 1412 | Ga0068857_100002526 | |||
| 1413 | Ga0068857_100003416 | |||
| 1414 | Ga0068857_100019188 | |||
| 1415 | Ga0068857_100046744 | |||
| 1416 | Ga0068857_100208270 | |||
| 1417 | Ga0068857_100483235 | |||
| 1418 | Ga0068854_100008180 | |||
| 1419 | Ga0068854_100028356 | |||
| 1420 | Ga0068854_100156966 | |||
| 1421 | Ga0068854_100377284 | |||
| 1422 | Ga0068854_100563792 | |||
| 1423 | Ga0068854_100755841 | |||
| 1424 | Ga0068854_101246911 | |||
| 1425 | Ga0068856_100001843 | |||
| 1426 | Ga0068856_100003176 | |||
| 1427 | Ga0068856_100006401 | |||
| 1428 | Ga0068856_100010274 | |||
| 1429 | Ga0068856_100117286 | |||
| 1430 | Ga0068856_100130865 | |||
| 1431 | Ga0068856_100163906 | |||
| 1432 | Ga0068856_100201185 | |||
| 1433 | Ga0068856_100390989 | |||
| 1434 | Ga0068856_100409019 | |||
| 1435 | Ga0068856_101103241 | |||
| 1436 | Ga0068856_101920204 | |||
| 1437 | Ga0070702_100018406 | |||
| 1438 | Ga0070702_100276386 | |||
| 1439 | Ga0068852_100013961 | |||
| 1440 | Ga0068852_100091062 | |||
| 1441 | Ga0068852_100095008 | |||
| 1442 | Ga0068852_100101898 | |||
| 1443 | Ga0068852_100130290 | |||
| 1444 | Ga0068852_100483508 | |||
| 1445 | Ga0068859_100000701 | |||
| 1446 | Ga0068859_100041442 | |||
| 1447 | Ga0068859_100460849 | |||
| 1448 | Ga0068864_100000898 | |||
| 1449 | Ga0068864_100004265 | |||
| 1450 | Ga0068864_100033118 | |||
| 1451 | Ga0068864_100444896 | |||
| 1452 | Ga0068864_101172263 | |||
| 1453 | Ga0068866_10003082 | |||
| 1454 | Ga0068866_10004230 | |||
| 1455 | Ga0068866_10025202 | |||
| 1456 | Ga0068866_10173257 | |||
| 1457 | Ga0068866_10336810 | |||
| 1458 | Ga0068861_100015560 | |||
| 1459 | Ga0068861_100271795 | |||
| 1460 | Ga0068861_102459930 | |||
| 1461 | Ga0068851_10003628 | |||
| 1462 | Ga0068851_10005203 | |||
| 1463 | Ga0068851_10296451 | |||
| 1464 | Ga0068851_10420709 | |||
| 1465 | Ga0068870_10007715 | |||
| 1466 | Ga0068870_10053961 | |||
| 1467 | Ga0068863_100015433 | |||
| 1468 | Ga0068863_100027051 | |||
| 1469 | Ga0068863_101089966 | |||
| 1470 | Ga0068863_101132770 | |||
| 1471 | Ga0068863_101602181 | |||
| 1472 | Ga0068858_100004311 | |||
| 1473 | Ga0068858_100007568 | |||
| 1474 | Ga0068858_100027352 | |||
| 1475 | Ga0068858_100040178 | |||
| 1476 | Ga0068858_100089158 | |||
| 1477 | Ga0068858_100347177 | |||
| 1478 | Ga0068858_100950185 | |||
| 1479 | Ga0068858_101378231 | |||
| 1480 | Ga0068860_100009860 | |||
| 1481 | Ga0068860_100017458 | |||
| 1482 | Ga0068860_100035297 | |||
| 1483 | Ga0068860_100145127 | |||
| 1484 | Ga0068860_100332877 | |||
| 1485 | Ga0068860_100350467 | |||
| 1486 | Ga0068862_100115022 | |||
| 1487 | Ga0068862_100126513 | |||
| 1488 | Ga0068862_100166702 | |||
| 1489 | Ga0081540_1029989 | |||
| 1490 | Ga0070717_10001624 | |||
| 1491 | Ga0070717_10021380 | |||
| 1492 | Ga0070717_10021949 | |||
| 1493 | Ga0070717_10046559 | |||
| 1494 | Ga0070717_10062672 | |||
| 1495 | Ga0070717_10068572 | |||
| 1496 | Ga0070717_10083898 | |||
| 1497 | Ga0070717_10124061 | |||
| 1498 | Ga0070717_10140175 | |||
| 1499 | Ga0070717_10361126 | |||
| 1500 | Ga0070717_10683162 | |||
| 1501 | Ga0070717_10728881 | |||
| 1502 | Ga0070717_10786156 | |||
| 1503 | Ga0070715_10002746 | |||
| 1504 | Ga0070715_10145704 | |||
| 1505 | Ga0070715_10351178 | |||
| 1506 | Ga0070715_10497835 | |||
| 1507 | Ga0070716_100006183 | |||
| 1508 | Ga0070716_100010270 | |||
| 1509 | Ga0070716_100017856 | |||
| 1510 | Ga0070716_100035542 | |||
| 1511 | Ga0070716_100040078 | |||
| 1512 | Ga0070716_100097023 | |||
| 1513 | Ga0070716_100135725 | |||
| 1514 | Ga0070716_100194494 | |||
| 1515 | Ga0070716_100574404 | |||
| 1516 | Ga0070716_100643141 | |||
| 1517 | Ga0070716_100662576 | |||
| 1518 | Ga0070716_100727090 | |||
| 1519 | Ga0070712_100000262 | |||
| 1520 | Ga0070712_100000618 | |||
| 1521 | Ga0070712_100014067 | |||
| 1522 | Ga0070712_100021621 | |||
| 1523 | Ga0070712_100198500 | |||
| 1524 | Ga0070712_100489788 | |||
| 1525 | Ga0070712_100516188 | |||
| 1526 | Ga0070712_100628293 | |||
| 1527 | Ga0070712_101611585 | |||
| 1528 | Ga0097621_100000395 | |||
| 1529 | Ga0097621_100002712 | |||
| 1530 | Ga0097621_100003022 | |||
