F491126

General Info

Members Datasets Scaffolds Average Seq Length
1169 328 2338 96

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10186542|Ga0099796_101865422
Length 106
Sequence VFSRQNWNLETRYWKQTLIAFLTLELHIEAAQSLKDRRQVVLRASFNVSVAELDASGLWNRATVGVVSVSDSRDYLDGLMKNVERQATRIANNHGADLADSFVEYF

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
134 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
135 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
136 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
257 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.82
Rhizosphere 93.58
Stem 0
Stem Tuber 0
Unclassified 27.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10186542 3300010159 Unclassified 835
2 MRS1b_contig_6382803 2162886011 Unclassified 903
3 MRS1b_contig_9171898 2162886011 Unclassified 1374
4 MBSR1b_contig_9749820 2162886012 Bacteria 1872
5 LJNas_1001079 3300000546 Bacteria 4237
6 LJNas_1001135 3300000546 Bacteria 4059
7 JGI24741J21665_1044410 3300001915 Bacteria 654
8 JGI24752J21851_1013055 3300001976 Bacteria 1085
9 JGI24034J26672_10123497 3300002239 Unclassified 503
10 JGI24751J29686_10005033 3300002459 Bacteria 2694
11 rootH1_10193919 3300003323 Unclassified 1216
12 rootH1_10326518 3300003323 Unclassified 1158
13 Ga0058863_10016641 3300004799 Bacteria 3138
14 Ga0065712_10008743 3300005290 Bacteria 3949
15 Ga0065712_10058536 3300005290 Unclassified 615
16 Ga0065712_10082582 3300005290 Bacteria 2904
17 Ga0065712_10246720 3300005290 Unclassified 970
18 Ga0065715_11044722 3300005293 Bacteria 533
19 Ga0065707_10461869 3300005295 Unclassified 790
20 Ga0070658_10144456 3300005327 Bacteria 1989
21 Ga0070658_10175172 3300005327 Bacteria 1803
22 Ga0070676_10002636 3300005328 Bacteria 9235
23 Ga0070683_100024239 3300005329 Bacteria 5433
24 Ga0070683_100051208 3300005329 Unclassified 3823
25 Ga0070683_100083853 3300005329 Unclassified 2985
26 Ga0070683_100121497 3300005329 Bacteria 2468
27 Ga0070683_100262019 3300005329 Bacteria 1644
28 Ga0070683_100366069 3300005329 Unclassified 1373
29 Ga0070690_100121027 3300005330 Bacteria 1756
30 Ga0070690_100733087 3300005330 Unclassified 761
31 Ga0070670_100002163 3300005331 Bacteria 16137
32 Ga0070670_100189664 3300005331 Unclassified 1785
33 Ga0070670_100614349 3300005331 Unclassified 973
34 Ga0070670_101462411 3300005331 Unclassified 627
35 Ga0070670_101562141 3300005331 Bacteria 606
36 Ga0070677_10059096 3300005333 Bacteria 1576
37 Ga0070677_10728922 3300005333 Unclassified 560
38 Ga0070677_10824694 3300005333 Unclassified 531
39 Ga0068869_100043195 3300005334 Unclassified 3236
40 Ga0068869_100078820 3300005334 Bacteria 2454
41 Ga0068869_100151067 3300005334 Bacteria 1801
42 Ga0068869_100224084 3300005334 Bacteria 1491
43 Ga0068869_100489353 3300005334 Bacteria 1025
44 Ga0068869_101772911 3300005334 Unclassified 552
45 Ga0070666_10010515 3300005335 Bacteria 5790
46 Ga0070666_10163128 3300005335 Bacteria 1558
47 Ga0070666_10260841 3300005335 Unclassified 1228
48 Ga0070680_100012730 3300005336 Bacteria 6540
49 Ga0070680_100017979 3300005336 Bacteria 5582
50 Ga0070680_100069074 3300005336 Bacteria 2901
51 Ga0070680_100144923 3300005336 Bacteria 1992
52 Ga0070680_100227758 3300005336 Unclassified 1574
53 Ga0070682_100020940 3300005337 Bacteria 3853
54 Ga0070682_100084027 3300005337 Bacteria 2068
55 Ga0070682_100101201 3300005337 Bacteria 1902
56 Ga0070682_101365466 3300005337 Unclassified 604
57 Ga0068868_100004608 3300005338 Bacteria 9669
58 Ga0068868_100005733 3300005338 Bacteria 8738
59 Ga0068868_100019713 3300005338 Bacteria 5057
60 Ga0068868_100046519 3300005338 Unclassified 3397
61 Ga0068868_100101109 3300005338 Bacteria 2333
62 Ga0068868_100144690 3300005338 Unclassified 1954
63 Ga0068868_100612571 3300005338 Bacteria 966
64 Ga0068868_100693154 3300005338 Bacteria 911
65 Ga0070660_100003269 3300005339 Bacteria 11126
66 Ga0070660_100065897 3300005339 Bacteria 2819
67 Ga0070689_100001444 3300005340 Bacteria 15164
68 Ga0070689_100157841 3300005340 Unclassified 1832
69 Ga0070689_101292351 3300005340 Bacteria 657
70 Ga0070691_10417278 3300005341 Bacteria 760
71 Ga0070661_100005865 3300005344 Bacteria 8447
72 Ga0070661_100041016 3300005344 Bacteria 3377
73 Ga0070661_100058538 3300005344 Bacteria 2824
74 Ga0070661_100088315 3300005344 Bacteria 2294
75 Ga0070668_100007447 3300005347 Bacteria 8122
76 Ga0070668_100045126 3300005347 Unclassified 3381
77 Ga0070669_100103155 3300005353 Unclassified 2154
78 Ga0070669_100358117 3300005353 Bacteria 1186
79 Ga0070669_100540975 3300005353 Unclassified 970
80 Ga0070675_100272534 3300005354 Bacteria 1485
81 Ga0070671_100227900 3300005355 Bacteria 1581
82 Ga0070671_100266764 3300005355 Bacteria 1455
83 Ga0070671_101355495 3300005355 Unclassified 628
84 Ga0070671_101450296 3300005355 Unclassified 607
85 Ga0070674_100049601 3300005356 Bacteria 2887
86 Ga0070674_100443076 3300005356 Unclassified 1070
87 Ga0070673_100046972 3300005364 Bacteria 3357
88 Ga0070673_100053292 3300005364 Bacteria 3176
89 Ga0070673_100385715 3300005364 Bacteria 1250
90 Ga0070673_101742590 3300005364 Unclassified 590
91 Ga0070688_100010943 3300005365 Bacteria 5024
92 Ga0070688_100191835 3300005365 Bacteria 1424
93 Ga0070688_100216208 3300005365 Bacteria 1348
94 Ga0070659_100220425 3300005366 Bacteria 1565
95 Ga0070659_101470904 3300005366 Bacteria 606
96 Ga0070667_100090690 3300005367 Bacteria 2627
97 Ga0070667_100468531 3300005367 Bacteria 1152
98 Ga0070667_100695718 3300005367 Unclassified 940
99 Ga0070667_101213544 3300005367 Bacteria 706
100 Ga0070667_101699206 3300005367 Bacteria 594
101 Ga0070709_10000423 3300005434 Bacteria 25611
102 Ga0070709_10020249 3300005434 Bacteria 3857
103 Ga0070709_10135876 3300005434 Archaea 1684
104 Ga0070709_10140106 3300005434 Bacteria 1661
105 Ga0070709_10279073 3300005434 Unclassified 1213
106 Ga0070709_10287034 3300005434 Bacteria 1198
107 Ga0070709_10836005 3300005434 Bacteria 725
108 Ga0070714_100000096 3300005435 Bacteria 74616
109 Ga0070714_100002108 3300005435 Bacteria 14594
110 Ga0070714_100017874 3300005435 Bacteria 5750
111 Ga0070714_100117686 3300005435 Bacteria 2360
112 Ga0070714_100132009 3300005435 Bacteria 2233
113 Ga0070714_100209199 3300005435 Bacteria 1787
114 Ga0070714_100295570 3300005435 Bacteria 1508
115 Ga0070714_100391089 3300005435 Bacteria 1313
116 Ga0070714_100467245 3300005435 Unclassified 1200
117 Ga0070714_100767236 3300005435 Bacteria 933
118 Ga0070714_100955642 3300005435 Unclassified 833
119 Ga0070714_101105700 3300005435 Bacteria 772
120 Ga0070714_101617003 3300005435 Bacteria 633
121 Ga0070714_102165016 3300005435 Unclassified 542
122 Ga0070713_100000134 3300005436 Bacteria 48639
123 Ga0070713_100000364 3300005436 Bacteria 29177
124 Ga0070713_100063451 3300005436 Bacteria 3097
125 Ga0070713_100095501 3300005436 Unclassified 2564
126 Ga0070713_100550144 3300005436 Unclassified 1093
127 Ga0070713_101018410 3300005436 Unclassified 799
128 Ga0070713_101969707 3300005436 Unclassified 567
129 Ga0070710_10004596 3300005437 Bacteria 6523
130 Ga0070710_10005846 3300005437 Bacteria 5871
131 Ga0070710_10065925 3300005437 Bacteria 2075
132 Ga0070710_10102051 3300005437 Bacteria 1710
133 Ga0070710_10212509 3300005437 Unclassified 1227
134 Ga0070710_10551691 3300005437 Bacteria 796
135 Ga0070710_11470547 3300005437 Unclassified 511
136 Ga0070701_10137393 3300005438 Unclassified 1394
137 Ga0070701_10210443 3300005438 Bacteria 1154
138 Ga0070711_100000271 3300005439 Bacteria 26787
139 Ga0070711_100005922 3300005439 Bacteria 7340
140 Ga0070711_100064787 3300005439 Unclassified 2554
141 Ga0070711_100142088 3300005439 Bacteria 1801
142 Ga0070711_100393545 3300005439 Bacteria 1123
143 Ga0070711_100480998 3300005439 Bacteria 1021
144 Ga0070711_100647232 3300005439 Bacteria 886
145 Ga0070711_100710313 3300005439 Unclassified 847
146 Ga0070711_102015255 3300005439 Bacteria 508
147 Ga0070705_100106655 3300005440 Unclassified 1781
148 Ga0070700_100335038 3300005441 Bacteria 1116
149 Ga0070694_101897467 3300005444 Unclassified 509
150 Ga0070708_100000459 3300005445 Bacteria 30632
151 Ga0070708_100037092 3300005445 Bacteria 4251
152 Ga0070708_100093222 3300005445 Bacteria 2745
153 Ga0070708_100120147 3300005445 Bacteria 2423
154 Ga0070708_100443273 3300005445 Bacteria 1225
155 Ga0070708_100521978 3300005445 Unclassified 1120
156 Ga0070708_100765105 3300005445 Bacteria 908
157 Ga0070663_100054294 3300005455 Bacteria 2863
158 Ga0070663_100147626 3300005455 Unclassified 1800
159 Ga0070663_100768922 3300005455 Bacteria 824
160 Ga0070678_100054773 3300005456 Bacteria 2908
161 Ga0070678_100835215 3300005456 Bacteria 838
162 Ga0070678_101101583 3300005456 Unclassified 733
163 Ga0070678_101574786 3300005456 Unclassified 616
164 Ga0070662_100008601 3300005457 Bacteria 6659
165 Ga0070662_100015770 3300005457 Bacteria 5066
166 Ga0070662_100221260 3300005457 Unclassified 1511
167 Ga0070681_10002834 3300005458 Bacteria 16024
168 Ga0070681_10005694 3300005458 Bacteria 12043
169 Ga0070681_10050021 3300005458 Bacteria 4171
170 Ga0070681_10151119 3300005458 Bacteria 2248
171 Ga0070681_10572937 3300005458 Bacteria 1043
172 Ga0070681_10971602 3300005458 Unclassified 769
173 Ga0070681_11300974 3300005458 Bacteria 650
174 Ga0068867_100003049 3300005459 Bacteria 11813
175 Ga0068867_100040462 3300005459 Bacteria 3402
176 Ga0068867_100197290 3300005459 Bacteria 1609
177 Ga0070685_10004878 3300005466 Bacteria 6784
178 Ga0070685_10307117 3300005466 Bacteria 1071
179 Ga0070706_100002982 3300005467 Bacteria 16776
180 Ga0070706_100096996 3300005467 Bacteria 2738
181 Ga0070706_100136757 3300005467 Bacteria 2287
182 Ga0070707_100003948 3300005468 Bacteria 13962
183 Ga0070707_100163640 3300005468 Unclassified 2168
184 Ga0070707_100172790 3300005468 Bacteria 2106
185 Ga0070707_100597797 3300005468 Bacteria 1066
186 Ga0070707_101237034 3300005468 Bacteria 713
187 Ga0070707_102159041 3300005468 Unclassified 524
188 Ga0070698_100002043 3300005471 Bacteria 22426
189 Ga0070698_100071081 3300005471 Bacteria 3491
190 Ga0070699_100000441 3300005518 Bacteria 39851
191 Ga0070699_100243307 3300005518 Bacteria 1607
192 Ga0070699_100312649 3300005518 Bacteria 1411
193 Ga0070679_100005583 3300005530 Bacteria 11655
194 Ga0070679_100060422 3300005530 Bacteria 3777
195 Ga0070679_100062432 3300005530 Bacteria 3714
196 Ga0070679_100115288 3300005530 Bacteria 2672
197 Ga0070679_100153230 3300005530 Bacteria 2281
198 Ga0070679_100196193 3300005530 Bacteria 1986
199 Ga0070679_100563428 3300005530 Bacteria 1083
200 Ga0070679_100674712 3300005530 Unclassified 976
201 Ga0070684_100040330 3300005535 Bacteria 4020
202 Ga0070684_100333499 3300005535 Bacteria 1394
203 Ga0070684_100363259 3300005535 Bacteria 1332
204 Ga0070697_100000158 3300005536 Bacteria 55228
205 Ga0070697_100170418 3300005536 Unclassified 1842
206 Ga0068853_100037836 3300005539 Unclassified 4107
207 Ga0068853_100426744 3300005539 Unclassified 1244
208 Ga0068853_100478685 3300005539 Unclassified 1173
