F491100

General Info

Members Datasets Scaffolds Average Seq Length
1167 258 1166 119

Family's Representative Sequence

Representative Sequence 3300035118|Ga0373954_0369197|Ga0373954_0369197_168_557
Length 129
Sequence MGDVMSPEPETVLTRVRDLALALPAAAERTSHGSPGFHIEKGKFFAYFWHDHHGDGETVAIVKTSGAEEQAMLIEQDSDFYFRPAYLGASGWIAMRLDRDGTDWDRVADRIAQSWEMVAPRRLLEMGGR

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.17
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 3.17
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 0.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000133 3300001904 Bacteria 12833
2 JGI24736J21556_1013433 3300001904 Bacteria 1322
3 JGI24752J21851_1019379 3300001976 Unclassified 887
4 JGI24740J21852_10016744 3300001979 Bacteria 2640
5 JGI24740J21852_10032844 3300001979 Bacteria 1655
6 JGI24740J21852_10074524 3300001979 Bacteria 901
7 JGI24740J21852_10092955 3300001979 Unclassified 776
8 JGI24739J22299_10004359 3300001989 Bacteria 5421
9 JGI24739J22299_10053170 3300001989 Unclassified 1300
10 JGI24739J22299_10263090 3300001989 Bacteria 505
11 JGI24737J22298_10000994 3300001990 Bacteria 10049
12 JGI24737J22298_10025322 3300001990 Bacteria 1876
13 JGI24737J22298_10035485 3300001990 Bacteria 1543
14 JGI24737J22298_10172687 3300001990 Bacteria 638
15 JGI24735J21928_10023708 3300002067 Bacteria 1860
16 JGI24735J21928_10051821 3300002067 Bacteria 1184
17 JGI24735J21928_10248330 3300002067 Unclassified 518
18 JGI24738J21930_10003890 3300002075 Bacteria 3728
19 JGI24738J21930_10007357 3300002075 Bacteria 2544
20 JGI25406J46586_10199109 3300003203 Bacteria 585
21 Ga0065712_10117477 3300005290 Bacteria 1718
22 Ga0065715_10867510 3300005293 Unclassified 586
23 Ga0070658_10000409 3300005327 Bacteria 37237
24 Ga0070658_10015117 3300005327 Bacteria 6177
25 Ga0070658_10043637 3300005327 Bacteria 3622
26 Ga0070658_10139786 3300005327 Bacteria 2022
27 Ga0070658_10142529 3300005327 Bacteria 2002
28 Ga0070658_10154754 3300005327 Bacteria 1921
29 Ga0070658_10184171 3300005327 Bacteria 1758
30 Ga0070658_10245167 3300005327 Bacteria 1519
31 Ga0070658_10320033 3300005327 Bacteria 1324
32 Ga0070658_10439344 3300005327 Bacteria 1123
33 Ga0070658_10486256 3300005327 Bacteria 1065
34 Ga0070658_10496905 3300005327 Bacteria 1053
35 Ga0070658_10615502 3300005327 Unclassified 941
36 Ga0070658_11070325 3300005327 Unclassified 701
37 Ga0070658_11138018 3300005327 Unclassified 679
38 Ga0070658_11510341 3300005327 Unclassified 582
39 Ga0070676_10296836 3300005328 Bacteria 1094
40 Ga0070676_10324847 3300005328 Bacteria 1050
41 Ga0070676_10660533 3300005328 Bacteria 760
42 Ga0070676_11130354 3300005328 Bacteria 593
43 Ga0070683_100000706 3300005329 Bacteria 24267
44 Ga0070683_100009797 3300005329 Bacteria 8209
45 Ga0070683_100011024 3300005329 Bacteria 7791
46 Ga0070683_100035063 3300005329 Bacteria 4587
47 Ga0070683_100457734 3300005329 Bacteria 1218
48 Ga0070683_100530136 3300005329 Bacteria 1125
49 Ga0070690_100369885 3300005330 Bacteria 1045
50 Ga0070690_100492227 3300005330 Bacteria 916
51 Ga0070690_101179238 3300005330 Unclassified 610
52 Ga0070670_100025540 3300005331 Bacteria 5081
53 Ga0070670_100078396 3300005331 Bacteria 2838
54 Ga0070670_100120233 3300005331 Bacteria 2266
55 Ga0070670_100154479 3300005331 Bacteria 1987
56 Ga0070670_100182359 3300005331 Bacteria 1823
57 Ga0070670_100793065 3300005331 Unclassified 855
58 Ga0070677_10120555 3300005333 Bacteria 1184
59 Ga0070677_10655550 3300005333 Bacteria 587
60 Ga0070666_10001236 3300005335 Bacteria 15445
61 Ga0070666_10011770 3300005335 Bacteria 5501
62 Ga0070666_10076404 3300005335 Bacteria 2285
63 Ga0070666_10114242 3300005335 Bacteria 1869
64 Ga0070666_10183045 3300005335 Bacteria 1470
65 Ga0070666_10242177 3300005335 Bacteria 1276
66 Ga0070666_10973626 3300005335 Unclassified 629
67 Ga0070680_100000834 3300005336 Bacteria 21786
68 Ga0070680_100004339 3300005336 Bacteria 10666
69 Ga0070680_100013072 3300005336 Bacteria 6462
70 Ga0070680_100022301 3300005336 Bacteria 5041
71 Ga0070680_100023324 3300005336 Bacteria 4935
72 Ga0070680_100131475 3300005336 Bacteria 2094
73 Ga0070680_100207836 3300005336 Bacteria 1651
74 Ga0070680_100226370 3300005336 Bacteria 1579
75 Ga0070680_100351325 3300005336 Bacteria 1254
76 Ga0070680_100433144 3300005336 Bacteria 1122
77 Ga0070680_100694162 3300005336 Bacteria 876
78 Ga0070680_101204127 3300005336 Bacteria 655
79 Ga0070682_100018071 3300005337 Bacteria 4116
80 Ga0070682_101545228 3300005337 Unclassified 572
81 Ga0070682_101628849 3300005337 Unclassified 559
82 Ga0070660_100000055 3300005339 Bacteria 67100
83 Ga0070660_100015476 3300005339 Bacteria 5510
84 Ga0070660_100023295 3300005339 Bacteria 4587
85 Ga0070660_100032087 3300005339 Bacteria 3950
86 Ga0070660_100053551 3300005339 Bacteria 3113
87 Ga0070660_100053691 3300005339 Bacteria 3109
88 Ga0070660_100080646 3300005339 Bacteria 2553
89 Ga0070660_100226815 3300005339 Bacteria 1519
90 Ga0070660_100262075 3300005339 Bacteria 1412
91 Ga0070660_100306173 3300005339 Bacteria 1303
92 Ga0070660_100345120 3300005339 Bacteria 1225
93 Ga0070660_100806936 3300005339 Bacteria 789
94 Ga0070660_100919259 3300005339 Unclassified 738
95 Ga0070660_101145731 3300005339 Bacteria 659
96 Ga0070660_101384605 3300005339 Bacteria 597
97 Ga0070691_10001109 3300005341 Bacteria 11174
98 Ga0070661_100000340 3300005344 Bacteria 37237
99 Ga0070661_100011683 3300005344 Bacteria 6123
100 Ga0070661_100020693 3300005344 Bacteria 4693
101 Ga0070661_100036721 3300005344 Bacteria 3561
102 Ga0070661_100079728 3300005344 Bacteria 2416
103 Ga0070661_100083744 3300005344 Bacteria 2356
104 Ga0070661_100107424 3300005344 Bacteria 2081
105 Ga0070661_100197618 3300005344 Bacteria 1535
106 Ga0070661_100275649 3300005344 Bacteria 1304
107 Ga0070661_100369286 3300005344 Bacteria 1129
108 Ga0070661_100686191 3300005344 Bacteria 833
109 Ga0070692_10000903 3300005345 Bacteria 10042
110 Ga0070692_10028373 3300005345 Bacteria 2781
111 Ga0070692_10041185 3300005345 Unclassified 2366
112 Ga0070692_10302327 3300005345 Bacteria 977
113 Ga0070692_10358364 3300005345 Bacteria 908
114 Ga0070692_10627274 3300005345 Bacteria 715
115 Ga0070668_100035677 3300005347 Bacteria 3793
116 Ga0070668_102079851 3300005347 Bacteria 524
117 Ga0070669_100865493 3300005353 Bacteria 771
118 Ga0070675_100932613 3300005354 Bacteria 796
119 Ga0070675_101735486 3300005354 Bacteria 576
120 Ga0070671_100001642 3300005355 Bacteria 16906
121 Ga0070671_100049934 3300005355 Bacteria 3480
122 Ga0070671_100051715 3300005355 Bacteria 3417
123 Ga0070671_100064346 3300005355 Bacteria 3054
124 Ga0070671_100066505 3300005355 Bacteria 3004
125 Ga0070671_100095727 3300005355 Bacteria 2489
126 Ga0070671_100101612 3300005355 Bacteria 2412
127 Ga0070674_100281497 3300005356 Bacteria 1318
128 Ga0070674_100953965 3300005356 Bacteria 750
129 Ga0070674_101423821 3300005356 Bacteria 621
130 Ga0070673_100038841 3300005364 Bacteria 3639
131 Ga0070673_100049443 3300005364 Bacteria 3283
132 Ga0070673_100326284 3300005364 Bacteria 1357
133 Ga0070673_100443209 3300005364 Bacteria 1167
134 Ga0070673_101644089 3300005364 Bacteria 607
135 Ga0070673_101680701 3300005364 Bacteria 601
136 Ga0070659_100000139 3300005366 Bacteria 55743
137 Ga0070659_100003111 3300005366 Bacteria 11806
138 Ga0070659_100006731 3300005366 Bacteria 8309
139 Ga0070659_100064423 3300005366 Bacteria 2901
140 Ga0070659_100096744 3300005366 Bacteria 2372
141 Ga0070659_100103047 3300005366 Bacteria 2298
142 Ga0070659_100335829 3300005366 Bacteria 1265
143 Ga0070659_100388746 3300005366 Bacteria 1176
144 Ga0070659_100401218 3300005366 Bacteria 1157
145 Ga0070659_100539128 3300005366 Bacteria 998
146 Ga0070659_100576034 3300005366 Bacteria 965
147 Ga0070659_100717511 3300005366 Bacteria 865
148 Ga0070659_101052025 3300005366 Unclassified 716
149 Ga0070659_101393421 3300005366 Bacteria 623
150 Ga0070667_100006525 3300005367 Bacteria 9695
151 Ga0070667_100006814 3300005367 Bacteria 9490
152 Ga0070667_100312732 3300005367 Bacteria 1416
153 Ga0070667_100401050 3300005367 Bacteria 1248
154 Ga0070667_100420517 3300005367 Bacteria 1218
155 Ga0070667_100487230 3300005367 Bacteria 1129
156 Ga0070667_101107059 3300005367 Bacteria 740
157 Ga0070709_11613259 3300005434 Unclassified 528
158 Ga0070714_100030925 3300005435 Bacteria 4461
159 Ga0070714_100069338 3300005435 Bacteria 3045
160 Ga0070714_100582057 3300005435 Bacteria 1074
161 Ga0070714_100835157 3300005435 Unclassified 893
162 Ga0070714_101246763 3300005435 Bacteria 726
163 Ga0070714_101511514 3300005435 Bacteria 656
164 Ga0070714_101607540 3300005435 Bacteria 635
165 Ga0070713_100709994 3300005436 Bacteria 960
166 Ga0070713_100947927 3300005436 Unclassified 829
167 Ga0070694_100208093 3300005444 Bacteria 1462
168 Ga0070663_100000504 3300005455 Bacteria 20646
169 Ga0070663_100005567 3300005455 Bacteria 7498
170 Ga0070663_100008686 3300005455 Bacteria 6262
171 Ga0070663_100020037 3300005455 Bacteria 4421
172 Ga0070663_100024583 3300005455 Bacteria 4057
173 Ga0070663_100059281 3300005455 Bacteria 2751
174 Ga0070663_100071647 3300005455 Bacteria 2522
175 Ga0070663_100106605 3300005455 Bacteria 2099
176 Ga0070663_100122390 3300005455 Bacteria 1967
177 Ga0070663_100150976 3300005455 Bacteria 1781
178 Ga0070663_100177979 3300005455 Bacteria 1648
179 Ga0070663_100209555 3300005455 Bacteria 1525
180 Ga0070663_100247134 3300005455 Bacteria 1411
181 Ga0070663_100372152 3300005455 Bacteria 1161
182 Ga0070663_101008149 3300005455 Unclassified 724
183 Ga0070663_101102647 3300005455 Bacteria 694
184 Ga0070663_101406544 3300005455 Bacteria 618
185 Ga0070678_100003609 3300005456 Bacteria 8629
186 Ga0070678_100142439 3300005456 Bacteria 1920
187 Ga0070662_100000024 3300005457 Bacteria 91042
188 Ga0070662_100001327 3300005457 Bacteria 15204
189 Ga0070662_100020005 3300005457 Bacteria 4555
190 Ga0070662_100041502 3300005457 Bacteria 3282
191 Ga0070662_100075916 3300005457 Bacteria 2490
192 Ga0070662_100115202 3300005457 Bacteria 2053
193 Ga0070662_100149538 3300005457 Bacteria 1817
194 Ga0070662_100215593 3300005457 Unclassified 1529
195 Ga0070662_100300261 3300005457 Bacteria 1304
196 Ga0070662_100590345 3300005457 Bacteria 933
197 Ga0070662_101529126 3300005457 Bacteria 576
198 Ga0070681_10022750 3300005458 Bacteria 6299
199 Ga0070681_10069329 3300005458 Bacteria 3492
200 Ga0070681_10088375 3300005458 Bacteria 3051
201 Ga0070681_10137376 3300005458 Bacteria 2374
202 Ga0070681_10199601 3300005458 Bacteria 1919
203 Ga0070681_11015098 3300005458 Bacteria 750
204 Ga0070681_11485136 3300005458 Bacteria 602
205 Ga0070681_11619572 3300005458 Bacteria 573
206 Ga0068867_100430889 3300005459 Bacteria 1119
207 Ga0068867_100973892 3300005459 Bacteria 767
208 Ga0068867_101351133 3300005459 Bacteria 659
209 Ga0070706_100334191 3300005467 Unclassified 1413
210 Ga0070679_100101762 3300005530 Bacteria 2859
211 Ga0070679_100136061 3300005530 Bacteria 2438
212 Ga0070679_100152629 3300005530 Bacteria 2286
213 Ga0070679_100224097 3300005530 Bacteria 1840
214 Ga0070679_100242072 3300005530 Bacteria 1761
215 Ga0070679_100308564 3300005530 Unclassified 1532
216 Ga0070679_100382718 3300005530 Bacteria 1354
217 Ga0070679_100603946 3300005530 Unclassified 1040
218 Ga0070679_100850720 3300005530 Bacteria 855
219 Ga0070679_101210034 3300005530 Bacteria 701
220 Ga0070684_100005570 3300005535 Bacteria 9668
221 Ga0070684_100069704 3300005535 Bacteria 3092
222 Ga0070684_100125680 3300005535 Bacteria 2310
223 Ga0070684_100220835 3300005535 Unclassified 1729
224 Ga0070684_100263179 3300005535 Unclassified 1578
225 Ga0070684_100450191 3300005535 Bacteria 1190
226 Ga0070684_100692312 3300005535 Bacteria 950
227 Ga0068853_100001074 3300005539 Bacteria 19308
228 Ga0068853_100026812 3300005539 Bacteria 4841
229 Ga0068853_100066591 3300005539 Bacteria 3128
230 Ga0068853_100086427 3300005539 Bacteria 2750
231 Ga0068853_100105437 3300005539 Bacteria 2497
232 Ga0068853_100111338 3300005539 Bacteria 2432
233 Ga0068853_100446799 3300005539 Bacteria 1216
234 Ga0068853_100567290 3300005539 Bacteria 1076
235 Ga0068853_101139635 3300005539 Bacteria 752
236 Ga0068853_101301551 3300005539 Unclassified 702
237 Ga0068853_101579712 3300005539 Bacteria 635
238 Ga0068853_101926089 3300005539 Unclassified 573
239 Ga0068853_102196767 3300005539 Unclassified 535
240 Ga0070672_100048912 3300005543 Bacteria 3288
241 Ga0070672_100134516 3300005543 Bacteria 2035
242 Ga0070672_100245468 3300005543 Unclassified 1507
243 Ga0070672_100324998 3300005543 Unclassified 1308
244 Ga0070672_100758404 3300005543 Bacteria 852
245 Ga0070686_100624154 3300005544 Unclassified 852
246 Ga0070686_101239642 3300005544 Unclassified 621
247 Ga0070696_100092516 3300005546 Unclassified 2155
248 Ga0070693_100001110 3300005547 Bacteria 12083
249 Ga0070693_100141031 3300005547 Unclassified 1517
250 Ga0070693_100413060 3300005547 Bacteria 938
251 Ga0070693_100969759 3300005547 Bacteria 641
252 Ga0070693_101261096 3300005547 Bacteria 570
253 Ga0070665_100000705 3300005548 Bacteria 44568
254 Ga0070665_100007630 3300005548 Bacteria 10998
255 Ga0070665_100021397 3300005548 Bacteria 6505
256 Ga0070665_100081856 3300005548 Bacteria 3234
257 Ga0070665_100082970 3300005548 Bacteria 3210
258 Ga0070665_100118761 3300005548 Bacteria 2646
259 Ga0070665_100807569 3300005548 Bacteria 951
260 Ga0070665_100900461 3300005548 Bacteria 897
261 Ga0068855_100001003 3300005563 Bacteria 35196
262 Ga0068855_100022702 3300005563 Bacteria 7519
263 Ga0068855_100239808 3300005563 Unclassified 2026
264 Ga0068855_100274141 3300005563 Bacteria 1875
265 Ga0068855_100420743 3300005563 Bacteria 1461
266 Ga0068855_100448893 3300005563 Bacteria 1407
267 Ga0068855_100545849 3300005563 Bacteria 1255
268 Ga0068855_100782195 3300005563 Bacteria 1015
269 Ga0068855_100894292 3300005563 Unclassified 938
270 Ga0068855_101371453 3300005563 Bacteria 729
271 Ga0068855_101636665 3300005563 Bacteria 658
272 Ga0068855_102452883 3300005563 Bacteria 520
273 Ga0070664_100000082 3300005564 Bacteria 60083
274 Ga0070664_100010862 3300005564 Bacteria 7384
275 Ga0070664_100018669 3300005564 Bacteria 5702
276 Ga0070664_100042636 3300005564 Bacteria 3830
277 Ga0070664_100044025 3300005564 Bacteria 3768
278 Ga0070664_100056697 3300005564 Bacteria 3329
279 Ga0070664_100275835 3300005564 Bacteria 1515
280 Ga0070664_100283038 3300005564 Bacteria 1495
281 Ga0070664_100383643 3300005564 Bacteria 1283
282 Ga0070664_100432081 3300005564 Bacteria 1207
283 Ga0070664_100517976 3300005564 Unclassified 1100
284 Ga0070664_100738881 3300005564 Unclassified 918
285 Ga0068857_100009522 3300005577 Bacteria 8435
286 Ga0068857_100024467 3300005577 Bacteria 5316
287 Ga0068857_100051464 3300005577 Bacteria 3654
288 Ga0068857_100152613 3300005577 Bacteria 2093
289 Ga0068857_100369006 3300005577 Bacteria 1331
290 Ga0068857_100408536 3300005577 Unclassified 1264
291 Ga0068857_101446929 3300005577 Bacteria 669
292 Ga0068857_101916253 3300005577 Bacteria 581
293 Ga0068854_100001469 3300005578 Bacteria 14276
294 Ga0068854_100014514 3300005578 Bacteria 5195
295 Ga0068854_100018885 3300005578 Bacteria 4635
296 Ga0068854_100025827 3300005578 Bacteria 4031
297 Ga0068854_100040772 3300005578 Bacteria 3277
298 Ga0068854_100104612 3300005578 Bacteria 2127
299 Ga0068854_100342165 3300005578 Unclassified 1222
300 Ga0068854_100541812 3300005578 Bacteria 986
301 Ga0068854_100607156 3300005578 Bacteria 935
302 Ga0068854_100645056 3300005578 Bacteria 908
303 Ga0068856_100000085 3300005614 Bacteria 87665
304 Ga0068856_100047272 3300005614 Bacteria 4240
305 Ga0068856_100078034 3300005614 Bacteria 3282
306 Ga0068856_100108049 3300005614 Bacteria 2778
307 Ga0068856_100309057 3300005614 Unclassified 1598
308 Ga0068856_100344597 3300005614 Bacteria 1508
309 Ga0068856_100446186 3300005614 Bacteria 1314
310 Ga0068856_100446611 3300005614 Bacteria 1314
311 Ga0068856_100673052 3300005614 Unclassified 1055
312 Ga0068856_100678303 3300005614 Unclassified 1051
313 Ga0068856_101098123 3300005614 Bacteria 813
314 Ga0068856_101137412 3300005614 Bacteria 798
315 Ga0068856_101301723 3300005614 Unclassified 742
316 Ga0068856_101724533 3300005614 Bacteria 638
317 Ga0068856_101792224 3300005614 Bacteria 626
