F491005

General Info

Members Datasets Scaffolds Average Seq Length
1161 372 2323 144

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100288223|Ga0070713_1002882232
Length 167
Sequence VSAAGSTEPQRGGGAGLAGTSAGAVELLIRKVRPNAVVPVRAYSGDAGLDLTSCDRVELAPGERALVPTGLAVAIPQGYAGYVQPRSGLAAKHGISIVNTPGLVDSGYRGELLVSLINTDRDETFVVEEGMRIAQLVILEVPDVELVEVGELPESERGVRGFGSSLH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
217 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
231 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
235 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
236 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
237 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
298 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 10.42
Rhizosphere 88.11
Stem 0
Stem Tuber 0
Unclassified 7.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100288223 3300005436 Bacteria 1508
2 rootH1_10083481 3300003316 Bacteria 1260
3 rootH1_10083481 3300003323 Bacteria 3926
4 Ga0055536_1016854 3300003781 Bacteria 2420
5 Ga0070658_10015018 3300005327 Bacteria 6199
6 Ga0070658_11622738 3300005327 Bacteria 560
7 Ga0070683_100090265 3300005329 Bacteria 2877
8 Ga0070683_100106871 3300005329 Bacteria 2639
9 Ga0070683_100133383 3300005329 Bacteria 2350
10 Ga0070683_100351431 3300005329 Bacteria 1404
11 Ga0070683_100361342 3300005329 Bacteria 1383
12 Ga0070683_101412908 3300005329 Bacteria 669
13 Ga0070690_100022168 3300005330 Bacteria 3884
14 Ga0070680_100011868 3300005336 Bacteria 6757
15 Ga0070680_100045576 3300005336 Bacteria 3565
16 Ga0070680_100113919 3300005336 Bacteria 2253
17 Ga0070680_100275589 3300005336 Bacteria 1425
18 Ga0070680_100277450 3300005336 Bacteria 1420
19 Ga0070680_100387154 3300005336 Bacteria 1191
20 Ga0070680_100491221 3300005336 Unclassified 1050
21 Ga0070680_101261833 3300005336 Unclassified 639
22 Ga0070682_100017679 3300005337 Bacteria 4159
23 Ga0070682_100275234 3300005337 Bacteria 1225
24 Ga0070682_100280796 3300005337 Bacteria 1214
25 Ga0070682_101680932 3300005337 Bacteria 551
26 Ga0068868_100330391 3300005338 Bacteria 1301
27 Ga0070660_100005889 3300005339 Bacteria 8480
28 Ga0070660_100006898 3300005339 Bacteria 7880
29 Ga0070660_100050468 3300005339 Bacteria 3201
30 Ga0070660_100094004 3300005339 Bacteria 2368
31 Ga0070660_100316319 3300005339 Bacteria 1282
32 Ga0070660_100399081 3300005339 Bacteria 1137
33 Ga0070661_100008922 3300005344 Bacteria 6939
34 Ga0070661_100068128 3300005344 Bacteria 2616
35 Ga0070661_100541446 3300005344 Bacteria 936
36 Ga0070661_100682140 3300005344 Bacteria 836
37 Ga0070668_100243128 3300005347 Bacteria 1492
38 Ga0070668_100503123 3300005347 Bacteria 1049
39 Ga0070671_101091040 3300005355 Bacteria 701
40 Ga0070674_100045155 3300005356 Bacteria 3009
41 Ga0070674_100200934 3300005356 Bacteria 1539
42 Ga0070659_100016427 3300005366 Bacteria 5558
43 Ga0070659_100065967 3300005366 Bacteria 2868
44 Ga0070659_100436503 3300005366 Bacteria 1109
45 Ga0070703_10052668 3300005406 Bacteria 1306
46 Ga0070709_10038941 3300005434 Bacteria 2914
47 Ga0070709_10054242 3300005434 Bacteria 2526
48 Ga0070714_100027889 3300005435 Bacteria 4679
49 Ga0070714_100237429 3300005435 Bacteria 1681
50 Ga0070714_100457453 3300005435 Bacteria 1213
51 Ga0070714_100512846 3300005435 Bacteria 1144
52 Ga0070713_100029423 3300005436 Bacteria 4351
53 Ga0070713_100114286 3300005436 Bacteria 2358
54 Ga0070713_100594243 3300005436 Bacteria 1051
55 Ga0070713_101108383 3300005436 Unclassified 765
56 Ga0070710_10145350 3300005437 Unclassified 1458
57 Ga0070710_10347753 3300005437 Bacteria 980
58 Ga0070701_10543217 3300005438 Unclassified 761
59 Ga0070711_100215557 3300005439 Unclassified 1489
60 Ga0070705_100003771 3300005440 Bacteria 7418
61 Ga0070705_100045000 3300005440 Bacteria 2537
62 Ga0070705_100315915 3300005440 Bacteria 1125
63 Ga0070705_101075256 3300005440 Bacteria 657
64 Ga0070705_101342046 3300005440 Bacteria 594
65 Ga0070694_100018073 3300005444 Bacteria 4468
66 Ga0070694_100020899 3300005444 Bacteria 4177
67 Ga0070694_100581936 3300005444 Bacteria 900
68 Ga0070708_100299681 3300005445 Bacteria 1514
69 Ga0070708_100757654 3300005445 Unclassified 913
70 Ga0070663_100342264 3300005455 Bacteria 1209