209 Ga0068853_101139439 3300005539 Unclassified 752
210 Ga0070672_100119703 3300005543 Unclassified 2154
211 Ga0070672_100516993 3300005543 Unclassified 1034
212 Ga0070686_100046794 3300005544 Unclassified 2732
213 Ga0070686_100062150 3300005544 Bacteria 2415
214 Ga0070695_100304858 3300005545 Bacteria 1179
215 Ga0070695_101296992 3300005545 Unclassified 601
216 Ga0070695_101464005 3300005545 Unclassified 568
217 Ga0070696_100064452 3300005546 Bacteria 2567
218 Ga0070693_100022453 3300005547 Bacteria 3356
219 Ga0070693_100028327 3300005547 Bacteria 3044
220 Ga0070693_100325725 3300005547 Unclassified 1044
221 Ga0070693_100669660 3300005547 Unclassified 757
222 Ga0070693_100978931 3300005547 Bacteria 639
223 Ga0070665_100235175 3300005548 Bacteria 1833
224 Ga0070665_100408666 3300005548 Unclassified 1366
225 Ga0070665_100491383 3300005548 Unclassified 1238
226 Ga0070704_102180424 3300005549 Unclassified 515
227 Ga0070704_102216403 3300005549 Bacteria 511
228 Ga0068855_100002637 3300005563 Bacteria 22119
229 Ga0068855_100005367 3300005563 Bacteria 15634
230 Ga0068855_100015827 3300005563 Bacteria 9073
231 Ga0068855_100129933 3300005563 Bacteria 2877
232 Ga0068855_100212104 3300005563 Bacteria 2175
233 Ga0068855_100361189 3300005563 Bacteria 1598
234 Ga0068855_100506310 3300005563 Unclassified 1311
235 Ga0068855_100667396 3300005563 Bacteria 1115
236 Ga0068855_100932764 3300005563 Bacteria 915
237 Ga0068855_101010547 3300005563 Bacteria 873
238 Ga0070664_100000368 3300005564 Bacteria 33302
239 Ga0070664_100013863 3300005564 Bacteria 6571
240 Ga0070664_100047104 3300005564 Bacteria 3642
241 Ga0070664_100093232 3300005564 Unclassified 2609
242 Ga0070664_101385912 3300005564 Unclassified 665
243 Ga0068857_100002526 3300005577 Bacteria 14975
244 Ga0068857_100003416 3300005577 Bacteria 13240
245 Ga0068857_100019188 3300005577 Bacteria 6002
246 Ga0068857_100046744 3300005577 Bacteria 3841
247 Ga0068857_100208270 3300005577 Bacteria 1784
248 Ga0068857_100483235 3300005577 Bacteria 1161
249 Ga0068854_100008180 3300005578 Bacteria 6709
250 Ga0068854_100028356 3300005578 Bacteria 3868
251 Ga0068854_100156966 3300005578 Bacteria 1759
252 Ga0068854_100377284 3300005578 Bacteria 1167
253 Ga0068854_100563792 3300005578 Unclassified 968
254 Ga0068854_100755841 3300005578 Bacteria 844
255 Ga0068854_101246911 3300005578 Unclassified 668
256 Ga0068856_100001843 3300005614 Bacteria 22170
257 Ga0068856_100003176 3300005614 Bacteria 16724
258 Ga0068856_100006401 3300005614 Bacteria 11552
259 Ga0068856_100010274 3300005614 Bacteria 9098
260 Ga0068856_100117286 3300005614 Bacteria 2662
261 Ga0068856_100130865 3300005614 Bacteria 2514
262 Ga0068856_100163906 3300005614 Unclassified 2234
263 Ga0068856_100201185 3300005614 Bacteria 2006
264 Ga0068856_100390989 3300005614 Bacteria 1410
265 Ga0068856_100409019 3300005614 Bacteria 1376
266 Ga0068856_101103241 3300005614 Unclassified 811
267 Ga0068856_101920204 3300005614 Unclassified 603
268 Ga0070702_100018406 3300005615 Bacteria 3624
269 Ga0070702_100276386 3300005615 Unclassified 1151
270 Ga0068852_100013961 3300005616 Bacteria 6162
271 Ga0068852_100091062 3300005616 Bacteria 2728
272 Ga0068852_100095008 3300005616 Unclassified 2676
273 Ga0068852_100101898 3300005616 Unclassified 2593
274 Ga0068852_100130290 3300005616 Bacteria 2315
275 Ga0068852_100483508 3300005616 Bacteria 1231
276 Ga0068859_100000701 3300005617 Bacteria 33613
277 Ga0068859_100041442 3300005617 Unclassified 4624
278 Ga0068859_100460849 3300005617 Unclassified 1367
279 Ga0068864_100000898 3300005618 Bacteria 25059
280 Ga0068864_100004265 3300005618 Bacteria 11763
281 Ga0068864_100033118 3300005618 Bacteria 4392
282 Ga0068864_100444896 3300005618 Bacteria 1238
283 Ga0068864_101172263 3300005618 Bacteria 766
284 Ga0068866_10003082 3300005718 Bacteria 6871
285 Ga0068866_10004230 3300005718 Bacteria 5896
286 Ga0068866_10025202 3300005718 Bacteria 2793
287 Ga0068866_10173257 3300005718 Bacteria 1268
288 Ga0068866_10336810 3300005718 Bacteria 954
289 Ga0068861_100015560 3300005719 Bacteria 5363
290 Ga0068861_100271795 3300005719 Bacteria 1456
291 Ga0068861_102459930 3300005719 Bacteria 524
292 Ga0068851_10003628 3300005834 Bacteria 6885
293 Ga0068851_10005203 3300005834 Bacteria 5902
294 Ga0068851_10296451 3300005834 Unclassified 929
295 Ga0068851_10420709 3300005834 Bacteria 789
296 Ga0068870_10007715 3300005840 Bacteria 4809
297 Ga0068870_10053961 3300005840 Unclassified 2136
298 Ga0068863_100015433 3300005841 Bacteria 7343
299 Ga0068863_100027051 3300005841 Bacteria 5471
300 Ga0068863_101089966 3300005841 Unclassified 803
301 Ga0068863_101132770 3300005841 Unclassified 787
302 Ga0068863_101602181 3300005841 Bacteria 660
303 Ga0068858_100004311 3300005842 Bacteria 13975
304 Ga0068858_100007568 3300005842 Bacteria 10492
305 Ga0068858_100027352 3300005842 Bacteria 5299
306 Ga0068858_100040178 3300005842 Unclassified 4337
307 Ga0068858_100089158 3300005842 Unclassified 2870
308 Ga0068858_100347177 3300005842 Bacteria 1421
309 Ga0068858_100950185 3300005842 Bacteria 841
310 Ga0068858_101378231 3300005842 Unclassified 694
311 Ga0068860_100009860 3300005843 Bacteria 9474
312 Ga0068860_100017458 3300005843 Bacteria 6991
313 Ga0068860_100035297 3300005843 Bacteria 4797
314 Ga0068860_100145127 3300005843 Bacteria 2283
315 Ga0068860_100332877 3300005843 Bacteria 1492
316 Ga0068860_100350467 3300005843 Bacteria 1453
317 Ga0068862_100115022 3300005844 Bacteria 2365
318 Ga0068862_100126513 3300005844 Unclassified 2256
319 Ga0068862_100166702 3300005844 Bacteria 1969
320 Ga0081540_1029989 3300005983 Bacteria 3019
321 Ga0070717_10001624 3300006028 Bacteria 15590
322 Ga0070717_10021380 3300006028 Bacteria 5098
323 Ga0070717_10021949 3300006028 Bacteria 5037
324 Ga0070717_10046559 3300006028 Unclassified 3549
325 Ga0070717_10062672 3300006028 Bacteria 3084
326 Ga0070717_10068572 3300006028 Bacteria 2952
327 Ga0070717_10083898 3300006028 Bacteria 2680
328 Ga0070717_10124061 3300006028 Bacteria 2215
329 Ga0070717_10140175 3300006028 Bacteria 2085
330 Ga0070717_10361126 3300006028 Bacteria 1300
331 Ga0070717_10683162 3300006028 Bacteria 932
332 Ga0070717_10728881 3300006028 Bacteria 901
333 Ga0070717_10786156 3300006028 Bacteria 866
334 Ga0070715_10002746 3300006163 Bacteria 5462
335 Ga0070715_10145704 3300006163 Bacteria 1155
336 Ga0070715_10351178 3300006163 Unclassified 805
337 Ga0070715_10497835 3300006163 Bacteria 697
338 Ga0070716_100006183 3300006173 Bacteria 5846
339 Ga0070716_100010270 3300006173 Bacteria 4691
340 Ga0070716_100017856 3300006173 Bacteria 3687
341 Ga0070716_100035542 3300006173 Bacteria 2740
342 Ga0070716_100040078 3300006173 Unclassified 2604
343 Ga0070716_100097023 3300006173 Unclassified 1798
344 Ga0070716_100135725 3300006173 Bacteria 1562
345 Ga0070716_100194494 3300006173 Unclassified 1343
346 Ga0070716_100574404 3300006173 Bacteria 844
347 Ga0070716_100643141 3300006173 Bacteria 803
348 Ga0070716_100662576 3300006173 Unclassified 793
349 Ga0070716_100727090 3300006173 Unclassified 761
350 Ga0070712_100000262 3300006175 Bacteria 29465
351 Ga0070712_100000618 3300006175 Bacteria 20900
352 Ga0070712_100014067 3300006175 Bacteria 5131
353 Ga0070712_100021621 3300006175 Unclassified 4227
354 Ga0070712_100198500 3300006175 Bacteria 1574
355 Ga0070712_100489788 3300006175 Bacteria 1029
356 Ga0070712_100516188 3300006175 Bacteria 1003
357 Ga0070712_100628293 3300006175 Unclassified 911
358 Ga0070712_101611585 3300006175 Unclassified 568
359 Ga0097621_100000395 3300006237 Bacteria 30394
360 Ga0097621_100002712 3300006237 Bacteria 12122
361 Ga0097621_100003022 3300006237 Bacteria 11552
362 Ga0097621_100079134 3300006237 Bacteria 2732
363 Ga0097621_100079567 3300006237 Bacteria 2725
364 Ga0097621_100429914 3300006237 Bacteria 1186
365 Ga0097621_100533616 3300006237 Bacteria 1066
366 Ga0068871_100002563 3300006358 Bacteria 12410
367 Ga0068871_100003240 3300006358 Bacteria 11162
368 Ga0068871_100004336 3300006358 Bacteria 9854
369 Ga0068871_100013189 3300006358 Bacteria 6129
370 Ga0068871_100160110 3300006358 Bacteria 1925
371 Ga0068871_100602234 3300006358 Bacteria 999
372 Ga0068871_100855222 3300006358 Bacteria 841
373 Ga0068871_100913868 3300006358 Unclassified 814
374 Ga0068871_102348984 3300006358 Bacteria 508
375 Ga0075434_100040746 3300006871 Bacteria 4600
376 Ga0068865_100056677 3300006881 Unclassified 2731
377 Ga0068865_100153636 3300006881 Bacteria 1748
378 Ga0068865_100223121 3300006881 Unclassified 1474
379 Ga0075436_100043910 3300006914 Bacteria 3081
380 Ga0075436_100255810 3300006914 Bacteria 1248
381 Ga0075436_100504967 3300006914 Bacteria 885
382 Ga0097620_100000701 3300006931 Bacteria 33613
383 Ga0097620_100041447 3300006931 Unclassified 4624
384 Ga0097620_100460909 3300006931 Unclassified 1367
385 Ga0075435_100002238 3300007076 Bacteria 12768
386 Ga0075435_100020692 3300007076 Bacteria 5049
387 Ga0099794_10299963 3300007265 Unclassified 832
388 Ga0099795_10071509 3300007788 Bacteria 1310
389 Ga0099795_10537264 3300007788 Unclassified 549
390 Ga0105250_10030931 3300009092 Bacteria 2151
391 Ga0105250_10143281 3300009092 Bacteria 991
392 Ga0105240_10004122 3300009093 Bacteria 22309
393 Ga0105240_10028901 3300009093 Bacteria 7232
394 Ga0105240_10043903 3300009093 Bacteria 5685
395 Ga0105240_10053354 3300009093 Bacteria 5074
396 Ga0105240_10063666 3300009093 Bacteria 4586
397 Ga0105240_10115193 3300009093 Bacteria 3246
398 Ga0105240_10213366 3300009093 Bacteria 2254
399 Ga0105240_10317271 3300009093 Bacteria 1777
400 Ga0105240_10835130 3300009093 Unclassified 996
401 Ga0105240_12136897 3300009093 Unclassified 581
402 Ga0105240_12473754 3300009093 Unclassified 537
403 Ga0105245_10003672 3300009098 Bacteria 13701
404 Ga0105245_10004606 3300009098 Bacteria 12176
405 Ga0105245_10087165 3300009098 Bacteria 2865
406 Ga0105245_10125943 3300009098 Bacteria 2398
407 Ga0105245_10588375 3300009098 Bacteria 1138
408 Ga0105245_11463057 3300009098 Unclassified 734
409 Ga0105247_10039588 3300009101 Bacteria 2880
410 Ga0105247_10078286 3300009101 Bacteria 2079
411 Ga0105247_10534222 3300009101 Unclassified 860
412 Ga0105247_10566286 3300009101 Unclassified 837
413 Ga0105247_11087198 3300009101 Bacteria 630
414 Ga0105243_10443582 3300009148 Bacteria 1216
415 Ga0105241_10027499 3300009174 Bacteria 4236
416 Ga0105241_10030638 3300009174 Unclassified 4022
417 Ga0105241_10031395 3300009174 Bacteria 3978
418 Ga0105241_10034345 3300009174 Bacteria 3809
419 Ga0105241_10068487 3300009174 Unclassified 2750
420 Ga0105241_10120553 3300009174 Bacteria 2111
421 Ga0105241_10273178 3300009174 Bacteria 1441
422 Ga0105241_10576705 3300009174 Unclassified 1013
423 Ga0105241_10602600 3300009174 Bacteria 992
424 Ga0105241_11411019 3300009174 Unclassified 667
425 Ga0105242_10057049 3300009176 Bacteria 3197
426 Ga0105242_10113431 3300009176 Bacteria 2314
427 Ga0105242_10114162 3300009176 Bacteria 2307
428 Ga0105242_10134757 3300009176 Bacteria 2136