| 1531 | Ga0097621_100079134 | |||
| 1532 | Ga0097621_100079567 | |||
| 1533 | Ga0097621_100429914 | |||
| 1534 | Ga0097621_100533616 | |||
| 1535 | Ga0068871_100002563 | |||
| 1536 | Ga0068871_100003240 | |||
| 1537 | Ga0068871_100004336 | |||
| 1538 | Ga0068871_100013189 | |||
| 1539 | Ga0068871_100160110 | |||
| 1540 | Ga0068871_100602234 | |||
| 1541 | Ga0068871_100855222 | |||
| 1542 | Ga0068871_100913868 | |||
| 1543 | Ga0068871_102348984 | |||
| 1544 | Ga0075434_100040746 | |||
| 1545 | Ga0068865_100056677 | |||
| 1546 | Ga0068865_100153636 | |||
| 1547 | Ga0068865_100223121 | |||
| 1548 | Ga0075436_100043910 | |||
| 1549 | Ga0075436_100255810 | |||
| 1550 | Ga0075436_100504967 | |||
| 1551 | Ga0097620_100000701 | |||
| 1552 | Ga0097620_100041447 | |||
| 1553 | Ga0097620_100460909 | |||
| 1554 | Ga0075435_100002238 | |||
| 1555 | Ga0075435_100020692 | |||
| 1556 | Ga0099794_10299963 | |||
| 1557 | Ga0099795_10071509 | |||
| 1558 | Ga0099795_10537264 | |||
| 1559 | Ga0105250_10030931 | |||
| 1560 | Ga0105250_10143281 | |||
| 1561 | Ga0105240_10004122 | |||
| 1562 | Ga0105240_10028901 | |||
| 1563 | Ga0105240_10043903 | |||
| 1564 | Ga0105240_10053354 | |||
| 1565 | Ga0105240_10063666 | |||
| 1566 | Ga0105240_10115193 | |||
| 1567 | Ga0105240_10213366 | |||
| 1568 | Ga0105240_10317271 | |||
| 1569 | Ga0105240_10835130 | |||
| 1570 | Ga0105240_12136897 | |||
| 1571 | Ga0105240_12473754 | |||
| 1572 | Ga0105245_10003672 | |||
| 1573 | Ga0105245_10004606 | |||
| 1574 | Ga0105245_10087165 | |||
| 1575 | Ga0105245_10125943 | |||
| 1576 | Ga0105245_10588375 | |||
| 1577 | Ga0105245_11463057 | |||
| 1578 | Ga0105247_10039588 | |||
| 1579 | Ga0105247_10078286 | |||
| 1580 | Ga0105247_10534222 | |||
| 1581 | Ga0105247_10566286 | |||
| 1582 | Ga0105247_11087198 | |||
| 1583 | Ga0105243_10443582 | |||
| 1584 | Ga0105241_10027499 | |||
| 1585 | Ga0105241_10030638 | |||
| 1586 | Ga0105241_10031395 | |||
| 1587 | Ga0105241_10034345 | |||
| 1588 | Ga0105241_10068487 | |||
| 1589 | Ga0105241_10120553 | |||
| 1590 | Ga0105241_10273178 | |||
| 1591 | Ga0105241_10576705 | |||
| 1592 | Ga0105241_10602600 | |||
| 1593 | Ga0105241_11411019 | |||
| 1594 | Ga0105242_10057049 | |||
| 1595 | Ga0105242_10113431 | |||
| 1596 | Ga0105242_10114162 | |||
| 1597 | Ga0105242_10134757 | |||
| 1598 | Ga0105242_10267583 | |||
| 1599 | Ga0105242_10692683 | |||
| 1600 | Ga0105248_10004109 | |||
| 1601 | Ga0105248_10116785 | |||
| 1602 | Ga0105248_10119865 | |||
| 1603 | Ga0105248_10168973 | |||
| 1604 | Ga0105248_10286340 | |||
| 1605 | Ga0105248_10313783 | |||
| 1606 | Ga0105248_10437215 | |||
| 1607 | Ga0105237_10039282 | |||
| 1608 | Ga0105237_10043379 | |||
| 1609 | Ga0105237_10106206 | |||
| 1610 | Ga0105237_10119405 | |||
| 1611 | Ga0105237_10154158 | |||
| 1612 | Ga0105237_10381271 | |||
| 1613 | Ga0105237_10582395 | |||
| 1614 | Ga0105237_10769833 | |||
| 1615 | Ga0105238_10000860 | |||
| 1616 | Ga0105238_10017227 | |||
| 1617 | Ga0105238_10033615 | |||
| 1618 | Ga0105238_10246160 | |||
| 1619 | Ga0105238_10724070 | |||
| 1620 | Ga0105238_10983331 | |||
| 1621 | Ga0105238_11214246 | |||
| 1622 | Ga0105238_11482996 | |||
| 1623 | Ga0105238_11552187 | |||
| 1624 | Ga0105238_11624012 | |||
| 1625 | Ga0105238_12436512 | |||
| 1626 | Ga0105249_10047876 | |||
| 1627 | Ga0105249_10976651 | |||
| 1628 | Ga0105249_11924854 | |||
| 1629 | Ga0099796_10228722 | |||
| 1630 | Ga0105239_10016353 | |||
| 1631 | Ga0105239_10018909 | |||
| 1632 | Ga0105239_10031708 | |||
| 1633 | Ga0105239_10069561 | |||
| 1634 | Ga0105239_10303205 | |||
| 1635 | Ga0105239_10446041 | |||
| 1636 | Ga0105239_11100898 | |||
| 1637 | Ga0105239_12149753 | |||
| 1638 | Ga0105246_10020423 | |||
| 1639 | Ga0105246_10100687 | |||
| 1640 | Ga0105246_10308167 | |||
| 1641 | Ga0105246_10446110 | |||
| 1642 | Ga0157373_10048030 | |||
| 1643 | Ga0157373_10075386 | |||
| 1644 | Ga0157373_10090064 | |||
| 1645 | Ga0157373_10118108 | |||
| 1646 | Ga0157373_10246714 | |||
| 1647 | Ga0157373_10926960 | |||
| 1648 | Ga0157373_10983103 | |||
| 1649 | Ga0157373_11177364 | |||
| 1650 | Ga0157371_10024160 | |||