71 Ga0070663_100533094 3300005455 Bacteria 979
72 Ga0070678_100050944 3300005456 Bacteria 2998
73 Ga0070662_100024466 3300005457 Bacteria 4160
74 Ga0070662_100034689 3300005457 Bacteria 3559
75 Ga0070662_100166874 3300005457 Bacteria 1726
76 Ga0070662_100659583 3300005457 Bacteria 883
77 Ga0070681_10001211 3300005458 Bacteria 22450
78 Ga0070681_10006154 3300005458 Bacteria 11657
79 Ga0070681_10024508 3300005458 Bacteria 6073
80 Ga0070681_10031476 3300005458 Bacteria 5326
81 Ga0070681_10068450 3300005458 Bacteria 3516
82 Ga0070681_10079201 3300005458 Bacteria 3242
83 Ga0070681_10117839 3300005458 Unclassified 2592
84 Ga0070681_10128247 3300005458 Bacteria 2469
85 Ga0070681_10216002 3300005458 Bacteria 1833
86 Ga0070681_10544970 3300005458 Bacteria 1074
87 Ga0070681_10650528 3300005458 Unclassified 969
88 Ga0070706_100009634 3300005467 Bacteria 8980
89 Ga0070706_100036148 3300005467 Bacteria 4560
90 Ga0070706_100191202 3300005467 Bacteria 1912
91 Ga0070706_100428495 3300005467 Bacteria 1231
92 Ga0070706_100788749 3300005467 Bacteria 880
93 Ga0070707_100087885 3300005468 Bacteria 3006
94 Ga0070707_100117452 3300005468 Bacteria 2582
95 Ga0070707_100547674 3300005468 Bacteria 1119
96 Ga0070707_101281840 3300005468 Bacteria 699
97 Ga0070698_100006972 3300005471 Bacteria 12237
98 Ga0070698_100134600 3300005471 Bacteria 2425
99 Ga0070698_101538051 3300005471 Bacteria 617
100 Ga0070699_100033968 3300005518 Bacteria 4408
101 Ga0070699_100139917 3300005518 Unclassified 2137
102 Ga0070699_100186211 3300005518 Bacteria 1843
103 Ga0070699_100700419 3300005518 Bacteria 925
104 Ga0070699_101957396 3300005518 Bacteria 536
105 Ga0070679_100005979 3300005530 Bacteria 11312
106 Ga0070679_100018501 3300005530 Bacteria 6762
107 Ga0070679_100101945 3300005530 Bacteria 2857
108 Ga0070679_100165307 3300005530 Bacteria 2186
109 Ga0070679_100192070 3300005530 Bacteria 2010
110 Ga0070679_100395151 3300005530 Bacteria 1329
111 Ga0070684_100003711 3300005535 Bacteria 11519
112 Ga0070684_100025315 3300005535 Bacteria 4987
113 Ga0070684_100107435 3300005535 Bacteria 2499
114 Ga0070684_100174590 3300005535 Bacteria 1952
115 Ga0070684_100338222 3300005535 Bacteria 1384
116 Ga0070684_100375674 3300005535 Bacteria 1309
117 Ga0070684_100520197 3300005535 Bacteria 1103
118 Ga0070697_100091492 3300005536 Bacteria 2516
119 Ga0070697_100315929 3300005536 Bacteria 1344
120 Ga0068853_100256877 3300005539 Archaea 1605
121 Ga0068853_100337001 3300005539 Bacteria 1401
122 Ga0068853_100434617 3300005539 Bacteria 1233
123 Ga0068853_100652120 3300005539 Bacteria 1002
124 Ga0068853_100756774 3300005539 Bacteria 929
125 Ga0068853_100915149 3300005539 Bacteria 843
126 Ga0070686_101202754 3300005544 Bacteria 630
127 Ga0070695_100014734 3300005545 Bacteria 4716
128 Ga0070695_100282335 3300005545 Bacteria 1220
129 Ga0070695_101000961 3300005545 Unclassified 680
130 Ga0070696_100011162 3300005546 Bacteria 6011
131 Ga0070696_100060489 3300005546 Bacteria 2648
132 Ga0070696_100981743 3300005546 Bacteria 705
133 Ga0070693_101366710 3300005547 Bacteria 549
134 Ga0070665_100000142 3300005548 Bacteria 133773
135 Ga0070665_100072181 3300005548 Bacteria 3460
136 Ga0070704_100008285 3300005549 Bacteria 6223
137 Ga0070704_100247383 3300005549 Bacteria 1462
138 Ga0070704_100249105 3300005549 Bacteria 1458
139 Ga0070704_100389047 3300005549 Bacteria 1187
140 Ga0070704_100441332 3300005549 Bacteria 1119
141 Ga0068855_100036020 3300005563 Bacteria 5891
142 Ga0068855_100095467 3300005563 Bacteria 3427
143 Ga0068855_100130908 3300005563 Bacteria 2865
144 Ga0068855_100144957 3300005563 Bacteria 2704
145 Ga0068855_100196745 3300005563 Bacteria 2271
146 Ga0070664_100109893 3300005564 Bacteria 2405
147 Ga0068857_100036003 3300005577 Bacteria 4385
148 Ga0068857_100071265 3300005577 Bacteria 3096
149 Ga0068857_100186832 3300005577 Bacteria 1887
150 Ga0068857_100415318 3300005577 Bacteria 1254
151 Ga0068857_100444783 3300005577 Bacteria 1211
152 Ga0068854_100191026 3300005578 Bacteria 1605
153 Ga0068854_100863282 3300005578 Unclassified 793
154 Ga0068856_100041648 3300005614 Bacteria 4515
155 Ga0068856_100058145 3300005614 Bacteria 3818
156 Ga0068856_100117044 3300005614 Bacteria 2666
157 Ga0068856_101719086 3300005614 Bacteria 640