318 Ga0068856_101859053 3300005614 Unclassified 613
319 Ga0068856_101863151 3300005614 Unclassified 613
320 Ga0068852_100001258 3300005616 Bacteria 16883
321 Ga0068852_100003532 3300005616 Bacteria 10941
322 Ga0068852_100033446 3300005616 Bacteria 4268
323 Ga0068852_100091277 3300005616 Bacteria 2725
324 Ga0068852_100130546 3300005616 Bacteria 2313
325 Ga0068852_100182698 3300005616 Bacteria 1973
326 Ga0068852_100236326 3300005616 Bacteria 1744
327 Ga0068852_100256822 3300005616 Bacteria 1676
328 Ga0068852_100339666 3300005616 Bacteria 1463
329 Ga0068852_100476219 3300005616 Bacteria 1240
330 Ga0068852_100491772 3300005616 Bacteria 1220
331 Ga0068852_100703201 3300005616 Unclassified 1021
332 Ga0068852_100713264 3300005616 Bacteria 1014
333 Ga0068852_101684787 3300005616 Bacteria 656
334 Ga0068852_101720795 3300005616 Bacteria 649
335 Ga0068852_101818310 3300005616 Bacteria 631
336 Ga0068859_100006121 3300005617 Bacteria 12223
337 Ga0068859_100417348 3300005617 Bacteria 1438
338 Ga0068859_100855665 3300005617 Unclassified 995
339 Ga0068864_100000188 3300005618 Bacteria 56337
340 Ga0068864_100000805 3300005618 Bacteria 26330
341 Ga0068864_100007304 3300005618 Bacteria 9088
342 Ga0068864_100010384 3300005618 Bacteria 7690
343 Ga0068864_101777178 3300005618 Bacteria 622
344 Ga0068866_10120753 3300005718 Bacteria 1476
345 Ga0068861_100583962 3300005719 Bacteria 1023
346 Ga0068861_101197157 3300005719 Bacteria 734
347 Ga0068851_10018818 3300005834 Bacteria 3332
348 Ga0068851_10029452 3300005834 Bacteria 2718
349 Ga0068851_10064226 3300005834 Bacteria 1886
350 Ga0068851_10124163 3300005834 Bacteria 1390
351 Ga0068851_10167403 3300005834 Bacteria 1211
352 Ga0068851_10304914 3300005834 Bacteria 916
353 Ga0068863_100021878 3300005841 Bacteria 6101
354 Ga0068863_100147312 3300005841 Bacteria 2252
355 Ga0068863_100490699 3300005841 Bacteria 1209
356 Ga0068863_101991938 3300005841 Unclassified 591
357 Ga0068858_100010948 3300005842 Bacteria 8573
358 Ga0068858_100160147 3300005842 Bacteria 2119
359 Ga0068860_100112161 3300005843 Bacteria 2607
360 Ga0068860_100179066 3300005843 Bacteria 2049
361 Ga0068862_100239079 3300005844 Bacteria 1650
362 Ga0068862_100278203 3300005844 Bacteria 1533
363 Ga0081540_1239274 3300005983 Bacteria 637
364 Ga0081539_10044982 3300005985 Bacteria 2543
365 Ga0070717_10012169 3300006028 Bacteria 6560
366 Ga0075365_10970112 3300006038 Unclassified 599
367 Ga0075364_10308798 3300006051 Bacteria 1077
368 Ga0070716_100037901 3300006173 Bacteria 2666
369 Ga0070712_100008502 3300006175 Bacteria 6456
370 Ga0075366_10579718 3300006195 Unclassified 695
371 Ga0068871_101000747 3300006358 Bacteria 778
372 Ga0068871_101201754 3300006358 Unclassified 711
373 Ga0068871_101661182 3300006358 Bacteria 605
374 Ga0075428_100233026 3300006844 Bacteria 1987
375 Ga0075434_101172486 3300006871 Unclassified 780
376 Ga0075429_100201990 3300006880 Bacteria 1741
377 Ga0068865_100015091 3300006881 Bacteria 4922
378 Ga0097620_100006121 3300006931 Bacteria 12223
379 Ga0097620_100115385 3300006931 Bacteria 2750
380 Ga0097620_100417375 3300006931 Bacteria 1438
381 Ga0097620_100855793 3300006931 Unclassified 995
382 Ga0105250_10180948 3300009092 Bacteria 885
383 Ga0105240_10080700 3300009093 Bacteria 4000
384 Ga0105240_10175999 3300009093 Bacteria 2529
385 Ga0105240_10332501 3300009093 Bacteria 1728
386 Ga0105240_10734800 3300009093 Bacteria 1074
387 Ga0105240_11431363 3300009093 Unclassified 726
388 Ga0111539_10047558 3300009094 Bacteria 5127
389 Ga0105245_10426998 3300009098 Bacteria 1329
390 Ga0105245_11885399 3300009098 Bacteria 651
391 Ga0105247_10164050 3300009101 Bacteria 1473
392 Ga0105243_10131287 3300009148 Bacteria 2125
393 Ga0105241_10068087 3300009174 Bacteria 2757
394 Ga0105241_10451700 3300009174 Bacteria 1137
395 Ga0105241_10469807 3300009174 Unclassified 1116
396 Ga0105242_10938499 3300009176 Bacteria 868
397 Ga0105248_10000059 3300009177 Bacteria 137176
398 Ga0105248_10000135 3300009177 Bacteria 85668
399 Ga0105248_10008997 3300009177 Bacteria 10980
400 Ga0105248_10009598 3300009177 Bacteria 10653
401 Ga0105248_10031716 3300009177 Bacteria 5904
402 Ga0105248_10037237 3300009177 Bacteria 5442
403 Ga0105248_10213077 3300009177 Bacteria 2176
404 Ga0105248_10249787 3300009177 Bacteria 1997
405 Ga0105248_10384713 3300009177 Unclassified 1580
406 Ga0105237_10223605 3300009545 Bacteria 1883
407 Ga0105238_10051181 3300009551 Bacteria 4154
408 Ga0105238_10097690 3300009551 Bacteria 2922
409 Ga0105238_10107690 3300009551 Bacteria 2768
410 Ga0105238_10136217 3300009551 Bacteria 2433
411 Ga0105238_10157242 3300009551 Bacteria 2248
412 Ga0105249_10562626 3300009553 Bacteria 1192
413 Ga0105249_11435245 3300009553 Bacteria 762
414 Ga0105239_10097877 3300010375 Bacteria 3243
415 Ga0105239_10690935 3300010375 Bacteria 1166
416 Ga0105239_11130490 3300010375 Bacteria 902
417 Ga0157373_10019837 3300013100 Bacteria 4891
418 Ga0157373_10020945 3300013100 Bacteria 4746
419 Ga0157373_10029482 3300013100 Bacteria 3952
420 Ga0157373_10050582 3300013100 Bacteria 2959
421 Ga0157373_10055254 3300013100 Bacteria 2820
422 Ga0157373_10132248 3300013100 Bacteria 1754
423 Ga0157373_10155508 3300013100 Bacteria 1609
424 Ga0157373_10212826 3300013100 Bacteria 1363
425 Ga0157373_10464531 3300013100 Bacteria 912
426 Ga0157373_10593943 3300013100 Bacteria 806
427 Ga0157373_11011026 3300013100 Bacteria 621
428 Ga0157371_10002432 3300013102 Bacteria 17753
429 Ga0157371_10005025 3300013102 Bacteria 11331
430 Ga0157371_10009970 3300013102 Bacteria 7435
431 Ga0157371_10010916 3300013102 Bacteria 7043
432 Ga0157371_10013162 3300013102 Bacteria 6298
433 Ga0157371_10031085 3300013102 Bacteria 3847
434 Ga0157371_10089888 3300013102 Bacteria 2175
435 Ga0157371_10139008 3300013102 Bacteria 1730
436 Ga0157371_10145535 3300013102 Bacteria 1688
437 Ga0157371_10154532 3300013102 Bacteria 1637
438 Ga0157371_10157685 3300013102 Unclassified 1620
439 Ga0157371_10288178 3300013102 Bacteria 1187
440 Ga0157371_10337483 3300013102 Bacteria 1096
441 Ga0157371_10388674 3300013102 Bacteria 1020
442 Ga0157371_10615807 3300013102 Bacteria 808
443 Ga0157371_11143247 3300013102 Bacteria 598
444 Ga0157371_11152496 3300013102 Bacteria 596
445 Ga0157370_10002392 3300013104 Bacteria 22621
446 Ga0157370_10007551 3300013104 Bacteria 11813
447 Ga0157370_10078895 3300013104 Bacteria 3100
448 Ga0157370_10083604 3300013104 Bacteria 3001
449 Ga0157370_10098221 3300013104 Bacteria 2746
450 Ga0157370_10150691 3300013104 Bacteria 2164
451 Ga0157370_10185552 3300013104 Unclassified 1931
452 Ga0157370_10218146 3300013104 Bacteria 1767
453 Ga0157370_10280534 3300013104 Unclassified 1540
454 Ga0157370_10747840 3300013104 Bacteria 891
455 Ga0157370_10871027 3300013104 Bacteria 818
456 Ga0157370_12032858 3300013104 Unclassified 515
457 Ga0157369_10000833 3300013105 Bacteria 39452
458 Ga0157369_10074758 3300013105 Bacteria 3634
459 Ga0157369_10191605 3300013105 Bacteria 2148
460 Ga0157369_10194292 3300013105 Bacteria 2132
461 Ga0157369_10210887 3300013105 Bacteria 2036
462 Ga0157369_10300279 3300013105 Bacteria 1670
463 Ga0157369_10346470 3300013105 Bacteria 1543
464 Ga0157369_10529665 3300013105 Bacteria 1218
465 Ga0157369_10739064 3300013105 Bacteria 1013
466 Ga0157369_10764383 3300013105 Bacteria 994
467 Ga0157369_10875995 3300013105 Bacteria 921
468 Ga0157369_11036560 3300013105 Bacteria 839
469 Ga0157369_11397780 3300013105 Unclassified 712
470 Ga0157374_10026529 3300013296 Bacteria 5213
471 Ga0157378_11224717 3300013297 Bacteria 790
472 Ga0157378_11690157 3300013297 Bacteria 680
473 Ga0163162_10016090 3300013306 Bacteria 7312
474 Ga0163162_10071868 3300013306 Bacteria 3514
475 Ga0163162_10664505 3300013306 Bacteria 1165
476 Ga0163162_10949994 3300013306 Bacteria 971
477 Ga0163162_11029454 3300013306 Bacteria 931
478 Ga0157372_10012882 3300013307 Bacteria 8916
479 Ga0157372_10027020 3300013307 Bacteria 6247
480 Ga0157372_10133225 3300013307 Bacteria 2861
481 Ga0157372_10144763 3300013307 Bacteria 2741
482 Ga0157372_10194713 3300013307 Bacteria 2348
483 Ga0157372_10293496 3300013307 Bacteria 1891
484 Ga0157372_10294126 3300013307 Bacteria 1888
485 Ga0157372_10667069 3300013307 Unclassified 1211
486 Ga0157372_10740936 3300013307 Bacteria 1143
487 Ga0157372_12030248 3300013307 Unclassified 661
488 Ga0157372_13130113 3300013307 Unclassified 528
489 Ga0157375_10007830 3300013308 Bacteria 9350
490 Ga0157375_13378812 3300013308 Unclassified 532
491 Ga0163163_10017733 3300014325 Bacteria 6646
492 Ga0163163_11263280 3300014325 Bacteria 801
493 Ga0157380_11378252 3300014326 Bacteria 755
494 Ga0182008_10601319 3300014497 Bacteria 617
495 Ga0157376_10920229 3300014969 Bacteria 893
496 Ga0157376_11176587 3300014969 Unclassified 794
497 Ga0163161_10216422 3300017792 Bacteria 1482
498 Ga0163161_10442043 3300017792 Bacteria 1050
499 Ga0206354_11382161 3300020081 Bacteria 2553
500 Ga0206353_11293208 3300020082 Unclassified 1302
501 Ga0213876_10008079 3300021384 Bacteria 5704
502 Ga0207697_10024711 3300025315 Bacteria 2459
503 Ga0207697_10101438 3300025315 Bacteria 1227
504 Ga0207656_10021676 3300025321 Bacteria 2569
505 Ga0207656_10028003 3300025321 Bacteria 2309
506 Ga0207656_10028914 3300025321 Bacteria 2279
507 Ga0207656_10144019 3300025321 Bacteria 1125
508 Ga0207656_10247987 3300025321 Unclassified 872
509 Ga0207656_10307789 3300025321 Bacteria 785
510 Ga0207682_10030830 3300025893 Bacteria 2149
511 Ga0207642_10274383 3300025899 Bacteria 967
512 Ga0207680_10000473 3300025903 Bacteria 19026
513 Ga0207680_10040842 3300025903 Bacteria 2703
514 Ga0207680_10155379 3300025903 Bacteria 1529
515 Ga0207680_10159193 3300025903 Bacteria 1512
516 Ga0207680_10161585 3300025903 Bacteria 1502
517 Ga0207680_10380247 3300025903 Bacteria 995
518 Ga0207647_10000870 3300025904 Bacteria 23366
519 Ga0207647_10006272 3300025904 Bacteria 8658
520 Ga0207647_10008913 3300025904 Bacteria 7155
521 Ga0207647_10009050 3300025904 Bacteria 7088
522 Ga0207647_10011427 3300025904 Bacteria 6229
523 Ga0207647_10037895 3300025904 Bacteria 3053
524 Ga0207647_10084469 3300025904 Bacteria 1900
525 Ga0207647_10112133 3300025904 Bacteria 1612
526 Ga0207647_10201975 3300025904 Bacteria 1149
527 Ga0207645_10054587 3300025907 Bacteria 2552
528 Ga0207645_10640582 3300025907 Bacteria 722
529 Ga0207645_10647872 3300025907 Bacteria 718
530 Ga0207643_10407839 3300025908 Bacteria 860
531 Ga0207705_10000062 3300025909 Bacteria 149432
532 Ga0207705_10003070 3300025909 Bacteria 12729
533 Ga0207705_10003678 3300025909 Bacteria 11665
534 Ga0207705_10005942 3300025909 Bacteria 9079
535 Ga0207705_10008818 3300025909 Bacteria 7353
536 Ga0207705_10027747 3300025909 Bacteria 4038
537 Ga0207705_10032327 3300025909 Bacteria 3738
538 Ga0207705_10039997 3300025909 Bacteria 3361
539 Ga0207705_10128814 3300025909 Bacteria 1882
540 Ga0207705_10145079 3300025909 Bacteria 1775
541 Ga0207705_10150079 3300025909 Bacteria 1746
542 Ga0207705_10164554 3300025909 Bacteria 1668
543 Ga0207705_10296576 3300025909 Bacteria 1239
544 Ga0207705_10325027 3300025909 Unclassified 1182
545 Ga0207705_10399449 3300025909 Bacteria 1063
546 Ga0207705_10895080 3300025909 Bacteria 688
547 Ga0207684_11212326 3300025910 Bacteria 624
548 Ga0207654_10930523 3300025911 Unclassified 631
549 Ga0207707_10041327 3300025912 Bacteria 4027
550 Ga0207707_10083636 3300025912 Bacteria 2787
551 Ga0207707_10217036 3300025912 Bacteria 1665
552 Ga0207707_10221904 3300025912 Bacteria 1645
553 Ga0207707_10597762 3300025912 Bacteria 934
554 Ga0207707_10930040 3300025912 Bacteria 717
555 Ga0207695_10002617 3300025913 Bacteria 26348
556 Ga0207695_10013374 3300025913 Bacteria 9794
557 Ga0207695_10425622 3300025913 Bacteria 1212
558 Ga0207695_10954229 3300025913 Unclassified 737
559 Ga0207671_10044589 3300025914 Bacteria 3280
560 Ga0207693_10030113 3300025915 Bacteria 4286
561 Ga0207660_10001300 3300025917 Bacteria 16670
562 Ga0207660_10021280 3300025917 Bacteria 4360
563 Ga0207660_10027210 3300025917 Bacteria 3899
564 Ga0207660_10185535 3300025917 Bacteria 1617
565 Ga0207660_10243174 3300025917 Unclassified 1418
566 Ga0207660_10259572 3300025917 Bacteria 1373
567 Ga0207660_10359928 3300025917 Unclassified 1167
568 Ga0207660_10935483 3300025917 Bacteria 707
569 Ga0207657_10000015 3300025919 Bacteria 175776
570 Ga0207657_10000948 3300025919 Bacteria 30737
571 Ga0207657_10001484 3300025919 Bacteria 25105
572 Ga0207657_10001896 3300025919 Bacteria 22595
573 Ga0207657_10002684 3300025919 Bacteria 19173
574 Ga0207657_10006647 3300025919 Bacteria 11966
575 Ga0207657_10009585 3300025919 Bacteria 9721
576 Ga0207657_10021767 3300025919 Bacteria 6025
577 Ga0207657_10034086 3300025919 Bacteria 4583
578 Ga0207657_10050092 3300025919 Bacteria 3636
579 Ga0207657_10053685 3300025919 Bacteria 3490
580 Ga0207657_10056008 3300025919 Bacteria 3404
581 Ga0207657_10058735 3300025919 Bacteria 3308
582 Ga0207657_10085042 3300025919 Bacteria 2650
583 Ga0207657_10093024 3300025919 Bacteria 2512
584 Ga0207657_10107289 3300025919 Bacteria 2310
585 Ga0207657_10186001 3300025919 Unclassified 1677
586 Ga0207657_10257682 3300025919 Bacteria 1389
587 Ga0207649_10002425 3300025920 Bacteria 10438
588 Ga0207649_10002611 3300025920 Bacteria 10007
589 Ga0207649_10005197 3300025920 Bacteria 7032
590 Ga0207649_10118992 3300025920 Bacteria 1778
591 Ga0207649_10150105 3300025920 Bacteria 1604
592 Ga0207649_10166809 3300025920 Bacteria 1530
593 Ga0207649_10222328 3300025920 Bacteria 1345
594 Ga0207649_10264264 3300025920 Unclassified 1245
595 Ga0207649_10299600 3300025920 Bacteria 1175
596 Ga0207649_10509106 3300025920 Bacteria 916
597 Ga0207649_10669939 3300025920 Bacteria 803
598 Ga0207649_11527567 3300025920 Bacteria 528
599 Ga0207649_11659966 3300025920 Bacteria 506
600 Ga0207652_10022628 3300025921 Bacteria 5202
601 Ga0207652_10104804 3300025921 Bacteria 2501
602 Ga0207652_10128043 3300025921 Bacteria 2263
603 Ga0207652_10215672 3300025921 Bacteria 1729
604 Ga0207652_10400353 3300025921 Bacteria 1239
605 Ga0207652_10573315 3300025921 Bacteria 1013
606 Ga0207652_10832938 3300025921 Unclassified 818
607 Ga0207652_11012095 3300025921 Bacteria 730
608 Ga0207681_10358500 3300025923 Bacteria 1169
609 Ga0207694_10010844 3300025924 Bacteria 6878
610 Ga0207694_10104439 3300025924 Bacteria 2248
611 Ga0207694_10164597 3300025924 Bacteria 1793
612 Ga0207694_10621429 3300025924 Bacteria 909
613 Ga0207694_10633932 3300025924 Bacteria 900
614 Ga0207650_10030799 3300025925 Bacteria 3869
615 Ga0207650_10057779 3300025925 Bacteria 2886
616 Ga0207650_10103608 3300025925 Bacteria 2194
617 Ga0207650_10106915 3300025925 Bacteria 2161
618 Ga0207650_10230739 3300025925 Bacteria 1493
619 Ga0207650_10320049 3300025925 Bacteria 1270
620 Ga0207650_10643529 3300025925 Unclassified 893
621 Ga0207659_10603820 3300025926 Bacteria 936
622 Ga0207659_10719941 3300025926 Bacteria 855
623 Ga0207687_10972815 3300025927 Bacteria 727
624 Ga0207700_10193481 3300025928 Bacteria 1710
625 Ga0207700_10410467 3300025928 Unclassified 1188
626 Ga0207664_10045818 3300025929 Bacteria 3430
627 Ga0207664_10055353 3300025929 Bacteria 3147
628 Ga0207664_10086558 3300025929 Bacteria 2560
629 Ga0207664_10535279 3300025929 Bacteria 1050
630 Ga0207664_10999356 3300025929 Unclassified 750
631 Ga0207644_10003340 3300025931 Bacteria 10349
632 Ga0207644_10021895 3300025931 Bacteria 4359
633 Ga0207644_10045797 3300025931 Bacteria 3113
634 Ga0207644_10113936 3300025931 Unclassified 2048
635 Ga0207644_10115709 3300025931 Bacteria 2034
636 Ga0207644_10239444 3300025931 Unclassified 1444
637 Ga0207644_11009141 3300025931 Bacteria 699
638 Ga0207690_10000032 3300025932 Bacteria 152479
639 Ga0207690_10011631 3300025932 Bacteria 5259
640 Ga0207690_10016378 3300025932 Bacteria 4507
641 Ga0207690_10044496 3300025932 Bacteria 2927
642 Ga0207690_10050753 3300025932 Bacteria 2770
643 Ga0207690_10078109 3300025932 Bacteria 2302
644 Ga0207690_10097186 3300025932 Bacteria 2095
645 Ga0207690_10170918 3300025932 Unclassified 1628
646 Ga0207690_10199216 3300025932 Bacteria 1520
647 Ga0207690_10220258 3300025932 Bacteria 1452
648 Ga0207690_10390842 3300025932 Unclassified 1107
649 Ga0207690_10409270 3300025932 Bacteria 1083