429 Ga0105242_10267583 3300009176 Unclassified 1547
430 Ga0105242_10692683 3300009176 Unclassified 996
431 Ga0105248_10004109 3300009177 Bacteria 16097
432 Ga0105248_10116785 3300009177 Bacteria 3009
433 Ga0105248_10119865 3300009177 Bacteria 2968
434 Ga0105248_10168973 3300009177 Bacteria 2465
435 Ga0105248_10286340 3300009177 Bacteria 1855
436 Ga0105248_10313783 3300009177 Bacteria 1766
437 Ga0105248_10437215 3300009177 Bacteria 1474
438 Ga0105237_10039282 3300009545 Unclassified 4778
439 Ga0105237_10043379 3300009545 Unclassified 4531
440 Ga0105237_10106206 3300009545 Bacteria 2800
441 Ga0105237_10119405 3300009545 Bacteria 2630
442 Ga0105237_10154158 3300009545 Bacteria 2294
443 Ga0105237_10381271 3300009545 Unclassified 1415
444 Ga0105237_10582395 3300009545 Bacteria 1126
445 Ga0105237_10769833 3300009545 Unclassified 969
446 Ga0105238_10000860 3300009551 Bacteria 31345
447 Ga0105238_10017227 3300009551 Bacteria 7341
448 Ga0105238_10033615 3300009551 Bacteria 5219
449 Ga0105238_10246160 3300009551 Bacteria 1766
450 Ga0105238_10724070 3300009551 Bacteria 1008
451 Ga0105238_10983331 3300009551 Bacteria 864
452 Ga0105238_11214246 3300009551 Bacteria 779
453 Ga0105238_11482996 3300009551 Bacteria 707
454 Ga0105238_11552187 3300009551 Unclassified 691
455 Ga0105238_11624012 3300009551 Unclassified 677
456 Ga0105238_12436512 3300009551 Unclassified 559
457 Ga0105249_10047876 3300009553 Bacteria 3897
458 Ga0105249_10976651 3300009553 Unclassified 915
459 Ga0105249_11924854 3300009553 Unclassified 664
460 Ga0099796_10228722 3300010159 Unclassified 765
461 Ga0105239_10016353 3300010375 Bacteria 8204
462 Ga0105239_10018909 3300010375 Bacteria 7612
463 Ga0105239_10031708 3300010375 Bacteria 5808
464 Ga0105239_10069561 3300010375 Bacteria 3867
465 Ga0105239_10303205 3300010375 Bacteria 1799
466 Ga0105239_10446041 3300010375 Bacteria 1468
467 Ga0105239_11100898 3300010375 Bacteria 914
468 Ga0105239_12149753 3300010375 Unclassified 649
469 Ga0105246_10020423 3300011119 Bacteria 4247
470 Ga0105246_10100687 3300011119 Bacteria 2103
471 Ga0105246_10308167 3300011119 Bacteria 1281
472 Ga0105246_10446110 3300011119 Bacteria 1086
473 Ga0157373_10048030 3300013100 Bacteria 3043
474 Ga0157373_10075386 3300013100 Bacteria 2380
475 Ga0157373_10090064 3300013100 Bacteria 2160
476 Ga0157373_10118108 3300013100 Bacteria 1864
477 Ga0157373_10246714 3300013100 Unclassified 1263
478 Ga0157373_10926960 3300013100 Bacteria 647
479 Ga0157373_10983103 3300013100 Unclassified 629
480 Ga0157373_11177364 3300013100 Bacteria 577
481 Ga0157371_10024160 3300013102 Bacteria 4440
482 Ga0157371_10097970 3300013102 Bacteria 2079
483 Ga0157371_10173764 3300013102 Bacteria 1540
484 Ga0157370_10024789 3300013104 Bacteria 5939
485 Ga0157370_10359451 3300013104 Bacteria 1342
486 Ga0157370_10471765 3300013104 Bacteria 1153
487 Ga0157370_12045484 3300013104 Unclassified 513
488 Ga0157369_10000323 3300013105 Bacteria 64226
489 Ga0157369_10037380 3300013105 Bacteria 5315
490 Ga0157369_10065338 3300013105 Unclassified 3915
491 Ga0157369_10086306 3300013105 Bacteria 3351
492 Ga0157369_10143297 3300013105 Unclassified 2527
493 Ga0157369_10209826 3300013105 Bacteria 2042
494 Ga0157369_10213639 3300013105 Bacteria 2021
495 Ga0157369_10217087 3300013105 Bacteria 2003
496 Ga0157369_10223974 3300013105 Unclassified 1968
497 Ga0157369_10508345 3300013105 Bacteria 1246
498 Ga0157369_10985600 3300013105 Bacteria 863
499 Ga0157369_11822404 3300013105 Unclassified 618
500 Ga0157374_10000131 3300013296 Bacteria 68526
501 Ga0157374_10000690 3300013296 Bacteria 29745
502 Ga0157374_10003128 3300013296 Bacteria 13904
503 Ga0157374_10003490 3300013296 Bacteria 13213
504 Ga0157374_10051976 3300013296 Bacteria 3814
505 Ga0157374_10166811 3300013296 Bacteria 2146
506 Ga0157374_10235785 3300013296 Bacteria 1798
507 Ga0157374_10494743 3300013296 Bacteria 1227
508 Ga0157374_10696778 3300013296 Bacteria 1029
509 Ga0157374_10913654 3300013296 Bacteria 896
510 Ga0157374_11784568 3300013296 Bacteria 640
511 Ga0157374_12743912 3300013296 Unclassified 520
512 Ga0157378_10000388 3300013297 Bacteria 43382
513 Ga0157378_10000924 3300013297 Bacteria 27038
514 Ga0157378_10001041 3300013297 Bacteria 25328
515 Ga0157378_10024596 3300013297 Bacteria 5302
516 Ga0157378_10052176 3300013297 Bacteria 3639
517 Ga0157378_10382487 3300013297 Unclassified 1382
518 Ga0157378_11048948 3300013297 Bacteria 851
519 Ga0163162_10002555 3300013306 Bacteria 17229
520 Ga0163162_10023203 3300013306 Bacteria 6121
521 Ga0163162_10223794 3300013306 Bacteria 2011
522 Ga0163162_10226750 3300013306 Bacteria 1998
523 Ga0163162_10677033 3300013306 Unclassified 1154
524 Ga0163162_12103384 3300013306 Unclassified 647
525 Ga0157372_10004337 3300013307 Bacteria 15162
526 Ga0157372_10005053 3300013307 Bacteria 14015
527 Ga0157372_10005073 3300013307 Bacteria 13996
528 Ga0157372_10013765 3300013307 Bacteria 8644
529 Ga0157372_10027852 3300013307 Bacteria 6159
530 Ga0157372_10029627 3300013307 Bacteria 5979
531 Ga0157372_10034206 3300013307 Bacteria 5586
532 Ga0157372_10042655 3300013307 Bacteria 5019
533 Ga0157372_10168594 3300013307 Bacteria 2533
534 Ga0157372_10204928 3300013307 Bacteria 2285
535 Ga0157372_10225186 3300013307 Bacteria 2174
536 Ga0157372_12882713 3300013307 Unclassified 551
537 Ga0157372_13391512 3300013307 Unclassified 507
538 Ga0157375_10046025 3300013308 Bacteria 4250
539 Ga0157375_10486576 3300013308 Bacteria 1399
540 Ga0157375_12440078 3300013308 Unclassified 624
541 Ga0157375_13353177 3300013308 Unclassified 534
542 Ga0163163_10013744 3300014325 Bacteria 7419
543 Ga0163163_10086425 3300014325 Bacteria 3145
544 Ga0163163_10219353 3300014325 Bacteria 1950
545 Ga0163163_10223620 3300014325 Bacteria 1931
546 Ga0163163_10520580 3300014325 Bacteria 1252
547 Ga0163163_10626428 3300014325 Bacteria 1139
548 Ga0163163_11219014 3300014325 Unclassified 815
549 Ga0157380_10657044 3300014326 Bacteria 1047
550 Ga0182008_10022568 3300014497 Bacteria 3222
551 Ga0182008_10401928 3300014497 Bacteria 736
552 Ga0182008_10984684 3300014497 Bacteria 502
553 Ga0157377_10000553 3300014745 Bacteria 15748
554 Ga0157379_10020013 3300014968 Bacteria 5914
555 Ga0157379_10129018 3300014968 Bacteria 2275
556 Ga0157379_10212150 3300014968 Bacteria 1753
557 Ga0157379_10351645 3300014968 Bacteria 1349
558 Ga0157379_10983689 3300014968 Bacteria 804
559 Ga0157376_10024322 3300014969 Bacteria 4753
560 Ga0157376_10026459 3300014969 Unclassified 4586
561 Ga0157376_10098234 3300014969 Bacteria 2552
562 Ga0157376_12868544 3300014969 Unclassified 522
563 Ga0182007_10005999 3300015262 Bacteria 5266
564 Ga0182005_1089711 3300015265 Unclassified 854
565 Ga0182005_1131068 3300015265 Unclassified 719
566 Ga0182005_1176412 3300015265 Bacteria 633
567 Ga0163161_10052956 3300017792 Unclassified 2942
568 Ga0213873_10053011 3300021358 Bacteria 1079
569 Ga0213876_10543186 3300021384 Bacteria 618
570 Ga0213871_10030876 3300021441 Unclassified 1396
571 Ga0224569_100415 3300022732 Bacteria 3632
572 Ga0224569_104886 3300022732 Unclassified 1004
573 Ga0224571_100576 3300022734 Unclassified 2080
574 Ga0224571_105902 3300022734 Bacteria 809
575 Ga0224572_1010953 3300024225 Bacteria 1712
576 Ga0224572_1034169 3300024225 Unclassified 966
577 Ga0224572_1046485 3300024225 Unclassified 813
578 Ga0228598_1004427 3300024227 Bacteria 2975
579 Ga0228598_1037914 3300024227 Bacteria 950
580 Ga0207697_10011415 3300025315 Bacteria 3757
581 Ga0207656_10018748 3300025321 Unclassified 2728
582 Ga0207656_10098824 3300025321 Unclassified 1335
583 Ga0207656_10307005 3300025321 Bacteria 786
584 Ga0207696_1049382 3300025711 Bacteria 1207
585 Ga0207682_10152652 3300025893 Bacteria 1042
586 Ga0207682_10498100 3300025893 Unclassified 577
587 Ga0207692_10005687 3300025898 Bacteria 5008
588 Ga0207692_10040412 3300025898 Bacteria 2301
589 Ga0207692_10178878 3300025898 Unclassified 1234
590 Ga0207692_10315219 3300025898 Unclassified 956
591 Ga0207692_10504790 3300025898 Bacteria 768
592 Ga0207642_10034045 3300025899 Bacteria 2162
593 Ga0207642_10048007 3300025899 Bacteria 1912
594 Ga0207642_10059580 3300025899 Unclassified 1766
595 Ga0207642_10074477 3300025899 Bacteria 1627
596 Ga0207642_10134282 3300025899 Bacteria 1296
597 Ga0207710_10006323 3300025900 Bacteria 5064
598 Ga0207710_10059872 3300025900 Unclassified 1725
599 Ga0207688_10012092 3300025901 Bacteria 4695
600 Ga0207680_10012624 3300025903 Bacteria 4309
601 Ga0207680_10026106 3300025903 Bacteria 3233
602 Ga0207680_10852426 3300025903 Unclassified 653
603 Ga0207647_10006337 3300025904 Bacteria 8607
604 Ga0207647_10008116 3300025904 Bacteria 7543
605 Ga0207647_10400539 3300025904 Unclassified 773
606 Ga0207647_10480216 3300025904 Bacteria 694
607 Ga0207685_10097593 3300025905 Archaea 1250
608 Ga0207699_10000209 3300025906 Bacteria 34945
609 Ga0207699_10029486 3300025906 Bacteria 3060
610 Ga0207699_10144010 3300025906 Bacteria 1569
611 Ga0207699_10155059 3300025906 Bacteria 1519
612 Ga0207699_10248059 3300025906 Bacteria 1226
613 Ga0207699_10360745 3300025906 Unclassified 1027
614 Ga0207699_10426331 3300025906 Bacteria 948
615 Ga0207699_10435431 3300025906 Unclassified 938
616 Ga0207699_10641451 3300025906 Unclassified 775
617 Ga0207699_10801201 3300025906 Bacteria 693
618 Ga0207699_11040779 3300025906 Unclassified 605
619 Ga0207699_11458295 3300025906 Unclassified 506
620 Ga0207645_10014919 3300025907 Bacteria 5182
621 Ga0207645_10647076 3300025907 Bacteria 718
622 Ga0207645_11189564 3300025907 Unclassified 512
623 Ga0207643_10000328 3300025908 Bacteria 32545
624 Ga0207643_10037980 3300025908 Unclassified 2704
625 Ga0207705_10081568 3300025909 Bacteria 2357
626 Ga0207684_10001048 3300025910 Bacteria 30878
627 Ga0207684_10016175 3300025910 Bacteria 6410
628 Ga0207684_10140217 3300025910 Bacteria 2078
629 Ga0207654_10014585 3300025911 Unclassified 4061
630 Ga0207654_10016876 3300025911 Bacteria 3810
631 Ga0207654_10360289 3300025911 Bacteria 1003
632 Ga0207654_10439518 3300025911 Unclassified 913
633 Ga0207707_10001653 3300025912 Bacteria 20580
634 Ga0207707_10012547 3300025912 Bacteria 7366
635 Ga0207707_10063871 3300025912 Bacteria 3204
636 Ga0207707_10484957 3300025912 Bacteria 1056
637 Ga0207707_10485236 3300025912 Unclassified 1055
638 Ga0207707_10882496 3300025912 Bacteria 740
639 Ga0207707_11137113 3300025912 Unclassified 635
640 Ga0207695_10041443 3300025913 Bacteria 4928
641 Ga0207695_10055923 3300025913 Bacteria 4109
642 Ga0207695_10190930 3300025913 Bacteria 1966
643 Ga0207695_10266973 3300025913 Bacteria 1608
644 Ga0207695_10330474 3300025913 Bacteria 1413
645 Ga0207695_10409782 3300025913 Unclassified 1240
646 Ga0207695_10475621 3300025913 Bacteria 1132
647 Ga0207695_11140604 3300025913 Unclassified 660
648 Ga0207671_10142949 3300025914 Bacteria 1845
649 Ga0207671_10266988 3300025914 Bacteria 1348
650 Ga0207671_10314424 3300025914 Bacteria 1238
651 Ga0207671_10373263 3300025914 Unclassified 1133
652 Ga0207671_10579127 3300025914 Bacteria 895