158 Ga0070702_100015906 3300005615 Bacteria 3851
159 Ga0070702_100950741 3300005615 Unclassified 676
160 Ga0068852_100109972 3300005616 Bacteria 2503
161 Ga0068852_101746418 3300005616 Bacteria 645
162 Ga0068852_102010131 3300005616 Bacteria 600
163 Ga0068864_101489597 3300005618 Bacteria 680
164 Ga0068866_10511614 3300005718 Bacteria 796
165 Ga0068861_100174548 3300005719 Bacteria 1784
166 Ga0068861_100181348 3300005719 Bacteria 1753
167 Ga0068861_100185501 3300005719 Bacteria 1735
168 Ga0068861_100577336 3300005719 Bacteria 1028
169 Ga0068851_10741341 3300005834 Bacteria 607
170 Ga0068870_10212321 3300005840 Unclassified 1180
171 Ga0068858_100728118 3300005842 Bacteria 966
172 Ga0068858_100744286 3300005842 Bacteria 955
173 Ga0068860_100656249 3300005843 Bacteria 1057
174 Ga0068862_100131447 3300005844 Bacteria 2214
175 Ga0081455_10017728 3300005937 Bacteria 6813
176 Ga0081455_10077687 3300005937 Bacteria 2730
177 Ga0081455_10635467 3300005937 Bacteria 690
178 Ga0081538_10016843 3300005981 Bacteria 5579
179 Ga0081538_10047916 3300005981 Bacteria 2614
180 Ga0081538_10112208 3300005981 Bacteria 1335
181 Ga0081538_10148313 3300005981 Bacteria 1067
182 Ga0081538_10195083 3300005981 Bacteria 842
183 Ga0081540_1004007 3300005983 Bacteria 11415
184 Ga0081539_10020311 3300005985 Bacteria 4497
185 Ga0081539_10030307 3300005985 Bacteria 3360
186 Ga0070717_10167785 3300006028 Bacteria 1908
187 Ga0070717_10229347 3300006028 Bacteria 1634
188 Ga0075365_10058287 3300006038 Bacteria 2571
189 Ga0075432_10059872 3300006058 Bacteria 1354
190 Ga0075432_10073276 3300006058 Unclassified 1233
191 Ga0075432_10176282 3300006058 Bacteria 834
192 Ga0070715_10061469 3300006163 Unclassified 1649
193 Ga0070716_100006808 3300006173 Bacteria 5602
194 Ga0070712_100025054 3300006175 Bacteria 3960
195 Ga0070712_100048361 3300006175 Bacteria 2948
196 Ga0070712_100085325 3300006175 Bacteria 2298
197 Ga0070712_100115895 3300006175 Bacteria 2008
198 Ga0070712_100309241 3300006175 Bacteria 1282
199 Ga0070712_100546091 3300006175 Bacteria 976
200 Ga0097621_100698197 3300006237 Unclassified 934
201 Ga0068871_101333120 3300006358 Unclassified 675
202 Ga0075428_100459735 3300006844 Bacteria 1363
203 Ga0075428_102454767 3300006844 Bacteria 534
204 Ga0075430_100002108 3300006846 Bacteria 16435
205 Ga0075430_100810498 3300006846 Bacteria 771
206 Ga0075431_100054564 3300006847 Bacteria 4121
207 Ga0075431_100197507 3300006847 Bacteria 2059
208 Ga0075431_101051129 3300006847 Bacteria 780
209 Ga0075433_10033888 3300006852 Bacteria 4381
210 Ga0075433_10078996 3300006852 Bacteria 2899
211 Ga0075433_10519534 3300006852 Unclassified 1047
212 Ga0075433_10803364 3300006852 Unclassified 822
213 Ga0075434_100005176 3300006871 Bacteria 11840
214 Ga0075434_100082259 3300006871 Bacteria 3217
215 Ga0075434_100271564 3300006871 Bacteria 1715
216 Ga0075434_100427497 3300006871 Bacteria 1346
217 Ga0075429_101096219 3300006880 Unclassified 695
218 Ga0075429_101905878 3300006880 Bacteria 515
219 Ga0068865_100168492 3300006881 Bacteria 1677
220 Ga0075436_100000947 3300006914 Bacteria 19413
221 Ga0075435_100002357 3300007076 Bacteria 12519
222 Ga0075435_100021556 3300007076 Bacteria 4958
223 Ga0075435_100030973 3300007076 Bacteria 4211
224 Ga0075435_100444515 3300007076 Unclassified 1118
225 Ga0105240_10286551 3300009093 Bacteria 1890
226 Ga0105240_10324900 3300009093 Bacteria 1752
227 Ga0105240_10393176 3300009093 Bacteria 1563
228 Ga0105240_11360004 3300009093 Bacteria 747
229 Ga0111539_10007332 3300009094 Bacteria 14124
230 Ga0111539_10010679 3300009094 Bacteria 11564
231 Ga0111539_10159167 3300009094 Bacteria 2641
232 Ga0105245_10012746 3300009098 Bacteria 7321
233 Ga0105245_10122058 3300009098 Bacteria 2435
234 Ga0105245_10236379 3300009098 Archaea 1769
235 Ga0105245_10262077 3300009098 Unclassified 1683
236 Ga0105245_10585833 3300009098 Bacteria 1140
237 Ga0105245_10660783 3300009098 Unclassified 1076
238 Ga0114129_10017065 3300009147 Bacteria 10335
239 Ga0114129_10039336 3300009147 Bacteria 6666
240 Ga0114129_10041692 3300009147 Bacteria 6465
241 Ga0114129_10189661 3300009147 Bacteria 2792
242 Ga0114129_10194674 3300009147 Bacteria 2750
243 Ga0114129_10269908 3300009147 Bacteria 2276