| 1651 | Ga0157371_10097970 | |||
| 1652 | Ga0157371_10173764 | |||
| 1653 | Ga0157370_10024789 | |||
| 1654 | Ga0157370_10359451 | |||
| 1655 | Ga0157370_10471765 | |||
| 1656 | Ga0157370_12045484 | |||
| 1657 | Ga0157369_10000323 | |||
| 1658 | Ga0157369_10037380 | |||
| 1659 | Ga0157369_10065338 | |||
| 1660 | Ga0157369_10086306 | |||
| 1661 | Ga0157369_10143297 | |||
| 1662 | Ga0157369_10209826 | |||
| 1663 | Ga0157369_10213639 | |||
| 1664 | Ga0157369_10217087 | |||
| 1665 | Ga0157369_10223974 | |||
| 1666 | Ga0157369_10508345 | |||
| 1667 | Ga0157369_10985600 | |||
| 1668 | Ga0157369_11822404 | |||
| 1669 | Ga0157374_10000131 | |||
| 1670 | Ga0157374_10000690 | |||
| 1671 | Ga0157374_10003128 | |||
| 1672 | Ga0157374_10003490 | |||
| 1673 | Ga0157374_10051976 | |||
| 1674 | Ga0157374_10166811 | |||
| 1675 | Ga0157374_10235785 | |||
| 1676 | Ga0157374_10494743 | |||
| 1677 | Ga0157374_10696778 | |||
| 1678 | Ga0157374_10913654 | |||
| 1679 | Ga0157374_11784568 | |||
| 1680 | Ga0157374_12743912 | |||
| 1681 | Ga0157378_10000388 | |||
| 1682 | Ga0157378_10000924 | |||
| 1683 | Ga0157378_10001041 | |||
| 1684 | Ga0157378_10024596 | |||
| 1685 | Ga0157378_10052176 | |||
| 1686 | Ga0157378_10382487 | |||
| 1687 | Ga0157378_11048948 | |||
| 1688 | Ga0163162_10002555 | |||
| 1689 | Ga0163162_10023203 | |||
| 1690 | Ga0163162_10223794 | |||
| 1691 | Ga0163162_10226750 | |||
| 1692 | Ga0163162_10677033 | |||
| 1693 | Ga0163162_12103384 | |||
| 1694 | Ga0157372_10004337 | |||
| 1695 | Ga0157372_10005053 | |||
| 1696 | Ga0157372_10005073 | |||
| 1697 | Ga0157372_10013765 | |||
| 1698 | Ga0157372_10027852 | |||
| 1699 | Ga0157372_10029627 | |||
| 1700 | Ga0157372_10034206 | |||
| 1701 | Ga0157372_10042655 | |||
| 1702 | Ga0157372_10168594 | |||
| 1703 | Ga0157372_10204928 | |||
| 1704 | Ga0157372_10225186 | |||
| 1705 | Ga0157372_12882713 | |||
| 1706 | Ga0157372_13391512 | |||
| 1707 | Ga0157375_10046025 | |||
| 1708 | Ga0157375_10486576 | |||
| 1709 | Ga0157375_12440078 | |||
| 1710 | Ga0157375_13353177 | |||
| 1711 | Ga0163163_10013744 | |||
| 1712 | Ga0163163_10086425 | |||
| 1713 | Ga0163163_10219353 | |||
| 1714 | Ga0163163_10223620 | |||
| 1715 | Ga0163163_10520580 | |||
| 1716 | Ga0163163_10626428 | |||
| 1717 | Ga0163163_11219014 | |||
| 1718 | Ga0157380_10657044 | |||
| 1719 | Ga0182008_10022568 | |||
| 1720 | Ga0182008_10401928 | |||
| 1721 | Ga0182008_10984684 | |||
| 1722 | Ga0157377_10000553 | |||
| 1723 | Ga0157379_10020013 | |||
| 1724 | Ga0157379_10129018 | |||
| 1725 | Ga0157379_10212150 | |||
| 1726 | Ga0157379_10351645 | |||
| 1727 | Ga0157379_10983689 | |||
| 1728 | Ga0157376_10024322 | |||
| 1729 | Ga0157376_10026459 | |||
| 1730 | Ga0157376_10098234 | |||
| 1731 | Ga0157376_12868544 | |||
| 1732 | Ga0182007_10005999 | |||
| 1733 | Ga0182005_1089711 | |||
| 1734 | Ga0182005_1131068 | |||
| 1735 | Ga0182005_1176412 | |||
| 1736 | Ga0163161_10052956 | |||
| 1737 | Ga0213873_10053011 | |||
| 1738 | Ga0213876_10543186 | |||
| 1739 | Ga0213871_10030876 | |||
| 1740 | Ga0224569_100415 | |||
| 1741 | Ga0224569_104886 | |||
| 1742 | Ga0224571_100576 | |||
| 1743 | Ga0224571_105902 | |||
| 1744 | Ga0224572_1010953 | |||
| 1745 | Ga0224572_1034169 | |||
| 1746 | Ga0224572_1046485 | |||
| 1747 | Ga0228598_1004427 | |||
| 1748 | Ga0228598_1037914 | |||
| 1749 | Ga0207697_10011415 | |||
| 1750 | Ga0207656_10018748 | |||
| 1751 | Ga0207656_10098824 | |||
| 1752 | Ga0207656_10307005 | |||
| 1753 | Ga0207696_1049382 | |||
| 1754 | Ga0207682_10152652 | |||
| 1755 | Ga0207682_10498100 | |||
| 1756 | Ga0207692_10005687 | |||
| 1757 | Ga0207692_10040412 | |||
| 1758 | Ga0207692_10178878 | |||
| 1759 | Ga0207692_10315219 | |||
| 1760 | Ga0207692_10504790 | |||
| 1761 | Ga0207642_10034045 | |||
| 1762 | Ga0207642_10048007 | |||
| 1763 | Ga0207642_10059580 | |||
| 1764 | Ga0207642_10074477 | |||
| 1765 | Ga0207642_10134282 | |||
| 1766 | Ga0207710_10006323 | |||
| 1767 | Ga0207710_10059872 | |||
| 1768 | Ga0207688_10012092 | |||
| 1769 | Ga0207680_10012624 | |||
| 1770 | Ga0207680_10026106 | |||
| 1771 | Ga0207680_10852426 | |||
| 1772 | Ga0207647_10006337 | |||