653 Ga0207693_10000026 3300025915 Bacteria 122717
654 Ga0207693_10000275 3300025915 Bacteria 47590
655 Ga0207693_10013544 3300025915 Bacteria 6572
656 Ga0207693_10041917 3300025915 Bacteria 3603
657 Ga0207693_10050041 3300025915 Bacteria 3281
658 Ga0207693_10475481 3300025915 Unclassified 976
659 Ga0207693_10487383 3300025915 Bacteria 963
660 Ga0207663_10000479 3300025916 Bacteria 17384
661 Ga0207663_10043172 3300025916 Bacteria 2759
662 Ga0207663_10115065 3300025916 Bacteria 1832
663 Ga0207663_10133191 3300025916 Bacteria 1720
664 Ga0207663_10165415 3300025916 Bacteria 1566
665 Ga0207663_10330785 3300025916 Bacteria 1148
666 Ga0207663_10661459 3300025916 Unclassified 825
667 Ga0207663_11117893 3300025916 Bacteria 634
668 Ga0207663_11189739 3300025916 Unclassified 613
669 Ga0207660_10052201 3300025917 Bacteria 2910
670 Ga0207660_10134124 3300025917 Bacteria 1888
671 Ga0207660_10172760 3300025917 Bacteria 1674
672 Ga0207662_10011391 3300025918 Bacteria 4931
673 Ga0207657_10002285 3300025919 Bacteria 20778
674 Ga0207657_10002326 3300025919 Bacteria 20596
675 Ga0207657_10002602 3300025919 Bacteria 19525
676 Ga0207649_10000612 3300025920 Bacteria 24135
677 Ga0207649_10106961 3300025920 Bacteria 1862
678 Ga0207649_10476179 3300025920 Unclassified 946
679 Ga0207652_10003536 3300025921 Bacteria 12892
680 Ga0207652_10031402 3300025921 Bacteria 4461
681 Ga0207652_10046052 3300025921 Bacteria 3720
682 Ga0207652_10327724 3300025921 Bacteria 1382
683 Ga0207652_10444464 3300025921 Bacteria 1169
684 Ga0207646_10001230 3300025922 Bacteria 32163
685 Ga0207646_10076603 3300025922 Bacteria 2989
686 Ga0207646_10142285 3300025922 Bacteria 2161
687 Ga0207646_10206029 3300025922 Bacteria 1776
688 Ga0207646_10207012 3300025922 Bacteria 1772
689 Ga0207646_10845555 3300025922 Bacteria 814
690 Ga0207681_10021015 3300025923 Bacteria 4143
691 Ga0207681_10255903 3300025923 Bacteria 1369
692 Ga0207694_10002710 3300025924 Bacteria 14344
693 Ga0207694_10038561 3300025924 Bacteria 3674
694 Ga0207694_10056775 3300025924 Bacteria 3041
695 Ga0207694_10145918 3300025924 Bacteria 1905
696 Ga0207694_10208383 3300025924 Bacteria 1592
697 Ga0207694_10287138 3300025924 Unclassified 1352
698 Ga0207650_10000152 3300025925 Bacteria 83134
699 Ga0207650_10002883 3300025925 Bacteria 11878
700 Ga0207650_10805378 3300025925 Bacteria 796
701 Ga0207650_10996740 3300025925 Unclassified 712
702 Ga0207659_11422123 3300025926 Bacteria 594
703 Ga0207687_10002291 3300025927 Bacteria 13037
704 Ga0207687_10018465 3300025927 Bacteria 4604
705 Ga0207687_10020665 3300025927 Bacteria 4369
706 Ga0207687_10412635 3300025927 Bacteria 1113
707 Ga0207687_11466307 3300025927 Bacteria 586
708 Ga0207700_10000306 3300025928 Bacteria 28993
709 Ga0207700_10000979 3300025928 Bacteria 16486
710 Ga0207700_10002156 3300025928 Bacteria 11277
711 Ga0207700_10036292 3300025928 Bacteria 3558
712 Ga0207700_10057403 3300025928 Unclassified 2935
713 Ga0207700_10265343 3300025928 Bacteria 1472
714 Ga0207700_10615410 3300025928 Bacteria 967
715 Ga0207700_10822379 3300025928 Unclassified 831
716 Ga0207700_10873893 3300025928 Unclassified 805
717 Ga0207700_10896078 3300025928 Bacteria 794
718 Ga0207700_11123708 3300025928 Bacteria 702
719 Ga0207700_11741819 3300025928 Unclassified 549
720 Ga0207664_10000087 3300025929 Bacteria 88607
721 Ga0207664_10002140 3300025929 Bacteria 13003
722 Ga0207664_10032225 3300025929 Bacteria 4015
723 Ga0207664_10042713 3300025929 Bacteria 3541
724 Ga0207664_10120591 3300025929 Bacteria 2194
725 Ga0207664_10138029 3300025929 Bacteria 2059
726 Ga0207664_10245128 3300025929 Bacteria 1562
727 Ga0207664_10345860 3300025929 Bacteria 1315
728 Ga0207664_10561603 3300025929 Unclassified 1024
729 Ga0207664_10586846 3300025929 Unclassified 1000
730 Ga0207664_10684951 3300025929 Unclassified 922
731 Ga0207664_11580792 3300025929 Unclassified 578
732 Ga0207644_10046547 3300025931 Bacteria 3091
733 Ga0207644_10301436 3300025931 Bacteria 1291
734 Ga0207644_10472450 3300025931 Unclassified 1032
735 Ga0207690_10062265 3300025932 Bacteria 2539
736 Ga0207690_10220679 3300025932 Bacteria 1450
737 Ga0207706_10000740 3300025933 Bacteria 34067
738 Ga0207706_10002545 3300025933 Bacteria 17768
739 Ga0207686_10061537 3300025934 Bacteria 2380
740 Ga0207686_10077765 3300025934 Bacteria 2155
741 Ga0207686_10107934 3300025934 Bacteria 1872
742 Ga0207686_10189208 3300025934 Bacteria 1466
743 Ga0207686_10234734 3300025934 Unclassified 1332
744 Ga0207686_10604012 3300025934 Unclassified 864
745 Ga0207709_10870831 3300025935 Unclassified 731
746 Ga0207670_10065300 3300025936 Bacteria 2497
747 Ga0207670_11432283 3300025936 Bacteria 587
748 Ga0207669_10389576 3300025937 Unclassified 1088
749 Ga0207669_10886659 3300025937 Unclassified 744
750 Ga0207704_10050127 3300025938 Bacteria 2517
751 Ga0207704_11241827 3300025938 Bacteria 636
752 Ga0207665_10004916 3300025939 Bacteria 8908
753 Ga0207665_10016139 3300025939 Bacteria 4905
754 Ga0207665_10075882 3300025939 Bacteria 2303
755 Ga0207665_10083911 3300025939 Bacteria 2198
756 Ga0207665_10162389 3300025939 Bacteria 1608
757 Ga0207665_10173358 3300025939 Unclassified 1559
758 Ga0207665_10204113 3300025939 Unclassified 1441
759 Ga0207665_10206920 3300025939 Unclassified 1432
760 Ga0207665_10209987 3300025939 Bacteria 1422
761 Ga0207665_10298961 3300025939 Bacteria 1203
762 Ga0207665_10529123 3300025939 Bacteria 914
763 Ga0207665_11043946 3300025939 Unclassified 651
764 Ga0207665_11626228 3300025939 Unclassified 512
765 Ga0207691_10000308 3300025940 Bacteria 48637
766 Ga0207711_10012353 3300025941 Bacteria 7097
767 Ga0207711_10030535 3300025941 Unclassified 4546
768 Ga0207711_10120261 3300025941 Bacteria 2344
769 Ga0207711_10132547 3300025941 Bacteria 2236
770 Ga0207711_10753334 3300025941 Unclassified 908
771 Ga0207689_10000618 3300025942 Bacteria 33979
772 Ga0207689_10083123 3300025942 Bacteria 2633
773 Ga0207689_10126520 3300025942 Bacteria 2102
774 Ga0207689_10169489 3300025942 Unclassified 1799
775 Ga0207661_10001294 3300025944 Bacteria 16735
776 Ga0207661_10079525 3300025944 Unclassified 2702
777 Ga0207661_10093522 3300025944 Unclassified 2509
778 Ga0207661_10165526 3300025944 Bacteria 1921
779 Ga0207661_10760068 3300025944 Bacteria 892
780 Ga0207661_11924867 3300025944 Unclassified 537
781 Ga0207679_10000298 3300025945 Bacteria 37205
782 Ga0207679_10078451 3300025945 Bacteria 2516
783 Ga0207679_10355093 3300025945 Bacteria 1279
784 Ga0207679_10475074 3300025945 Bacteria 1112
785 Ga0207667_10000802 3300025949 Bacteria 40809
786 Ga0207667_10008703 3300025949 Bacteria 12029
787 Ga0207667_10015779 3300025949 Bacteria 8566
788 Ga0207667_10095689 3300025949 Bacteria 3065
789 Ga0207667_10147641 3300025949 Bacteria 2420
790 Ga0207667_10242636 3300025949 Bacteria 1844
791 Ga0207667_10299668 3300025949 Bacteria 1642
792 Ga0207667_10884280 3300025949 Bacteria 886
793 Ga0207667_11262549 3300025949 Unclassified 716
794 Ga0207667_12174771 3300025949 Unclassified 512
795 Ga0207651_10028023 3300025960 Bacteria 3546
796 Ga0207651_10885775 3300025960 Bacteria 794
797 Ga0207651_11016547 3300025960 Bacteria 741
798 Ga0207712_10013356 3300025961 Bacteria 5263
799 Ga0207712_10527738 3300025961 Bacteria 1013
800 Ga0207712_10732646 3300025961 Unclassified 865
801 Ga0207712_11154393 3300025961 Unclassified 690
802 Ga0207712_11459658 3300025961 Unclassified 612
803 Ga0207668_10253118 3300025972 Bacteria 1431
804 Ga0207668_10875249 3300025972 Bacteria 798
805 Ga0207640_10025994 3300025981 Bacteria 3551
806 Ga0207640_10058926 3300025981 Bacteria 2532
807 Ga0207640_10169301 3300025981 Bacteria 1626
808 Ga0207640_10223881 3300025981 Bacteria 1442
809 Ga0207640_10393682 3300025981 Bacteria 1126
810 Ga0207640_11443187 3300025981 Unclassified 617
811 Ga0207658_10164606 3300025986 Bacteria 1820
812 Ga0207658_11072761 3300025986 Unclassified 735
813 Ga0207658_11951055 3300025986 Unclassified 535
814 Ga0207677_10002182 3300026023 Bacteria 10290
815 Ga0207677_10050324 3300026023 Unclassified 2818
816 Ga0207677_10055739 3300026023 Unclassified 2705
817 Ga0207677_11204727 3300026023 Bacteria 693
818 Ga0207677_12268125 3300026023 Unclassified 505
819 Ga0207703_10006614 3300026035 Bacteria 9248
820 Ga0207703_10290929 3300026035 Bacteria 1487
821 Ga0207703_10811364 3300026035 Bacteria 894
822 Ga0207703_11339989 3300026035 Unclassified 688
823 Ga0207703_11774022 3300026035 Bacteria 593
824 Ga0207639_10034908 3300026041 Unclassified 3720
825 Ga0207639_10463259 3300026041 Bacteria 1153
826 Ga0207639_10719020 3300026041 Unclassified 927
827 Ga0207678_10001414 3300026067 Bacteria 22033
828 Ga0207678_10006402 3300026067 Bacteria 10457
829 Ga0207678_10087345 3300026067 Bacteria 2665
830 Ga0207678_10536629 3300026067 Bacteria 1022
831 Ga0207708_10281715 3300026075 Bacteria 1347
832 Ga0207702_10001466 3300026078 Bacteria 23418
833 Ga0207702_10006585 3300026078 Bacteria 9985
834 Ga0207702_10007672 3300026078 Bacteria 9173
835 Ga0207702_10030165 3300026078 Bacteria 4518
836 Ga0207702_10220885 3300026078 Bacteria 1766
837 Ga0207702_10256086 3300026078 Bacteria 1646
838 Ga0207702_10786502 3300026078 Bacteria 940
839 Ga0207702_11961894 3300026078 Unclassified 576
840 Ga0207641_10000052 3300026088 Bacteria 173672
841 Ga0207641_10014828 3300026088 Bacteria 6389
842 Ga0207641_10035964 3300026088 Unclassified 4131
843 Ga0207641_10836545 3300026088 Bacteria 912
844 Ga0207641_11090066 3300026088 Unclassified 797
845 Ga0207641_11228068 3300026088 Unclassified 749
846 Ga0207648_10001643 3300026089 Bacteria 24510
847 Ga0207648_10003472 3300026089 Bacteria 16526
848 Ga0207648_10014202 3300026089 Bacteria 7366
849 Ga0207676_10000176 3300026095 Bacteria 56110
850 Ga0207676_10001129 3300026095 Bacteria 20170
851 Ga0207676_10004043 3300026095 Bacteria 10345
852 Ga0207676_10124788 3300026095 Bacteria 2178
853 Ga0207676_10915527 3300026095 Bacteria 861
854 Ga0207674_10000125 3300026116 Bacteria 89047
855 Ga0207674_10000561 3300026116 Bacteria 48618
856 Ga0207674_10005435 3300026116 Bacteria 15129
857 Ga0207674_10026155 3300026116 Bacteria 6208
858 Ga0207674_10122742 3300026116 Bacteria 2564
859 Ga0207674_10123814 3300026116 Bacteria 2551
860 Ga0207674_10413522 3300026116 Bacteria 1303
861 Ga0207675_100027751 3300026118 Bacteria 5273
862 Ga0207675_100163396 3300026118 Bacteria 2125
863 Ga0207675_101574796 3300026118 Bacteria 678
864 Ga0207683_10002524 3300026121 Bacteria 15984
865 Ga0207683_10498632 3300026121 Unclassified 1124
866 Ga0207683_10793578 3300026121 Bacteria 879
867 Ga0207683_10822407 3300026121 Bacteria 862
868 Ga0207683_11768994 3300026121 Unclassified 567
869 Ga0207698_10022855 3300026142 Unclassified 4358
870 Ga0207698_10084521 3300026142 Unclassified 2573
871 Ga0207698_10531712 3300026142 Bacteria 1149
872 Ga0207698_10703927 3300026142 Bacteria 1005
873 Ga0207698_10910326 3300026142 Unclassified 887
874 Ga0207698_11041404 3300026142 Bacteria 830
875 Ga0265356_1000766 3300028017 Bacteria 5407