244 Ga0114129_10411492 3300009147 Bacteria 1781
245 Ga0114129_10568928 3300009147 Bacteria 1472
246 Ga0114129_10687902 3300009147 Unclassified 1316
247 Ga0114129_11293096 3300009147 Bacteria 904
248 Ga0114129_12106237 3300009147 Unclassified 680
249 Ga0105243_10075875 3300009148 Bacteria 2730
250 Ga0105243_10157419 3300009148 Bacteria 1955
251 Ga0105243_10214655 3300009148 Bacteria 1696
252 Ga0105243_10625258 3300009148 Bacteria 1040
253 Ga0105241_10458424 3300009174 Bacteria 1129
254 Ga0105242_10405602 3300009176 Bacteria 1273
255 Ga0105248_10024828 3300009177 Bacteria 6664
256 Ga0105237_10052617 3300009545 Bacteria 4087
257 Ga0105237_10126052 3300009545 Bacteria 2555
258 Ga0105237_10331478 3300009545 Bacteria 1526
259 Ga0105237_10812354 3300009545 Bacteria 942
260 Ga0105238_10167719 3300009551 Bacteria 2172
261 Ga0105238_11004558 3300009551 Unclassified 855
262 Ga0105238_11198556 3300009551 Unclassified 784
263 Ga0105249_10010851 3300009553 Bacteria 8006
264 Ga0105249_10071305 3300009553 Bacteria 3209
265 Ga0105249_10153800 3300009553 Bacteria 2217
266 Ga0105249_10564101 3300009553 Bacteria 1190
267 Ga0105249_10938293 3300009553 Bacteria 933
268 Ga0105239_10038088 3300010375 Bacteria 5268
269 Ga0105239_10195213 3300010375 Bacteria 2267
270 Ga0105239_10279255 3300010375 Bacteria 1880
271 Ga0105239_10428923 3300010375 Bacteria 1498
272 Ga0105239_10954450 3300010375 Bacteria 985
273 Ga0105239_11643418 3300010375 Bacteria 743
274 Ga0105239_11834665 3300010375 Bacteria 703
275 Ga0105239_13085444 3300010375 Bacteria 543
276 Ga0105246_10012450 3300011119 Bacteria 5311
277 Ga0105246_11186414 3300011119 Bacteria 702
278 Ga0154010_174948 3300013062 Bacteria 854
279 Ga0157373_10085393 3300013100 Bacteria 2225
280 Ga0157373_10433225 3300013100 Bacteria 945
281 Ga0157371_10230787 3300013102 Bacteria 1330
282 Ga0157371_10421269 3300013102 Bacteria 979
283 Ga0157370_10023626 3300013104 Bacteria 6101
284 Ga0157370_10132064 3300013104 Bacteria 2329
285 Ga0157370_10141219 3300013104 Bacteria 2244
286 Ga0157370_10180672 3300013104 Bacteria 1961
287 Ga0157370_10797802 3300013104 Bacteria 859
288 Ga0157369_10019033 3300013105 Bacteria 7688
289 Ga0157369_10071417 3300013105 Bacteria 3727
290 Ga0157369_10179200 3300013105 Bacteria 2230
291 Ga0157369_10216570 3300013105 Bacteria 2006
292 Ga0157369_11064392 3300013105 Bacteria 827
293 Ga0157374_10196026 3300013296 Bacteria 1977
294 Ga0157374_10961010 3300013296 Bacteria 873
295 Ga0157378_11250738 3300013297 Bacteria 783
296 Ga0163162_10155009 3300013306 Bacteria 2410
297 Ga0163162_10207142 3300013306 Bacteria 2090
298 Ga0157372_10034055 3300013307 Bacteria 5597
299 Ga0157372_10072877 3300013307 Bacteria 3870
300 Ga0157372_10140424 3300013307 Bacteria 2782
301 Ga0157372_10344712 3300013307 Bacteria 1735
302 Ga0157372_10383457 3300013307 Bacteria 1637
303 Ga0157372_10386050 3300013307 Bacteria 1632
304 Ga0157372_10396235 3300013307 Bacteria 1609
305 Ga0157372_10962358 3300013307 Bacteria 989
306 Ga0157375_10213871 3300013308 Bacteria 2085
307 Ga0157375_10353724 3300013308 Bacteria 1635
308 Ga0157375_10385089 3300013308 Bacteria 1569
309 Ga0157375_10440914 3300013308 Bacteria 1468
310 Ga0157375_13353484 3300013308 Bacteria 534
311 Ga0163163_10363098 3300014325 Unclassified 1505
312 Ga0157380_10625154 3300014326 Bacteria 1070
313 Ga0182008_10000487 3300014497 Bacteria 29903
314 Ga0182008_10285942 3300014497 Unclassified 859
315 Ga0157377_10620612 3300014745 Bacteria 774
316 Ga0182007_10010452 3300015262 Bacteria 3663
317 Ga0182007_10131856 3300015262 Bacteria 841
318 Ga0163161_10090047 3300017792 Bacteria 2270
319 Ga0163161_10287801 3300017792 Bacteria 1291
320 Ga0206356_11060558 3300020070 Bacteria 971
321 Ga0206356_11537578 3300020070 Bacteria 2051
322 Ga0206354_10308263 3300020081 Bacteria 4394
323 Ga0206354_10578468 3300020081 Bacteria 1263
324 Ga0206354_11268256 3300020081 Bacteria 2488
325 Ga0206354_11547566 3300020081 Bacteria 1557
326 Ga0206353_10116331 3300020082 Bacteria 1517
327 Ga0206353_10302908 3300020082 Bacteria 1609
328 Ga0206353_10850770 3300020082 Bacteria 868
329 Ga0206353_10926494 3300020082 Bacteria 1412
330 Ga0206353_10938317 3300020082 Bacteria 2345
331 Ga0206353_11810256 3300020082 Bacteria 3863