650 Ga0207690_10628753 3300025932 Unclassified 878
651 Ga0207690_11280512 3300025932 Unclassified 613
652 Ga0207706_10000032 3300025933 Bacteria 142723
653 Ga0207706_10002828 3300025933 Bacteria 16835
654 Ga0207706_10018555 3300025933 Bacteria 6259
655 Ga0207706_10058935 3300025933 Bacteria 3382
656 Ga0207706_10059581 3300025933 Bacteria 3362
657 Ga0207706_10078756 3300025933 Bacteria 2898
658 Ga0207706_10084945 3300025933 Bacteria 2783
659 Ga0207706_10100351 3300025933 Bacteria 2546
660 Ga0207706_10175648 3300025933 Bacteria 1881
661 Ga0207706_10193062 3300025933 Bacteria 1787
662 Ga0207706_10371014 3300025933 Bacteria 1243
663 Ga0207706_10392296 3300025933 Bacteria 1204
664 Ga0207706_10442703 3300025933 Bacteria 1125
665 Ga0207706_10592213 3300025933 Bacteria 953
666 Ga0207686_10045705 3300025934 Bacteria 2696
667 Ga0207669_10026439 3300025937 Bacteria 3157
668 Ga0207704_10281971 3300025938 Bacteria 1263
669 Ga0207691_10015996 3300025940 Bacteria 7125
670 Ga0207691_10018226 3300025940 Bacteria 6650
671 Ga0207691_10211714 3300025940 Bacteria 1683
672 Ga0207691_10227254 3300025940 Bacteria 1617
673 Ga0207691_10614724 3300025940 Bacteria 919
674 Ga0207711_10001624 3300025941 Bacteria 20742
675 Ga0207711_10027867 3300025941 Bacteria 4748
676 Ga0207711_10079536 3300025941 Bacteria 2862
677 Ga0207711_10156478 3300025941 Bacteria 2060
678 Ga0207711_10189258 3300025941 Bacteria 1875
679 Ga0207711_10317831 3300025941 Bacteria 1438
680 Ga0207711_11321501 3300025941 Unclassified 663
681 Ga0207689_10028007 3300025942 Bacteria 4713
682 Ga0207661_10000692 3300025944 Bacteria 21894
683 Ga0207661_10011631 3300025944 Bacteria 6385
684 Ga0207661_10044750 3300025944 Bacteria 3500
685 Ga0207661_10266972 3300025944 Bacteria 1526
686 Ga0207661_10299957 3300025944 Bacteria 1440
687 Ga0207661_10500494 3300025944 Unclassified 1110
688 Ga0207661_11170826 3300025944 Bacteria 708
689 Ga0207679_10000983 3300025945 Bacteria 18340
690 Ga0207679_10018656 3300025945 Bacteria 4652
691 Ga0207679_10021911 3300025945 Bacteria 4341
692 Ga0207679_10141710 3300025945 Bacteria 1944
693 Ga0207679_10168262 3300025945 Bacteria 1802
694 Ga0207679_10192699 3300025945 Bacteria 1696
695 Ga0207679_10322493 3300025945 Bacteria 1338
696 Ga0207679_10347202 3300025945 Bacteria 1292
697 Ga0207679_10676419 3300025945 Bacteria 935
698 Ga0207679_10722046 3300025945 Bacteria 905
699 Ga0207679_11204700 3300025945 Bacteria 695
700 Ga0207667_10009700 3300025949 Bacteria 11323
701 Ga0207667_10015221 3300025949 Bacteria 8746
702 Ga0207667_10022712 3300025949 Bacteria 6920
703 Ga0207667_10057465 3300025949 Bacteria 4084
704 Ga0207667_10127289 3300025949 Bacteria 2624
705 Ga0207667_10142459 3300025949 Bacteria 2468
706 Ga0207667_10194612 3300025949 Bacteria 2080
707 Ga0207667_10195471 3300025949 Bacteria 2075
708 Ga0207667_10353561 3300025949 Bacteria 1498
709 Ga0207667_10361713 3300025949 Unclassified 1480
710 Ga0207667_10502844 3300025949 Bacteria 1229
711 Ga0207667_10553614 3300025949 Bacteria 1163
712 Ga0207667_10687019 3300025949 Bacteria 1027
713 Ga0207667_10980960 3300025949 Bacteria 833
714 Ga0207667_11053578 3300025949 Bacteria 798
715 Ga0207651_10325973 3300025960 Bacteria 1285
716 Ga0207651_10590557 3300025960 Bacteria 970
717 Ga0207651_10891670 3300025960 Bacteria 792
718 Ga0207712_10191193 3300025961 Bacteria 1616
719 Ga0207712_10654082 3300025961 Bacteria 914
720 Ga0207668_10123197 3300025972 Bacteria 1967
721 Ga0207668_10439670 3300025972 Bacteria 1111
722 Ga0207640_10002376 3300025981 Bacteria 10074
723 Ga0207640_10007027 3300025981 Bacteria 6197
724 Ga0207640_10100058 3300025981 Bacteria 2030
725 Ga0207640_10106571 3300025981 Unclassified 1977
726 Ga0207640_10144533 3300025981 Bacteria 1739
727 Ga0207640_10164420 3300025981 Bacteria 1646
728 Ga0207640_10258194 3300025981 Bacteria 1356
729 Ga0207640_10335486 3300025981 Bacteria 1209
730 Ga0207640_10409854 3300025981 Bacteria 1106
731 Ga0207640_10510172 3300025981 Bacteria 1003
732 Ga0207640_10911678 3300025981 Bacteria 768
733 Ga0207640_11036485 3300025981 Bacteria 723
734 Ga0207640_11497388 3300025981 Bacteria 606
735 Ga0207658_10009000 3300025986 Bacteria 6774
736 Ga0207658_10066541 3300025986 Bacteria 2711
737 Ga0207658_10322326 3300025986 Unclassified 1338
738 Ga0207658_10836765 3300025986 Bacteria 836
739 Ga0207658_11258283 3300025986 Unclassified 676
740 Ga0207658_11284273 3300025986 Bacteria 669
741 Ga0207658_12091092 3300025986 Bacteria 515
742 Ga0207677_11134633 3300026023 Bacteria 714
743 Ga0207703_10007531 3300026035 Bacteria 8637
744 Ga0207703_10113269 3300026035 Bacteria 2318
745 Ga0207639_10002345 3300026041 Bacteria 12725
746 Ga0207639_10122169 3300026041 Bacteria 2141
747 Ga0207639_10128581 3300026041 Bacteria 2093
748 Ga0207639_10141131 3300026041 Bacteria 2007
749 Ga0207639_10218663 3300026041 Bacteria 1644
750 Ga0207639_10234137 3300026041 Unclassified 1593
751 Ga0207639_10345689 3300026041 Bacteria 1327
752 Ga0207639_10475174 3300026041 Bacteria 1138
753 Ga0207639_12203771 3300026041 Bacteria 512
754 Ga0207678_10000812 3300026067 Bacteria 28578
755 Ga0207678_10000938 3300026067 Bacteria 26581
756 Ga0207678_10001029 3300026067 Bacteria 25450
757 Ga0207678_10004608 3300026067 Bacteria 12388
758 Ga0207678_10016401 3300026067 Bacteria 6503
759 Ga0207678_10019488 3300026067 Bacteria 5960
760 Ga0207678_10022102 3300026067 Bacteria 5574
761 Ga0207678_10029540 3300026067 Bacteria 4785
762 Ga0207678_10039479 3300026067 Bacteria 4097
763 Ga0207678_10083905 3300026067 Bacteria 2725
764 Ga0207678_10094005 3300026067 Bacteria 2561
765 Ga0207678_10110536 3300026067 Bacteria 2345
766 Ga0207678_10111750 3300026067 Bacteria 2331
767 Ga0207678_10744084 3300026067 Bacteria 864
768 Ga0207678_10944910 3300026067 Bacteria 763
769 Ga0207708_11809186 3300026075 Bacteria 536
770 Ga0207702_10000072 3300026078 Bacteria 113840
771 Ga0207702_10012268 3300026078 Bacteria 7131
772 Ga0207702_10023316 3300026078 Bacteria 5132
773 Ga0207702_10024851 3300026078 Bacteria 4971
774 Ga0207702_10071467 3300026078 Bacteria 2988
775 Ga0207702_10074727 3300026078 Unclassified 2926
776 Ga0207702_10188850 3300026078 Bacteria 1902
777 Ga0207702_10223310 3300026078 Bacteria 1756
778 Ga0207702_10257261 3300026078 Bacteria 1642
779 Ga0207702_10272756 3300026078 Unclassified 1596
780 Ga0207702_10284623 3300026078 Bacteria 1564
781 Ga0207702_10428653 3300026078 Bacteria 1280
782 Ga0207702_10444505 3300026078 Bacteria 1257
783 Ga0207702_10500363 3300026078 Unclassified 1185
784 Ga0207702_10516669 3300026078 Bacteria 1165
785 Ga0207702_10630991 3300026078 Unclassified 1053
786 Ga0207702_10769131 3300026078 Bacteria 951
787 Ga0207702_10820413 3300026078 Bacteria 920
788 Ga0207702_11092511 3300026078 Unclassified 791
789 Ga0207702_12052382 3300026078 Unclassified 562
790 Ga0207641_10020421 3300026088 Bacteria 5440
791 Ga0207641_10237048 3300026088 Bacteria 1698
792 Ga0207641_10430910 3300026088 Bacteria 1271
793 Ga0207641_10952736 3300026088 Unclassified 854
794 Ga0207648_10035683 3300026089 Bacteria 4381
795 Ga0207648_10293627 3300026089 Bacteria 1456
796 Ga0207648_10407655 3300026089 Bacteria 1232
797 Ga0207676_10000184 3300026095 Bacteria 55154
798 Ga0207676_10007561 3300026095 Bacteria 7709
799 Ga0207676_10114491 3300026095 Bacteria 2262
800 Ga0207676_10311325 3300026095 Bacteria 1442
801 Ga0207676_10442572 3300026095 Bacteria 1223
802 Ga0207674_10001488 3300026116 Bacteria 30251
803 Ga0207674_10001704 3300026116 Bacteria 28122
804 Ga0207674_10002230 3300026116 Bacteria 24529
805 Ga0207674_10003633 3300026116 Bacteria 18804
806 Ga0207674_10251441 3300026116 Bacteria 1714
807 Ga0207674_10456796 3300026116 Unclassified 1234
808 Ga0207674_11548863 3300026116 Bacteria 632
809 Ga0207675_100749850 3300026118 Bacteria 988
810 Ga0207683_10000808 3300026121 Bacteria 28633
811 Ga0207683_10312387 3300026121 Bacteria 1439
812 Ga0207683_11387496 3300026121 Bacteria 650
813 Ga0207698_10000647 3300026142 Bacteria 20147
814 Ga0207698_10000955 3300026142 Bacteria 16786
815 Ga0207698_10001368 3300026142 Bacteria 14189
816 Ga0207698_10009371 3300026142 Bacteria 6241
817 Ga0207698_10017848 3300026142 Bacteria 4823
818 Ga0207698_10019862 3300026142 Bacteria 4611
819 Ga0207698_10048939 3300026142 Bacteria 3213
820 Ga0207698_10061580 3300026142 Bacteria 2925
821 Ga0207698_10099698 3300026142 Bacteria 2404
822 Ga0207698_10132541 3300026142 Bacteria 2132
823 Ga0207698_10134054 3300026142 Bacteria 2122
824 Ga0207698_10168661 3300026142 Bacteria 1925
825 Ga0207698_10189926 3300026142 Bacteria 1828
826 Ga0207698_10352694 3300026142 Bacteria 1390
827 Ga0207698_10421858 3300026142 Bacteria 1280
828 Ga0207698_10553600 3300026142 Bacteria 1128
829 Ga0207698_10634420 3300026142 Bacteria 1057
830 Ga0207698_10767816 3300026142 Unclassified 964
831 Ga0209974_10010108 3300027876 Bacteria 3190
832 Ga0209974_10058390 3300027876 Bacteria 1304
833 Ga0268266_10000133 3300028379 Bacteria 143210
834 Ga0268266_10149400 3300028379 Bacteria 2104
835 Ga0268266_10150780 3300028379 Bacteria 2095
836 Ga0268266_10491419 3300028379 Bacteria 1171
837 Ga0268266_10750272 3300028379 Bacteria 942
838 Ga0268266_11760537 3300028379 Unclassified 594
839 Ga0268265_10898652 3300028380 Bacteria 869
840 Ga0268265_11307066 3300028380 Bacteria 725
841 Ga0268264_10051213 3300028381 Bacteria 3440
842 Ga0268264_10201313 3300028381 Bacteria 1822
843 Ga0307517_10375262 3300028786 Bacteria 762
844 Ga0307408_101035200 3300031548 Bacteria 758
845 Ga0307408_101481411 3300031548 Bacteria 641
846 Ga0307405_10327164 3300031731 Bacteria 1173
847 Ga0307405_11074631 3300031731 Bacteria 690
848 Ga0307413_10417854 3300031824 Bacteria 1055
849 Ga0307413_11367614 3300031824 Bacteria 622
850 Ga0307410_10572428 3300031852 Bacteria 939
851 Ga0307410_11676871 3300031852 Unclassified 563
852 Ga0307406_10251734 3300031901 Bacteria 1331
853 Ga0307406_10318339 3300031901 Bacteria 1202
854 Ga0307409_100117421 3300031995 Bacteria 2245
855 Ga0307409_100409452 3300031995 Bacteria 1298
856 Ga0307409_100755212 3300031995 Bacteria 977
857 Ga0307416_100178896 3300032002 Bacteria 1985
858 Ga0307416_100538229 3300032002 Bacteria 1239
859 Ga0307416_100990647 3300032002 Bacteria 943
860 Ga0307414_10997326 3300032004 Bacteria 771
861 Ga0307411_10217298 3300032005 Bacteria 1480
862 Ga0307411_12333361 3300032005 Bacteria 503
863 Ga0307415_100032440 3300032126 Bacteria 3377
864 Ga0307415_100064658 3300032126 Bacteria 2546
865 Ga0307415_101780835 3300032126 Bacteria 595
866 Ga0307510_10099039 3300033180 Bacteria 2716
867 Ga0307510_10145191 3300033180 Bacteria 2007
868 Ga0373959_0063135 3300034820 Bacteria 824
869 Ga0373928_0262149 3300035084 Unclassified 518
870 Ga0373923_0033131 3300035111 Bacteria 2091
871 Ga0373954_0369197 3300035118 Bacteria 709
872 Ga0373961_0056451 3300035241 Unclassified 1179
873 Ga0373931_0032336 3300035691 Unclassified 2707
874 Ga0373931_1221039 3300035691 Bacteria 515
875 Ga0373925_1623030 3300037068 Unclassified 528
876 Ga0395899_0002132 3300037312 Bacteria 16264
877 Ga0395899_0004370 3300037312 Bacteria 11023
878 Ga0395899_0005372 3300037312 Bacteria 9947
879 Ga0395899_0012650 3300037312 Bacteria 6468
880 Ga0395899_0046090 3300037312 Bacteria 3247
881 Ga0395899_0059884 3300037312 Bacteria 2806
882 Ga0395899_0067158 3300037312 Bacteria 2632
883 Ga0395899_0250853 3300037312 Bacteria 1214
884 Ga0395899_0302643 3300037312 Bacteria 1081
885 Ga0395899_0332640 3300037312 Bacteria 1020
886 Ga0395899_0373181 3300037312 Bacteria 949
887 Ga0395899_0380243 3300037312 Bacteria 938
888 Ga0395899_0473750 3300037312 Bacteria 816
889 Ga0395899_0482021 3300037312 Bacteria 807
890 Ga0395899_0641870 3300037312 Bacteria 672
891 Ga0395900_0001365 3300037418 Bacteria 29397
892 Ga0395900_0002298 3300037418 Bacteria 21230
893 Ga0395900_0016483 3300037418 Bacteria 7535
894 Ga0395900_0025498 3300037418 Bacteria 6053
895 Ga0395900_0027515 3300037418 Bacteria 5825
896 Ga0395900_0039099 3300037418 Bacteria 4889
897 Ga0395900_0077019 3300037418 Bacteria 3426
898 Ga0395900_0099305 3300037418 Bacteria 2990
899 Ga0395900_0106324 3300037418 Bacteria 2882
900 Ga0395900_0120312 3300037418 Bacteria 2694
901 Ga0395900_0128109 3300037418 Bacteria 2602
902 Ga0395900_0134263 3300037418 Bacteria 2535
903 Ga0395900_0163209 3300037418 Bacteria 2271
904 Ga0395900_0186167 3300037418 Bacteria 2107
905 Ga0395900_0188818 3300037418 Bacteria 2091
906 Ga0395900_0218045 3300037418 Bacteria 1924
907 Ga0395900_0271489 3300037418 Bacteria 1690
908 Ga0395900_0296186 3300037418 Bacteria 1605
909 Ga0395900_0366421 3300037418 Bacteria 1411
910 Ga0395900_0376179 3300037418 Bacteria 1389
911 Ga0395900_0379589 3300037418 Bacteria 1381
912 Ga0395900_0423459 3300037418 Unclassified 1292
913 Ga0395900_0442343 3300037418 Bacteria 1257
914 Ga0395900_0444210 3300037418 Bacteria 1254
915 Ga0395900_0625588 3300037418 Bacteria 1015
916 Ga0395900_0703036 3300037418 Unclassified 944
917 Ga0395900_0762404 3300037418 Bacteria 897
918 Ga0395900_0818656 3300037418 Bacteria 858
919 Ga0395900_0827588 3300037418 Bacteria 852
920 Ga0395900_1150018 3300037418 Bacteria 692
921 Ga0395900_1249008 3300037418 Bacteria 657
922 Ga0395900_1273548 3300037418 Bacteria 650
923 Ga0395900_1399224 3300037418 Unclassified 612
924 Ga0395900_1673271 3300037418 Bacteria 547
925 Ga0395900_1738354 3300037418 Bacteria 534
926 Ga0395900_1738428 3300037418 Bacteria 534
927 Ga0395898_0002787 3300037466 Bacteria 20076
928 Ga0395898_0015950 3300037466 Bacteria 7698
929 Ga0395898_0041352 3300037466 Bacteria 4553
930 Ga0395898_0043092 3300037466 Bacteria 4448
931 Ga0395898_0052689 3300037466 Bacteria 3975
932 Ga0395898_0055922 3300037466 Bacteria 3848
933 Ga0395898_0065285 3300037466 Bacteria 3528
934 Ga0395898_0103523 3300037466 Bacteria 2731
935 Ga0395898_0116813 3300037466 Bacteria 2556
936 Ga0395898_0130525 3300037466 Bacteria 2407
937 Ga0395898_0134336 3300037466 Bacteria 2369
938 Ga0395898_0142516 3300037466 Bacteria 2294
939 Ga0395898_0198916 3300037466 Unclassified 1914
940 Ga0395898_0211982 3300037466 Bacteria 1847
941 Ga0395898_0214411 3300037466 Bacteria 1836
942 Ga0395898_0242718 3300037466 Bacteria 1718
943 Ga0395898_0336882 3300037466 Unclassified 1438
944 Ga0395898_0488649 3300037466 Bacteria 1171
945 Ga0395898_0539956 3300037466 Bacteria 1108
946 Ga0395898_0719532 3300037466 Bacteria 940
947 Ga0395898_0758265 3300037466 Unclassified 912
948 Ga0395898_0964847 3300037466 Bacteria 789
949 Ga0395898_1564778 3300037466 Bacteria 584
950 Ga0395905_0001405 3300037471 Bacteria 29143
951 Ga0395905_0002442 3300037471 Bacteria 20597
952 Ga0395905_0006372 3300037471 Bacteria 11894
953 Ga0395905_0007884 3300037471 Bacteria 10538
954 Ga0395905_0008353 3300037471 Bacteria 10212
955 Ga0395905_0009214 3300037471 Bacteria 9665
956 Ga0395905_0012995 3300037471 Bacteria 8002
957 Ga0395905_0017126 3300037471 Bacteria 6882
958 Ga0395905_0021213 3300037471 Bacteria 6147
959 Ga0395905_0024387 3300037471 Bacteria 5709
960 Ga0395905_0028578 3300037471 Bacteria 5256
961 Ga0395905_0029295 3300037471 Bacteria 5187
962 Ga0395905_0058292 3300037471 Bacteria 3611
963 Ga0395905_0063321 3300037471 Bacteria 3460
964 Ga0395905_0075387 3300037471 Bacteria 3161
965 Ga0395905_0098644 3300037471 Bacteria 2743
966 Ga0395905_0114262 3300037471 Bacteria 2537
967 Ga0395905_0179857 3300037471 Bacteria 1985
968 Ga0395905_0281531 3300037471 Bacteria 1549
969 Ga0395905_0339915 3300037471 Bacteria 1392
970 Ga0395905_0353530 3300037471 Bacteria 1361
971 Ga0395905_0553427 3300037471 Bacteria 1051
972 Ga0395905_0583992 3300037471 Bacteria 1019
973 Ga0395905_0587422 3300037471 Bacteria 1015
974 Ga0395905_0595114 3300037471 Bacteria 1008
975 Ga0395905_0603445 3300037471 Bacteria 999
976 Ga0395905_0661086 3300037471 Bacteria 947
977 Ga0395905_0675654 3300037471 Bacteria 935
978 Ga0395905_0678081 3300037471 Bacteria 933
979 Ga0395905_0727746 3300037471 Bacteria 894
980 Ga0395905_0780276 3300037471 Unclassified 858
981 Ga0395905_0998701 3300037471 Bacteria 740
982 Ga0395905_1004281 3300037471 Bacteria 737
983 Ga0395905_1092770 3300037471 Unclassified 701
984 Ga0395905_1273010 3300037471 Bacteria 639
985 Ga0395905_1349618 3300037471 Bacteria 617
986 Ga0395905_1764466 3300037471 Bacteria 524