876 Ga0265356_1011999 3300028017 Bacteria 954
877 Ga0268266_10092603 3300028379 Unclassified 2652
878 Ga0268266_12300064 3300028379 Unclassified 510
879 Ga0268265_10191932 3300028380 Bacteria 1765
880 Ga0268265_10979301 3300028380 Unclassified 834
881 Ga0268264_10006934 3300028381 Bacteria 9504
882 Ga0268264_10011379 3300028381 Bacteria 7350
883 Ga0268264_10106594 3300028381 Unclassified 2447
884 Ga0268264_10259415 3300028381 Unclassified 1618
885 Ga0268264_10595489 3300028381 Bacteria 1089
886 Ga0268264_11065374 3300028381 Bacteria 816
887 Ga0268264_12395624 3300028381 Bacteria 534
888 Ga0268264_12437654 3300028381 Unclassified 529
889 Ga0265338_10011173 3300028800 Bacteria 10408
890 Ga0265338_10061089 3300028800 Bacteria 3304
891 Ga0265338_10119970 3300028800 Unclassified 2099
892 Ga0265338_10177814 3300028800 Bacteria 1625
893 Ga0265338_10680910 3300028800 Unclassified 711
894 Ga0265338_10972356 3300028800 Bacteria 576
895 Ga0265338_11011802 3300028800 Bacteria 562
896 Ga0265324_10153429 3300029957 Bacteria 782
897 Ga0265762_1000401 3300030760 Bacteria 7442
898 Ga0265762_1001210 3300030760 Bacteria 4680
899 Ga0265762_1005514 3300030760 Bacteria 2270
900 Ga0265762_1037256 3300030760 Bacteria 941
901 Ga0265770_1056611 3300030878 Bacteria 721
902 Ga0265760_10023165 3300031090 Bacteria 1803
903 Ga0265760_10336576 3300031090 Unclassified 539
904 Ga0265325_10004543 3300031241 Bacteria 8747
905 Ga0265325_10200013 3300031241 Bacteria 922
906 Ga0265339_10023928 3300031249 Bacteria 3525
907 Ga0265339_10064549 3300031249 Bacteria 1964
908 Ga0265339_10252930 3300031249 Bacteria 852
909 Ga0265339_10411893 3300031249 Bacteria 631
910 Ga0265331_10114238 3300031250 Unclassified 1237
911 Ga0265316_10006220 3300031344 Bacteria 11445
912 Ga0265316_10016491 3300031344 Bacteria 6403
913 Ga0265316_10133418 3300031344 Bacteria 1869
914 Ga0265316_10178274 3300031344 Bacteria 1583
915 Ga0265316_10673412 3300031344 Unclassified 730
916 Ga0265314_10012372 3300031711 Bacteria 6966
917 Ga0265314_10022604 3300031711 Bacteria 4816
918 Ga0265342_10014809 3300031712 Bacteria 5162
919 Ga0316212_1026710 3300033547 Bacteria 810
920 Ga0373948_0100863 3300034817 Unclassified 680
921 Ga0373958_0035263 3300034819 Bacteria 1001
922 Ga0373938_0011890 3300034957 Bacteria 1626
923 Ga0373926_0028827 3300035083 Bacteria 1950
924 Ga0373926_0084906 3300035083 Bacteria 1174
925 Ga0373934_0016874 3300035086 Unclassified 2780
926 Ga0373934_0099393 3300035086 Bacteria 1176
927 Ga0373944_0062344 3300035089 Unclassified 1199
928 Ga0373944_0202982 3300035089 Bacteria 718
929 Ga0373951_0007459 3300035091 Bacteria 2484
930 Ga0373952_0067118 3300035092 Bacteria 890
931 Ga0373923_0002217 3300035111 Bacteria 5914
932 Ga0373923_0159354 3300035111 Bacteria 1029
933 Ga0373923_0555561 3300035111 Unclassified 563
934 Ga0373936_0010297 3300035113 Bacteria 3529
935 Ga0373936_0102688 3300035113 Bacteria 1207
936 Ga0373936_0292886 3300035113 Unclassified 733
937 Ga0373939_0165265 3300035114 Bacteria 815
938 Ga0373945_0003343 3300035116 Bacteria 5042
939 Ga0373945_0101339 3300035116 Bacteria 1127
940 Ga0373945_0237635 3300035116 Unclassified 766
941 Ga0373945_0553359 3300035116 Unclassified 516
942 Ga0373953_0105884 3300035117 Bacteria 1186
943 Ga0373954_0188422 3300035118 Unclassified 1012
944 Ga0373956_0056146 3300035119 Bacteria 1777
945 Ga0373960_0064682 3300035121 Bacteria 1117
946 Ga0373943_0001626 3300035170 Bacteria 10190
947 Ga0373943_0344546 3300035170 Bacteria 853
948 Ga0373943_0362979 3300035170 Unclassified 832
949 Ga0373946_0002814 3300035171 Bacteria 6150
950 Ga0373946_0148381 3300035171 Bacteria 1092
951 Ga0373955_0243010 3300035172 Bacteria 1078
952 Ga0373955_0252596 3300035172 Bacteria 1057
953 Ga0373942_0077761 3300035207 Unclassified 980
954 Ga0373962_0062279 3300035242 Bacteria 1098
955 Ga0373924_0040106 3300035410 Bacteria 1915
956 Ga0373931_0034821 3300035691 Bacteria 2615
957 Ga0373931_0100539 3300035691 Bacteria 1626
958 Ga0373931_0318615 3300035691 Bacteria 965
959 Ga0373931_0904073 3300035691 Unclassified 593
960 Ga0373935_0005817 3300035692 Bacteria 7302
961 Ga0373935_0046735 3300035692 Unclassified 2735
962 Ga0373935_0106296 3300035692 Bacteria 1857
963 Ga0373935_1144951 3300035692 Unclassified 579
964 Ga0373935_1422811 3300035692 Unclassified 518
965 Ga0373927_0000747 3300035695 Bacteria 24845
966 Ga0373927_0014065 3300035695 Bacteria 5305
967 Ga0373927_0084648 3300035695 Bacteria 2057
968 Ga0373927_0172697 3300035695 Bacteria 1417
969 Ga0373927_0294472 3300035695 Unclassified 1068
970 Ga0373927_1085632 3300035695 Bacteria 528
971 Ga0373933_0028842 3300035724 Bacteria 3203
972 Ga0373933_0178489 3300035724 Bacteria 1354
973 Ga0373933_0263838 3300035724 Bacteria 1111
974 Ga0373933_0967731 3300035724 Unclassified 561
975 Ga0373933_1166632 3300035724 Bacteria 508
976 Ga0373947_0011342 3300035725 Bacteria 5116
977 Ga0373947_0014094 3300035725 Bacteria 4583
978 Ga0373947_0547906 3300035725 Unclassified 787
979 Ga0373937_0198306 3300036401 Bacteria 1887
980 Ga0373937_0304131 3300036401 Bacteria 1507
981 Ga0373937_0513887 3300036401 Bacteria 1138
982 Ga0373937_0669470 3300036401 Unclassified 984
983 Ga0373937_1435735 3300036401 Bacteria 638
984 Ga0373937_1855054 3300036401 Unclassified 549
985 Ga0373937_1922789 3300036401 Bacteria 538
986 Ga0373925_0004658 3300037068 Bacteria 10348
987 Ga0373925_0026245 3300037068 Bacteria 4262
988 Ga0373925_0176237 3300037068 Bacteria 1690
989 Ga0373925_0264800 3300037068 Bacteria 1381
990 Ga0373925_0466103 3300037068 Unclassified 1035
991 Ga0373925_0923190 3300037068 Unclassified 719
992 Ga0373925_1069826 3300037068 Unclassified 664
993 Ga0395900_1301114 3300037418 Unclassified 641
994 Ga0395898_0725081 3300037466 Bacteria 936
995 Ga0436365_0628206 3300039437 Bacteria 1069
996 Ga0436360_0246638 3300039438 Unclassified 2550
997 Ga0436363_0958565 3300039450 Bacteria 1186
998 Ga0436362_0405904 3300039453 Unclassified 600
999 Ga0436362_1033386 3300039453 Bacteria 2657
1000 Ga0451839_0076152 3300041496 Unclassified 541
1001 Ga0451577_1336472 3300042876 Bacteria 637
1002 Ga0466966_0948723 3300044684 Unclassified 519
1003 Ga0466961_0257802 3300044693 Bacteria 1070
1004 Ga0466963_0031366 3300044694 Unclassified 3435
1005 Ga0466963_0165209 3300044694 Bacteria 1542
1006 Ga0466963_0731204 3300044694 Bacteria 698
1007 Ga0466964_0181822 3300044706 Bacteria 998
1008 Ga0466964_0634191 3300044706 Unclassified 589
1009 Ga0466964_0811975 3300044706 Unclassified 529
1010 Ga0453684_1002999 3300044712 Unclassified 888
1011 Ga0466968_0064189 3300044735 Bacteria 1588
1012 Ga0466959_0296843 3300045049 Unclassified 1107
1013 Ga0451576_0080329 3300045051 Bacteria 3393
1014 Ga0451576_0086697 3300045051 Bacteria 3256
1015 Ga0451576_0671549 3300045051 Bacteria 1089
1016 Ga0451576_0717923 3300045051 Bacteria 1050
1017 Ga0451576_1371234 3300045051 Unclassified 736
1018 Ga0466958_0395616 3300045836 Unclassified 892
1019 Ga0466958_1140714 3300045836 Bacteria 509
1020 Ga0466967_0053937 3300045976 Bacteria 3536
1021 Ga0466967_0100894 3300045976 Bacteria 2637
1022 Ga0466967_0735964 3300045976 Bacteria 978
1023 Ga0495592_0744746 3300046454 Bacteria 586
1024 Ga0495603_0373179 3300046455 Bacteria 818
1025 Ga0495603_0487013 3300046455 Unclassified 706
1026 Ga0495629_0545444 3300046459 Unclassified 779
1027 Ga0495651_0440268 3300046462 Unclassified 844
1028 Ga0495651_0939590 3300046462 Bacteria 527
1029 Ga0495653_0679607 3300046463 Bacteria 627
1030 Ga0495580_0000603 3300046472 Bacteria 30353
1031 Ga0495580_0001289 3300046472 Bacteria 22103
1032 Ga0495580_0003921 3300046472 Bacteria 12557
1033 Ga0495580_0009412 3300046472 Bacteria 7686
1034 Ga0495580_0034777 3300046472 Bacteria 3625
1035 Ga0495580_0049839 3300046472 Bacteria 2962
1036 Ga0495580_0175814 3300046472 Unclassified 1479
1037 Ga0495580_0233020 3300046472 Bacteria 1264
1038 Ga0495580_0444425 3300046472 Unclassified 870
1039 Ga0495580_0575513 3300046472 Unclassified 746
1040 Ga0495582_0001718 3300046473 Bacteria 12359
1041 Ga0495582_0002195 3300046473 Bacteria 10922
1042 Ga0495582_0201690 3300046473 Unclassified 1136
1043 Ga0495639_0014516 3300046475 Bacteria 3411
1044 Ga0495662_0066426 3300046476 Bacteria 1745
1045 Ga0495664_0016333 3300046477 Bacteria 4226
1046 Ga0495664_0065861 3300046477 Unclassified 2160
1047 Ga0495594_0395988 3300046499 Unclassified 786
1048 Ga0495608_0315133 3300046511 Bacteria 967
1049 Ga0495618_0645444 3300046514 Unclassified 626
1050 Ga0495630_0100516 3300046517 Bacteria 2188
1051 Ga0495630_0209526 3300046517 Bacteria 1488
1052 Ga0495630_0295296 3300046517 Unclassified 1238
1053 Ga0495630_0346110 3300046517 Bacteria 1138
1054 Ga0495666_0109979 3300046526 Bacteria 1295
1055 Ga0495652_0575471 3300046529 Bacteria 771
1056 Ga0495665_0029765 3300046531 Bacteria 2924
1057 Ga0495665_0190339 3300046531 Unclassified 1065
1058 Ga0495665_0379291 3300046531 Unclassified 718
1059 Ga0495586_0122509 3300046535 Bacteria 1453
1060 Ga0495587_0032512 3300046536 Bacteria 3154
1061 Ga0495587_0580062 3300046536 Unclassified 618
1062 Ga0495667_0175614 3300046559 Unclassified 1376
1063 Ga0495635_0123300 3300046663 Bacteria 1767
1064 Ga0495657_0161318 3300046675 Unclassified 1387
1065 Ga0495623_0303880 3300046679 Bacteria 881
1066 Ga0495623_0378222 3300046679 Bacteria 766
1067 Ga0495623_0687405 3300046679 Unclassified 525
1068 Ga0495623_0703661 3300046679 Bacteria 517
1069 Ga0495646_0378954 3300046680 Bacteria 738
1070 Ga0495658_0114741 3300046683 Bacteria 1623
1071 Ga0495669_0202159 3300046684 Bacteria 950
1072 Ga0495613_0185423 3300046689 Bacteria 1472
1073 Ga0495600_0212828 3300046809 Bacteria 1238
1074 Ga0495581_0016034 3300047315 Bacteria 4355
1075 Ga0495581_0067826 3300047315 Bacteria 2063
1076 Ga0495581_0104136 3300047315 Bacteria 1649
1077 Ga0495581_0113158 3300047315 Bacteria 1578
1078 Ga0495604_0039992 3300047317 Unclassified 3683
1079 Ga0495674_0094012 3300047319 Bacteria 2558
1080 Ga0495674_0186315 3300047319 Bacteria 1727
1081 Ga0495674_0280833 3300047319 Bacteria 1364
1082 Ga0495674_0589143 3300047319 Bacteria 882
1083 Ga0495674_0838568 3300047319 Unclassified 713
1084 Ga0495674_1401102 3300047319 Bacteria 521
1085 Ga0495676_0282386 3300047321 Bacteria 1124
1086 Ga0495675_0665863 3300047444 Unclassified 585
1087 Ga0495685_273547 3300047447 Unclassified 533
1088 Ga0495684_0507009 3300047471 Unclassified 829
1089 Ga0495602_0130451 3300048088 Bacteria 2006
1090 Ga0495602_0476993 3300048088 Bacteria 876
1091 Ga0495614_0189451 3300048089 Bacteria 928
1092 Ga0496100_0348790 3300048903 Bacteria 1117
1093 Ga0496100_0736734 3300048903 Unclassified 770
1094 Ga0496100_1012209 3300048903 Unclassified 654
1095 Ga0496101_0049553 3300048904 Bacteria 3022
1096 Ga0496101_0417595 3300048904 Bacteria 1057
1097 Ga0496101_0535783 3300048904 Bacteria 925
1098 Ga0496101_0753745 3300048904 Unclassified 768
1099 Ga0496101_1001404 3300048904 Bacteria 657
1100 Ga0496102_0309600 3300048905 Bacteria 1488