| 1773 | Ga0207647_10008116 | |||
| 1774 | Ga0207647_10400539 | |||
| 1775 | Ga0207647_10480216 | |||
| 1776 | Ga0207685_10097593 | |||
| 1777 | Ga0207699_10000209 | |||
| 1778 | Ga0207699_10029486 | |||
| 1779 | Ga0207699_10144010 | |||
| 1780 | Ga0207699_10155059 | |||
| 1781 | Ga0207699_10248059 | |||
| 1782 | Ga0207699_10360745 | |||
| 1783 | Ga0207699_10426331 | |||
| 1784 | Ga0207699_10435431 | |||
| 1785 | Ga0207699_10641451 | |||
| 1786 | Ga0207699_10801201 | |||
| 1787 | Ga0207699_11040779 | |||
| 1788 | Ga0207699_11458295 | |||
| 1789 | Ga0207645_10014919 | |||
| 1790 | Ga0207645_10647076 | |||
| 1791 | Ga0207645_11189564 | |||
| 1792 | Ga0207643_10000328 | |||
| 1793 | Ga0207643_10037980 | |||
| 1794 | Ga0207705_10081568 | |||
| 1795 | Ga0207684_10001048 | |||
| 1796 | Ga0207684_10016175 | |||
| 1797 | Ga0207684_10140217 | |||
| 1798 | Ga0207654_10014585 | |||
| 1799 | Ga0207654_10016876 | |||
| 1800 | Ga0207654_10360289 | |||
| 1801 | Ga0207654_10439518 | |||
| 1802 | Ga0207707_10001653 | |||
| 1803 | Ga0207707_10012547 | |||
| 1804 | Ga0207707_10063871 | |||
| 1805 | Ga0207707_10484957 | |||
| 1806 | Ga0207707_10485236 | |||
| 1807 | Ga0207707_10882496 | |||
| 1808 | Ga0207707_11137113 | |||
| 1809 | Ga0207695_10041443 | |||
| 1810 | Ga0207695_10055923 | |||
| 1811 | Ga0207695_10190930 | |||
| 1812 | Ga0207695_10266973 | |||
| 1813 | Ga0207695_10330474 | |||
| 1814 | Ga0207695_10409782 | |||
| 1815 | Ga0207695_10475621 | |||
| 1816 | Ga0207695_11140604 | |||
| 1817 | Ga0207671_10142949 | |||
| 1818 | Ga0207671_10266988 | |||
| 1819 | Ga0207671_10314424 | |||
| 1820 | Ga0207671_10373263 | |||
| 1821 | Ga0207671_10579127 | |||
| 1822 | Ga0207693_10000026 | |||
| 1823 | Ga0207693_10000275 | |||
| 1824 | Ga0207693_10013544 | |||
| 1825 | Ga0207693_10041917 | |||
| 1826 | Ga0207693_10050041 | |||
| 1827 | Ga0207693_10475481 | |||
| 1828 | Ga0207693_10487383 | |||
| 1829 | Ga0207663_10000479 | |||
| 1830 | Ga0207663_10043172 | |||
| 1831 | Ga0207663_10115065 | |||
| 1832 | Ga0207663_10133191 | |||
| 1833 | Ga0207663_10165415 | |||
| 1834 | Ga0207663_10330785 | |||
| 1835 | Ga0207663_10661459 | |||
| 1836 | Ga0207663_11117893 | |||
| 1837 | Ga0207663_11189739 | |||
| 1838 | Ga0207660_10052201 | |||
| 1839 | Ga0207660_10134124 | |||
| 1840 | Ga0207660_10172760 | |||
| 1841 | Ga0207662_10011391 | |||
| 1842 | Ga0207657_10002285 | |||
| 1843 | Ga0207657_10002326 | |||
| 1844 | Ga0207657_10002602 | |||
| 1845 | Ga0207649_10000612 | |||
| 1846 | Ga0207649_10106961 | |||
| 1847 | Ga0207649_10476179 | |||
| 1848 | Ga0207652_10003536 | |||
| 1849 | Ga0207652_10031402 | |||
| 1850 | Ga0207652_10046052 | |||
| 1851 | Ga0207652_10327724 | |||
| 1852 | Ga0207652_10444464 | |||
| 1853 | Ga0207646_10001230 | |||
| 1854 | Ga0207646_10076603 | |||
| 1855 | Ga0207646_10142285 | |||
| 1856 | Ga0207646_10206029 | |||
| 1857 | Ga0207646_10207012 | |||
| 1858 | Ga0207646_10845555 | |||
| 1859 | Ga0207681_10021015 | |||
| 1860 | Ga0207681_10255903 | |||
| 1861 | Ga0207694_10002710 | |||
| 1862 | Ga0207694_10038561 | |||
| 1863 | Ga0207694_10056775 | |||
| 1864 | Ga0207694_10145918 | |||
| 1865 | Ga0207694_10208383 | |||
| 1866 | Ga0207694_10287138 | |||
| 1867 | Ga0207650_10000152 | |||
| 1868 | Ga0207650_10002883 | |||
| 1869 | Ga0207650_10805378 | |||
| 1870 | Ga0207650_10996740 | |||
| 1871 | Ga0207659_11422123 | |||
| 1872 | Ga0207687_10002291 | |||
| 1873 | Ga0207687_10018465 | |||
| 1874 | Ga0207687_10020665 | |||
| 1875 | Ga0207687_10412635 | |||
| 1876 | Ga0207687_11466307 | |||
| 1877 | Ga0207700_10000306 | |||
| 1878 | Ga0207700_10000979 | |||
| 1879 | Ga0207700_10002156 | |||
| 1880 | Ga0207700_10036292 | |||
| 1881 | Ga0207700_10057403 | |||
| 1882 | Ga0207700_10265343 | |||
| 1883 | Ga0207700_10615410 | |||
| 1884 | Ga0207700_10822379 | |||
| 1885 | Ga0207700_10873893 | |||
| 1886 | Ga0207700_10896078 | |||
| 1887 | Ga0207700_11123708 | |||
| 1888 | Ga0207700_11741819 | |||
| 1889 | Ga0207664_10000087 | |||
| 1890 | Ga0207664_10002140 | |||
| 1891 | Ga0207664_10032225 | |||
| 1892 | Ga0207664_10042713 | |||
| 1893 | Ga0207664_10120591 | |||
| 1894 | Ga0207664_10138029 | |||