987 Ga0436364_1148538 3300037853 Bacteria 1663
988 Ga0395901_0001856 3300038443 Bacteria 21854
989 Ga0395901_0005264 3300038443 Bacteria 13064
990 Ga0395901_0005690 3300038443 Bacteria 12615
991 Ga0395901_0010242 3300038443 Bacteria 9497
992 Ga0395901_0039783 3300038443 Bacteria 4866
993 Ga0395901_0050886 3300038443 Bacteria 4304
994 Ga0395901_0053375 3300038443 Bacteria 4200
995 Ga0395901_0057280 3300038443 Bacteria 4053
996 Ga0395901_0061335 3300038443 Bacteria 3912
997 Ga0395901_0076296 3300038443 Bacteria 3496
998 Ga0395901_0088492 3300038443 Bacteria 3239
999 Ga0395901_0145987 3300038443 Bacteria 2486
1000 Ga0395901_0163731 3300038443 Bacteria 2335
1001 Ga0395901_0185856 3300038443 Bacteria 2179
1002 Ga0395901_0261517 3300038443 Bacteria 1801
1003 Ga0395901_0269298 3300038443 Bacteria 1772
1004 Ga0395901_0345565 3300038443 Bacteria 1536
1005 Ga0395901_0348510 3300038443 Bacteria 1528
1006 Ga0395901_0498078 3300038443 Bacteria 1241
1007 Ga0395901_0669949 3300038443 Bacteria 1038
1008 Ga0395901_0685636 3300038443 Bacteria 1024
1009 Ga0395901_0724987 3300038443 Bacteria 989
1010 Ga0395901_0787278 3300038443 Bacteria 941
1011 Ga0395901_0870417 3300038443 Bacteria 885
1012 Ga0395901_0933710 3300038443 Bacteria 847
1013 Ga0395901_1653804 3300038443 Unclassified 592
1014 Ga0395901_1691406 3300038443 Bacteria 584
1015 Ga0395901_1694814 3300038443 Unclassified 583
1016 Ga0436365_0228661 3300039437 Bacteria 14347
1017 Ga0436363_1018584 3300039450 Bacteria 552
1018 Ga0451807_0382904 3300041486 Unclassified 746
1019 Ga0451807_2060847 3300041486 Bacteria 733
1020 Ga0451841_1048754 3300041498 Bacteria 505
1021 Ga0439445_0092782 3300042004 Bacteria 851
1022 Ga0439448_0017830 3300042005 Bacteria 2171
1023 Ga0439432_034264 3300042006 Bacteria 1631
1024 Ga0439455_0013618 3300042012 Bacteria 1845
1025 Ga0450889_003538 3300042144 Bacteria 1543
1026 Ga0439458_0010029 3300042157 Bacteria 2110
1027 Ga0466969_0001723 3300044656 Bacteria 11692
1028 Ga0466972_0046751 3300044658 Bacteria 2094
1029 Ga0466966_0008151 3300044684 Bacteria 6943
1030 Ga0466966_0015180 3300044684 Bacteria 5096
1031 Ga0466966_0068982 3300044684 Bacteria 2218
1032 Ga0466966_0078694 3300044684 Bacteria 2055
1033 Ga0466966_0122118 3300044684 Bacteria 1599
1034 Ga0466966_0171253 3300044684 Bacteria 1319
1035 Ga0466961_0037164 3300044693 Bacteria 3124
1036 Ga0466961_0038219 3300044693 Bacteria 3078
1037 Ga0466961_0090755 3300044693 Bacteria 1929
1038 Ga0466961_0174858 3300044693 Unclassified 1334
1039 Ga0466961_0282070 3300044693 Unclassified 1016
1040 Ga0466961_0360665 3300044693 Bacteria 884
1041 Ga0466963_0000077 3300044694 Bacteria 33869
1042 Ga0466963_0002279 3300044694 Bacteria 10664
1043 Ga0466963_0040632 3300044694 Bacteria 3049
1044 Ga0466963_0061720 3300044694 Bacteria 2506
1045 Ga0466963_0608714 3300044694 Unclassified 771
1046 Ga0466963_0740974 3300044694 Unclassified 693
1047 Ga0466963_1290273 3300044694 Bacteria 513
1048 Ga0466964_0029081 3300044706 Bacteria 2180
1049 Ga0466971_0000515 3300044719 Bacteria 15258
1050 Ga0466971_0050581 3300044719 Bacteria 1870
1051 Ga0466971_0102295 3300044719 Bacteria 1317
1052 Ga0466968_0346329 3300044735 Unclassified 721
1053 Ga0466970_0051025 3300044765 Bacteria 2207
1054 Ga0466957_0002641 3300044842 Bacteria 9676
1055 Ga0466957_0012397 3300044842 Bacteria 4933
1056 Ga0466957_0018848 3300044842 Bacteria 4056
1057 Ga0466957_0165201 3300044842 Bacteria 1439
1058 Ga0466957_0545597 3300044842 Bacteria 807
1059 Ga0466960_0180407 3300044901 Bacteria 1144
1060 Ga0466960_0202282 3300044901 Unclassified 1086
1061 Ga0466960_0322498 3300044901 Bacteria 875
1062 Ga0466959_0011195 3300045049 Bacteria 6434
1063 Ga0466959_0022001 3300045049 Bacteria 4709
1064 Ga0466959_0039843 3300045049 Bacteria 3473
1065 Ga0466959_0095379 3300045049 Bacteria 2133
1066 Ga0466959_0144683 3300045049 Bacteria 1678
1067 Ga0466959_0331301 3300045049 Bacteria 1039
1068 Ga0466958_0001733 3300045836 Bacteria 10545
1069 Ga0466958_0017457 3300045836 Bacteria 4148
1070 Ga0466958_0028609 3300045836 Bacteria 3305
1071 Ga0466958_0182867 3300045836 Bacteria 1330
1072 Ga0466958_1153465 3300045836 Bacteria 506
1073 Ga0466967_0000024 3300045976 Bacteria 71156
1074 Ga0466967_0032643 3300045976 Bacteria 4398
1075 Ga0466967_0047965 3300045976 Bacteria 3727
1076 Ga0466967_0066940 3300045976 Bacteria 3202
1077 Ga0466967_0075768 3300045976 Bacteria 3024
1078 Ga0466967_0088337 3300045976 Bacteria 2813
1079 Ga0466967_0097852 3300045976 Bacteria 2678
1080 Ga0466967_0212012 3300045976 Bacteria 1837
1081 Ga0466967_0328619 3300045976 Bacteria 1476
1082 Ga0466967_0389671 3300045976 Bacteria 1354
1083 Ga0466967_0531505 3300045976 Bacteria 1156
1084 Ga0495629_0665849 3300046459 Bacteria 693
1085 Ga0495583_0081784 3300046506 Bacteria 1402
1086 Ga0495583_0378622 3300046506 Bacteria 557
1087 Ga0495643_0178063 3300046522 Bacteria 1035
1088 Ga0495648_0104660 3300046524 Bacteria 1554
1089 Ga0495663_0038288 3300046525 Bacteria 1449
1090 Ga0495663_0191731 3300046525 Bacteria 711
1091 Ga0495642_0084635 3300046528 Bacteria 1338
1092 Ga0495668_0014585 3300046616 Bacteria 4602
1093 Ga0495668_0132326 3300046616 Bacteria 1365
1094 Ga0495668_0477719 3300046616 Unclassified 686
1095 Ga0495625_0190931 3300046660 Bacteria 1357
1096 Ga0495625_0374429 3300046660 Unclassified 895
1097 Ga0495669_0001938 3300046684 Bacteria 8506
1098 Ga0495669_0008002 3300046684 Bacteria 4436
1099 Ga0495669_0017008 3300046684 Bacteria 3119
1100 Ga0495669_0024855 3300046684 Bacteria 2610
1101 Ga0495669_0061422 3300046684 Bacteria 1700
1102 Ga0495669_0412087 3300046684 Unclassified 655
1103 Ga0495677_0012781 3300047445 Bacteria 3060
1104 Ga0495677_0101894 3300047445 Bacteria 1087
1105 Ga0495677_0112009 3300047445 Bacteria 1038
1106 Ga0495677_0130739 3300047445 Unclassified 961
1107 Ga0495677_0303756 3300047445 Bacteria 628
1108 Ga0495686_0369569 3300047472 Bacteria 776
1109 Ga0496100_0016396 3300048903 Bacteria 4351
1110 Ga0496100_0093097 3300048903 Bacteria 2061
1111 Ga0496101_0061368 3300048904 Bacteria 2730
1112 Ga0496101_0195983 3300048904 Unclassified 1560
1113 Ga0496101_0701789 3300048904 Unclassified 799
1114 Ga0496101_0783348 3300048904 Unclassified 752
1115 Ga0496105_0770918 3300048908 Bacteria 733
1116 Ga0496106_0011126 3300048909 Bacteria 6655
1117 Ga0496106_0297977 3300048909 Bacteria 1293
1118 Ga0496107_0000486 3300048910 Bacteria 21842
1119 Ga0496107_0031786 3300048910 Bacteria 3769
1120 Ga0496107_0259413 3300048910 Unclassified 1293
1121 Ga0496108_0027908 3300048911 Bacteria 4667
1122 Ga0496108_0085092 3300048911 Bacteria 2684
1123 Ga0496109_0001936 3300048912 Bacteria 17209
1124 Ga0496109_0019198 3300048912 Bacteria 6021
1125 Ga0496109_0123749 3300048912 Bacteria 2411
1126 Ga0496109_0506227 3300048912 Bacteria 1140
1127 Ga0496110_0002358 3300048913 Bacteria 14142
1128 Ga0496110_0178827 3300048913 Bacteria 1926
1129 Ga0496110_0427508 3300048913 Unclassified 1207
1130 Ga0496110_0464749 3300048913 Unclassified 1153
1131 Ga0496111_0000826 3300048914 Bacteria 16670
1132 Ga0496111_0282910 3300048914 Unclassified 1230
1133 Ga0496111_0407524 3300048914 Bacteria 1004
1134 Ga0496111_0893124 3300048914 Bacteria 640
1135 Ga0496112_0000424 3300048915 Bacteria 27867
1136 Ga0496112_0002624 3300048915 Bacteria 14527
1137 Ga0496112_0026625 3300048915 Bacteria 5569
1138 Ga0496112_0173381 3300048915 Bacteria 2122
1139 Ga0496112_0244091 3300048915 Bacteria 1748
1140 Ga0496112_1511946 3300048915 Bacteria 585
1141 Ga0496113_0009432 3300048916 Bacteria 6403
1142 Ga0496113_0011808 3300048916 Bacteria 5850
1143 Ga0496113_0064005 3300048916 Bacteria 2780
1144 Ga0496121_0006369 3300048924 Bacteria 14698
1145 Ga0501068_0235869 3300049584 Bacteria 1164
1146 Ga0501070_0095776 3300049586 Bacteria 2456
1147 Ga0501074_0004661 3300049590 Bacteria 9819
1148 Ga0501080_0080833 3300049742 Bacteria 3020
1149 Ga0501035_0380612 3300049822 Bacteria 1177
1150 nmdc:mga03683_141781_c1 3300050489 Bacteria 1081
1151 nmdc:mga00v17_117133_c1 3300050491 Bacteria 1694
1152 nmdc:mga07m45_696760_c1 3300050496 Bacteria 584
1153 nmdc:mga09592_460145_c1 3300050508 Bacteria 1097
1154 nmdc:mga08y16_109930_c1 3300050511 Bacteria 2870
1155 nmdc:mga08y16_1474291_c1 3300050511 Unclassified 641
1156 nmdc:mga0n895_83041_c1 3300050512 Bacteria 3194
1157 Ga0495619_0617800 3300053085 Bacteria 741
1158 Ga0500643_018685 3300053087 Bacteria 2295
1159 Ga0500556_0016263 3300053104 Bacteria 2311
1160 Ga0500645_001039 3300053730 Bacteria 15509
1161 Ga0500645_009051 3300053730 Bacteria 3363
1162 Ga0501084_1113219 3300054114 Bacteria 663
1163 Ga0466962_0018309 3300061719 Bacteria 3369
1164 Ga0466962_0047614 3300061719 Bacteria 2048
1165 Ga0466962_0211945 3300061719 Bacteria 948
1166 Ga0466962_0447559 3300061719 Bacteria 650

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0122118 Ga0466966_0122118_398_706 100
2 3300006175 Ga0070712_100008502 Ga0070712_1000085025 116
3 3300014326 Ga0157380_11378252 Ga0157380_113782521 116
4 3300025915 Ga0207693_10030113 Ga0207693_100301134 116
5 3300037853 Ga0436364_1148538 Ga0436364_1148538_169_534 116
6 3300049822 Ga0501035_0380612 Ga0501035_0380612_19_390 116
7 iso_pu_bacteria 8057101203 8057103490 116
8 3300005327 Ga0070658_11510341 Ga0070658_115103412 117
9 3300005331 Ga0070670_100182359 Ga0070670_1001823593 117
10 3300005339 Ga0070660_100080646 Ga0070660_1000806463 117
11 3300005345 Ga0070692_10000903 Ga0070692_100009038 117
12 3300005366 Ga0070659_100388746 Ga0070659_1003887462 117
13 3300005455 Ga0070663_100122390 Ga0070663_1001223903 117
14 3300005539 Ga0068853_101926089 Ga0068853_1019260891 117
15 3300005547 Ga0070693_100969759 Ga0070693_1009697592 117
16 3300005563 Ga0068855_100239808 Ga0068855_1002398082 117
17 3300005844 Ga0068862_100278203 Ga0068862_1002782032 117
18 3300005983 Ga0081540_1239274 Ga0081540_12392742 117
19 3300006038 Ga0075365_10970112 Ga0075365_109701122 117
20 3300006051 Ga0075364_10308798 Ga0075364_103087982 117
21 3300006195 Ga0075366_10579718 Ga0075366_105797182 117
22 3300013104 Ga0157370_10150691 Ga0157370_101506913 117
23 3300025904 Ga0207647_10201975 Ga0207647_102019752 117
24 3300025907 Ga0207645_10647872 Ga0207645_106478721 117
25 3300025909 Ga0207705_10008818 Ga0207705_100088188 117
26 3300025919 Ga0207657_10050092 Ga0207657_100500923 117
27 3300025921 Ga0207652_10832938 Ga0207652_108329382 117
28 3300025925 Ga0207650_10230739 Ga0207650_102307392 117
29 3300025932 Ga0207690_10199216 Ga0207690_101992162 117
30 3300025949 Ga0207667_10194612 Ga0207667_101946123 117
31 3300026067 Ga0207678_10110536 Ga0207678_101105363 117
32 3300026078 Ga0207702_12052382 Ga0207702_120523822 117
33 3300031824 Ga0307413_11367614 Ga0307413_113676142 117
34 3300031852 Ga0307410_11676871 Ga0307410_116768712 117
35 3300041486 Ga0451807_2060847 Ga0451807_2060847_226_624 117
36 3300044901 Ga0466960_0322498 Ga0466960_0322498_192_551 117
37 3300050489 nmdc:mga03683_141781_c1 nmdc:mga03683_141781_c1_317_670 117
38 3300050491 nmdc:mga00v17_117133_c1 nmdc:mga00v17_117133_c1_1071_1424 117
39 3300050511 nmdc:mga08y16_1474291_c1 nmdc:mga08y16_1474291_c1_139_492 117
40 3300001904 JGI24736J21556_1000133 JGI24736J21556_10001337 118
41 3300001904 JGI24736J21556_1013433 JGI24736J21556_10134332 118
42 3300001976 JGI24752J21851_1019379 JGI24752J21851_10193791 118
43 3300001979 JGI24740J21852_10016744 JGI24740J21852_100167443 118
44 3300001979 JGI24740J21852_10032844 JGI24740J21852_100328443 118
45 3300001979 JGI24740J21852_10074524 JGI24740J21852_100745242 118
46 3300001979 JGI24740J21852_10092955 JGI24740J21852_100929552 118
47 3300001989 JGI24739J22299_10004359 JGI24739J22299_100043596 118
48 3300001989 JGI24739J22299_10053170 JGI24739J22299_100531702 118
49 3300001989 JGI24739J22299_10263090 JGI24739J22299_102630901 118
50 3300001990 JGI24737J22298_10000994 JGI24737J22298_1000099410 118
51 3300001990 JGI24737J22298_10025322 JGI24737J22298_100253223 118
52 3300001990 JGI24737J22298_10035485 JGI24737J22298_100354852 118
53 3300001990 JGI24737J22298_10172687 JGI24737J22298_101726872 118
54 3300002067 JGI24735J21928_10023708 JGI24735J21928_100237083 118
55 3300002067 JGI24735J21928_10051821 JGI24735J21928_100518211 118
56 3300002067 JGI24735J21928_10248330 JGI24735J21928_102483301 118
57 3300002075 JGI24738J21930_10003890 JGI24738J21930_100038904 118
58 3300002075 JGI24738J21930_10007357 JGI24738J21930_100073573 118
59 3300003203 JGI25406J46586_10199109 JGI25406J46586_101991091 118
60 3300005290 Ga0065712_10117477 Ga0065712_101174772 118
61 3300005293 Ga0065715_10867510 Ga0065715_108675102 118
62 3300005327 Ga0070658_10000409 Ga0070658_1000040935 118
63 3300005327 Ga0070658_10015117 Ga0070658_100151175 118
64 3300005327 Ga0070658_10043637 Ga0070658_100436375 118
65 3300005327 Ga0070658_10139786 Ga0070658_101397862 118
66 3300005327 Ga0070658_10142529 Ga0070658_101425293 118
67 3300005327 Ga0070658_10154754 Ga0070658_101547542 118
68 3300005327 Ga0070658_10184171 Ga0070658_101841713 118
69 3300005327 Ga0070658_10245167 Ga0070658_102451671 118
70 3300005327 Ga0070658_10320033 Ga0070658_103200333 118
71 3300005327 Ga0070658_10439344 Ga0070658_104393443 118
72 3300005327 Ga0070658_10486256 Ga0070658_104862562 118
73 3300005327 Ga0070658_10496905 Ga0070658_104969052 118
74 3300005327 Ga0070658_10615502 Ga0070658_106155022 118
75 3300005327 Ga0070658_11070325 Ga0070658_110703252 118
76 3300005327 Ga0070658_11138018 Ga0070658_111380181 118
77 3300005328 Ga0070676_10296836 Ga0070676_102968362 118
78 3300005328 Ga0070676_10324847 Ga0070676_103248473 118
79 3300005328 Ga0070676_10660533 Ga0070676_106605332 118
80 3300005328 Ga0070676_11130354 Ga0070676_111303541 118
81 3300005329 Ga0070683_100000706 Ga0070683_1000007066 118
82 3300005329 Ga0070683_100009797 Ga0070683_1000097978 118
83 3300005329 Ga0070683_100011024 Ga0070683_1000110243 118
84 3300005329 Ga0070683_100035063 Ga0070683_1000350634 118
85 3300005329 Ga0070683_100457734 Ga0070683_1004577342 118
86 3300005329 Ga0070683_100530136 Ga0070683_1005301361 118
87 3300005330 Ga0070690_100369885 Ga0070690_1003698852 118
88 3300005330 Ga0070690_100492227 Ga0070690_1004922271 118
89 3300005330 Ga0070690_101179238 Ga0070690_1011792381 118
90 3300005331 Ga0070670_100025540 Ga0070670_1000255404 118
91 3300005331 Ga0070670_100078396 Ga0070670_1000783961 118
92 3300005331 Ga0070670_100120233 Ga0070670_1001202332 118
93 3300005331 Ga0070670_100154479 Ga0070670_1001544792 118
94 3300005331 Ga0070670_100793065 Ga0070670_1007930652 118
95 3300005333 Ga0070677_10120555 Ga0070677_101205552 118
96 3300005333 Ga0070677_10655550 Ga0070677_106555501 118
97 3300005335 Ga0070666_10001236 Ga0070666_1000123614 118
98 3300005335 Ga0070666_10011770 Ga0070666_100117703 118
99 3300005335 Ga0070666_10076404 Ga0070666_100764045 118
100 3300005335 Ga0070666_10114242 Ga0070666_101142422 118
101 3300005335 Ga0070666_10183045 Ga0070666_101830452 118
102 3300005335 Ga0070666_10242177 Ga0070666_102421773 118
103 3300005335 Ga0070666_10973626 Ga0070666_109736262 118
104 3300005336 Ga0070680_100000834 Ga0070680_10000083412 118
105 3300005336 Ga0070680_100004339 Ga0070680_10000433910 118
106 3300005336 Ga0070680_100013072 Ga0070680_1000130725 118
107 3300005336 Ga0070680_100022301 Ga0070680_1000223014 118
108 3300005336 Ga0070680_100023324 Ga0070680_1000233245 118
109 3300005336 Ga0070680_100131475 Ga0070680_1001314752 118
110 3300005336 Ga0070680_100207836 Ga0070680_1002078362 118
111 3300005336 Ga0070680_100226370 Ga0070680_1002263702 118
112 3300005336 Ga0070680_100351325 Ga0070680_1003513252 118
113 3300005336 Ga0070680_100433144 Ga0070680_1004331442 118
114 3300005336 Ga0070680_100694162 Ga0070680_1006941622 118
115 3300005336 Ga0070680_101204127 Ga0070680_1012041272 118
116 3300005337 Ga0070682_100018071 Ga0070682_1000180713 118
117 3300005337 Ga0070682_101545228 Ga0070682_1015452282 118
118 3300005337 Ga0070682_101628849 Ga0070682_1016288491 118
119 3300005339 Ga0070660_100000055 Ga0070660_10000005541 118
120 3300005339 Ga0070660_100015476 Ga0070660_1000154763 118
121 3300005339 Ga0070660_100023295 Ga0070660_1000232954 118
122 3300005339 Ga0070660_100032087 Ga0070660_1000320872 118