1101 Ga0496102_0554075 3300048905 Bacteria 1072
1102 Ga0496102_0615511 3300048905 Bacteria 1009
1103 Ga0496102_0900454 3300048905 Bacteria 806
1104 Ga0496102_1634175 3300048905 Unclassified 562
1105 Ga0496103_0201464 3300048906 Unclassified 1280
1106 Ga0496103_0300120 3300048906 Bacteria 1033
1107 Ga0496103_0318699 3300048906 Bacteria 1000
1108 Ga0496103_0862464 3300048906 Bacteria 569
1109 Ga0496104_0058767 3300048907 Bacteria 3640
1110 Ga0496104_0070054 3300048907 Unclassified 3334
1111 Ga0496104_0118656 3300048907 Bacteria 2540
1112 Ga0496104_0146462 3300048907 Unclassified 2268
1113 Ga0496104_0166384 3300048907 Bacteria 2115
1114 Ga0496104_0697285 3300048907 Unclassified 923
1115 Ga0496105_0025317 3300048908 Unclassified 4830
1116 Ga0496105_0185026 3300048908 Bacteria 1705
1117 Ga0496105_0406337 3300048908 Bacteria 1080
1118 Ga0496106_0044811 3300048909 Bacteria 3322
1119 Ga0496106_0233346 3300048909 Bacteria 1469
1120 Ga0496107_0075478 3300048910 Bacteria 2454
1121 Ga0496107_0344390 3300048910 Bacteria 1109
1122 Ga0496107_0570412 3300048910 Unclassified 837
1123 Ga0496108_0000242 3300048911 Bacteria 48793
1124 Ga0496108_0114263 3300048911 Bacteria 2311
1125 Ga0496108_0973288 3300048911 Unclassified 726
1126 Ga0496109_0000120 3300048912 Bacteria 81828
1127 Ga0496109_0051640 3300048912 Bacteria 3745
1128 Ga0496109_0092435 3300048912 Bacteria 2798
1129 Ga0496109_0112074 3300048912 Bacteria 2537
1130 Ga0496109_0449451 3300048912 Bacteria 1217
1131 Ga0496109_1250089 3300048912 Bacteria 679
1132 Ga0496109_1406471 3300048912 Unclassified 633
1133 Ga0496110_0003869 3300048913 Bacteria 11531
1134 Ga0496110_0018359 3300048913 Bacteria 5865
1135 Ga0496110_1208322 3300048913 Unclassified 665
1136 Ga0496111_0013049 3300048914 Bacteria 5641
1137 Ga0496111_0020419 3300048914 Bacteria 4612
1138 Ga0496112_0000198 3300048915 Bacteria 39413
1139 Ga0496112_0024111 3300048915 Bacteria 5823
1140 Ga0496112_0046570 3300048915 Bacteria 4254
1141 Ga0496112_0064520 3300048915 Bacteria 3614
1142 Ga0496112_0080018 3300048915 Unclassified 3232
1143 Ga0496112_0198584 3300048915 Bacteria 1966
1144 Ga0496112_0275747 3300048915 Bacteria 1629
1145 Ga0496112_0374280 3300048915 Unclassified 1365
1146 Ga0496112_0560108 3300048915 Bacteria 1076
1147 Ga0496112_1526184 3300048915 Unclassified 582
1148 Ga0496113_0000111 3300048916 Bacteria 35094
1149 Ga0496113_0229510 3300048916 Bacteria 1480
1150 Ga0496113_0967228 3300048916 Unclassified 671
1151 Ga0496113_1255283 3300048916 Unclassified 577
1152 Ga0496114_0141388 3300048917 Bacteria 2084
1153 Ga0496114_0236103 3300048917 Bacteria 1607
1154 Ga0496115_0003194 3300048918 Bacteria 11768
1155 Ga0496115_0051792 3300048918 Bacteria 3291
1156 Ga0496115_0161131 3300048918 Unclassified 1854
1157 Ga0496115_0242887 3300048918 Unclassified 1484
1158 Ga0496115_0524973 3300048918 Unclassified 949
1159 Ga0496115_0673134 3300048918 Bacteria 816
1160 nmdc:mga0n895_6611_c1 3300050512 Bacteria 9870
1161 nmdc:mga0rr50_15265_c1 3300050513 Bacteria 5066
1162 nmdc:mga0rr50_2703_c1 3300050513 Bacteria 10061
1163 nmdc:mga08x19_103937_c1 3300050514 Bacteria 1887
1164 nmdc:mga08x19_11637_c1 3300050514 Bacteria 5296
1165 Ga0495601_0723047 3300053077 Bacteria 634
1166 Ga0495612_0512072 3300053078 Bacteria 551
1167 Ga0495619_0256876 3300053085 Bacteria 1211
1168 Ga0495619_1190674 3300053085 Bacteria 505
1169 Ga0466962_0159842 3300061719 Bacteria 1095
1170 Ga0099796_10186542
1171 MRS1b_contig_6382803
1172 MRS1b_contig_9171898
1173 MBSR1b_contig_9749820
1174 LJNas_1001079
1175 LJNas_1001135
1176 JGI24741J21665_1044410
1177 JGI24752J21851_1013055
1178 JGI24034J26672_10123497
1179 JGI24751J29686_10005033
1180 rootH1_10193919
1181 rootH1_10326518
1182 Ga0058863_10016641
1183 Ga0065712_10008743
1184 Ga0065712_10058536
1185 Ga0065712_10082582
1186 Ga0065712_10246720
1187 Ga0065715_11044722
1188 Ga0065707_10461869
1189 Ga0070658_10144456
1190 Ga0070658_10175172
1191 Ga0070676_10002636
1192 Ga0070683_100024239
1193 Ga0070683_100051208
1194 Ga0070683_100083853
1195 Ga0070683_100121497
1196 Ga0070683_100262019
1197 Ga0070683_100366069
1198 Ga0070690_100121027
1199 Ga0070690_100733087
1200 Ga0070670_100002163
1201 Ga0070670_100189664
1202 Ga0070670_100614349
1203 Ga0070670_101462411
1204 Ga0070670_101562141
1205 Ga0070677_10059096
1206 Ga0070677_10728922
1207 Ga0070677_10824694
1208 Ga0068869_100043195
1209 Ga0068869_100078820
1210 Ga0068869_100151067
1211 Ga0068869_100224084
1212 Ga0068869_100489353
1213 Ga0068869_101772911
1214 Ga0070666_10010515
1215 Ga0070666_10163128
1216 Ga0070666_10260841
1217 Ga0070680_100012730
1218 Ga0070680_100017979
1219 Ga0070680_100069074
1220 Ga0070680_100144923
1221 Ga0070680_100227758
1222 Ga0070682_100020940
1223 Ga0070682_100084027
1224 Ga0070682_100101201
1225 Ga0070682_101365466
1226 Ga0068868_100004608
1227 Ga0068868_100005733
1228 Ga0068868_100019713
1229 Ga0068868_100046519
1230 Ga0068868_100101109
1231 Ga0068868_100144690
1232 Ga0068868_100612571
1233 Ga0068868_100693154
1234 Ga0070660_100003269
1235 Ga0070660_100065897
1236 Ga0070689_100001444
1237 Ga0070689_100157841
1238 Ga0070689_101292351
1239 Ga0070691_10417278
1240 Ga0070661_100005865
1241 Ga0070661_100041016
1242 Ga0070661_100058538
1243 Ga0070661_100088315
1244 Ga0070668_100007447
1245 Ga0070668_100045126
1246 Ga0070669_100103155
1247 Ga0070669_100358117
1248 Ga0070669_100540975
1249 Ga0070675_100272534
1250 Ga0070671_100227900
1251 Ga0070671_100266764
1252 Ga0070671_101355495
1253 Ga0070671_101450296
1254 Ga0070674_100049601
1255 Ga0070674_100443076
1256 Ga0070673_100046972
1257 Ga0070673_100053292
1258 Ga0070673_100385715
1259 Ga0070673_101742590
1260 Ga0070688_100010943
1261 Ga0070688_100191835
1262 Ga0070688_100216208
1263 Ga0070659_100220425
1264 Ga0070659_101470904
1265 Ga0070667_100090690
1266 Ga0070667_100468531
1267 Ga0070667_100695718
1268 Ga0070667_101213544
1269 Ga0070667_101699206
1270 Ga0070709_10000423
1271 Ga0070709_10020249
1272 Ga0070709_10135876
1273 Ga0070709_10140106
1274 Ga0070709_10279073
1275 Ga0070709_10287034
1276 Ga0070709_10836005
1277 Ga0070714_100000096
1278 Ga0070714_100002108
1279 Ga0070714_100017874
1280 Ga0070714_100117686
1281 Ga0070714_100132009
1282 Ga0070714_100209199
1283 Ga0070714_100295570
1284 Ga0070714_100391089
1285 Ga0070714_100467245
1286 Ga0070714_100767236
1287 Ga0070714_100955642
1288 Ga0070714_101105700
1289 Ga0070714_101617003
1290 Ga0070714_102165016
1291 Ga0070713_100000134
1292 Ga0070713_100000364
1293 Ga0070713_100063451
1294 Ga0070713_100095501
1295 Ga0070713_100550144
1296 Ga0070713_101018410
1297 Ga0070713_101969707
1298 Ga0070710_10004596
1299 Ga0070710_10005846
1300 Ga0070710_10065925
1301 Ga0070710_10102051
1302 Ga0070710_10212509
1303 Ga0070710_10551691
1304 Ga0070710_11470547
1305 Ga0070701_10137393
1306 Ga0070701_10210443
1307 Ga0070711_100000271
1308 Ga0070711_100005922
1309 Ga0070711_100064787
1310 Ga0070711_100142088
1311 Ga0070711_100393545
1312 Ga0070711_100480998
1313 Ga0070711_100647232
1314 Ga0070711_100710313
1315 Ga0070711_102015255
1316 Ga0070705_100106655
1317 Ga0070700_100335038
1318 Ga0070694_101897467
1319 Ga0070708_100000459
1320 Ga0070708_100037092
1321 Ga0070708_100093222
1322 Ga0070708_100120147
1323 Ga0070708_100443273
1324 Ga0070708_100521978
1325 Ga0070708_100765105
1326 Ga0070663_100054294
1327 Ga0070663_100147626
1328 Ga0070663_100768922
1329 Ga0070678_100054773
1330 Ga0070678_100835215
1331 Ga0070678_101101583
1332 Ga0070678_101574786
1333 Ga0070662_100008601
1334 Ga0070662_100015770
1335 Ga0070662_100221260
1336 Ga0070681_10002834
1337 Ga0070681_10005694
1338 Ga0070681_10050021
1339 Ga0070681_10151119
1340 Ga0070681_10572937
1341 Ga0070681_10971602
1342 Ga0070681_11300974
1343 Ga0068867_100003049
1344 Ga0068867_100040462
1345 Ga0068867_100197290
1346 Ga0070685_10004878
1347 Ga0070685_10307117
1348 Ga0070706_100002982
1349 Ga0070706_100096996
1350 Ga0070706_100136757
1351 Ga0070707_100003948
1352 Ga0070707_100163640
1353 Ga0070707_100172790
1354 Ga0070707_100597797
1355 Ga0070707_101237034
1356 Ga0070707_102159041
1357 Ga0070698_100002043
1358 Ga0070698_100071081
1359 Ga0070699_100000441
1360 Ga0070699_100243307
1361 Ga0070699_100312649
1362 Ga0070679_100005583
1363 Ga0070679_100060422
1364 Ga0070679_100062432
1365 Ga0070679_100115288
1366 Ga0070679_100153230
1367 Ga0070679_100196193
1368 Ga0070679_100563428
1369 Ga0070679_100674712
1370 Ga0070684_100040330
1371 Ga0070684_100333499
1372 Ga0070684_100363259
1373 Ga0070697_100000158
1374 Ga0070697_100170418
1375 Ga0068853_100037836
1376 Ga0068853_100426744
1377 Ga0068853_100478685
1378 Ga0068853_101139439
1379 Ga0070672_100119703
1380 Ga0070672_100516993
1381 Ga0070686_100046794
1382 Ga0070686_100062150
1383 Ga0070695_100304858
1384 Ga0070695_101296992
1385 Ga0070695_101464005
1386 Ga0070696_100064452
1387 Ga0070693_100022453
1388 Ga0070693_100028327
1389 Ga0070693_100325725
1390 Ga0070693_100669660
1391 Ga0070693_100978931
1392 Ga0070665_100235175
1393 Ga0070665_100408666
1394 Ga0070665_100491383
1395 Ga0070704_102180424
1396 Ga0070704_102216403
1397 Ga0068855_100002637
1398 Ga0068855_100005367
1399 Ga0068855_100015827
1400 Ga0068855_100129933
1401 Ga0068855_100212104
1402 Ga0068855_100361189
1403 Ga0068855_100506310
1404 Ga0068855_100667396
1405 Ga0068855_100932764
1406 Ga0068855_101010547
1407 Ga0070664_100000368
1408 Ga0070664_100013863
1409 Ga0070664_100047104
1410 Ga0070664_100093232
1411 Ga0070664_101385912
1412 Ga0068857_100002526
1413 Ga0068857_100003416
1414 Ga0068857_100019188
1415 Ga0068857_100046744
1416 Ga0068857_100208270
1417 Ga0068857_100483235
1418 Ga0068854_100008180
1419 Ga0068854_100028356
1420 Ga0068854_100156966
1421 Ga0068854_100377284
1422 Ga0068854_100563792
1423 Ga0068854_100755841
1424 Ga0068854_101246911
1425 Ga0068856_100001843
1426 Ga0068856_100003176
1427 Ga0068856_100006401
1428 Ga0068856_100010274
1429 Ga0068856_100117286
1430 Ga0068856_100130865
1431 Ga0068856_100163906
1432 Ga0068856_100201185
1433 Ga0068856_100390989
1434 Ga0068856_100409019
1435 Ga0068856_101103241
1436 Ga0068856_101920204
1437 Ga0070702_100018406
1438 Ga0070702_100276386
1439 Ga0068852_100013961
1440 Ga0068852_100091062
1441 Ga0068852_100095008
1442 Ga0068852_100101898
1443 Ga0068852_100130290
1444 Ga0068852_100483508
1445 Ga0068859_100000701
1446 Ga0068859_100041442
1447 Ga0068859_100460849
1448 Ga0068864_100000898
1449 Ga0068864_100004265
1450 Ga0068864_100033118
1451 Ga0068864_100444896
1452 Ga0068864_101172263
1453 Ga0068866_10003082
1454 Ga0068866_10004230
1455 Ga0068866_10025202
1456 Ga0068866_10173257
1457 Ga0068866_10336810
1458 Ga0068861_100015560
1459 Ga0068861_100271795
1460 Ga0068861_102459930
1461 Ga0068851_10003628
1462 Ga0068851_10005203
1463 Ga0068851_10296451
1464 Ga0068851_10420709
1465 Ga0068870_10007715
1466 Ga0068870_10053961
1467 Ga0068863_100015433
1468 Ga0068863_100027051
1469 Ga0068863_101089966
1470 Ga0068863_101132770
1471 Ga0068863_101602181
1472 Ga0068858_100004311
1473 Ga0068858_100007568