332 Ga0207653_10005347 3300025885 Bacteria 4013
333 Ga0207692_10177496 3300025898 Unclassified 1239
334 Ga0207642_10060751 3300025899 Bacteria 1754
335 Ga0207685_10099454 3300025905 Bacteria 1241
336 Ga0207699_10029805 3300025906 Bacteria 3046
337 Ga0207699_10060017 3300025906 Bacteria 2281
338 Ga0207699_10194100 3300025906 Bacteria 1372
339 Ga0207699_10623354 3300025906 Bacteria 786
340 Ga0207643_10074177 3300025908 Bacteria 1962
341 Ga0207705_10090402 3300025909 Bacteria 2241
342 Ga0207705_10113187 3300025909 Bacteria 2007
343 Ga0207705_10817174 3300025909 Bacteria 723
344 Ga0207684_10000595 3300025910 Bacteria 43323
345 Ga0207684_10071641 3300025910 Bacteria 2944
346 Ga0207684_10138858 3300025910 Bacteria 2088
347 Ga0207684_10238457 3300025910 Bacteria 1569
348 Ga0207684_10249809 3300025910 Bacteria 1530
349 Ga0207684_10554929 3300025910 Unclassified 983
350 Ga0207654_10127579 3300025911 Bacteria 1606
351 Ga0207707_10007562 3300025912 Bacteria 9465
352 Ga0207707_10031713 3300025912 Bacteria 4625
353 Ga0207707_10052819 3300025912 Bacteria 3537
354 Ga0207707_10055911 3300025912 Bacteria 3433
355 Ga0207707_10070608 3300025912 Bacteria 3043
356 Ga0207707_10070905 3300025912 Bacteria 3036
357 Ga0207707_10144845 3300025912 Unclassified 2077
358 Ga0207707_10235412 3300025912 Bacteria 1593
359 Ga0207695_10040640 3300025913 Bacteria 4983
360 Ga0207695_10171531 3300025913 Bacteria 2095
361 Ga0207695_10478732 3300025913 Bacteria 1127
362 Ga0207671_10076666 3300025914 Bacteria 2502
363 Ga0207671_10094543 3300025914 Bacteria 2256
364 Ga0207671_10624215 3300025914 Bacteria 859
365 Ga0207693_10001581 3300025915 Bacteria 20145
366 Ga0207693_10004236 3300025915 Bacteria 12165
367 Ga0207693_10021377 3300025915 Bacteria 5142
368 Ga0207693_10035810 3300025915 Bacteria 3912
369 Ga0207693_10530506 3300025915 Bacteria 918
370 Ga0207663_10002524 3300025916 Bacteria 8806
371 Ga0207663_10524872 3300025916 Unclassified 923
372 Ga0207663_10814915 3300025916 Bacteria 744
373 Ga0207660_10017445 3300025917 Bacteria 4770
374 Ga0207660_10017816 3300025917 Bacteria 4726
375 Ga0207660_10027344 3300025917 Bacteria 3891
376 Ga0207660_10087307 3300025917 Bacteria 2304
377 Ga0207660_10128402 3300025917 Bacteria 1927
378 Ga0207660_10272021 3300025917 Bacteria 1342
379 Ga0207660_10310095 3300025917 Bacteria 1258
380 Ga0207660_10387616 3300025917 Bacteria 1124
381 Ga0207660_10524030 3300025917 Bacteria 963
382 Ga0207662_10391450 3300025918 Bacteria 941
383 Ga0207657_10000054 3300025919 Bacteria 106767
384 Ga0207657_10003977 3300025919 Bacteria 15705
385 Ga0207657_10005514 3300025919 Bacteria 13210
386 Ga0207657_10011616 3300025919 Bacteria 8734
387 Ga0207657_10011988 3300025919 Bacteria 8576
388 Ga0207657_10037356 3300025919 Bacteria 4338
389 Ga0207657_10156420 3300025919 Bacteria 1854
390 Ga0207657_10588267 3300025919 Bacteria 869
391 Ga0207649_10034276 3300025920 Bacteria 3040
392 Ga0207649_10039292 3300025920 Bacteria 2868
393 Ga0207649_10129540 3300025920 Bacteria 1712
394 Ga0207649_10408685 3300025920 Bacteria 1017
395 Ga0207649_10690636 3300025920 Bacteria 791
396 Ga0207652_10004445 3300025921 Bacteria 11420
397 Ga0207652_10038262 3300025921 Bacteria 4065
398 Ga0207652_10040882 3300025921 Bacteria 3939
399 Ga0207652_10063362 3300025921 Bacteria 3197
400 Ga0207652_10111726 3300025921 Bacteria 2424
401 Ga0207652_10123670 3300025921 Bacteria 2304
402 Ga0207652_10135715 3300025921 Bacteria 2197
403 Ga0207652_10252087 3300025921 Bacteria 1592
404 Ga0207652_10876169 3300025921 Bacteria 794
405 Ga0207646_10006870 3300025922 Bacteria 11686
406 Ga0207646_10205607 3300025922 Bacteria 1778
407 Ga0207646_10252758 3300025922 Unclassified 1592
408 Ga0207646_10527296 3300025922 Bacteria 1063
409 Ga0207681_10684717 3300025923 Bacteria 852
410 Ga0207694_11323152 3300025924 Bacteria 609
411 Ga0207687_10015768 3300025927 Bacteria 4959
412 Ga0207687_10043101 3300025927 Bacteria 3108
413 Ga0207687_10210682 3300025927 Bacteria 1524
414 Ga0207687_10354102 3300025927 Bacteria 1197
415 Ga0207687_10518585 3300025927 Bacteria 997
416 Ga0207687_10923300 3300025927 Bacteria 747
417 Ga0207700_10000006 3300025928 Bacteria 348187
418 Ga0207700_10379106 3300025928 Bacteria 1236
419 Ga0207700_10465286 3300025928 Bacteria 1116