123 3300005339 Ga0070660_100053551 Ga0070660_1000535514 118
124 3300005339 Ga0070660_100053691 Ga0070660_1000536913 118
125 3300005339 Ga0070660_100226815 Ga0070660_1002268151 118
126 3300005339 Ga0070660_100262075 Ga0070660_1002620753 118
127 3300005339 Ga0070660_100306173 Ga0070660_1003061732 118
128 3300005339 Ga0070660_100345120 Ga0070660_1003451202 118
129 3300005339 Ga0070660_100806936 Ga0070660_1008069361 118
130 3300005339 Ga0070660_100919259 Ga0070660_1009192592 118
131 3300005339 Ga0070660_101145731 Ga0070660_1011457311 118
132 3300005339 Ga0070660_101384605 Ga0070660_1013846052 118
133 3300005341 Ga0070691_10001109 Ga0070691_100011097 118
134 3300005344 Ga0070661_100000340 Ga0070661_10000034035 118
135 3300005344 Ga0070661_100011683 Ga0070661_1000116835 118
136 3300005344 Ga0070661_100020693 Ga0070661_1000206931 118
137 3300005344 Ga0070661_100036721 Ga0070661_1000367213 118
138 3300005344 Ga0070661_100079728 Ga0070661_1000797283 118
139 3300005344 Ga0070661_100083744 Ga0070661_1000837443 118
140 3300005344 Ga0070661_100107424 Ga0070661_1001074243 118
141 3300005344 Ga0070661_100197618 Ga0070661_1001976182 118
142 3300005344 Ga0070661_100275649 Ga0070661_1002756493 118
143 3300005344 Ga0070661_100369286 Ga0070661_1003692861 118
144 3300005344 Ga0070661_100686191 Ga0070661_1006861912 118
145 3300005345 Ga0070692_10028373 Ga0070692_100283733 118
146 3300005345 Ga0070692_10041185 Ga0070692_100411853 118
147 3300005345 Ga0070692_10302327 Ga0070692_103023272 118
148 3300005345 Ga0070692_10358364 Ga0070692_103583642 118
149 3300005345 Ga0070692_10627274 Ga0070692_106272742 118
150 3300005347 Ga0070668_100035677 Ga0070668_1000356773 118
151 3300005347 Ga0070668_102079851 Ga0070668_1020798511 118
152 3300005353 Ga0070669_100865493 Ga0070669_1008654932 118
153 3300005354 Ga0070675_100932613 Ga0070675_1009326132 118
154 3300005354 Ga0070675_101735486 Ga0070675_1017354861 118
155 3300005355 Ga0070671_100001642 Ga0070671_1000016428 118
156 3300005355 Ga0070671_100049934 Ga0070671_1000499343 118
157 3300005355 Ga0070671_100051715 Ga0070671_1000517152 118
158 3300005355 Ga0070671_100064346 Ga0070671_1000643464 118
159 3300005355 Ga0070671_100066505 Ga0070671_1000665052 118
160 3300005355 Ga0070671_100095727 Ga0070671_1000957273 118
161 3300005355 Ga0070671_100101612 Ga0070671_1001016123 118
162 3300005356 Ga0070674_100281497 Ga0070674_1002814973 118
163 3300005356 Ga0070674_100953965 Ga0070674_1009539652 118
164 3300005356 Ga0070674_101423821 Ga0070674_1014238212 118
165 3300005364 Ga0070673_100038841 Ga0070673_1000388414 118
166 3300005364 Ga0070673_100049443 Ga0070673_1000494433 118
167 3300005364 Ga0070673_100326284 Ga0070673_1003262842 118
168 3300005364 Ga0070673_100443209 Ga0070673_1004432093 118
169 3300005364 Ga0070673_101644089 Ga0070673_1016440892 118
170 3300005364 Ga0070673_101680701 Ga0070673_1016807012 118
171 3300005366 Ga0070659_100000139 Ga0070659_10000013949 118
172 3300005366 Ga0070659_100003111 Ga0070659_1000031113 118
173 3300005366 Ga0070659_100006731 Ga0070659_1000067311 118
174 3300005366 Ga0070659_100064423 Ga0070659_1000644233 118
175 3300005366 Ga0070659_100096744 Ga0070659_1000967443 118
176 3300005366 Ga0070659_100103047 Ga0070659_1001030473 118
177 3300005366 Ga0070659_100335829 Ga0070659_1003358292 118
178 3300005366 Ga0070659_100401218 Ga0070659_1004012183 118
179 3300005366 Ga0070659_100539128 Ga0070659_1005391282 118
180 3300005366 Ga0070659_100576034 Ga0070659_1005760341 118
181 3300005366 Ga0070659_100717511 Ga0070659_1007175112 118
182 3300005366 Ga0070659_101052025 Ga0070659_1010520252 118
183 3300005366 Ga0070659_101393421 Ga0070659_1013934212 118
184 3300005367 Ga0070667_100006525 Ga0070667_1000065258 118
185 3300005367 Ga0070667_100006814 Ga0070667_1000068149 118
186 3300005367 Ga0070667_100312732 Ga0070667_1003127323 118
187 3300005367 Ga0070667_100401050 Ga0070667_1004010502 118
188 3300005367 Ga0070667_100420517 Ga0070667_1004205172 118
189 3300005367 Ga0070667_100487230 Ga0070667_1004872302 118
190 3300005367 Ga0070667_101107059 Ga0070667_1011070591 118
191 3300005434 Ga0070709_11613259 Ga0070709_116132591 118
192 3300005435 Ga0070714_100030925 Ga0070714_1000309253 118
193 3300005435 Ga0070714_100069338 Ga0070714_1000693384 118
194 3300005435 Ga0070714_100582057 Ga0070714_1005820572 118
195 3300005435 Ga0070714_100835157 Ga0070714_1008351572 118
196 3300005435 Ga0070714_101246763 Ga0070714_1012467632 118
197 3300005435 Ga0070714_101511514 Ga0070714_1015115141 118
198 3300005435 Ga0070714_101607540 Ga0070714_1016075402 118
199 3300005436 Ga0070713_100709994 Ga0070713_1007099942 118
200 3300005436 Ga0070713_100947927 Ga0070713_1009479272 118
201 3300005444 Ga0070694_100208093 Ga0070694_1002080932 118
202 3300005455 Ga0070663_100000504 Ga0070663_1000005048 118
203 3300005455 Ga0070663_100005567 Ga0070663_1000055672 118
204 3300005455 Ga0070663_100008686 Ga0070663_1000086862 118
205 3300005455 Ga0070663_100020037 Ga0070663_1000200372 118
206 3300005455 Ga0070663_100024583 Ga0070663_1000245832 118
207 3300005455 Ga0070663_100059281 Ga0070663_1000592811 118
208 3300005455 Ga0070663_100071647 Ga0070663_1000716474 118
209 3300005455 Ga0070663_100106605 Ga0070663_1001066053 118
210 3300005455 Ga0070663_100150976 Ga0070663_1001509762 118
211 3300005455 Ga0070663_100177979 Ga0070663_1001779793 118
212 3300005455 Ga0070663_100209555 Ga0070663_1002095553 118
213 3300005455 Ga0070663_100247134 Ga0070663_1002471342 118
214 3300005455 Ga0070663_100372152 Ga0070663_1003721522 118
215 3300005455 Ga0070663_101008149 Ga0070663_1010081491 118
216 3300005455 Ga0070663_101102647 Ga0070663_1011026471 118
217 3300005455 Ga0070663_101406544 Ga0070663_1014065441 118
218 3300005456 Ga0070678_100003609 Ga0070678_1000036093 118
219 3300005456 Ga0070678_100142439 Ga0070678_1001424392 118
220 3300005457 Ga0070662_100000024 Ga0070662_1000000248 118
221 3300005457 Ga0070662_100001327 Ga0070662_10000132715 118
222 3300005457 Ga0070662_100020005 Ga0070662_1000200053 118
223 3300005457 Ga0070662_100041502 Ga0070662_1000415023 118
224 3300005457 Ga0070662_100075916 Ga0070662_1000759165 118
225 3300005457 Ga0070662_100115202 Ga0070662_1001152023 118
226 3300005457 Ga0070662_100149538 Ga0070662_1001495382 118
227 3300005457 Ga0070662_100215593 Ga0070662_1002155932 118
228 3300005457 Ga0070662_100300261 Ga0070662_1003002612 118
229 3300005457 Ga0070662_100590345 Ga0070662_1005903452 118
230 3300005457 Ga0070662_101529126 Ga0070662_1015291261 118
231 3300005458 Ga0070681_10022750 Ga0070681_100227507 118
232 3300005458 Ga0070681_10069329 Ga0070681_100693293 118
233 3300005458 Ga0070681_10088375 Ga0070681_100883752 118
234 3300005458 Ga0070681_10137376 Ga0070681_101373763 118
235 3300005458 Ga0070681_10199601 Ga0070681_101996013 118
236 3300005458 Ga0070681_11015098 Ga0070681_110150981 118
237 3300005458 Ga0070681_11485136 Ga0070681_114851361 118
238 3300005458 Ga0070681_11619572 Ga0070681_116195721 118
239 3300005459 Ga0068867_100430889 Ga0068867_1004308891 118
240 3300005459 Ga0068867_100973892 Ga0068867_1009738921 118
241 3300005459 Ga0068867_101351133 Ga0068867_1013511332 118
242 3300005467 Ga0070706_100334191 Ga0070706_1003341913 118
243 3300005530 Ga0070679_100101762 Ga0070679_1001017622 118
244 3300005530 Ga0070679_100136061 Ga0070679_1001360612 118
245 3300005530 Ga0070679_100152629 Ga0070679_1001526291 118
246 3300005530 Ga0070679_100224097 Ga0070679_1002240972 118
247 3300005530 Ga0070679_100242072 Ga0070679_1002420722 118
248 3300005530 Ga0070679_100308564 Ga0070679_1003085643 118
249 3300005530 Ga0070679_100382718 Ga0070679_1003827182 118
250 3300005530 Ga0070679_100603946 Ga0070679_1006039461 118
251 3300005530 Ga0070679_100850720 Ga0070679_1008507202 118
252 3300005530 Ga0070679_101210034 Ga0070679_1012100341 118
253 3300005535 Ga0070684_100005570 Ga0070684_1000055706 118
254 3300005535 Ga0070684_100069704 Ga0070684_1000697041 118
255 3300005535 Ga0070684_100125680 Ga0070684_1001256802 118
256 3300005535 Ga0070684_100220835 Ga0070684_1002208353 118
257 3300005535 Ga0070684_100263179 Ga0070684_1002631793 118
258 3300005535 Ga0070684_100450191 Ga0070684_1004501912 118
259 3300005535 Ga0070684_100692312 Ga0070684_1006923122 118
260 3300005539 Ga0068853_100001074 Ga0068853_1000010747 118
261 3300005539 Ga0068853_100026812 Ga0068853_1000268127 118
262 3300005539 Ga0068853_100066591 Ga0068853_1000665914 118
263 3300005539 Ga0068853_100086427 Ga0068853_1000864273 118
264 3300005539 Ga0068853_100105437 Ga0068853_1001054373 118
265 3300005539 Ga0068853_100111338 Ga0068853_1001113383 118
266 3300005539 Ga0068853_100446799 Ga0068853_1004467993 118
267 3300005539 Ga0068853_100567290 Ga0068853_1005672902 118
268 3300005539 Ga0068853_101139635 Ga0068853_1011396352 118
269 3300005539 Ga0068853_101301551 Ga0068853_1013015512 118
270 3300005539 Ga0068853_101579712 Ga0068853_1015797121 118
271 3300005539 Ga0068853_102196767 Ga0068853_1021967671 118
272 3300005543 Ga0070672_100048912 Ga0070672_1000489123 118
273 3300005543 Ga0070672_100134516 Ga0070672_1001345163 118
274 3300005543 Ga0070672_100245468 Ga0070672_1002454682 118
275 3300005543 Ga0070672_100324998 Ga0070672_1003249982 118
276 3300005543 Ga0070672_100758404 Ga0070672_1007584041 118
277 3300005544 Ga0070686_100624154 Ga0070686_1006241542 118
278 3300005544 Ga0070686_101239642 Ga0070686_1012396422 118
279 3300005546 Ga0070696_100092516 Ga0070696_1000925162 118
280 3300005547 Ga0070693_100001110 Ga0070693_1000011108 118
281 3300005547 Ga0070693_100141031 Ga0070693_1001410312 118
282 3300005547 Ga0070693_100413060 Ga0070693_1004130602 118
283 3300005547 Ga0070693_101261096 Ga0070693_1012610961 118
284 3300005548 Ga0070665_100000705 Ga0070665_10000070537 118
285 3300005548 Ga0070665_100007630 Ga0070665_10000763010 118
286 3300005548 Ga0070665_100021397 Ga0070665_1000213973 118
287 3300005548 Ga0070665_100081856 Ga0070665_1000818564 118
288 3300005548 Ga0070665_100082970 Ga0070665_1000829703 118
289 3300005548 Ga0070665_100118761 Ga0070665_1001187612 118
290 3300005548 Ga0070665_100807569 Ga0070665_1008075692 118
291 3300005548 Ga0070665_100900461 Ga0070665_1009004612 118
292 3300005563 Ga0068855_100001003 Ga0068855_10000100313 118
293 3300005563 Ga0068855_100022702 Ga0068855_1000227023 118
294 3300005563 Ga0068855_100274141 Ga0068855_1002741413 118
295 3300005563 Ga0068855_100420743 Ga0068855_1004207432 118
296 3300005563 Ga0068855_100448893 Ga0068855_1004488932 118
297 3300005563 Ga0068855_100545849 Ga0068855_1005458492 118
298 3300005563 Ga0068855_100782195 Ga0068855_1007821952 118
299 3300005563 Ga0068855_100894292 Ga0068855_1008942922 118
300 3300005563 Ga0068855_101371453 Ga0068855_1013714532 118
301 3300005563 Ga0068855_101636665 Ga0068855_1016366652 118
302 3300005563 Ga0068855_102452883 Ga0068855_1024528832 118
303 3300005564 Ga0070664_100000082 Ga0070664_10000008247 118
304 3300005564 Ga0070664_100010862 Ga0070664_1000108627 118
305 3300005564 Ga0070664_100018669 Ga0070664_1000186696 118
306 3300005564 Ga0070664_100042636 Ga0070664_1000426364 118
307 3300005564 Ga0070664_100044025 Ga0070664_1000440254 118
308 3300005564 Ga0070664_100056697 Ga0070664_1000566971 118
309 3300005564 Ga0070664_100275835 Ga0070664_1002758353 118
310 3300005564 Ga0070664_100283038 Ga0070664_1002830383 118
311 3300005564 Ga0070664_100383643 Ga0070664_1003836432 118
312 3300005564 Ga0070664_100432081 Ga0070664_1004320812 118
313 3300005564 Ga0070664_100517976 Ga0070664_1005179763 118
314 3300005564 Ga0070664_100738881 Ga0070664_1007388812 118
315 3300005577 Ga0068857_100009522 Ga0068857_1000095223 118
316 3300005577 Ga0068857_100024467 Ga0068857_1000244676 118
317 3300005577 Ga0068857_100051464 Ga0068857_1000514644 118
318 3300005577 Ga0068857_100152613 Ga0068857_1001526133 118
319 3300005577 Ga0068857_100369006 Ga0068857_1003690063 118
320 3300005577 Ga0068857_100408536 Ga0068857_1004085362 118
321 3300005577 Ga0068857_101446929 Ga0068857_1014469292 118
322 3300005577 Ga0068857_101916253 Ga0068857_1019162531 118
323 3300005578 Ga0068854_100001469 Ga0068854_1000014698 118
324 3300005578 Ga0068854_100014514 Ga0068854_1000145143 118
325 3300005578 Ga0068854_100018885 Ga0068854_1000188856 118
326 3300005578 Ga0068854_100025827 Ga0068854_1000258273 118
327 3300005578 Ga0068854_100040772 Ga0068854_1000407723 118
328 3300005578 Ga0068854_100104612 Ga0068854_1001046123 118
329 3300005578 Ga0068854_100342165 Ga0068854_1003421653 118
330 3300005578 Ga0068854_100541812 Ga0068854_1005418122 118
331 3300005578 Ga0068854_100607156 Ga0068854_1006071562 118
332 3300005578 Ga0068854_100645056 Ga0068854_1006450562 118
333 3300005614 Ga0068856_100000085 Ga0068856_10000008559 118
334 3300005614 Ga0068856_100047272 Ga0068856_1000472725 118
335 3300005614 Ga0068856_100078034 Ga0068856_1000780342 118
336 3300005614 Ga0068856_100108049 Ga0068856_1001080492 118
337 3300005614 Ga0068856_100309057 Ga0068856_1003090573 118
338 3300005614 Ga0068856_100344597 Ga0068856_1003445971 118
339 3300005614 Ga0068856_100446186 Ga0068856_1004461862 118
340 3300005614 Ga0068856_100446611 Ga0068856_1004466112 118
341 3300005614 Ga0068856_100673052 Ga0068856_1006730522 118
342 3300005614 Ga0068856_100678303 Ga0068856_1006783033 118
343 3300005614 Ga0068856_101098123 Ga0068856_1010981232 118
344 3300005614 Ga0068856_101137412 Ga0068856_1011374122 118
345 3300005614 Ga0068856_101301723 Ga0068856_1013017232 118
346 3300005614 Ga0068856_101724533 Ga0068856_1017245331 118
347 3300005614 Ga0068856_101792224 Ga0068856_1017922241 118
348 3300005614 Ga0068856_101859053 Ga0068856_1018590532 118
349 3300005614 Ga0068856_101863151 Ga0068856_1018631512 118
350 3300005616 Ga0068852_100001258 Ga0068852_10000125815 118
351 3300005616 Ga0068852_100003532 Ga0068852_1000035327 118
352 3300005616 Ga0068852_100033446 Ga0068852_1000334464 118
353 3300005616 Ga0068852_100091277 Ga0068852_1000912775 118
354 3300005616 Ga0068852_100130546 Ga0068852_1001305464 118
355 3300005616 Ga0068852_100182698 Ga0068852_1001826982 118
356 3300005616 Ga0068852_100236326 Ga0068852_1002363262 118
357 3300005616 Ga0068852_100256822 Ga0068852_1002568221 118
358 3300005616 Ga0068852_100339666 Ga0068852_1003396662 118
359 3300005616 Ga0068852_100476219 Ga0068852_1004762193 118
360 3300005616 Ga0068852_100491772 Ga0068852_1004917722 118
361 3300005616 Ga0068852_100703201 Ga0068852_1007032012 118
362 3300005616 Ga0068852_100713264 Ga0068852_1007132641 118
363 3300005616 Ga0068852_101684787 Ga0068852_1016847872 118
364 3300005616 Ga0068852_101720795 Ga0068852_1017207952 118
365 3300005616 Ga0068852_101818310 Ga0068852_1018183101 118
366 3300005617 Ga0068859_100006121 Ga0068859_10000612112 118
367 3300005617 Ga0068859_100417348 Ga0068859_1004173483 118
368 3300005617 Ga0068859_100855665 Ga0068859_1008556652 118
369 3300005618 Ga0068864_100000188 Ga0068864_1000001889 118
370 3300005618 Ga0068864_100000805 Ga0068864_10000080515 118
371 3300005618 Ga0068864_100007304 Ga0068864_1000073048 118
372 3300005618 Ga0068864_100010384 Ga0068864_1000103848 118
373 3300005618 Ga0068864_101777178 Ga0068864_1017771782 118
374 3300005718 Ga0068866_10120753 Ga0068866_101207532 118
375 3300005719 Ga0068861_100583962 Ga0068861_1005839622 118
376 3300005719 Ga0068861_101197157 Ga0068861_1011971572 118
377 3300005834 Ga0068851_10018818 Ga0068851_100188184 118
378 3300005834 Ga0068851_10029452 Ga0068851_100294523 118
379 3300005834 Ga0068851_10064226 Ga0068851_100642262 118
380 3300005834 Ga0068851_10124163 Ga0068851_101241632 118
381 3300005834 Ga0068851_10167403 Ga0068851_101674032 118
382 3300005834 Ga0068851_10304914 Ga0068851_103049142 118
383 3300005841 Ga0068863_100021878 Ga0068863_1000218787 118
384 3300005841 Ga0068863_100147312 Ga0068863_1001473122 118
385 3300005841 Ga0068863_100490699 Ga0068863_1004906992 118
386 3300005841 Ga0068863_101991938 Ga0068863_1019919382 118
387 3300005842 Ga0068858_100010948 Ga0068858_1000109483 118
388 3300005842 Ga0068858_100160147 Ga0068858_1001601473 118
389 3300005843 Ga0068860_100112161 Ga0068860_1001121614 118
390 3300005843 Ga0068860_100179066 Ga0068860_1001790662 118
391 3300005844 Ga0068862_100239079 Ga0068862_1002390793 118
392 3300005985 Ga0081539_10044982 Ga0081539_100449825 118