1474 Ga0068858_100027352
1475 Ga0068858_100040178
1476 Ga0068858_100089158
1477 Ga0068858_100347177
1478 Ga0068858_100950185
1479 Ga0068858_101378231
1480 Ga0068860_100009860
1481 Ga0068860_100017458
1482 Ga0068860_100035297
1483 Ga0068860_100145127
1484 Ga0068860_100332877
1485 Ga0068860_100350467
1486 Ga0068862_100115022
1487 Ga0068862_100126513
1488 Ga0068862_100166702
1489 Ga0081540_1029989
1490 Ga0070717_10001624
1491 Ga0070717_10021380
1492 Ga0070717_10021949
1493 Ga0070717_10046559
1494 Ga0070717_10062672
1495 Ga0070717_10068572
1496 Ga0070717_10083898
1497 Ga0070717_10124061
1498 Ga0070717_10140175
1499 Ga0070717_10361126
1500 Ga0070717_10683162
1501 Ga0070717_10728881
1502 Ga0070717_10786156
1503 Ga0070715_10002746
1504 Ga0070715_10145704
1505 Ga0070715_10351178
1506 Ga0070715_10497835
1507 Ga0070716_100006183
1508 Ga0070716_100010270
1509 Ga0070716_100017856
1510 Ga0070716_100035542
1511 Ga0070716_100040078
1512 Ga0070716_100097023
1513 Ga0070716_100135725
1514 Ga0070716_100194494
1515 Ga0070716_100574404
1516 Ga0070716_100643141
1517 Ga0070716_100662576
1518 Ga0070716_100727090
1519 Ga0070712_100000262
1520 Ga0070712_100000618
1521 Ga0070712_100014067
1522 Ga0070712_100021621
1523 Ga0070712_100198500
1524 Ga0070712_100489788
1525 Ga0070712_100516188
1526 Ga0070712_100628293
1527 Ga0070712_101611585
1528 Ga0097621_100000395
1529 Ga0097621_100002712
1530 Ga0097621_100003022
1531 Ga0097621_100079134
1532 Ga0097621_100079567
1533 Ga0097621_100429914
1534 Ga0097621_100533616
1535 Ga0068871_100002563
1536 Ga0068871_100003240
1537 Ga0068871_100004336
1538 Ga0068871_100013189
1539 Ga0068871_100160110
1540 Ga0068871_100602234
1541 Ga0068871_100855222
1542 Ga0068871_100913868
1543 Ga0068871_102348984
1544 Ga0075434_100040746
1545 Ga0068865_100056677
1546 Ga0068865_100153636
1547 Ga0068865_100223121
1548 Ga0075436_100043910
1549 Ga0075436_100255810
1550 Ga0075436_100504967
1551 Ga0097620_100000701
1552 Ga0097620_100041447
1553 Ga0097620_100460909
1554 Ga0075435_100002238
1555 Ga0075435_100020692
1556 Ga0099794_10299963
1557 Ga0099795_10071509
1558 Ga0099795_10537264
1559 Ga0105250_10030931
1560 Ga0105250_10143281
1561 Ga0105240_10004122
1562 Ga0105240_10028901
1563 Ga0105240_10043903
1564 Ga0105240_10053354
1565 Ga0105240_10063666
1566 Ga0105240_10115193
1567 Ga0105240_10213366
1568 Ga0105240_10317271
1569 Ga0105240_10835130
1570 Ga0105240_12136897
1571 Ga0105240_12473754
1572 Ga0105245_10003672
1573 Ga0105245_10004606
1574 Ga0105245_10087165
1575 Ga0105245_10125943
1576 Ga0105245_10588375
1577 Ga0105245_11463057
1578 Ga0105247_10039588
1579 Ga0105247_10078286
1580 Ga0105247_10534222
1581 Ga0105247_10566286
1582 Ga0105247_11087198
1583 Ga0105243_10443582
1584 Ga0105241_10027499
1585 Ga0105241_10030638
1586 Ga0105241_10031395
1587 Ga0105241_10034345
1588 Ga0105241_10068487
1589 Ga0105241_10120553
1590 Ga0105241_10273178
1591 Ga0105241_10576705
1592 Ga0105241_10602600
1593 Ga0105241_11411019
1594 Ga0105242_10057049
1595 Ga0105242_10113431
1596 Ga0105242_10114162
1597 Ga0105242_10134757
1598 Ga0105242_10267583
1599 Ga0105242_10692683
1600 Ga0105248_10004109
1601 Ga0105248_10116785
1602 Ga0105248_10119865
1603 Ga0105248_10168973
1604 Ga0105248_10286340
1605 Ga0105248_10313783
1606 Ga0105248_10437215
1607 Ga0105237_10039282
1608 Ga0105237_10043379
1609 Ga0105237_10106206
1610 Ga0105237_10119405
1611 Ga0105237_10154158
1612 Ga0105237_10381271
1613 Ga0105237_10582395
1614 Ga0105237_10769833
1615 Ga0105238_10000860
1616 Ga0105238_10017227
1617 Ga0105238_10033615
1618 Ga0105238_10246160
1619 Ga0105238_10724070
1620 Ga0105238_10983331
1621 Ga0105238_11214246
1622 Ga0105238_11482996
1623 Ga0105238_11552187
1624 Ga0105238_11624012
1625 Ga0105238_12436512
1626 Ga0105249_10047876
1627 Ga0105249_10976651
1628 Ga0105249_11924854
1629 Ga0099796_10228722
1630 Ga0105239_10016353
1631 Ga0105239_10018909
1632 Ga0105239_10031708
1633 Ga0105239_10069561
1634 Ga0105239_10303205
1635 Ga0105239_10446041
1636 Ga0105239_11100898
1637 Ga0105239_12149753
1638 Ga0105246_10020423
1639 Ga0105246_10100687
1640 Ga0105246_10308167
1641 Ga0105246_10446110
1642 Ga0157373_10048030
1643 Ga0157373_10075386
1644 Ga0157373_10090064
1645 Ga0157373_10118108
1646 Ga0157373_10246714
1647 Ga0157373_10926960
1648 Ga0157373_10983103
1649 Ga0157373_11177364
1650 Ga0157371_10024160
1651 Ga0157371_10097970
1652 Ga0157371_10173764
1653 Ga0157370_10024789
1654 Ga0157370_10359451
1655 Ga0157370_10471765
1656 Ga0157370_12045484
1657 Ga0157369_10000323
1658 Ga0157369_10037380
1659 Ga0157369_10065338
1660 Ga0157369_10086306
1661 Ga0157369_10143297
1662 Ga0157369_10209826
1663 Ga0157369_10213639
1664 Ga0157369_10217087
1665 Ga0157369_10223974
1666 Ga0157369_10508345
1667 Ga0157369_10985600
1668 Ga0157369_11822404
1669 Ga0157374_10000131
1670 Ga0157374_10000690
1671 Ga0157374_10003128
1672 Ga0157374_10003490
1673 Ga0157374_10051976
1674 Ga0157374_10166811
1675 Ga0157374_10235785
1676 Ga0157374_10494743
1677 Ga0157374_10696778
1678 Ga0157374_10913654
1679 Ga0157374_11784568
1680 Ga0157374_12743912
1681 Ga0157378_10000388
1682 Ga0157378_10000924
1683 Ga0157378_10001041
1684 Ga0157378_10024596
1685 Ga0157378_10052176
1686 Ga0157378_10382487
1687 Ga0157378_11048948
1688 Ga0163162_10002555
1689 Ga0163162_10023203
1690 Ga0163162_10223794
1691 Ga0163162_10226750
1692 Ga0163162_10677033
1693 Ga0163162_12103384
1694 Ga0157372_10004337
1695 Ga0157372_10005053
1696 Ga0157372_10005073
1697 Ga0157372_10013765
1698 Ga0157372_10027852
1699 Ga0157372_10029627
1700 Ga0157372_10034206
1701 Ga0157372_10042655
1702 Ga0157372_10168594
1703 Ga0157372_10204928
1704 Ga0157372_10225186
1705 Ga0157372_12882713
1706 Ga0157372_13391512
1707 Ga0157375_10046025
1708 Ga0157375_10486576
1709 Ga0157375_12440078
1710 Ga0157375_13353177
1711 Ga0163163_10013744
1712 Ga0163163_10086425
1713 Ga0163163_10219353
1714 Ga0163163_10223620
1715 Ga0163163_10520580
1716 Ga0163163_10626428
1717 Ga0163163_11219014
1718 Ga0157380_10657044
1719 Ga0182008_10022568
1720 Ga0182008_10401928
1721 Ga0182008_10984684
1722 Ga0157377_10000553
1723 Ga0157379_10020013
1724 Ga0157379_10129018
1725 Ga0157379_10212150
1726 Ga0157379_10351645
1727 Ga0157379_10983689
1728 Ga0157376_10024322
1729 Ga0157376_10026459
1730 Ga0157376_10098234
1731 Ga0157376_12868544
1732 Ga0182007_10005999
1733 Ga0182005_1089711
1734 Ga0182005_1131068
1735 Ga0182005_1176412
1736 Ga0163161_10052956
1737 Ga0213873_10053011
1738 Ga0213876_10543186
1739 Ga0213871_10030876
1740 Ga0224569_100415
1741 Ga0224569_104886
1742 Ga0224571_100576
1743 Ga0224571_105902
1744 Ga0224572_1010953
1745 Ga0224572_1034169
1746 Ga0224572_1046485
1747 Ga0228598_1004427
1748 Ga0228598_1037914
1749 Ga0207697_10011415
1750 Ga0207656_10018748
1751 Ga0207656_10098824
1752 Ga0207656_10307005
1753 Ga0207696_1049382
1754 Ga0207682_10152652
1755 Ga0207682_10498100
1756 Ga0207692_10005687
1757 Ga0207692_10040412
1758 Ga0207692_10178878
1759 Ga0207692_10315219
1760 Ga0207692_10504790
1761 Ga0207642_10034045
1762 Ga0207642_10048007
1763 Ga0207642_10059580
1764 Ga0207642_10074477
1765 Ga0207642_10134282
1766 Ga0207710_10006323
1767 Ga0207710_10059872
1768 Ga0207688_10012092
1769 Ga0207680_10012624
1770 Ga0207680_10026106
1771 Ga0207680_10852426
1772 Ga0207647_10006337
1773 Ga0207647_10008116
1774 Ga0207647_10400539
1775 Ga0207647_10480216
1776 Ga0207685_10097593
1777 Ga0207699_10000209
1778 Ga0207699_10029486
1779 Ga0207699_10144010
1780 Ga0207699_10155059
1781 Ga0207699_10248059
1782 Ga0207699_10360745
1783 Ga0207699_10426331
1784 Ga0207699_10435431
1785 Ga0207699_10641451
1786 Ga0207699_10801201
1787 Ga0207699_11040779
1788 Ga0207699_11458295
1789 Ga0207645_10014919
1790 Ga0207645_10647076
1791 Ga0207645_11189564
1792 Ga0207643_10000328
1793 Ga0207643_10037980
1794 Ga0207705_10081568
1795 Ga0207684_10001048
1796 Ga0207684_10016175
1797 Ga0207684_10140217
1798 Ga0207654_10014585
1799 Ga0207654_10016876
1800 Ga0207654_10360289
1801 Ga0207654_10439518
1802 Ga0207707_10001653
1803 Ga0207707_10012547
1804 Ga0207707_10063871
1805 Ga0207707_10484957
1806 Ga0207707_10485236
1807 Ga0207707_10882496
1808 Ga0207707_11137113
1809 Ga0207695_10041443
1810 Ga0207695_10055923
1811 Ga0207695_10190930
1812 Ga0207695_10266973
1813 Ga0207695_10330474
1814 Ga0207695_10409782
1815 Ga0207695_10475621
1816 Ga0207695_11140604
1817 Ga0207671_10142949
1818 Ga0207671_10266988
1819 Ga0207671_10314424
1820 Ga0207671_10373263
1821 Ga0207671_10579127
1822 Ga0207693_10000026
1823 Ga0207693_10000275
1824 Ga0207693_10013544
1825 Ga0207693_10041917
1826 Ga0207693_10050041
1827 Ga0207693_10475481
1828 Ga0207693_10487383
1829 Ga0207663_10000479
1830 Ga0207663_10043172
1831 Ga0207663_10115065
1832 Ga0207663_10133191
1833 Ga0207663_10165415
1834 Ga0207663_10330785
1835 Ga0207663_10661459
1836 Ga0207663_11117893
1837 Ga0207663_11189739
1838 Ga0207660_10052201
1839 Ga0207660_10134124
1840 Ga0207660_10172760
1841 Ga0207662_10011391
1842 Ga0207657_10002285
1843 Ga0207657_10002326
1844 Ga0207657_10002602
1845 Ga0207649_10000612
1846 Ga0207649_10106961
1847 Ga0207649_10476179
1848 Ga0207652_10003536
1849 Ga0207652_10031402
1850 Ga0207652_10046052
1851 Ga0207652_10327724
1852 Ga0207652_10444464
1853 Ga0207646_10001230
1854 Ga0207646_10076603
1855 Ga0207646_10142285
1856 Ga0207646_10206029
1857 Ga0207646_10207012
1858 Ga0207646_10845555
1859 Ga0207681_10021015
1860 Ga0207681_10255903
1861 Ga0207694_10002710
1862 Ga0207694_10038561
1863 Ga0207694_10056775
1864 Ga0207694_10145918
1865 Ga0207694_10208383
1866 Ga0207694_10287138
1867 Ga0207650_10000152
1868 Ga0207650_10002883
1869 Ga0207650_10805378
1870 Ga0207650_10996740
1871 Ga0207659_11422123
1872 Ga0207687_10002291
1873 Ga0207687_10018465
1874 Ga0207687_10020665
1875 Ga0207687_10412635
1876 Ga0207687_11466307
1877 Ga0207700_10000306
1878 Ga0207700_10000979
1879 Ga0207700_10002156
1880 Ga0207700_10036292
1881 Ga0207700_10057403
1882 Ga0207700_10265343
1883 Ga0207700_10615410
1884 Ga0207700_10822379
1885 Ga0207700_10873893
1886 Ga0207700_10896078
1887 Ga0207700_11123708
1888 Ga0207700_11741819
1889 Ga0207664_10000087
1890 Ga0207664_10002140
1891 Ga0207664_10032225
1892 Ga0207664_10042713
1893 Ga0207664_10120591
1894 Ga0207664_10138029
1895 Ga0207664_10245128
1896 Ga0207664_10345860
1897 Ga0207664_10561603
1898 Ga0207664_10586846
1899 Ga0207664_10684951
1900 Ga0207664_11580792
1901 Ga0207644_10046547
1902 Ga0207644_10301436
1903 Ga0207644_10472450
1904 Ga0207690_10062265
1905 Ga0207690_10220679
1906 Ga0207706_10000740
1907 Ga0207706_10002545
1908 Ga0207686_10061537
1909 Ga0207686_10077765
1910 Ga0207686_10107934
1911 Ga0207686_10189208
1912 Ga0207686_10234734
1913 Ga0207686_10604012
1914 Ga0207709_10870831
1915 Ga0207670_10065300
1916 Ga0207670_11432283
1917 Ga0207669_10389576
1918 Ga0207669_10886659
1919 Ga0207704_10050127
1920 Ga0207704_11241827
1921 Ga0207665_10004916
1922 Ga0207665_10016139
1923 Ga0207665_10075882
1924 Ga0207665_10083911
1925 Ga0207665_10162389
1926 Ga0207665_10173358