420 Ga0207664_10024170 3300025929 Bacteria 4564
421 Ga0207664_10128676 3300025929 Bacteria 2129
422 Ga0207664_10133843 3300025929 Bacteria 2089
423 Ga0207664_10164041 3300025929 Bacteria 1897
424 Ga0207664_10345051 3300025929 Bacteria 1317
425 Ga0207664_10552500 3300025929 Bacteria 1033
426 Ga0207664_10628038 3300025929 Bacteria 965
427 Ga0207644_11697620 3300025931 Bacteria 529
428 Ga0207690_10035494 3300025932 Bacteria 3221
429 Ga0207690_10074440 3300025932 Bacteria 2352
430 Ga0207690_10147847 3300025932 Bacteria 1739
431 Ga0207690_10291788 3300025932 Unclassified 1273
432 Ga0207690_10413442 3300025932 Bacteria 1078
433 Ga0207690_11300703 3300025932 Bacteria 608
434 Ga0207690_11386188 3300025932 Bacteria 588
435 Ga0207706_10028155 3300025933 Bacteria 5020
436 Ga0207706_10268610 3300025933 Bacteria 1489
437 Ga0207706_10396740 3300025933 Unclassified 1196
438 Ga0207686_10316494 3300025934 Bacteria 1164
439 Ga0207709_10603517 3300025935 Bacteria 869
440 Ga0207669_10019902 3300025937 Bacteria 3506
441 Ga0207665_10010466 3300025939 Bacteria 6095
442 Ga0207665_10034758 3300025939 Bacteria 3344
443 Ga0207665_10079012 3300025939 Bacteria 2261
444 Ga0207691_10141984 3300025940 Bacteria 2116
445 Ga0207711_10153738 3300025941 Bacteria 2078
446 Ga0207711_10483011 3300025941 Unclassified 1154
447 Ga0207689_10650157 3300025942 Unclassified 888
448 Ga0207689_11175867 3300025942 Bacteria 646
449 Ga0207661_10058628 3300025944 Bacteria 3099
450 Ga0207661_10283668 3300025944 Bacteria 1481
451 Ga0207661_10326308 3300025944 Bacteria 1381
452 Ga0207661_10399046 3300025944 Bacteria 1247
453 Ga0207661_11138459 3300025944 Bacteria 718
454 Ga0207661_11536714 3300025944 Unclassified 610
455 Ga0207679_10046972 3300025945 Bacteria 3134
456 Ga0207679_10891072 3300025945 Bacteria 814
457 Ga0207667_10023514 3300025949 Bacteria 6785
458 Ga0207667_10066221 3300025949 Bacteria 3766
459 Ga0207667_10141333 3300025949 Bacteria 2478
460 Ga0207667_10175364 3300025949 Bacteria 2203
461 Ga0207667_10196978 3300025949 Bacteria 2067
462 Ga0207667_10831886 3300025949 Bacteria 918
463 Ga0207667_10857212 3300025949 Bacteria 902
464 Ga0207712_10041383 3300025961 Bacteria 3166
465 Ga0207712_10042305 3300025961 Bacteria 3136
466 Ga0207712_10171094 3300025961 Bacteria 1698
467 Ga0207712_10346154 3300025961 Bacteria 1234
468 Ga0207712_10650795 3300025961 Bacteria 916
469 Ga0207668_10200428 3300025972 Bacteria 1589
470 Ga0207668_10356110 3300025972 Bacteria 1225
471 Ga0207668_10695739 3300025972 Bacteria 893
472 Ga0207640_10028669 3300025981 Bacteria 3407
473 Ga0207640_10073364 3300025981 Bacteria 2312
474 Ga0207640_10456106 3300025981 Bacteria 1055
475 Ga0207640_10824017 3300025981 Bacteria 806
476 Ga0207640_11094706 3300025981 Bacteria 705
477 Ga0207677_10037372 3300026023 Bacteria 3173
478 Ga0207677_10869014 3300026023 Bacteria 811
479 Ga0207677_11521322 3300026023 Bacteria 618
480 Ga0207677_11760576 3300026023 Bacteria 575
481 Ga0207703_10607933 3300026035 Bacteria 1034
482 Ga0207639_10240708 3300026041 Bacteria 1573
483 Ga0207639_10385106 3300026041 Bacteria 1260
484 Ga0207639_10495588 3300026041 Bacteria 1115
485 Ga0207639_10564102 3300026041 Bacteria 1047
486 Ga0207639_10602056 3300026041 Bacteria 1014
487 Ga0207639_11560812 3300026041 Bacteria 619
488 Ga0207678_10611761 3300026067 Bacteria 956
489 Ga0207708_10218915 3300026075 Bacteria 1525
490 Ga0207708_10266663 3300026075 Bacteria 1384
491 Ga0207708_10618096 3300026075 Bacteria 919
492 Ga0207708_11111129 3300026075 Bacteria 689
493 Ga0207702_10037364 3300026078 Bacteria 4064
494 Ga0207702_10061916 3300026078 Bacteria 3194
495 Ga0207702_10516857 3300026078 Bacteria 1165
496 Ga0207702_10583072 3300026078 Bacteria 1096
497 Ga0207702_10932911 3300026078 Bacteria 860
498 Ga0207641_10433505 3300026088 Bacteria 1268
499 Ga0207648_10721958 3300026089 Bacteria 924
500 Ga0207648_10752708 3300026089 Bacteria 905
501 Ga0207676_10266344 3300026095 Bacteria 1550
502 Ga0207674_10006223 3300026116 Bacteria 14068
503 Ga0207674_10059284 3300026116 Bacteria 3874
504 Ga0207674_10107454 3300026116 Bacteria 2767
505 Ga0207674_10112588 3300026116 Bacteria 2695
506 Ga0207674_10292048 3300026116 Bacteria 1579
507 Ga0207674_10508544 3300026116 Bacteria 1164