393 3300006028 Ga0070717_10012169 Ga0070717_100121693 118
394 3300006173 Ga0070716_100037901 Ga0070716_1000379013 118
395 3300006358 Ga0068871_101000747 Ga0068871_1010007472 118
396 3300006358 Ga0068871_101201754 Ga0068871_1012017541 118
397 3300006358 Ga0068871_101661182 Ga0068871_1016611822 118
398 3300006844 Ga0075428_100233026 Ga0075428_1002330263 118
399 3300006871 Ga0075434_101172486 Ga0075434_1011724862 118
400 3300006880 Ga0075429_100201990 Ga0075429_1002019902 118
401 3300006881 Ga0068865_100015091 Ga0068865_1000150917 118
402 3300006931 Ga0097620_100006121 Ga0097620_1000061213 118
403 3300006931 Ga0097620_100115385 Ga0097620_1001153853 118
404 3300006931 Ga0097620_100417375 Ga0097620_1004173753 118
405 3300006931 Ga0097620_100855793 Ga0097620_1008557932 118
406 3300009092 Ga0105250_10180948 Ga0105250_101809482 118
407 3300009093 Ga0105240_10080700 Ga0105240_100807003 118
408 3300009093 Ga0105240_10175999 Ga0105240_101759992 118
409 3300009093 Ga0105240_10332501 Ga0105240_103325013 118
410 3300009093 Ga0105240_10734800 Ga0105240_107348002 118
411 3300009093 Ga0105240_11431363 Ga0105240_114313632 118
412 3300009094 Ga0111539_10047558 Ga0111539_100475584 118
413 3300009098 Ga0105245_10426998 Ga0105245_104269982 118
414 3300009098 Ga0105245_11885399 Ga0105245_118853992 118
415 3300009101 Ga0105247_10164050 Ga0105247_101640503 118
416 3300009148 Ga0105243_10131287 Ga0105243_101312872 118
417 3300009174 Ga0105241_10068087 Ga0105241_100680873 118
418 3300009174 Ga0105241_10451700 Ga0105241_104517002 118
419 3300009174 Ga0105241_10469807 Ga0105241_104698072 118
420 3300009176 Ga0105242_10938499 Ga0105242_109384992 118
421 3300009177 Ga0105248_10000059 Ga0105248_10000059117 118
422 3300009177 Ga0105248_10000135 Ga0105248_1000013551 118
423 3300009177 Ga0105248_10008997 Ga0105248_100089973 118
424 3300009177 Ga0105248_10009598 Ga0105248_100095986 118
425 3300009177 Ga0105248_10031716 Ga0105248_100317163 118
426 3300009177 Ga0105248_10037237 Ga0105248_100372377 118
427 3300009177 Ga0105248_10213077 Ga0105248_102130774 118
428 3300009177 Ga0105248_10249787 Ga0105248_102497873 118
429 3300009177 Ga0105248_10384713 Ga0105248_103847132 118
430 3300009545 Ga0105237_10223605 Ga0105237_102236053 118
431 3300009551 Ga0105238_10051181 Ga0105238_100511813 118
432 3300009551 Ga0105238_10097690 Ga0105238_100976905 118
433 3300009551 Ga0105238_10107690 Ga0105238_101076904 118
434 3300009551 Ga0105238_10136217 Ga0105238_101362173 118
435 3300009551 Ga0105238_10157242 Ga0105238_101572423 118
436 3300009553 Ga0105249_10562626 Ga0105249_105626262 118
437 3300009553 Ga0105249_11435245 Ga0105249_114352452 118
438 3300010375 Ga0105239_10097877 Ga0105239_100978771 118
439 3300010375 Ga0105239_10690935 Ga0105239_106909352 118
440 3300010375 Ga0105239_11130490 Ga0105239_111304902 118
441 3300013100 Ga0157373_10019837 Ga0157373_100198376 118
442 3300013100 Ga0157373_10020945 Ga0157373_100209452 118
443 3300013100 Ga0157373_10029482 Ga0157373_100294824 118
444 3300013100 Ga0157373_10050582 Ga0157373_100505822 118
445 3300013100 Ga0157373_10055254 Ga0157373_100552543 118
446 3300013100 Ga0157373_10132248 Ga0157373_101322482 118
447 3300013100 Ga0157373_10155508 Ga0157373_101555081 118
448 3300013100 Ga0157373_10212826 Ga0157373_102128263 118
449 3300013100 Ga0157373_10464531 Ga0157373_104645311 118
450 3300013100 Ga0157373_10593943 Ga0157373_105939432 118
451 3300013100 Ga0157373_11011026 Ga0157373_110110261 118
452 3300013102 Ga0157371_10002432 Ga0157371_100024325 118
453 3300013102 Ga0157371_10005025 Ga0157371_100050252 118
454 3300013102 Ga0157371_10009970 Ga0157371_100099704 118
455 3300013102 Ga0157371_10010916 Ga0157371_100109168 118
456 3300013102 Ga0157371_10013162 Ga0157371_100131628 118
457 3300013102 Ga0157371_10031085 Ga0157371_100310855 118
458 3300013102 Ga0157371_10089888 Ga0157371_100898882 118
459 3300013102 Ga0157371_10139008 Ga0157371_101390082 118
460 3300013102 Ga0157371_10145535 Ga0157371_101455352 118
461 3300013102 Ga0157371_10154532 Ga0157371_101545323 118
462 3300013102 Ga0157371_10157685 Ga0157371_101576852 118
463 3300013102 Ga0157371_10288178 Ga0157371_102881782 118
464 3300013102 Ga0157371_10337483 Ga0157371_103374832 118
465 3300013102 Ga0157371_10388674 Ga0157371_103886742 118
466 3300013102 Ga0157371_10615807 Ga0157371_106158072 118
467 3300013102 Ga0157371_11143247 Ga0157371_111432471 118
468 3300013102 Ga0157371_11152496 Ga0157371_111524962 118
469 3300013104 Ga0157370_10002392 Ga0157370_1000239219 118
470 3300013104 Ga0157370_10007551 Ga0157370_100075513 118
471 3300013104 Ga0157370_10078895 Ga0157370_100788954 118
472 3300013104 Ga0157370_10083604 Ga0157370_100836043 118
473 3300013104 Ga0157370_10098221 Ga0157370_100982213 118
474 3300013104 Ga0157370_10185552 Ga0157370_101855522 118
475 3300013104 Ga0157370_10218146 Ga0157370_102181463 118
476 3300013104 Ga0157370_10280534 Ga0157370_102805341 118
477 3300013104 Ga0157370_10747840 Ga0157370_107478402 118
478 3300013104 Ga0157370_10871027 Ga0157370_108710272 118
479 3300013104 Ga0157370_12032858 Ga0157370_120328582 118
480 3300013105 Ga0157369_10000833 Ga0157369_1000083326 118
481 3300013105 Ga0157369_10074758 Ga0157369_100747583 118
482 3300013105 Ga0157369_10191605 Ga0157369_101916052 118
483 3300013105 Ga0157369_10194292 Ga0157369_101942923 118
484 3300013105 Ga0157369_10210887 Ga0157369_102108872 118
485 3300013105 Ga0157369_10300279 Ga0157369_103002793 118
486 3300013105 Ga0157369_10346470 Ga0157369_103464702 118
487 3300013105 Ga0157369_10529665 Ga0157369_105296652 118
488 3300013105 Ga0157369_10739064 Ga0157369_107390642 118
489 3300013105 Ga0157369_10764383 Ga0157369_107643831 118
490 3300013105 Ga0157369_10875995 Ga0157369_108759952 118
491 3300013105 Ga0157369_11036560 Ga0157369_110365602 118
492 3300013105 Ga0157369_11397780 Ga0157369_113977801 118
493 3300013296 Ga0157374_10026529 Ga0157374_100265293 118
494 3300013297 Ga0157378_11224717 Ga0157378_112247171 118
495 3300013297 Ga0157378_11690157 Ga0157378_116901572 118
496 3300013306 Ga0163162_10016090 Ga0163162_100160906 118
497 3300013306 Ga0163162_10071868 Ga0163162_100718684 118
498 3300013306 Ga0163162_10664505 Ga0163162_106645052 118
499 3300013306 Ga0163162_10949994 Ga0163162_109499942 118
500 3300013306 Ga0163162_11029454 Ga0163162_110294541 118
501 3300013307 Ga0157372_10012882 Ga0157372_100128828 118
502 3300013307 Ga0157372_10027020 Ga0157372_100270204 118
503 3300013307 Ga0157372_10133225 Ga0157372_101332252 118
504 3300013307 Ga0157372_10144763 Ga0157372_101447633 118
505 3300013307 Ga0157372_10194713 Ga0157372_101947133 118
506 3300013307 Ga0157372_10293496 Ga0157372_102934963 118
507 3300013307 Ga0157372_10294126 Ga0157372_102941263 118
508 3300013307 Ga0157372_10667069 Ga0157372_106670693 118
509 3300013307 Ga0157372_10740936 Ga0157372_107409362 118
510 3300013307 Ga0157372_12030248 Ga0157372_120302482 118
511 3300013307 Ga0157372_13130113 Ga0157372_131301132 118
512 3300013308 Ga0157375_10007830 Ga0157375_100078308 118
513 3300013308 Ga0157375_13378812 Ga0157375_133788121 118
514 3300014325 Ga0163163_10017733 Ga0163163_100177336 118
515 3300014325 Ga0163163_11263280 Ga0163163_112632802 118
516 3300014497 Ga0182008_10601319 Ga0182008_106013191 118
517 3300014969 Ga0157376_10920229 Ga0157376_109202292 118
518 3300014969 Ga0157376_11176587 Ga0157376_111765872 118
519 3300017792 Ga0163161_10216422 Ga0163161_102164223 118
520 3300017792 Ga0163161_10442043 Ga0163161_104420432 118
521 3300020081 Ga0206354_11382161 Ga0206354_113821613 118
522 3300020082 Ga0206353_11293208 Ga0206353_112932082 118
523 3300021384 Ga0213876_10008079 Ga0213876_100080795 118
524 3300025315 Ga0207697_10024711 Ga0207697_100247112 118
525 3300025315 Ga0207697_10101438 Ga0207697_101014382 118
526 3300025321 Ga0207656_10021676 Ga0207656_100216761 118
527 3300025321 Ga0207656_10028003 Ga0207656_100280033 118
528 3300025321 Ga0207656_10028914 Ga0207656_100289143 118
529 3300025321 Ga0207656_10144019 Ga0207656_101440192 118
530 3300025321 Ga0207656_10247987 Ga0207656_102479872 118
531 3300025321 Ga0207656_10307789 Ga0207656_103077892 118
532 3300025893 Ga0207682_10030830 Ga0207682_100308303 118
533 3300025899 Ga0207642_10274383 Ga0207642_102743832 118
534 3300025903 Ga0207680_10000473 Ga0207680_1000047317 118
535 3300025903 Ga0207680_10040842 Ga0207680_100408426 118
536 3300025903 Ga0207680_10155379 Ga0207680_101553792 118
537 3300025903 Ga0207680_10159193 Ga0207680_101591933 118
538 3300025903 Ga0207680_10161585 Ga0207680_101615852 118
539 3300025903 Ga0207680_10380247 Ga0207680_103802472 118
540 3300025904 Ga0207647_10000870 Ga0207647_100008708 118
541 3300025904 Ga0207647_10006272 Ga0207647_100062722 118
542 3300025904 Ga0207647_10008913 Ga0207647_100089136 118
543 3300025904 Ga0207647_10009050 Ga0207647_100090507 118
544 3300025904 Ga0207647_10011427 Ga0207647_100114277 118
545 3300025904 Ga0207647_10037895 Ga0207647_100378952 118
546 3300025904 Ga0207647_10084469 Ga0207647_100844692 118
547 3300025904 Ga0207647_10112133 Ga0207647_101121333 118
548 3300025907 Ga0207645_10054587 Ga0207645_100545873 118
549 3300025907 Ga0207645_10640582 Ga0207645_106405822 118
550 3300025908 Ga0207643_10407839 Ga0207643_104078392 118
551 3300025909 Ga0207705_10000062 Ga0207705_100000626 118
552 3300025909 Ga0207705_10003070 Ga0207705_100030704 118
553 3300025909 Ga0207705_10003678 Ga0207705_100036784 118
554 3300025909 Ga0207705_10005942 Ga0207705_100059427 118
555 3300025909 Ga0207705_10027747 Ga0207705_100277473 118
556 3300025909 Ga0207705_10032327 Ga0207705_100323275 118
557 3300025909 Ga0207705_10039997 Ga0207705_100399972 118
558 3300025909 Ga0207705_10128814 Ga0207705_101288143 118
559 3300025909 Ga0207705_10145079 Ga0207705_101450793 118
560 3300025909 Ga0207705_10150079 Ga0207705_101500793 118
561 3300025909 Ga0207705_10164554 Ga0207705_101645543 118
562 3300025909 Ga0207705_10296576 Ga0207705_102965763 118
563 3300025909 Ga0207705_10325027 Ga0207705_103250272 118
564 3300025909 Ga0207705_10399449 Ga0207705_103994492 118
565 3300025909 Ga0207705_10895080 Ga0207705_108950802 118
566 3300025910 Ga0207684_11212326 Ga0207684_112123261 118
567 3300025911 Ga0207654_10930523 Ga0207654_109305231 118
568 3300025912 Ga0207707_10041327 Ga0207707_100413275 118
569 3300025912 Ga0207707_10083636 Ga0207707_100836362 118
570 3300025912 Ga0207707_10217036 Ga0207707_102170363 118
571 3300025912 Ga0207707_10221904 Ga0207707_102219043 118
572 3300025912 Ga0207707_10597762 Ga0207707_105977622 118
573 3300025912 Ga0207707_10930040 Ga0207707_109300402 118
574 3300025913 Ga0207695_10002617 Ga0207695_1000261717 118
575 3300025913 Ga0207695_10013374 Ga0207695_100133742 118
576 3300025913 Ga0207695_10425622 Ga0207695_104256222 118
577 3300025913 Ga0207695_10954229 Ga0207695_109542291 118
578 3300025914 Ga0207671_10044589 Ga0207671_100445893 118
579 3300025917 Ga0207660_10001300 Ga0207660_1000130015 118
580 3300025917 Ga0207660_10021280 Ga0207660_100212803 118
581 3300025917 Ga0207660_10027210 Ga0207660_100272102 118
582 3300025917 Ga0207660_10185535 Ga0207660_101855351 118
583 3300025917 Ga0207660_10243174 Ga0207660_102431742 118
584 3300025917 Ga0207660_10259572 Ga0207660_102595723 118
585 3300025917 Ga0207660_10359928 Ga0207660_103599282 118
586 3300025917 Ga0207660_10935483 Ga0207660_109354831 118
587 3300025919 Ga0207657_10000015 Ga0207657_10000015115 118
588 3300025919 Ga0207657_10000948 Ga0207657_1000094817 118
589 3300025919 Ga0207657_10001484 Ga0207657_100014848 118
590 3300025919 Ga0207657_10001896 Ga0207657_1000189617 118
591 3300025919 Ga0207657_10002684 Ga0207657_100026843 118
592 3300025919 Ga0207657_10006647 Ga0207657_100066473 118
593 3300025919 Ga0207657_10009585 Ga0207657_100095853 118
594 3300025919 Ga0207657_10021767 Ga0207657_100217673 118
595 3300025919 Ga0207657_10034086 Ga0207657_100340866 118
596 3300025919 Ga0207657_10053685 Ga0207657_100536853 118
597 3300025919 Ga0207657_10056008 Ga0207657_100560084 118
598 3300025919 Ga0207657_10058735 Ga0207657_100587352 118
599 3300025919 Ga0207657_10085042 Ga0207657_100850424 118
600 3300025919 Ga0207657_10093024 Ga0207657_100930243 118
601 3300025919 Ga0207657_10107289 Ga0207657_101072893 118
602 3300025919 Ga0207657_10186001 Ga0207657_101860013 118
603 3300025919 Ga0207657_10257682 Ga0207657_102576821 118
604 3300025920 Ga0207649_10002425 Ga0207649_100024258 118
605 3300025920 Ga0207649_10002611 Ga0207649_100026113 118
606 3300025920 Ga0207649_10005197 Ga0207649_100051972 118
607 3300025920 Ga0207649_10118992 Ga0207649_101189923 118
608 3300025920 Ga0207649_10150105 Ga0207649_101501052 118
609 3300025920 Ga0207649_10166809 Ga0207649_101668092 118
610 3300025920 Ga0207649_10222328 Ga0207649_102223282 118
611 3300025920 Ga0207649_10264264 Ga0207649_102642642 118
612 3300025920 Ga0207649_10299600 Ga0207649_102996003 118
613 3300025920 Ga0207649_10509106 Ga0207649_105091062 118
614 3300025920 Ga0207649_10669939 Ga0207649_106699392 118
615 3300025920 Ga0207649_11527567 Ga0207649_115275672 118
616 3300025920 Ga0207649_11659966 Ga0207649_116599661 118
617 3300025921 Ga0207652_10022628 Ga0207652_100226283 118
618 3300025921 Ga0207652_10104804 Ga0207652_101048042 118
619 3300025921 Ga0207652_10128043 Ga0207652_101280433 118
620 3300025921 Ga0207652_10215672 Ga0207652_102156723 118
621 3300025921 Ga0207652_10400353 Ga0207652_104003532 118
622 3300025921 Ga0207652_10573315 Ga0207652_105733152 118
623 3300025921 Ga0207652_11012095 Ga0207652_110120952 118
624 3300025923 Ga0207681_10358500 Ga0207681_103585002 118
625 3300025924 Ga0207694_10010844 Ga0207694_100108441 118
626 3300025924 Ga0207694_10104439 Ga0207694_101044392 118
627 3300025924 Ga0207694_10164597 Ga0207694_101645972 118
628 3300025924 Ga0207694_10621429 Ga0207694_106214292 118
629 3300025924 Ga0207694_10633932 Ga0207694_106339322 118
630 3300025925 Ga0207650_10030799 Ga0207650_100307992 118
631 3300025925 Ga0207650_10057779 Ga0207650_100577792 118
632 3300025925 Ga0207650_10103608 Ga0207650_101036083 118
633 3300025925 Ga0207650_10106915 Ga0207650_101069153 118
634 3300025925 Ga0207650_10320049 Ga0207650_103200492 118
635 3300025925 Ga0207650_10643529 Ga0207650_106435292 118
636 3300025926 Ga0207659_10603820 Ga0207659_106038202 118
637 3300025926 Ga0207659_10719941 Ga0207659_107199412 118
638 3300025927 Ga0207687_10972815 Ga0207687_109728153 118
639 3300025928 Ga0207700_10193481 Ga0207700_101934813 118
640 3300025928 Ga0207700_10410467 Ga0207700_104104673 118
641 3300025929 Ga0207664_10045818 Ga0207664_100458184 118
642 3300025929 Ga0207664_10055353 Ga0207664_100553533 118
643 3300025929 Ga0207664_10086558 Ga0207664_100865582 118
644 3300025929 Ga0207664_10535279 Ga0207664_105352792 118
645 3300025929 Ga0207664_10999356 Ga0207664_109993562 118
646 3300025931 Ga0207644_10003340 Ga0207644_100033402 118
647 3300025931 Ga0207644_10021895 Ga0207644_100218956 118
648 3300025931 Ga0207644_10045797 Ga0207644_100457974 118
649 3300025931 Ga0207644_10113936 Ga0207644_101139363 118
650 3300025931 Ga0207644_10115709 Ga0207644_101157092 118
651 3300025931 Ga0207644_10239444 Ga0207644_102394442 118
652 3300025931 Ga0207644_11009141 Ga0207644_110091412 118
653 3300025932 Ga0207690_10000032 Ga0207690_1000003281 118
654 3300025932 Ga0207690_10011631 Ga0207690_100116316 118
655 3300025932 Ga0207690_10016378 Ga0207690_100163783 118
656 3300025932 Ga0207690_10044496 Ga0207690_100444963 118
657 3300025932 Ga0207690_10050753 Ga0207690_100507532 118
658 3300025932 Ga0207690_10078109 Ga0207690_100781093 118
659 3300025932 Ga0207690_10097186 Ga0207690_100971862 118
660 3300025932 Ga0207690_10170918 Ga0207690_101709183 118
661 3300025932 Ga0207690_10220258 Ga0207690_102202583 118
662 3300025932 Ga0207690_10390842 Ga0207690_103908422 118
663 3300025932 Ga0207690_10409270 Ga0207690_104092702 118
664 3300025932 Ga0207690_10628753 Ga0207690_106287531 118
665 3300025932 Ga0207690_11280512 Ga0207690_112805121 118
666 3300025933 Ga0207706_10000032 Ga0207706_1000003279 118
667 3300025933 Ga0207706_10002828 Ga0207706_1000282812 118
668 3300025933 Ga0207706_10018555 Ga0207706_100185554 118
669 3300025933 Ga0207706_10058935 Ga0207706_100589355 118