| 1895 | Ga0207664_10245128 | |||
| 1896 | Ga0207664_10345860 | |||
| 1897 | Ga0207664_10561603 | |||
| 1898 | Ga0207664_10586846 | |||
| 1899 | Ga0207664_10684951 | |||
| 1900 | Ga0207664_11580792 | |||
| 1901 | Ga0207644_10046547 | |||
| 1902 | Ga0207644_10301436 | |||
| 1903 | Ga0207644_10472450 | |||
| 1904 | Ga0207690_10062265 | |||
| 1905 | Ga0207690_10220679 | |||
| 1906 | Ga0207706_10000740 | |||
| 1907 | Ga0207706_10002545 | |||
| 1908 | Ga0207686_10061537 | |||
| 1909 | Ga0207686_10077765 | |||
| 1910 | Ga0207686_10107934 | |||
| 1911 | Ga0207686_10189208 | |||
| 1912 | Ga0207686_10234734 | |||
| 1913 | Ga0207686_10604012 | |||
| 1914 | Ga0207709_10870831 | |||
| 1915 | Ga0207670_10065300 | |||
| 1916 | Ga0207670_11432283 | |||
| 1917 | Ga0207669_10389576 | |||
| 1918 | Ga0207669_10886659 | |||
| 1919 | Ga0207704_10050127 | |||
| 1920 | Ga0207704_11241827 | |||
| 1921 | Ga0207665_10004916 | |||
| 1922 | Ga0207665_10016139 | |||
| 1923 | Ga0207665_10075882 | |||
| 1924 | Ga0207665_10083911 | |||
| 1925 | Ga0207665_10162389 | |||
| 1926 | Ga0207665_10173358 | |||
| 1927 | Ga0207665_10204113 | |||
| 1928 | Ga0207665_10206920 | |||
| 1929 | Ga0207665_10209987 | |||
| 1930 | Ga0207665_10298961 | |||
| 1931 | Ga0207665_10529123 | |||
| 1932 | Ga0207665_11043946 | |||
| 1933 | Ga0207665_11626228 | |||
| 1934 | Ga0207691_10000308 | |||
| 1935 | Ga0207711_10012353 | |||
| 1936 | Ga0207711_10030535 | |||
| 1937 | Ga0207711_10120261 | |||
| 1938 | Ga0207711_10132547 | |||
| 1939 | Ga0207711_10753334 | |||
| 1940 | Ga0207689_10000618 | |||
| 1941 | Ga0207689_10083123 | |||
| 1942 | Ga0207689_10126520 | |||
| 1943 | Ga0207689_10169489 | |||
| 1944 | Ga0207661_10001294 | |||
| 1945 | Ga0207661_10079525 | |||
| 1946 | Ga0207661_10093522 | |||
| 1947 | Ga0207661_10165526 | |||
| 1948 | Ga0207661_10760068 | |||
| 1949 | Ga0207661_11924867 | |||
| 1950 | Ga0207679_10000298 | |||
| 1951 | Ga0207679_10078451 | |||
| 1952 | Ga0207679_10355093 | |||
| 1953 | Ga0207679_10475074 | |||
| 1954 | Ga0207667_10000802 | |||
| 1955 | Ga0207667_10008703 | |||
| 1956 | Ga0207667_10015779 | |||
| 1957 | Ga0207667_10095689 | |||
| 1958 | Ga0207667_10147641 | |||
| 1959 | Ga0207667_10242636 | |||
| 1960 | Ga0207667_10299668 | |||
| 1961 | Ga0207667_10884280 | |||
| 1962 | Ga0207667_11262549 | |||
| 1963 | Ga0207667_12174771 | |||
| 1964 | Ga0207651_10028023 | |||
| 1965 | Ga0207651_10885775 | |||
| 1966 | Ga0207651_11016547 | |||
| 1967 | Ga0207712_10013356 | |||
| 1968 | Ga0207712_10527738 | |||
| 1969 | Ga0207712_10732646 | |||
| 1970 | Ga0207712_11154393 | |||
| 1971 | Ga0207712_11459658 | |||
| 1972 | Ga0207668_10253118 | |||
| 1973 | Ga0207668_10875249 | |||
| 1974 | Ga0207640_10025994 | |||
| 1975 | Ga0207640_10058926 | |||
| 1976 | Ga0207640_10169301 | |||
| 1977 | Ga0207640_10223881 | |||
| 1978 | Ga0207640_10393682 | |||
| 1979 | Ga0207640_11443187 | |||
| 1980 | Ga0207658_10164606 | |||
| 1981 | Ga0207658_11072761 | |||
| 1982 | Ga0207658_11951055 | |||
| 1983 | Ga0207677_10002182 | |||
| 1984 | Ga0207677_10050324 | |||
| 1985 | Ga0207677_10055739 | |||
| 1986 | Ga0207677_11204727 | |||
| 1987 | Ga0207677_12268125 | |||
| 1988 | Ga0207703_10006614 | |||
| 1989 | Ga0207703_10290929 | |||
| 1990 | Ga0207703_10811364 | |||
| 1991 | Ga0207703_11339989 | |||
| 1992 | Ga0207703_11774022 | |||
| 1993 | Ga0207639_10034908 | |||
| 1994 | Ga0207639_10463259 | |||
| 1995 | Ga0207639_10719020 | |||
| 1996 | Ga0207678_10001414 | |||
| 1997 | Ga0207678_10006402 | |||
| 1998 | Ga0207678_10087345 | |||
| 1999 | Ga0207678_10536629 | |||
| 2000 | Ga0207708_10281715 | |||
| 2001 | Ga0207702_10001466 | |||
| 2002 | Ga0207702_10006585 | |||
| 2003 | Ga0207702_10007672 | |||
| 2004 | Ga0207702_10030165 | |||
| 2005 | Ga0207702_10220885 | |||
| 2006 | Ga0207702_10256086 | |||
| 2007 | Ga0207702_10786502 | |||
| 2008 | Ga0207702_11961894 | |||
| 2009 | Ga0207641_10000052 | |||
| 2010 | Ga0207641_10014828 | |||
| 2011 | Ga0207641_10035964 | |||
| 2012 | Ga0207641_10836545 | |||
| 2013 | Ga0207641_11090066 | |||
| 2014 | Ga0207641_11228068 | |||
| 2015 | Ga0207648_10001643 | |||