1927 Ga0207665_10204113
1928 Ga0207665_10206920
1929 Ga0207665_10209987
1930 Ga0207665_10298961
1931 Ga0207665_10529123
1932 Ga0207665_11043946
1933 Ga0207665_11626228
1934 Ga0207691_10000308
1935 Ga0207711_10012353
1936 Ga0207711_10030535
1937 Ga0207711_10120261
1938 Ga0207711_10132547
1939 Ga0207711_10753334
1940 Ga0207689_10000618
1941 Ga0207689_10083123
1942 Ga0207689_10126520
1943 Ga0207689_10169489
1944 Ga0207661_10001294
1945 Ga0207661_10079525
1946 Ga0207661_10093522
1947 Ga0207661_10165526
1948 Ga0207661_10760068
1949 Ga0207661_11924867
1950 Ga0207679_10000298
1951 Ga0207679_10078451
1952 Ga0207679_10355093
1953 Ga0207679_10475074
1954 Ga0207667_10000802
1955 Ga0207667_10008703
1956 Ga0207667_10015779
1957 Ga0207667_10095689
1958 Ga0207667_10147641
1959 Ga0207667_10242636
1960 Ga0207667_10299668
1961 Ga0207667_10884280
1962 Ga0207667_11262549
1963 Ga0207667_12174771
1964 Ga0207651_10028023
1965 Ga0207651_10885775
1966 Ga0207651_11016547
1967 Ga0207712_10013356
1968 Ga0207712_10527738
1969 Ga0207712_10732646
1970 Ga0207712_11154393
1971 Ga0207712_11459658
1972 Ga0207668_10253118
1973 Ga0207668_10875249
1974 Ga0207640_10025994
1975 Ga0207640_10058926
1976 Ga0207640_10169301
1977 Ga0207640_10223881
1978 Ga0207640_10393682
1979 Ga0207640_11443187
1980 Ga0207658_10164606
1981 Ga0207658_11072761
1982 Ga0207658_11951055
1983 Ga0207677_10002182
1984 Ga0207677_10050324
1985 Ga0207677_10055739
1986 Ga0207677_11204727
1987 Ga0207677_12268125
1988 Ga0207703_10006614
1989 Ga0207703_10290929
1990 Ga0207703_10811364
1991 Ga0207703_11339989
1992 Ga0207703_11774022
1993 Ga0207639_10034908
1994 Ga0207639_10463259
1995 Ga0207639_10719020
1996 Ga0207678_10001414
1997 Ga0207678_10006402
1998 Ga0207678_10087345
1999 Ga0207678_10536629
2000 Ga0207708_10281715
2001 Ga0207702_10001466
2002 Ga0207702_10006585
2003 Ga0207702_10007672
2004 Ga0207702_10030165
2005 Ga0207702_10220885
2006 Ga0207702_10256086
2007 Ga0207702_10786502
2008 Ga0207702_11961894
2009 Ga0207641_10000052
2010 Ga0207641_10014828
2011 Ga0207641_10035964
2012 Ga0207641_10836545
2013 Ga0207641_11090066
2014 Ga0207641_11228068
2015 Ga0207648_10001643
2016 Ga0207648_10003472
2017 Ga0207648_10014202
2018 Ga0207676_10000176
2019 Ga0207676_10001129
2020 Ga0207676_10004043
2021 Ga0207676_10124788
2022 Ga0207676_10915527
2023 Ga0207674_10000125
2024 Ga0207674_10000561
2025 Ga0207674_10005435
2026 Ga0207674_10026155
2027 Ga0207674_10122742
2028 Ga0207674_10123814
2029 Ga0207674_10413522
2030 Ga0207675_100027751
2031 Ga0207675_100163396
2032 Ga0207675_101574796
2033 Ga0207683_10002524
2034 Ga0207683_10498632
2035 Ga0207683_10793578
2036 Ga0207683_10822407
2037 Ga0207683_11768994
2038 Ga0207698_10022855
2039 Ga0207698_10084521
2040 Ga0207698_10531712
2041 Ga0207698_10703927
2042 Ga0207698_10910326
2043 Ga0207698_11041404
2044 Ga0265356_1000766
2045 Ga0265356_1011999
2046 Ga0268266_10092603
2047 Ga0268266_12300064
2048 Ga0268265_10191932
2049 Ga0268265_10979301
2050 Ga0268264_10006934
2051 Ga0268264_10011379
2052 Ga0268264_10106594
2053 Ga0268264_10259415
2054 Ga0268264_10595489
2055 Ga0268264_11065374
2056 Ga0268264_12395624
2057 Ga0268264_12437654
2058 Ga0265338_10011173
2059 Ga0265338_10061089
2060 Ga0265338_10119970
2061 Ga0265338_10177814
2062 Ga0265338_10680910
2063 Ga0265338_10972356
2064 Ga0265338_11011802
2065 Ga0265324_10153429
2066 Ga0265762_1000401
2067 Ga0265762_1001210
2068 Ga0265762_1005514
2069 Ga0265762_1037256
2070 Ga0265770_1056611
2071 Ga0265760_10023165
2072 Ga0265760_10336576
2073 Ga0265325_10004543
2074 Ga0265325_10200013
2075 Ga0265339_10023928
2076 Ga0265339_10064549
2077 Ga0265339_10252930
2078 Ga0265339_10411893
2079 Ga0265331_10114238
2080 Ga0265316_10006220
2081 Ga0265316_10016491
2082 Ga0265316_10133418
2083 Ga0265316_10178274
2084 Ga0265316_10673412
2085 Ga0265314_10012372
2086 Ga0265314_10022604
2087 Ga0265342_10014809
2088 Ga0316212_1026710
2089 Ga0373948_0100863
2090 Ga0373958_0035263
2091 Ga0373938_0011890
2092 Ga0373926_0028827
2093 Ga0373926_0084906
2094 Ga0373934_0016874
2095 Ga0373934_0099393
2096 Ga0373944_0062344
2097 Ga0373944_0202982
2098 Ga0373951_0007459
2099 Ga0373952_0067118
2100 Ga0373923_0002217
2101 Ga0373923_0159354
2102 Ga0373923_0555561
2103 Ga0373936_0010297
2104 Ga0373936_0102688
2105 Ga0373936_0292886
2106 Ga0373939_0165265
2107 Ga0373945_0003343
2108 Ga0373945_0101339
2109 Ga0373945_0237635
2110 Ga0373945_0553359
2111 Ga0373953_0105884
2112 Ga0373954_0188422
2113 Ga0373956_0056146
2114 Ga0373960_0064682
2115 Ga0373943_0001626
2116 Ga0373943_0344546
2117 Ga0373943_0362979
2118 Ga0373946_0002814
2119 Ga0373946_0148381
2120 Ga0373955_0243010
2121 Ga0373955_0252596
2122 Ga0373942_0077761
2123 Ga0373962_0062279
2124 Ga0373924_0040106
2125 Ga0373931_0034821
2126 Ga0373931_0100539
2127 Ga0373931_0318615
2128 Ga0373931_0904073
2129 Ga0373935_0005817
2130 Ga0373935_0046735
2131 Ga0373935_0106296
2132 Ga0373935_1144951
2133 Ga0373935_1422811
2134 Ga0373927_0000747
2135 Ga0373927_0014065
2136 Ga0373927_0084648
2137 Ga0373927_0172697
2138 Ga0373927_0294472
2139 Ga0373927_1085632
2140 Ga0373933_0028842
2141 Ga0373933_0178489
2142 Ga0373933_0263838
2143 Ga0373933_0967731
2144 Ga0373933_1166632
2145 Ga0373947_0011342
2146 Ga0373947_0014094
2147 Ga0373947_0547906
2148 Ga0373937_0198306
2149 Ga0373937_0304131
2150 Ga0373937_0513887
2151 Ga0373937_0669470
2152 Ga0373937_1435735
2153 Ga0373937_1855054
2154 Ga0373937_1922789
2155 Ga0373925_0004658
2156 Ga0373925_0026245
2157 Ga0373925_0176237
2158 Ga0373925_0264800
2159 Ga0373925_0466103
2160 Ga0373925_0923190
2161 Ga0373925_1069826
2162 Ga0395900_1301114
2163 Ga0395898_0725081
2164 Ga0436365_0628206
2165 Ga0436360_0246638
2166 Ga0436363_0958565
2167 Ga0436362_0405904
2168 Ga0436362_1033386
2169 Ga0451839_0076152
2170 Ga0451577_1336472
2171 Ga0466966_0948723
2172 Ga0466961_0257802
2173 Ga0466963_0031366
2174 Ga0466963_0165209
2175 Ga0466963_0731204
2176 Ga0466964_0181822
2177 Ga0466964_0634191
2178 Ga0466964_0811975
2179 Ga0453684_1002999
2180 Ga0466968_0064189
2181 Ga0466959_0296843
2182 Ga0451576_0080329
2183 Ga0451576_0086697
2184 Ga0451576_0671549
2185 Ga0451576_0717923
2186 Ga0451576_1371234
2187 Ga0466958_0395616
2188 Ga0466958_1140714
2189 Ga0466967_0053937
2190 Ga0466967_0100894
2191 Ga0466967_0735964
2192 Ga0495592_0744746
2193 Ga0495603_0373179
2194 Ga0495603_0487013
2195 Ga0495629_0545444
2196 Ga0495651_0440268
2197 Ga0495651_0939590
2198 Ga0495653_0679607
2199 Ga0495580_0000603
2200 Ga0495580_0001289
2201 Ga0495580_0003921
2202 Ga0495580_0009412
2203 Ga0495580_0034777
2204 Ga0495580_0049839
2205 Ga0495580_0175814
2206 Ga0495580_0233020
2207 Ga0495580_0444425
2208 Ga0495580_0575513
2209 Ga0495582_0001718
2210 Ga0495582_0002195
2211 Ga0495582_0201690
2212 Ga0495639_0014516
2213 Ga0495662_0066426
2214 Ga0495664_0016333
2215 Ga0495664_0065861
2216 Ga0495594_0395988
2217 Ga0495608_0315133
2218 Ga0495618_0645444
2219 Ga0495630_0100516
2220 Ga0495630_0209526
2221 Ga0495630_0295296
2222 Ga0495630_0346110
2223 Ga0495666_0109979
2224 Ga0495652_0575471
2225 Ga0495665_0029765
2226 Ga0495665_0190339
2227 Ga0495665_0379291
2228 Ga0495586_0122509
2229 Ga0495587_0032512
2230 Ga0495587_0580062
2231 Ga0495667_0175614
2232 Ga0495635_0123300
2233 Ga0495657_0161318
2234 Ga0495623_0303880
2235 Ga0495623_0378222
2236 Ga0495623_0687405
2237 Ga0495623_0703661
2238 Ga0495646_0378954
2239 Ga0495658_0114741
2240 Ga0495669_0202159
2241 Ga0495613_0185423
2242 Ga0495600_0212828
2243 Ga0495581_0016034
2244 Ga0495581_0067826
2245 Ga0495581_0104136
2246 Ga0495581_0113158
2247 Ga0495604_0039992
2248 Ga0495674_0094012
2249 Ga0495674_0186315
2250 Ga0495674_0280833
2251 Ga0495674_0589143
2252 Ga0495674_0838568
2253 Ga0495674_1401102
2254 Ga0495676_0282386
2255 Ga0495675_0665863
2256 Ga0495685_273547
2257 Ga0495684_0507009
2258 Ga0495602_0130451
2259 Ga0495602_0476993
2260 Ga0495614_0189451
2261 Ga0496100_0348790
2262 Ga0496100_0736734
2263 Ga0496100_1012209
2264 Ga0496101_0049553
2265 Ga0496101_0417595
2266 Ga0496101_0535783
2267 Ga0496101_0753745
2268 Ga0496101_1001404
2269 Ga0496102_0309600
2270 Ga0496102_0554075
2271 Ga0496102_0615511
2272 Ga0496102_0900454
2273 Ga0496102_1634175
2274 Ga0496103_0201464
2275 Ga0496103_0300120
2276 Ga0496103_0318699
2277 Ga0496103_0862464
2278 Ga0496104_0058767
2279 Ga0496104_0070054
2280 Ga0496104_0118656
2281 Ga0496104_0146462
2282 Ga0496104_0166384
2283 Ga0496104_0697285
2284 Ga0496105_0025317
2285 Ga0496105_0185026
2286 Ga0496105_0406337
2287 Ga0496106_0044811
2288 Ga0496106_0233346
2289 Ga0496107_0075478
2290 Ga0496107_0344390
2291 Ga0496107_0570412
2292 Ga0496108_0000242
2293 Ga0496108_0114263
2294 Ga0496108_0973288
2295 Ga0496109_0000120
2296 Ga0496109_0051640
2297 Ga0496109_0092435
2298 Ga0496109_0112074
2299 Ga0496109_0449451
2300 Ga0496109_1250089
2301 Ga0496109_1406471
2302 Ga0496110_0003869
2303 Ga0496110_0018359
2304 Ga0496110_1208322
2305 Ga0496111_0013049
2306 Ga0496111_0020419
2307 Ga0496112_0000198
2308 Ga0496112_0024111
2309 Ga0496112_0046570
2310 Ga0496112_0064520
2311 Ga0496112_0080018
2312 Ga0496112_0198584
2313 Ga0496112_0275747
2314 Ga0496112_0374280
2315 Ga0496112_0560108
2316 Ga0496112_1526184
2317 Ga0496113_0000111
2318 Ga0496113_0229510
2319 Ga0496113_0967228
2320 Ga0496113_1255283
2321 Ga0496114_0141388
2322 Ga0496114_0236103
2323 Ga0496115_0003194
2324 Ga0496115_0051792
2325 Ga0496115_0161131
2326 Ga0496115_0242887
2327 Ga0496115_0524973
2328 Ga0496115_0673134
2329 nmdc:mga0n895_6611_c1
2330 nmdc:mga0rr50_15265_c1
2331 nmdc:mga0rr50_2703_c1
2332 nmdc:mga08x19_103937_c1
2333 nmdc:mga08x19_11637_c1
2334 Ga0495601_0723047
2335 Ga0495612_0512072
2336 Ga0495619_0256876
2337 Ga0495619_1190674
2338 Ga0466962_0159842

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

19

101

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.9183 2 93
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.8457 2 93
7b90-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant 0.7511 3 95
5ae2-assembly1.cif.gz_A ether lipid-generating enzyme agps in complex with inhibitor 1e 0.7439 2 85
6wxo-assembly1.cif.gz_A de novo tim barrel-ferredoxin fold fusion homodimer with 2-histidine 2-glutamate centre tfd-he 0.7296 4 90
ID Description Score Start End Superfamily
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9184 2 93 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9006 2 93 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8458 2 93 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8383 2 93 3.30.70.1120
af_P0AEP9_350_431_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7598 4 89 3.30.70.2740
ID Description Score Start End GO Terms
AF-Q1IIT4-F1-model_v4 YlxP-like protein 0.9889 2 95
AF-A0A1H5WFH4-F1-model_v4 DUF503 domain-containing protein 0.986 2 93
AF-A0A1Z9M751-F1-model_v4 DUF503 domain-containing protein 0.9801 2 95
AF-A0A1G7FZM0-F1-model_v4 DUF503 domain-containing protein 0.9782 2 95
AF-A0A7D8BDH0-F1-model_v4 DUF503 family protein 0.9728 2 93

Map