670 3300025933 Ga0207706_10059581 Ga0207706_100595813 118
671 3300025933 Ga0207706_10078756 Ga0207706_100787562 118
672 3300025933 Ga0207706_10084945 Ga0207706_100849453 118
673 3300025933 Ga0207706_10100351 Ga0207706_101003513 118
674 3300025933 Ga0207706_10175648 Ga0207706_101756482 118
675 3300025933 Ga0207706_10193062 Ga0207706_101930623 118
676 3300025933 Ga0207706_10371014 Ga0207706_103710143 118
677 3300025933 Ga0207706_10392296 Ga0207706_103922962 118
678 3300025933 Ga0207706_10442703 Ga0207706_104427032 118
679 3300025933 Ga0207706_10592213 Ga0207706_105922132 118
680 3300025934 Ga0207686_10045705 Ga0207686_100457052 118
681 3300025937 Ga0207669_10026439 Ga0207669_100264392 118
682 3300025938 Ga0207704_10281971 Ga0207704_102819711 118
683 3300025940 Ga0207691_10015996 Ga0207691_100159968 118
684 3300025940 Ga0207691_10018226 Ga0207691_100182266 118
685 3300025940 Ga0207691_10211714 Ga0207691_102117142 118
686 3300025940 Ga0207691_10227254 Ga0207691_102272541 118
687 3300025940 Ga0207691_10614724 Ga0207691_106147242 118
688 3300025941 Ga0207711_10001624 Ga0207711_1000162414 118
689 3300025941 Ga0207711_10027867 Ga0207711_100278677 118
690 3300025941 Ga0207711_10079536 Ga0207711_100795364 118
691 3300025941 Ga0207711_10156478 Ga0207711_101564782 118
692 3300025941 Ga0207711_10189258 Ga0207711_101892582 118
693 3300025941 Ga0207711_10317831 Ga0207711_103178312 118
694 3300025941 Ga0207711_11321501 Ga0207711_113215012 118
695 3300025942 Ga0207689_10028007 Ga0207689_100280076 118
696 3300025944 Ga0207661_10000692 Ga0207661_1000069220 118
697 3300025944 Ga0207661_10011631 Ga0207661_100116315 118
698 3300025944 Ga0207661_10044750 Ga0207661_100447504 118
699 3300025944 Ga0207661_10266972 Ga0207661_102669722 118
700 3300025944 Ga0207661_10299957 Ga0207661_102999572 118
701 3300025944 Ga0207661_10500494 Ga0207661_105004942 118
702 3300025944 Ga0207661_11170826 Ga0207661_111708262 118
703 3300025945 Ga0207679_10000983 Ga0207679_100009832 118
704 3300025945 Ga0207679_10018656 Ga0207679_100186561 118
705 3300025945 Ga0207679_10021911 Ga0207679_100219113 118
706 3300025945 Ga0207679_10141710 Ga0207679_101417102 118
707 3300025945 Ga0207679_10168262 Ga0207679_101682622 118
708 3300025945 Ga0207679_10192699 Ga0207679_101926992 118
709 3300025945 Ga0207679_10322493 Ga0207679_103224932 118
710 3300025945 Ga0207679_10347202 Ga0207679_103472021 118
711 3300025945 Ga0207679_10676419 Ga0207679_106764192 118
712 3300025945 Ga0207679_10722046 Ga0207679_107220462 118
713 3300025945 Ga0207679_11204700 Ga0207679_112047002 118
714 3300025949 Ga0207667_10009700 Ga0207667_100097007 118
715 3300025949 Ga0207667_10015221 Ga0207667_100152217 118
716 3300025949 Ga0207667_10022712 Ga0207667_100227125 118
717 3300025949 Ga0207667_10057465 Ga0207667_100574653 118
718 3300025949 Ga0207667_10127289 Ga0207667_101272893 118
719 3300025949 Ga0207667_10142459 Ga0207667_101424593 118
720 3300025949 Ga0207667_10195471 Ga0207667_101954713 118
721 3300025949 Ga0207667_10353561 Ga0207667_103535612 118
722 3300025949 Ga0207667_10361713 Ga0207667_103617133 118
723 3300025949 Ga0207667_10502844 Ga0207667_105028442 118
724 3300025949 Ga0207667_10553614 Ga0207667_105536142 118
725 3300025949 Ga0207667_10687019 Ga0207667_106870192 118
726 3300025949 Ga0207667_10980960 Ga0207667_109809601 118
727 3300025949 Ga0207667_11053578 Ga0207667_110535782 118
728 3300025960 Ga0207651_10325973 Ga0207651_103259733 118
729 3300025960 Ga0207651_10590557 Ga0207651_105905572 118
730 3300025960 Ga0207651_10891670 Ga0207651_108916702 118
731 3300025961 Ga0207712_10191193 Ga0207712_101911932 118
732 3300025961 Ga0207712_10654082 Ga0207712_106540822 118
733 3300025972 Ga0207668_10123197 Ga0207668_101231973 118
734 3300025972 Ga0207668_10439670 Ga0207668_104396702 118
735 3300025981 Ga0207640_10002376 Ga0207640_100023769 118
736 3300025981 Ga0207640_10007027 Ga0207640_100070273 118
737 3300025981 Ga0207640_10100058 Ga0207640_101000583 118
738 3300025981 Ga0207640_10106571 Ga0207640_101065712 118
739 3300025981 Ga0207640_10144533 Ga0207640_101445332 118
740 3300025981 Ga0207640_10164420 Ga0207640_101644202 118
741 3300025981 Ga0207640_10258194 Ga0207640_102581943 118
742 3300025981 Ga0207640_10335486 Ga0207640_103354862 118
743 3300025981 Ga0207640_10409854 Ga0207640_104098543 118
744 3300025981 Ga0207640_10510172 Ga0207640_105101722 118
745 3300025981 Ga0207640_10911678 Ga0207640_109116782 118
746 3300025981 Ga0207640_11036485 Ga0207640_110364851 118
747 3300025981 Ga0207640_11497388 Ga0207640_114973882 118
748 3300025986 Ga0207658_10009000 Ga0207658_100090008 118
749 3300025986 Ga0207658_10066541 Ga0207658_100665412 118
750 3300025986 Ga0207658_10322326 Ga0207658_103223262 118
751 3300025986 Ga0207658_10836765 Ga0207658_108367652 118
752 3300025986 Ga0207658_11258283 Ga0207658_112582832 118
753 3300025986 Ga0207658_11284273 Ga0207658_112842732 118
754 3300025986 Ga0207658_12091092 Ga0207658_120910922 118
755 3300026023 Ga0207677_11134633 Ga0207677_111346332 118
756 3300026035 Ga0207703_10007531 Ga0207703_100075317 118
757 3300026035 Ga0207703_10113269 Ga0207703_101132693 118
758 3300026041 Ga0207639_10002345 Ga0207639_1000234512 118
759 3300026041 Ga0207639_10122169 Ga0207639_101221691 118
760 3300026041 Ga0207639_10128581 Ga0207639_101285812 118
761 3300026041 Ga0207639_10141131 Ga0207639_101411313 118
762 3300026041 Ga0207639_10218663 Ga0207639_102186632 118
763 3300026041 Ga0207639_10234137 Ga0207639_102341373 118
764 3300026041 Ga0207639_10345689 Ga0207639_103456893 118
765 3300026041 Ga0207639_10475174 Ga0207639_104751742 118
766 3300026041 Ga0207639_12203771 Ga0207639_122037711 118
767 3300026067 Ga0207678_10000812 Ga0207678_100008127 118
768 3300026067 Ga0207678_10000938 Ga0207678_1000093820 118
769 3300026067 Ga0207678_10001029 Ga0207678_1000102919 118
770 3300026067 Ga0207678_10004608 Ga0207678_100046084 118
771 3300026067 Ga0207678_10016401 Ga0207678_100164012 118
772 3300026067 Ga0207678_10019488 Ga0207678_100194887 118
773 3300026067 Ga0207678_10022102 Ga0207678_100221023 118
774 3300026067 Ga0207678_10029540 Ga0207678_100295403 118
775 3300026067 Ga0207678_10039479 Ga0207678_100394793 118
776 3300026067 Ga0207678_10083905 Ga0207678_100839053 118
777 3300026067 Ga0207678_10094005 Ga0207678_100940052 118
778 3300026067 Ga0207678_10111750 Ga0207678_101117502 118
779 3300026067 Ga0207678_10744084 Ga0207678_107440842 118
780 3300026067 Ga0207678_10944910 Ga0207678_109449102 118
781 3300026075 Ga0207708_11809186 Ga0207708_118091862 118
782 3300026078 Ga0207702_10000072 Ga0207702_1000007256 118
783 3300026078 Ga0207702_10012268 Ga0207702_100122682 118
784 3300026078 Ga0207702_10023316 Ga0207702_100233165 118
785 3300026078 Ga0207702_10024851 Ga0207702_100248513 118
786 3300026078 Ga0207702_10071467 Ga0207702_100714673 118
787 3300026078 Ga0207702_10074727 Ga0207702_100747273 118
788 3300026078 Ga0207702_10188850 Ga0207702_101888503 118
789 3300026078 Ga0207702_10223310 Ga0207702_102233103 118
790 3300026078 Ga0207702_10257261 Ga0207702_102572612 118
791 3300026078 Ga0207702_10272756 Ga0207702_102727562 118
792 3300026078 Ga0207702_10284623 Ga0207702_102846233 118
793 3300026078 Ga0207702_10428653 Ga0207702_104286533 118
794 3300026078 Ga0207702_10444505 Ga0207702_104445052 118
795 3300026078 Ga0207702_10500363 Ga0207702_105003633 118
796 3300026078 Ga0207702_10516669 Ga0207702_105166692 118
797 3300026078 Ga0207702_10630991 Ga0207702_106309911 118
798 3300026078 Ga0207702_10769131 Ga0207702_107691312 118
799 3300026078 Ga0207702_10820413 Ga0207702_108204132 118
800 3300026078 Ga0207702_11092511 Ga0207702_110925112 118
801 3300026088 Ga0207641_10020421 Ga0207641_100204217 118
802 3300026088 Ga0207641_10237048 Ga0207641_102370483 118
803 3300026088 Ga0207641_10430910 Ga0207641_104309103 118
804 3300026088 Ga0207641_10952736 Ga0207641_109527362 118
805 3300026089 Ga0207648_10035683 Ga0207648_100356832 118
806 3300026089 Ga0207648_10293627 Ga0207648_102936273 118
807 3300026089 Ga0207648_10407655 Ga0207648_104076553 118
808 3300026095 Ga0207676_10000184 Ga0207676_1000018421 118
809 3300026095 Ga0207676_10007561 Ga0207676_100075618 118
810 3300026095 Ga0207676_10114491 Ga0207676_101144913 118
811 3300026095 Ga0207676_10311325 Ga0207676_103113253 118
812 3300026095 Ga0207676_10442572 Ga0207676_104425722 118
813 3300026116 Ga0207674_10001488 Ga0207674_1000148817 118
814 3300026116 Ga0207674_10001704 Ga0207674_1000170412 118
815 3300026116 Ga0207674_10002230 Ga0207674_1000223020 118
816 3300026116 Ga0207674_10003633 Ga0207674_1000363319 118
817 3300026116 Ga0207674_10251441 Ga0207674_102514413 118
818 3300026116 Ga0207674_10456796 Ga0207674_104567962 118
819 3300026116 Ga0207674_11548863 Ga0207674_115488631 118
820 3300026118 Ga0207675_100749850 Ga0207675_1007498502 118
821 3300026121 Ga0207683_10000808 Ga0207683_1000080820 118
822 3300026121 Ga0207683_10312387 Ga0207683_103123873 118
823 3300026121 Ga0207683_11387496 Ga0207683_113874962 118
824 3300026142 Ga0207698_10000647 Ga0207698_100006479 118
825 3300026142 Ga0207698_10000955 Ga0207698_1000095515 118
826 3300026142 Ga0207698_10001368 Ga0207698_100013688 118
827 3300026142 Ga0207698_10009371 Ga0207698_100093716 118
828 3300026142 Ga0207698_10017848 Ga0207698_100178485 118
829 3300026142 Ga0207698_10019862 Ga0207698_100198623 118
830 3300026142 Ga0207698_10048939 Ga0207698_100489392 118
831 3300026142 Ga0207698_10061580 Ga0207698_100615804 118
832 3300026142 Ga0207698_10099698 Ga0207698_100996985 118
833 3300026142 Ga0207698_10132541 Ga0207698_101325413 118
834 3300026142 Ga0207698_10134054 Ga0207698_101340542 118
835 3300026142 Ga0207698_10168661 Ga0207698_101686612 118
836 3300026142 Ga0207698_10189926 Ga0207698_101899262 118
837 3300026142 Ga0207698_10352694 Ga0207698_103526942 118
838 3300026142 Ga0207698_10421858 Ga0207698_104218582 118
839 3300026142 Ga0207698_10553600 Ga0207698_105536002 118
840 3300026142 Ga0207698_10634420 Ga0207698_106344202 118
841 3300026142 Ga0207698_10767816 Ga0207698_107678162 118
842 3300027876 Ga0209974_10010108 Ga0209974_100101083 118
843 3300027876 Ga0209974_10058390 Ga0209974_100583903 118
844 3300028379 Ga0268266_10000133 Ga0268266_1000013370 118
845 3300028379 Ga0268266_10149400 Ga0268266_101494001 118
846 3300028379 Ga0268266_10150780 Ga0268266_101507803 118
847 3300028379 Ga0268266_10491419 Ga0268266_104914192 118
848 3300028379 Ga0268266_10750272 Ga0268266_107502722 118
849 3300028379 Ga0268266_11760537 Ga0268266_117605372 118
850 3300028380 Ga0268265_10898652 Ga0268265_108986522 118
851 3300028380 Ga0268265_11307066 Ga0268265_113070662 118
852 3300028381 Ga0268264_10051213 Ga0268264_100512133 118
853 3300028381 Ga0268264_10201313 Ga0268264_102013132 118
854 3300028786 Ga0307517_10375262 Ga0307517_103752622 118
855 3300031548 Ga0307408_101035200 Ga0307408_1010352002 118
856 3300031548 Ga0307408_101481411 Ga0307408_1014814111 118
857 3300031731 Ga0307405_10327164 Ga0307405_103271641 118
858 3300031731 Ga0307405_11074631 Ga0307405_110746312 118
859 3300031824 Ga0307413_10417854 Ga0307413_104178542 118
860 3300031852 Ga0307410_10572428 Ga0307410_105724282 118
861 3300031901 Ga0307406_10251734 Ga0307406_102517343 118
862 3300031901 Ga0307406_10318339 Ga0307406_103183392 118
863 3300031995 Ga0307409_100117421 Ga0307409_1001174212 118
864 3300031995 Ga0307409_100409452 Ga0307409_1004094523 118
865 3300031995 Ga0307409_100755212 Ga0307409_1007552122 118
866 3300032002 Ga0307416_100178896 Ga0307416_1001788964 118
867 3300032002 Ga0307416_100538229 Ga0307416_1005382292 118
868 3300032002 Ga0307416_100990647 Ga0307416_1009906472 118
869 3300032004 Ga0307414_10997326 Ga0307414_109973261 118
870 3300032005 Ga0307411_10217298 Ga0307411_102172982 118
871 3300032005 Ga0307411_12333361 Ga0307411_123333611 118
872 3300032126 Ga0307415_100032440 Ga0307415_1000324403 118
873 3300032126 Ga0307415_100064658 Ga0307415_1000646582 118
874 3300032126 Ga0307415_101780835 Ga0307415_1017808352 118
875 3300033180 Ga0307510_10099039 Ga0307510_100990393 118
876 3300033180 Ga0307510_10145191 Ga0307510_101451914 118
877 3300034820 Ga0373959_0063135 Ga0373959_0063135_133_495 118
878 3300035084 Ga0373928_0262149 Ga0373928_0262149_93_449 118
879 3300035111 Ga0373923_0033131 Ga0373923_0033131_679_1035 118
880 3300035118 Ga0373954_0369197 Ga0373954_0369197_168_557 118
881 3300035241 Ga0373961_0056451 Ga0373961_0056451_219_575 118
882 3300035691 Ga0373931_0032336 Ga0373931_0032336_1695_2051 118
883 3300035691 Ga0373931_1221039 Ga0373931_1221039_57_419 118
884 3300037068 Ga0373925_1623030 Ga0373925_1623030_120_482 118
885 3300037312 Ga0395899_0002132 Ga0395899_0002132_13270_13626 118
886 3300037312 Ga0395899_0004370 Ga0395899_0004370_1938_2300 118
887 3300037312 Ga0395899_0005372 Ga0395899_0005372_3746_4102 118
888 3300037312 Ga0395899_0012650 Ga0395899_0012650_539_895 118
889 3300037312 Ga0395899_0046090 Ga0395899_0046090_682_1038 118
890 3300037312 Ga0395899_0059884 Ga0395899_0059884_1968_2324 118
891 3300037312 Ga0395899_0067158 Ga0395899_0067158_481_837 118
892 3300037312 Ga0395899_0250853 Ga0395899_0250853_414_776 118
893 3300037312 Ga0395899_0302643 Ga0395899_0302643_84_440 118
894 3300037312 Ga0395899_0332640 Ga0395899_0332640_64_426 118
895 3300037312 Ga0395899_0373181 Ga0395899_0373181_481_837 118
896 3300037312 Ga0395899_0380243 Ga0395899_0380243_117_473 118
897 3300037312 Ga0395899_0473750 Ga0395899_0473750_436_792 118
898 3300037312 Ga0395899_0482021 Ga0395899_0482021_306_662 118
899 3300037312 Ga0395899_0641870 Ga0395899_0641870_243_599 118
900 3300037418 Ga0395900_0001365 Ga0395900_0001365_6436_6798 118
901 3300037418 Ga0395900_0002298 Ga0395900_0002298_930_1286 118
902 3300037418 Ga0395900_0016483 Ga0395900_0016483_6777_7139 118
903 3300037418 Ga0395900_0025498 Ga0395900_0025498_5049_5411 118
904 3300037418 Ga0395900_0027515 Ga0395900_0027515_2971_3333 118
905 3300037418 Ga0395900_0039099 Ga0395900_0039099_1232_1588 118
906 3300037418 Ga0395900_0077019 Ga0395900_0077019_3024_3380 118
907 3300037418 Ga0395900_0099305 Ga0395900_0099305_1827_2183 118
908 3300037418 Ga0395900_0106324 Ga0395900_0106324_1438_1794 118
909 3300037418 Ga0395900_0120312 Ga0395900_0120312_851_1213 118
910 3300037418 Ga0395900_0128109 Ga0395900_0128109_439_795 118
911 3300037418 Ga0395900_0134263 Ga0395900_0134263_79_441 118
912 3300037418 Ga0395900_0163209 Ga0395900_0163209_1689_2045 118
913 3300037418 Ga0395900_0186167 Ga0395900_0186167_1321_1677 118
914 3300037418 Ga0395900_0188818 Ga0395900_0188818_132_488 118
915 3300037418 Ga0395900_0218045 Ga0395900_0218045_394_750 118
916 3300037418 Ga0395900_0271489 Ga0395900_0271489_246_602 118
917 3300037418 Ga0395900_0296186 Ga0395900_0296186_296_658 118
918 3300037418 Ga0395900_0366421 Ga0395900_0366421_689_1045 118
919 3300037418 Ga0395900_0376179 Ga0395900_0376179_858_1214 118
920 3300037418 Ga0395900_0379589 Ga0395900_0379589_521_877 118
921 3300037418 Ga0395900_0423459 Ga0395900_0423459_318_674 118
922 3300037418 Ga0395900_0442343 Ga0395900_0442343_720_1082 118
923 3300037418 Ga0395900_0444210 Ga0395900_0444210_451_813 118
924 3300037418 Ga0395900_0625588 Ga0395900_0625588_41_403 118
925 3300037418 Ga0395900_0703036 Ga0395900_0703036_57_413 118
926 3300037418 Ga0395900_0762404 Ga0395900_0762404_316_672 118
927 3300037418 Ga0395900_0818656 Ga0395900_0818656_207_563 118
928 3300037418 Ga0395900_0827588 Ga0395900_0827588_429_785 118
929 3300037418 Ga0395900_1150018 Ga0395900_1150018_138_494 118
930 3300037418 Ga0395900_1249008 Ga0395900_1249008_121_477 118
931 3300037418 Ga0395900_1273548 Ga0395900_1273548_256_612 118
932 3300037418 Ga0395900_1399224 Ga0395900_1399224_206_568 118
933 3300037418 Ga0395900_1673271 Ga0395900_1673271_73_429 118
934 3300037418 Ga0395900_1738354 Ga0395900_1738354_15_371 118
935 3300037418 Ga0395900_1738428 Ga0395900_1738428_128_484 118
936 3300037466 Ga0395898_0002787 Ga0395898_0002787_13141_13503 118
937 3300037466 Ga0395898_0015950 Ga0395898_0015950_4495_4851 118
938 3300037466 Ga0395898_0041352 Ga0395898_0041352_2104_2460 118
939 3300037466 Ga0395898_0043092 Ga0395898_0043092_2715_3077 118
940 3300037466 Ga0395898_0052689 Ga0395898_0052689_1167_1523 118