| 2016 | Ga0207648_10003472 | |||
| 2017 | Ga0207648_10014202 | |||
| 2018 | Ga0207676_10000176 | |||
| 2019 | Ga0207676_10001129 | |||
| 2020 | Ga0207676_10004043 | |||
| 2021 | Ga0207676_10124788 | |||
| 2022 | Ga0207676_10915527 | |||
| 2023 | Ga0207674_10000125 | |||
| 2024 | Ga0207674_10000561 | |||
| 2025 | Ga0207674_10005435 | |||
| 2026 | Ga0207674_10026155 | |||
| 2027 | Ga0207674_10122742 | |||
| 2028 | Ga0207674_10123814 | |||
| 2029 | Ga0207674_10413522 | |||
| 2030 | Ga0207675_100027751 | |||
| 2031 | Ga0207675_100163396 | |||
| 2032 | Ga0207675_101574796 | |||
| 2033 | Ga0207683_10002524 | |||
| 2034 | Ga0207683_10498632 | |||
| 2035 | Ga0207683_10793578 | |||
| 2036 | Ga0207683_10822407 | |||
| 2037 | Ga0207683_11768994 | |||
| 2038 | Ga0207698_10022855 | |||
| 2039 | Ga0207698_10084521 | |||
| 2040 | Ga0207698_10531712 | |||
| 2041 | Ga0207698_10703927 | |||
| 2042 | Ga0207698_10910326 | |||
| 2043 | Ga0207698_11041404 | |||
| 2044 | Ga0265356_1000766 | |||
| 2045 | Ga0265356_1011999 | |||
| 2046 | Ga0268266_10092603 | |||
| 2047 | Ga0268266_12300064 | |||
| 2048 | Ga0268265_10191932 | |||
| 2049 | Ga0268265_10979301 | |||
| 2050 | Ga0268264_10006934 | |||
| 2051 | Ga0268264_10011379 | |||
| 2052 | Ga0268264_10106594 | |||
| 2053 | Ga0268264_10259415 | |||
| 2054 | Ga0268264_10595489 | |||
| 2055 | Ga0268264_11065374 | |||
| 2056 | Ga0268264_12395624 | |||
| 2057 | Ga0268264_12437654 | |||
| 2058 | Ga0265338_10011173 | |||
| 2059 | Ga0265338_10061089 | |||
| 2060 | Ga0265338_10119970 | |||
| 2061 | Ga0265338_10177814 | |||
| 2062 | Ga0265338_10680910 | |||
| 2063 | Ga0265338_10972356 | |||
| 2064 | Ga0265338_11011802 | |||
| 2065 | Ga0265324_10153429 | |||
| 2066 | Ga0265762_1000401 | |||
| 2067 | Ga0265762_1001210 | |||
| 2068 | Ga0265762_1005514 | |||
| 2069 | Ga0265762_1037256 | |||
| 2070 | Ga0265770_1056611 | |||
| 2071 | Ga0265760_10023165 | |||
| 2072 | Ga0265760_10336576 | |||
| 2073 | Ga0265325_10004543 | |||
| 2074 | Ga0265325_10200013 | |||
| 2075 | Ga0265339_10023928 | |||
| 2076 | Ga0265339_10064549 | |||
| 2077 | Ga0265339_10252930 | |||
| 2078 | Ga0265339_10411893 | |||
| 2079 | Ga0265331_10114238 | |||
| 2080 | Ga0265316_10006220 | |||
| 2081 | Ga0265316_10016491 | |||
| 2082 | Ga0265316_10133418 | |||
| 2083 | Ga0265316_10178274 | |||
| 2084 | Ga0265316_10673412 | |||
| 2085 | Ga0265314_10012372 | |||
| 2086 | Ga0265314_10022604 | |||
| 2087 | Ga0265342_10014809 | |||
| 2088 | Ga0316212_1026710 | |||
| 2089 | Ga0373948_0100863 | |||
| 2090 | Ga0373958_0035263 | |||
| 2091 | Ga0373938_0011890 | |||
| 2092 | Ga0373926_0028827 | |||
| 2093 | Ga0373926_0084906 | |||
| 2094 | Ga0373934_0016874 | |||
| 2095 | Ga0373934_0099393 | |||
| 2096 | Ga0373944_0062344 | |||
| 2097 | Ga0373944_0202982 | |||
| 2098 | Ga0373951_0007459 | |||
| 2099 | Ga0373952_0067118 | |||
| 2100 | Ga0373923_0002217 | |||
| 2101 | Ga0373923_0159354 | |||
| 2102 | Ga0373923_0555561 | |||
| 2103 | Ga0373936_0010297 | |||
| 2104 | Ga0373936_0102688 | |||
| 2105 | Ga0373936_0292886 | |||
| 2106 | Ga0373939_0165265 | |||
| 2107 | Ga0373945_0003343 | |||
| 2108 | Ga0373945_0101339 | |||
| 2109 | Ga0373945_0237635 | |||
| 2110 | Ga0373945_0553359 | |||
| 2111 | Ga0373953_0105884 | |||
| 2112 | Ga0373954_0188422 | |||
| 2113 | Ga0373956_0056146 | |||
| 2114 | Ga0373960_0064682 | |||
| 2115 | Ga0373943_0001626 | |||
| 2116 | Ga0373943_0344546 | |||
| 2117 | Ga0373943_0362979 | |||
| 2118 | Ga0373946_0002814 | |||
| 2119 | Ga0373946_0148381 | |||
| 2120 | Ga0373955_0243010 | |||
| 2121 | Ga0373955_0252596 | |||
| 2122 | Ga0373942_0077761 | |||
| 2123 | Ga0373962_0062279 | |||
| 2124 | Ga0373924_0040106 | |||
| 2125 | Ga0373931_0034821 | |||
| 2126 | Ga0373931_0100539 | |||
| 2127 | Ga0373931_0318615 | |||
| 2128 | Ga0373931_0904073 | |||
| 2129 | Ga0373935_0005817 | |||
| 2130 | Ga0373935_0046735 | |||
| 2131 | Ga0373935_0106296 | |||
| 2132 | Ga0373935_1144951 | |||
| 2133 | Ga0373935_1422811 | |||
| 2134 | Ga0373927_0000747 | |||
| 2135 | Ga0373927_0014065 | |||
| 2136 | Ga0373927_0084648 | |||
| 2137 | Ga0373927_0172697 | |||
| 2138 | Ga0373927_0294472 | |||