508 Ga0207675_100030764 3300026118 Bacteria 4999
509 Ga0207675_100061187 3300026118 Bacteria 3515
510 Ga0207675_100096696 3300026118 Bacteria 2780
511 Ga0207675_100520179 3300026118 Bacteria 1186
512 Ga0207683_10011124 3300026121 Bacteria 7669
513 Ga0207683_10815666 3300026121 Bacteria 866
514 Ga0207683_11780766 3300026121 Bacteria 565
515 Ga0209998_10009501 3300027717 Bacteria 2019
516 Ga0207428_10000551 3300027907 Bacteria 44433
517 Ga0207428_10009220 3300027907 Bacteria 8864
518 Ga0207428_10038045 3300027907 Bacteria 3914
519 Ga0268266_10000081 3300028379 Bacteria 207431
520 Ga0268266_10236597 3300028379 Bacteria 1684
521 Ga0268265_10278422 3300028380 Bacteria 1496
522 Ga0268264_10353395 3300028381 Bacteria 1400
523 Ga0268264_10463017 3300028381 Bacteria 1230
524 Ga0265326_10084701 3300028558 Bacteria 897
525 Ga0265319_1152429 3300028563 Bacteria 715
526 Ga0265318_10018736 3300028577 Bacteria 2819
527 Ga0265318_10038357 3300028577 Bacteria 1832
528 Ga0265318_10159727 3300028577 Bacteria 826
529 Ga0265323_10084124 3300028653 Bacteria 1072
530 Ga0265322_10011308 3300028654 Bacteria 2589
531 Ga0265338_10013856 3300028800 Bacteria 9057
532 Ga0265338_10045873 3300028800 Bacteria 4013
533 Ga0265338_10060846 3300028800 Bacteria 3313
534 Ga0265330_10074404 3300031235 Bacteria 1468
535 Ga0265332_10049793 3300031238 Bacteria 1801
536 Ga0265325_10042525 3300031241 Bacteria 2375
537 Ga0265329_10073297 3300031242 Bacteria 1083
538 Ga0265340_10030522 3300031247 Bacteria 2701
539 Ga0265340_10175885 3300031247 Bacteria 969
540 Ga0265339_10007462 3300031249 Bacteria 7067
541 Ga0265339_10090713 3300031249 Bacteria 1602
542 Ga0265331_10068331 3300031250 Bacteria 1666
543 Ga0265331_10170982 3300031250 Unclassified 983
544 Ga0265327_10003047 3300031251 Bacteria 16584
545 Ga0265327_10076032 3300031251 Bacteria 1669
546 Ga0265316_10002206 3300031344 Bacteria 20468
547 Ga0265316_10066278 3300031344 Bacteria 2795
548 Ga0265316_10643000 3300031344 Bacteria 750
549 Ga0265316_10879438 3300031344 Bacteria 626
550 Ga0307408_100010016 3300031548 Bacteria 6246
551 Ga0307408_100183990 3300031548 Bacteria 1678
552 Ga0307408_100243604 3300031548 Unclassified 1479
553 Ga0265313_10061225 3300031595 Bacteria 1762
554 Ga0265314_10003413 3300031711 Bacteria 15378
555 Ga0265314_10032486 3300031711 Bacteria 3839
556 Ga0265314_10086123 3300031711 Bacteria 2058
557 Ga0265342_10069720 3300031712 Bacteria 2052
558 Ga0307405_10005839 3300031731 Bacteria 5992
559 Ga0307405_10012720 3300031731 Bacteria 4468
560 Ga0307405_11198283 3300031731 Bacteria 657
561 Ga0307413_10002950 3300031824 Bacteria 7039
562 Ga0307413_10077315 3300031824 Bacteria 2119
563 Ga0307413_11540270 3300031824 Bacteria 589
564 Ga0307410_10002995 3300031852 Bacteria 8333
565 Ga0307410_10062021 3300031852 Bacteria 2560
566 Ga0307410_11443735 3300031852 Bacteria 605
567 Ga0307406_10002763 3300031901 Bacteria 9576
568 Ga0307406_10116774 3300031901 Bacteria 1847
569 Ga0307406_10189494 3300031901 Bacteria 1504
570 Ga0307406_10853611 3300031901 Bacteria 772
571 Ga0307407_10004116 3300031903 Bacteria 6121
572 Ga0307407_10097586 3300031903 Bacteria 1817
573 Ga0307407_10916440 3300031903 Unclassified 673
574 Ga0307412_11177375 3300031911 Bacteria 685
575 Ga0307409_100009005 3300031995 Bacteria 6104
576 Ga0307409_100011218 3300031995 Bacteria 5633
577 Ga0307409_100294676 3300031995 Bacteria 1506
578 Ga0307409_100394792 3300031995 Bacteria 1319
579 Ga0307409_100472312 3300031995 Bacteria 1215
580 Ga0307409_100703459 3300031995 Bacteria 1010
581 Ga0307409_101369944 3300031995 Bacteria 733
582 Ga0307416_100001425 3300032002 Bacteria 12993
583 Ga0307416_100021273 3300032002 Bacteria 4652
584 Ga0307416_100043845 3300032002 Bacteria 3507
585 Ga0307414_10171377 3300032004 Bacteria 1735
586 Ga0307414_10489136 3300032004 Bacteria 1087
587 Ga0307414_10964300 3300032004 Bacteria 784
588 Ga0307411_10003163 3300032005 Bacteria 7563
589 Ga0307411_10791480 3300032005 Bacteria 834
590 Ga0307415_100000286 3300032126 Bacteria 21920
591 Ga0307415_100004173 3300032126 Bacteria 7457
592 Ga0307415_100347416 3300032126 Bacteria 1247
593 Ga0373930_0018229 3300034816 Bacteria 1347
594 Ga0373948_0007410 3300034817 Bacteria 1844
595 Ga0373948_0077709 3300034817 Bacteria 753