941 3300037466 Ga0395898_0055922 Ga0395898_0055922_2055_2411 118
942 3300037466 Ga0395898_0065285 Ga0395898_0065285_3059_3415 118
943 3300037466 Ga0395898_0103523 Ga0395898_0103523_1698_2060 118
944 3300037466 Ga0395898_0116813 Ga0395898_0116813_1095_1451 118
945 3300037466 Ga0395898_0130525 Ga0395898_0130525_996_1352 118
946 3300037466 Ga0395898_0134336 Ga0395898_0134336_1231_1587 118
947 3300037466 Ga0395898_0142516 Ga0395898_0142516_366_722 118
948 3300037466 Ga0395898_0198916 Ga0395898_0198916_837_1193 118
949 3300037466 Ga0395898_0211982 Ga0395898_0211982_1375_1731 118
950 3300037466 Ga0395898_0214411 Ga0395898_0214411_11_373 118
951 3300037466 Ga0395898_0242718 Ga0395898_0242718_154_516 118
952 3300037466 Ga0395898_0336882 Ga0395898_0336882_741_1097 118
953 3300037466 Ga0395898_0488649 Ga0395898_0488649_172_534 118
954 3300037466 Ga0395898_0539956 Ga0395898_0539956_274_630 118
955 3300037466 Ga0395898_0719532 Ga0395898_0719532_110_466 118
956 3300037466 Ga0395898_0758265 Ga0395898_0758265_323_679 118
957 3300037466 Ga0395898_0964847 Ga0395898_0964847_101_457 118
958 3300037466 Ga0395898_1564778 Ga0395898_1564778_79_435 118
959 3300037471 Ga0395905_0001405 Ga0395905_0001405_4267_4629 118
960 3300037471 Ga0395905_0002442 Ga0395905_0002442_2006_2368 118
961 3300037471 Ga0395905_0006372 Ga0395905_0006372_1294_1656 118
962 3300037471 Ga0395905_0007884 Ga0395905_0007884_6145_6501 118
963 3300037471 Ga0395905_0008353 Ga0395905_0008353_9016_9378 118
964 3300037471 Ga0395905_0009214 Ga0395905_0009214_2386_2748 118
965 3300037471 Ga0395905_0012995 Ga0395905_0012995_5944_6306 118
966 3300037471 Ga0395905_0017126 Ga0395905_0017126_3791_4147 118
967 3300037471 Ga0395905_0021213 Ga0395905_0021213_4477_4833 118
968 3300037471 Ga0395905_0024387 Ga0395905_0024387_4903_5265 118
969 3300037471 Ga0395905_0028578 Ga0395905_0028578_593_949 118
970 3300037471 Ga0395905_0029295 Ga0395905_0029295_4798_5154 118
971 3300037471 Ga0395905_0058292 Ga0395905_0058292_190_546 118
972 3300037471 Ga0395905_0063321 Ga0395905_0063321_714_1070 118
973 3300037471 Ga0395905_0075387 Ga0395905_0075387_413_769 118
974 3300037471 Ga0395905_0098644 Ga0395905_0098644_115_477 118
975 3300037471 Ga0395905_0114262 Ga0395905_0114262_1256_1612 118
976 3300037471 Ga0395905_0179857 Ga0395905_0179857_1047_1409 118
977 3300037471 Ga0395905_0281531 Ga0395905_0281531_852_1214 118
978 3300037471 Ga0395905_0339915 Ga0395905_0339915_142_498 118
979 3300037471 Ga0395905_0353530 Ga0395905_0353530_523_879 118
980 3300037471 Ga0395905_0553427 Ga0395905_0553427_478_834 118
981 3300037471 Ga0395905_0583992 Ga0395905_0583992_499_861 118
982 3300037471 Ga0395905_0587422 Ga0395905_0587422_44_400 118
983 3300037471 Ga0395905_0595114 Ga0395905_0595114_489_851 118
984 3300037471 Ga0395905_0603445 Ga0395905_0603445_409_765 118
985 3300037471 Ga0395905_0661086 Ga0395905_0661086_34_390 118
986 3300037471 Ga0395905_0675654 Ga0395905_0675654_369_731 118
987 3300037471 Ga0395905_0678081 Ga0395905_0678081_552_908 118
988 3300037471 Ga0395905_0727746 Ga0395905_0727746_228_584 118
989 3300037471 Ga0395905_0780276 Ga0395905_0780276_242_598 118
990 3300037471 Ga0395905_0998701 Ga0395905_0998701_115_477 118
991 3300037471 Ga0395905_1004281 Ga0395905_1004281_344_700 118
992 3300037471 Ga0395905_1092770 Ga0395905_1092770_153_509 118
993 3300037471 Ga0395905_1273010 Ga0395905_1273010_194_556 118
994 3300037471 Ga0395905_1349618 Ga0395905_1349618_189_545 118
995 3300037471 Ga0395905_1764466 Ga0395905_1764466_23_385 118
996 3300038443 Ga0395901_0001856 Ga0395901_0001856_840_1196 118
997 3300038443 Ga0395901_0005264 Ga0395901_0005264_11203_11565 118
998 3300038443 Ga0395901_0005690 Ga0395901_0005690_10326_10682 118
999 3300038443 Ga0395901_0010242 Ga0395901_0010242_5499_5861 118
1000 3300038443 Ga0395901_0039783 Ga0395901_0039783_4185_4541 118
1001 3300038443 Ga0395901_0050886 Ga0395901_0050886_3141_3497 118
1002 3300038443 Ga0395901_0053375 Ga0395901_0053375_1644_2000 118
1003 3300038443 Ga0395901_0057280 Ga0395901_0057280_1020_1382 118
1004 3300038443 Ga0395901_0061335 Ga0395901_0061335_876_1238 118
1005 3300038443 Ga0395901_0076296 Ga0395901_0076296_603_959 118
1006 3300038443 Ga0395901_0088492 Ga0395901_0088492_2490_2846 118
1007 3300038443 Ga0395901_0145987 Ga0395901_0145987_622_984 118
1008 3300038443 Ga0395901_0163731 Ga0395901_0163731_1398_1760 118
1009 3300038443 Ga0395901_0185856 Ga0395901_0185856_1479_1841 118
1010 3300038443 Ga0395901_0261517 Ga0395901_0261517_549_911 118
1011 3300038443 Ga0395901_0269298 Ga0395901_0269298_1291_1647 118
1012 3300038443 Ga0395901_0345565 Ga0395901_0345565_833_1189 118
1013 3300038443 Ga0395901_0348510 Ga0395901_0348510_34_390 118
1014 3300038443 Ga0395901_0498078 Ga0395901_0498078_492_848 118
1015 3300038443 Ga0395901_0669949 Ga0395901_0669949_408_764 118
1016 3300038443 Ga0395901_0685636 Ga0395901_0685636_117_473 118
1017 3300038443 Ga0395901_0724987 Ga0395901_0724987_19_375 118
1018 3300038443 Ga0395901_0787278 Ga0395901_0787278_77_439 118
1019 3300038443 Ga0395901_0870417 Ga0395901_0870417_210_572 118
1020 3300038443 Ga0395901_0933710 Ga0395901_0933710_426_782 118
1021 3300038443 Ga0395901_1653804 Ga0395901_1653804_105_467 118
1022 3300038443 Ga0395901_1691406 Ga0395901_1691406_186_548 118
1023 3300038443 Ga0395901_1694814 Ga0395901_1694814_70_426 118
1024 3300039437 Ga0436365_0228661 Ga0436365_0228661_8205_8561 118
1025 3300039450 Ga0436363_1018584 Ga0436363_1018584_96_452 118
1026 3300041486 Ga0451807_0382904 Ga0451807_0382904_79_441 118
1027 3300041498 Ga0451841_1048754 Ga0451841_1048754_74_430 118
1028 3300042004 Ga0439445_0092782 Ga0439445_0092782_206_568 118
1029 3300042005 Ga0439448_0017830 Ga0439448_0017830_671_1033 118
1030 3300042006 Ga0439432_034264 Ga0439432_034264_1061_1423 118
1031 3300042012 Ga0439455_0013618 Ga0439455_0013618_847_1209 118
1032 3300042144 Ga0450889_003538 Ga0450889_003538_91_453 118
1033 3300042157 Ga0439458_0010029 Ga0439458_0010029_667_1029 118
1034 3300044656 Ga0466969_0001723 Ga0466969_0001723_7735_8091 118
1035 3300044658 Ga0466972_0046751 Ga0466972_0046751_352_708 118
1036 3300044684 Ga0466966_0008151 Ga0466966_0008151_2494_2850 118
1037 3300044684 Ga0466966_0015180 Ga0466966_0015180_3184_3540 118
1038 3300044684 Ga0466966_0068982 Ga0466966_0068982_1662_2018 118
1039 3300044684 Ga0466966_0078694 Ga0466966_0078694_967_1323 118
1040 3300044684 Ga0466966_0171253 Ga0466966_0171253_953_1309 118
1041 3300044693 Ga0466961_0037164 Ga0466961_0037164_2668_3024 118
1042 3300044693 Ga0466961_0038219 Ga0466961_0038219_1990_2346 118
1043 3300044693 Ga0466961_0090755 Ga0466961_0090755_841_1197 118
1044 3300044693 Ga0466961_0174858 Ga0466961_0174858_205_561 118
1045 3300044693 Ga0466961_0282070 Ga0466961_0282070_56_412 118
1046 3300044693 Ga0466961_0360665 Ga0466961_0360665_144_500 118
1047 3300044694 Ga0466963_0000077 Ga0466963_0000077_18102_18458 118
1048 3300044694 Ga0466963_0002279 Ga0466963_0002279_6935_7291 118
1049 3300044694 Ga0466963_0040632 Ga0466963_0040632_1476_1832 118
1050 3300044694 Ga0466963_0061720 Ga0466963_0061720_645_1001 118
1051 3300044694 Ga0466963_0608714 Ga0466963_0608714_183_539 118
1052 3300044694 Ga0466963_0740974 Ga0466963_0740974_59_415 118
1053 3300044694 Ga0466963_1290273 Ga0466963_1290273_77_433 118
1054 3300044706 Ga0466964_0029081 Ga0466964_0029081_305_661 118
1055 3300044719 Ga0466971_0000515 Ga0466971_0000515_9300_9656 118
1056 3300044719 Ga0466971_0050581 Ga0466971_0050581_484_840 118
1057 3300044719 Ga0466971_0102295 Ga0466971_0102295_286_642 118
1058 3300044735 Ga0466968_0346329 Ga0466968_0346329_232_588 118
1059 3300044765 Ga0466970_0051025 Ga0466970_0051025_414_770 118
1060 3300044842 Ga0466957_0002641 Ga0466957_0002641_6074_6430 118
1061 3300044842 Ga0466957_0012397 Ga0466957_0012397_2054_2410 118
1062 3300044842 Ga0466957_0018848 Ga0466957_0018848_216_572 118
1063 3300044842 Ga0466957_0165201 Ga0466957_0165201_172_528 118
1064 3300044842 Ga0466957_0545597 Ga0466957_0545597_73_429 118
1065 3300044901 Ga0466960_0180407 Ga0466960_0180407_127_483 118
1066 3300044901 Ga0466960_0202282 Ga0466960_0202282_126_482 118
1067 3300045049 Ga0466959_0011195 Ga0466959_0011195_3991_4347 118
1068 3300045049 Ga0466959_0022001 Ga0466959_0022001_2658_3014 118
1069 3300045049 Ga0466959_0039843 Ga0466959_0039843_2916_3272 118
1070 3300045049 Ga0466959_0095379 Ga0466959_0095379_1636_1992 118
1071 3300045049 Ga0466959_0144683 Ga0466959_0144683_655_1011 118
1072 3300045049 Ga0466959_0331301 Ga0466959_0331301_394_750 118
1073 3300045836 Ga0466958_0001733 Ga0466958_0001733_5351_5707 118
1074 3300045836 Ga0466958_0017457 Ga0466958_0017457_2492_2848 118
1075 3300045836 Ga0466958_0028609 Ga0466958_0028609_1865_2221 118
1076 3300045836 Ga0466958_0182867 Ga0466958_0182867_279_635 118
1077 3300045836 Ga0466958_1153465 Ga0466958_1153465_125_481 118
1078 3300045976 Ga0466967_0000024 Ga0466967_0000024_12248_12604 118
1079 3300045976 Ga0466967_0032643 Ga0466967_0032643_3111_3467 118
1080 3300045976 Ga0466967_0047965 Ga0466967_0047965_2528_2884 118
1081 3300045976 Ga0466967_0066940 Ga0466967_0066940_977_1333 118
1082 3300045976 Ga0466967_0075768 Ga0466967_0075768_1230_1586 118
1083 3300045976 Ga0466967_0088337 Ga0466967_0088337_1936_2292 118
1084 3300045976 Ga0466967_0097852 Ga0466967_0097852_2055_2411 118
1085 3300045976 Ga0466967_0212012 Ga0466967_0212012_1349_1705 118
1086 3300045976 Ga0466967_0328619 Ga0466967_0328619_707_1063 118
1087 3300045976 Ga0466967_0389671 Ga0466967_0389671_686_1042 118
1088 3300045976 Ga0466967_0531505 Ga0466967_0531505_273_629 118
1089 3300046459 Ga0495629_0665849 Ga0495629_0665849_61_423 118
1090 3300046506 Ga0495583_0081784 Ga0495583_0081784_406_783 118
1091 3300046506 Ga0495583_0378622 Ga0495583_0378622_128_484 118
1092 3300046522 Ga0495643_0178063 Ga0495643_0178063_33_410 118
1093 3300046524 Ga0495648_0104660 Ga0495648_0104660_602_979 118
1094 3300046525 Ga0495663_0038288 Ga0495663_0038288_633_989 118
1095 3300046525 Ga0495663_0191731 Ga0495663_0191731_186_548 118
1096 3300046528 Ga0495642_0084635 Ga0495642_0084635_357_713 118
1097 3300046616 Ga0495668_0014585 Ga0495668_0014585_1484_1840 118
1098 3300046616 Ga0495668_0132326 Ga0495668_0132326_986_1342 118
1099 3300046616 Ga0495668_0477719 Ga0495668_0477719_282_638 118
1100 3300046660 Ga0495625_0190931 Ga0495625_0190931_735_1112 118
1101 3300046660 Ga0495625_0374429 Ga0495625_0374429_334_696 118
1102 3300046684 Ga0495669_0001938 Ga0495669_0001938_5014_5370 118
1103 3300046684 Ga0495669_0008002 Ga0495669_0008002_3964_4320 118
1104 3300046684 Ga0495669_0017008 Ga0495669_0017008_2296_2658 118
1105 3300046684 Ga0495669_0024855 Ga0495669_0024855_164_526 118
1106 3300046684 Ga0495669_0061422 Ga0495669_0061422_576_932 118
1107 3300046684 Ga0495669_0412087 Ga0495669_0412087_198_554 118
1108 3300047445 Ga0495677_0012781 Ga0495677_0012781_2231_2608 118
1109 3300047445 Ga0495677_0101894 Ga0495677_0101894_255_611 118
1110 3300047445 Ga0495677_0112009 Ga0495677_0112009_31_393 118
1111 3300047445 Ga0495677_0130739 Ga0495677_0130739_40_396 118
1112 3300047445 Ga0495677_0303756 Ga0495677_0303756_15_371 118
1113 3300047472 Ga0495686_0369569 Ga0495686_0369569_60_416 118
1114 3300048903 Ga0496100_0016396 Ga0496100_0016396_3917_4273 118
1115 3300048903 Ga0496100_0093097 Ga0496100_0093097_1234_1590 118
1116 3300048904 Ga0496101_0061368 Ga0496101_0061368_1353_1709 118
1117 3300048904 Ga0496101_0195983 Ga0496101_0195983_711_1067 118
1118 3300048904 Ga0496101_0701789 Ga0496101_0701789_141_497 118
1119 3300048904 Ga0496101_0783348 Ga0496101_0783348_167_523 118
1120 3300048908 Ga0496105_0770918 Ga0496105_0770918_238_594 118
1121 3300048909 Ga0496106_0011126 Ga0496106_0011126_84_440 118
1122 3300048909 Ga0496106_0297977 Ga0496106_0297977_496_852 118
1123 3300048910 Ga0496107_0000486 Ga0496107_0000486_17032_17388 118
1124 3300048910 Ga0496107_0031786 Ga0496107_0031786_853_1209 118
1125 3300048910 Ga0496107_0259413 Ga0496107_0259413_405_761 118
1126 3300048911 Ga0496108_0027908 Ga0496108_0027908_1354_1710 118
1127 3300048911 Ga0496108_0085092 Ga0496108_0085092_1164_1520 118
1128 3300048912 Ga0496109_0001936 Ga0496109_0001936_4348_4704 118
1129 3300048912 Ga0496109_0019198 Ga0496109_0019198_4056_4412 118
1130 3300048912 Ga0496109_0123749 Ga0496109_0123749_1633_1995 118
1131 3300048912 Ga0496109_0506227 Ga0496109_0506227_731_1087 118
1132 3300048913 Ga0496110_0002358 Ga0496110_0002358_1748_2104 118
1133 3300048913 Ga0496110_0178827 Ga0496110_0178827_1003_1359 118
1134 3300048913 Ga0496110_0427508 Ga0496110_0427508_318_674 118
1135 3300048913 Ga0496110_0464749 Ga0496110_0464749_410_772 118
1136 3300048914 Ga0496111_0000826 Ga0496111_0000826_1773_2129 118
1137 3300048914 Ga0496111_0282910 Ga0496111_0282910_503_859 118
1138 3300048914 Ga0496111_0407524 Ga0496111_0407524_547_909 118
1139 3300048914 Ga0496111_0893124 Ga0496111_0893124_39_395 118
1140 3300048915 Ga0496112_0000424 Ga0496112_0000424_13035_13391 118
1141 3300048915 Ga0496112_0002624 Ga0496112_0002624_9591_9947 118
1142 3300048915 Ga0496112_0026625 Ga0496112_0026625_2599_2961 118
1143 3300048915 Ga0496112_0173381 Ga0496112_0173381_1291_1647 118
1144 3300048915 Ga0496112_0244091 Ga0496112_0244091_581_943 118
1145 3300048915 Ga0496112_1511946 Ga0496112_1511946_210_566 118
1146 3300048916 Ga0496113_0009432 Ga0496113_0009432_2609_2965 118
1147 3300048916 Ga0496113_0011808 Ga0496113_0011808_5108_5464 118
1148 3300048916 Ga0496113_0064005 Ga0496113_0064005_152_508 118
1149 3300048924 Ga0496121_0006369 Ga0496121_0006369_10158_10535 118
1150 3300049584 Ga0501068_0235869 Ga0501068_0235869_736_1092 118
1151 3300049586 Ga0501070_0095776 Ga0501070_0095776_64_441 118
1152 3300049590 Ga0501074_0004661 Ga0501074_0004661_8692_9048 118
1153 3300049742 Ga0501080_0080833 Ga0501080_0080833_1985_2341 118
1154 3300050496 nmdc:mga07m45_696760_c1 nmdc:mga07m45_696760_c1_19_381 118
1155 3300050508 nmdc:mga09592_460145_c1 nmdc:mga09592_460145_c1_587_949 118
1156 3300050511 nmdc:mga08y16_109930_c1 nmdc:mga08y16_109930_c1_2058_2420 118
1157 3300050512 nmdc:mga0n895_83041_c1 nmdc:mga0n895_83041_c1_2647_3009 118
1158 3300053085 Ga0495619_0617800 Ga0495619_0617800_134_508 118
1159 3300053087 Ga0500643_018685 Ga0500643_018685_1180_1557 118
1160 3300053104 Ga0500556_0016263 Ga0500556_0016263_1235_1612 118
1161 3300053730 Ga0500645_001039 Ga0500645_001039_418_795 118
1162 3300053730 Ga0500645_009051 Ga0500645_009051_1148_1525 118
1163 3300054114 Ga0501084_1113219 Ga0501084_1113219_180_536 118
1164 3300061719 Ga0466962_0018309 Ga0466962_0018309_192_548 118
1165 3300061719 Ga0466962_0047614 Ga0466962_0047614_782_1138 118
1166 3300061719 Ga0466962_0211945 Ga0466962_0211945_187_543 118
1167 3300061719 Ga0466962_0447559 Ga0466962_0447559_103_459 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

21

117

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.8193 4 106
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7182 4 106
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6958 5 105
2jfg-assembly1.cif.gz_A crystal structure of murd ligase in complex with uma and adp 0.6952 17 38
6lnw-assembly1.cif.gz_A crystal structure of accessory secretory protein 1,2 and 3 in streptococcus pneumoniae 0.6864 16 55
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8281 6 114 3.30.70.1230
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8219 4 115 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8194 4 106 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7834 4 115 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7823 5 115 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A520HTS9-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9746 5 118 GO:0004644
GO:0005829
GO:0006189
AF-A0A7G6XYD8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9716 6 118 GO:0003677
AF-A0A437J9S3-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9707 5 115 GO:0004644
GO:0005829
GO:0006189
AF-A0A1E3M0G2-F1-model_v4 Phosphoribosylglycinamide formyltransferase 0.9662 4 118
AF-A0A1G2W6C6-F1-model_v4 Phosphoribosylglycinamide formyltransferase 0.9644 4 113

Feature Viewer

pLDDT pTM Quality
93.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map