| 2139 | Ga0373927_1085632 | |||
| 2140 | Ga0373933_0028842 | |||
| 2141 | Ga0373933_0178489 | |||
| 2142 | Ga0373933_0263838 | |||
| 2143 | Ga0373933_0967731 | |||
| 2144 | Ga0373933_1166632 | |||
| 2145 | Ga0373947_0011342 | |||
| 2146 | Ga0373947_0014094 | |||
| 2147 | Ga0373947_0547906 | |||
| 2148 | Ga0373937_0198306 | |||
| 2149 | Ga0373937_0304131 | |||
| 2150 | Ga0373937_0513887 | |||
| 2151 | Ga0373937_0669470 | |||
| 2152 | Ga0373937_1435735 | |||
| 2153 | Ga0373937_1855054 | |||
| 2154 | Ga0373937_1922789 | |||
| 2155 | Ga0373925_0004658 | |||
| 2156 | Ga0373925_0026245 | |||
| 2157 | Ga0373925_0176237 | |||
| 2158 | Ga0373925_0264800 | |||
| 2159 | Ga0373925_0466103 | |||
| 2160 | Ga0373925_0923190 | |||
| 2161 | Ga0373925_1069826 | |||
| 2162 | Ga0395900_1301114 | |||
| 2163 | Ga0395898_0725081 | |||
| 2164 | Ga0436365_0628206 | |||
| 2165 | Ga0436360_0246638 | |||
| 2166 | Ga0436363_0958565 | |||
| 2167 | Ga0436362_0405904 | |||
| 2168 | Ga0436362_1033386 | |||
| 2169 | Ga0451839_0076152 | |||
| 2170 | Ga0451577_1336472 | |||
| 2171 | Ga0466966_0948723 | |||
| 2172 | Ga0466961_0257802 | |||
| 2173 | Ga0466963_0031366 | |||
| 2174 | Ga0466963_0165209 | |||
| 2175 | Ga0466963_0731204 | |||
| 2176 | Ga0466964_0181822 | |||
| 2177 | Ga0466964_0634191 | |||
| 2178 | Ga0466964_0811975 | |||
| 2179 | Ga0453684_1002999 | |||
| 2180 | Ga0466968_0064189 | |||
| 2181 | Ga0466959_0296843 | |||
| 2182 | Ga0451576_0080329 | |||
| 2183 | Ga0451576_0086697 | |||
| 2184 | Ga0451576_0671549 | |||
| 2185 | Ga0451576_0717923 | |||
| 2186 | Ga0451576_1371234 | |||
| 2187 | Ga0466958_0395616 | |||
| 2188 | Ga0466958_1140714 | |||
| 2189 | Ga0466967_0053937 | |||
| 2190 | Ga0466967_0100894 | |||
| 2191 | Ga0466967_0735964 | |||
| 2192 | Ga0495592_0744746 | |||
| 2193 | Ga0495603_0373179 | |||
| 2194 | Ga0495603_0487013 | |||
| 2195 | Ga0495629_0545444 | |||
| 2196 | Ga0495651_0440268 | |||
| 2197 | Ga0495651_0939590 | |||
| 2198 | Ga0495653_0679607 | |||
| 2199 | Ga0495580_0000603 | |||
| 2200 | Ga0495580_0001289 | |||
| 2201 | Ga0495580_0003921 | |||
| 2202 | Ga0495580_0009412 | |||
| 2203 | Ga0495580_0034777 | |||
| 2204 | Ga0495580_0049839 | |||
| 2205 | Ga0495580_0175814 | |||
| 2206 | Ga0495580_0233020 | |||
| 2207 | Ga0495580_0444425 | |||
| 2208 | Ga0495580_0575513 | |||
| 2209 | Ga0495582_0001718 | |||
| 2210 | Ga0495582_0002195 | |||
| 2211 | Ga0495582_0201690 | |||
| 2212 | Ga0495639_0014516 | |||
| 2213 | Ga0495662_0066426 | |||
| 2214 | Ga0495664_0016333 | |||
| 2215 | Ga0495664_0065861 | |||
| 2216 | Ga0495594_0395988 | |||
| 2217 | Ga0495608_0315133 | |||
| 2218 | Ga0495618_0645444 | |||
| 2219 | Ga0495630_0100516 | |||
| 2220 | Ga0495630_0209526 | |||
| 2221 | Ga0495630_0295296 | |||
| 2222 | Ga0495630_0346110 | |||
| 2223 | Ga0495666_0109979 | |||
| 2224 | Ga0495652_0575471 | |||
| 2225 | Ga0495665_0029765 | |||
| 2226 | Ga0495665_0190339 | |||
| 2227 | Ga0495665_0379291 | |||
| 2228 | Ga0495586_0122509 | |||
| 2229 | Ga0495587_0032512 | |||
| 2230 | Ga0495587_0580062 | |||
| 2231 | Ga0495667_0175614 | |||
| 2232 | Ga0495635_0123300 | |||
| 2233 | Ga0495657_0161318 | |||
| 2234 | Ga0495623_0303880 | |||
| 2235 | Ga0495623_0378222 | |||
| 2236 | Ga0495623_0687405 | |||
| 2237 | Ga0495623_0703661 | |||
| 2238 | Ga0495646_0378954 | |||
| 2239 | Ga0495658_0114741 | |||
| 2240 | Ga0495669_0202159 | |||
| 2241 | Ga0495613_0185423 | |||
| 2242 | Ga0495600_0212828 | |||
| 2243 | Ga0495581_0016034 | |||
| 2244 | Ga0495581_0067826 | |||
| 2245 | Ga0495581_0104136 | |||
| 2246 | Ga0495581_0113158 | |||
| 2247 | Ga0495604_0039992 | |||
| 2248 | Ga0495674_0094012 | |||
| 2249 | Ga0495674_0186315 | |||
| 2250 | Ga0495674_0280833 | |||
| 2251 | Ga0495674_0589143 | |||
| 2252 | Ga0495674_0838568 | |||
| 2253 | Ga0495674_1401102 | |||
| 2254 | Ga0495676_0282386 | |||
| 2255 | Ga0495675_0665863 | |||
| 2256 | Ga0495685_273547 | |||
| 2257 | Ga0495684_0507009 | |||
| 2258 | Ga0495602_0130451 | |||
| 2259 | Ga0495602_0476993 | |||
| 2260 | Ga0495614_0189451 | |||
| 2261 | Ga0496100_0348790 | |||
| 2262 | Ga0496100_0736734 | |||
| 2263 | Ga0496100_1012209 | |||
| 2264 | Ga0496101_0049553 | |||
| 2265 | Ga0496101_0417595 | |||
| 2266 | Ga0496101_0535783 | |||
| 2267 | Ga0496101_0753745 | |||
| 2268 | Ga0496101_1001404 | |||
| 2269 | Ga0496102_0309600 | |||
| 2270 | Ga0496102_0554075 | |||
| 2271 | Ga0496102_0615511 | |||
| 2272 | Ga0496102_0900454 | |||
| 2273 | Ga0496102_1634175 | |||
| 2274 | Ga0496103_0201464 | |||
| 2275 | Ga0496103_0300120 | |||
| 2276 | Ga0496103_0318699 | |||
| 2277 | Ga0496103_0862464 | |||
| 2278 | Ga0496104_0058767 | |||
| 2279 | Ga0496104_0070054 | |||
| 2280 | Ga0496104_0118656 | |||
| 2281 | Ga0496104_0146462 | |||
| 2282 | Ga0496104_0166384 | |||
| 2283 | Ga0496104_0697285 | |||
| 2284 | Ga0496105_0025317 | |||
| 2285 | Ga0496105_0185026 | |||
| 2286 | Ga0496105_0406337 | |||
| 2287 | Ga0496106_0044811 | |||
| 2288 | Ga0496106_0233346 | |||
| 2289 | Ga0496107_0075478 | |||
| 2290 | Ga0496107_0344390 | |||
| 2291 | Ga0496107_0570412 | |||
| 2292 | Ga0496108_0000242 | |||
| 2293 | Ga0496108_0114263 | |||
| 2294 | Ga0496108_0973288 | |||
| 2295 | Ga0496109_0000120 | |||
| 2296 | Ga0496109_0051640 | |||
| 2297 | Ga0496109_0092435 | |||
| 2298 | Ga0496109_0112074 | |||
| 2299 | Ga0496109_0449451 | |||
| 2300 | Ga0496109_1250089 | |||
| 2301 | Ga0496109_1406471 | |||
| 2302 | Ga0496110_0003869 | |||
| 2303 | Ga0496110_0018359 | |||
| 2304 | Ga0496110_1208322 | |||
| 2305 | Ga0496111_0013049 | |||
| 2306 | Ga0496111_0020419 | |||
| 2307 | Ga0496112_0000198 | |||
| 2308 | Ga0496112_0024111 | |||
| 2309 | Ga0496112_0046570 | |||
| 2310 | Ga0496112_0064520 | |||
| 2311 | Ga0496112_0080018 | |||
| 2312 | Ga0496112_0198584 | |||
| 2313 | Ga0496112_0275747 | |||
| 2314 | Ga0496112_0374280 | |||
| 2315 | Ga0496112_0560108 | |||
| 2316 | Ga0496112_1526184 | |||
| 2317 | Ga0496113_0000111 | |||
| 2318 | Ga0496113_0229510 | |||
| 2319 | Ga0496113_0967228 | |||
| 2320 | Ga0496113_1255283 | |||
| 2321 | Ga0496114_0141388 | |||
| 2322 | Ga0496114_0236103 | |||
| 2323 | Ga0496115_0003194 | |||
| 2324 | Ga0496115_0051792 | |||
| 2325 | Ga0496115_0161131 | |||
| 2326 | Ga0496115_0242887 | |||
| 2327 | Ga0496115_0524973 | |||
| 2328 | Ga0496115_0673134 | |||
| 2329 | nmdc:mga0n895_6611_c1 | |||
| 2330 | nmdc:mga0rr50_15265_c1 | |||
| 2331 | nmdc:mga0rr50_2703_c1 | |||
| 2332 | nmdc:mga08x19_103937_c1 | |||
| 2333 | nmdc:mga08x19_11637_c1 | |||
| 2334 | Ga0495601_0723047 | |||
| 2335 | Ga0495612_0512072 | |||
| 2336 | Ga0495619_0256876 | |||
| 2337 | Ga0495619_1190674 | |||
| 2338 | Ga0466962_0159842 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j27-assembly1.cif.gz_A | crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution | 0.9183 | 2 | 93 |
| 1j27-assembly1.cif.gz_A | crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution | 0.8457 | 2 | 93 |
| 7b90-assembly1.cif.gz_E | circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant | 0.7511 | 3 | 95 |
| 5ae2-assembly1.cif.gz_A | ether lipid-generating enzyme agps in complex with inhibitor 1e | 0.7439 | 2 | 85 |
| 6wxo-assembly1.cif.gz_A | de novo tim barrel-ferredoxin fold fusion homodimer with 2-histidine 2-glutamate centre tfd-he | 0.7296 | 4 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j27A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.9184 | 2 | 93 | 3.30.70.1120 |
| af_O33252_1_96_3.30.70.1120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.9006 | 2 | 93 | 3.30.70.1120 |
| 1j27A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.8458 | 2 | 93 | 3.30.70.1120 |
| af_O33252_1_96_3.30.70.1120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.8383 | 2 | 93 | 3.30.70.1120 |
| af_P0AEP9_350_431_3.30.70.2740 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7598 | 4 | 89 | 3.30.70.2740 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1IIT4-F1-model_v4 | YlxP-like protein | 0.9889 | 2 | 95 |
|
| AF-A0A1H5WFH4-F1-model_v4 | DUF503 domain-containing protein | 0.986 | 2 | 93 |
|
| AF-A0A1Z9M751-F1-model_v4 | DUF503 domain-containing protein | 0.9801 | 2 | 95 |
|
| AF-A0A1G7FZM0-F1-model_v4 | DUF503 domain-containing protein | 0.9782 | 2 | 95 |
|
| AF-A0A7D8BDH0-F1-model_v4 | DUF503 family protein | 0.9728 | 2 | 93 |
|