596 Ga0373950_0002783 3300034818 Bacteria 2445
597 Ga0373958_0002498 3300034819 Bacteria 2588
598 Ga0373938_0003711 3300034957 Bacteria 2516
599 Ga0373928_0014717 3300035084 Bacteria 1585
600 Ga0373928_0179446 3300035084 Bacteria 601
601 Ga0373929_0019235 3300035085 Bacteria 1365
602 Ga0373949_0002911 3300035090 Bacteria 4220
603 Ga0373951_0012208 3300035091 Bacteria 1931
604 Ga0373952_0004699 3300035092 Bacteria 2482
605 Ga0373932_0002305 3300035112 Bacteria 4852
606 Ga0373939_0000998 3300035114 Bacteria 7006
607 Ga0373939_0032710 3300035114 Bacteria 1514
608 Ga0373939_0033574 3300035114 Bacteria 1500
609 Ga0373941_0011207 3300035115 Bacteria 2311
610 Ga0373941_0059477 3300035115 Bacteria 1239
611 Ga0373960_0000459 3300035121 Bacteria 8026
612 Ga0373943_0031688 3300035170 Bacteria 2510
613 Ga0373942_0004263 3300035207 Bacteria 3329
614 Ga0373961_0007365 3300035241 Bacteria 2660
615 Ga0373961_0153153 3300035241 Bacteria 787
616 Ga0373962_0011891 3300035242 Bacteria 2187
617 Ga0316574_0164656 3300035398 Bacteria 1428
618 Ga0373931_0005838 3300035691 Bacteria 5727
619 Ga0373931_0062040 3300035691 Bacteria 2017
620 Ga0373931_0140921 3300035691 Bacteria 1396
621 Ga0373931_0865138 3300035691 Bacteria 606
622 Ga0373935_0083041 3300035692 Bacteria 2085
623 Ga0373937_0087073 3300036401 Bacteria 2891
624 Ga0395899_0001614 3300037312 Bacteria 18846
625 Ga0395899_0003283 3300037312 Bacteria 12824
626 Ga0395899_0014311 3300037312 Bacteria 6056
627 Ga0395899_0016263 3300037312 Bacteria 5671
628 Ga0395899_0025572 3300037312 Bacteria 4455
629 Ga0395899_0027903 3300037312 Bacteria 4252
630 Ga0395899_0039999 3300037312 Bacteria 3508
631 Ga0395899_0106454 3300037312 Bacteria 2019
632 Ga0395899_0109783 3300037312 Bacteria 1984
633 Ga0395899_0119318 3300037312 Bacteria 1891
634 Ga0395899_0234401 3300037312 Unclassified 1266
635 Ga0395900_0004680 3300037418 Bacteria 14424
636 Ga0395900_0005323 3300037418 Bacteria 13489
637 Ga0395900_0010115 3300037418 Bacteria 9647
638 Ga0395900_0016923 3300037418 Bacteria 7442
639 Ga0395900_0018889 3300037418 Bacteria 7031
640 Ga0395900_0044318 3300037418 Bacteria 4584
641 Ga0395900_0049100 3300037418 Bacteria 4347
642 Ga0395900_0066125 3300037418 Bacteria 3715
643 Ga0395900_0073000 3300037418 Bacteria 3527
644 Ga0395900_0081470 3300037418 Bacteria 3325
645 Ga0395900_0085975 3300037418 Bacteria 3232
646 Ga0395900_0126305 3300037418 Bacteria 2623
647 Ga0395900_0131713 3300037418 Bacteria 2562
648 Ga0395900_0143157 3300037418 Bacteria 2447
649 Ga0395900_0193215 3300037418 Bacteria 2063
650 Ga0395900_0228390 3300037418 Bacteria 1873
651 Ga0395900_0346593 3300037418 Bacteria 1459
652 Ga0395900_0444000 3300037418 Bacteria 1254
653 Ga0395900_0583789 3300037418 Unclassified 1059
654 Ga0395900_0640890 3300037418 Bacteria 1000
655 Ga0395900_0645091 3300037418 Bacteria 996
656 Ga0395900_0755906 3300037418 Bacteria 902
657 Ga0395900_1065083 3300037418 Bacteria 727
658 Ga0395900_1465796 3300037418 Bacteria 595
659 Ga0395900_1619754 3300037418 Bacteria 559
660 Ga0395898_0002616 3300037466 Bacteria 20962
661 Ga0395898_0005906 3300037466 Bacteria 13162
662 Ga0395898_0007257 3300037466 Bacteria 11761
663 Ga0395898_0019563 3300037466 Bacteria 6888
664 Ga0395898_0025937 3300037466 Bacteria 5902
665 Ga0395898_0032324 3300037466 Bacteria 5223
666 Ga0395898_0052482 3300037466 Bacteria 3983
667 Ga0395898_0070467 3300037466 Bacteria 3379
668 Ga0395898_0101435 3300037466 Bacteria 2763
669 Ga0395898_0104976 3300037466 Bacteria 2709
670 Ga0395898_0111475 3300037466 Bacteria 2622
671 Ga0395898_0149383 3300037466 Bacteria 2236
672 Ga0395898_0218653 3300037466 Bacteria 1817
673 Ga0395898_0291240 3300037466 Unclassified 1557
674 Ga0395898_0309631 3300037466 Bacteria 1506
675 Ga0395898_0382788 3300037466 Bacteria 1342
676 Ga0395898_0405998 3300037466 Bacteria 1299
677 Ga0395898_0432054 3300037466 Bacteria 1255
678 Ga0395898_0655311 3300037466 Bacteria 992
679 Ga0395898_0668770 3300037466 Bacteria 981
680 Ga0395898_0693237 3300037466 Bacteria 960
681 Ga0395898_0826227 3300037466 Unclassified 866
682 Ga0395898_1272535 3300037466 Bacteria 665
683 Ga0395898_1421871 3300037466 Unclassified 621
684 Ga0395905_0003496 3300037471 Bacteria 16767
685 Ga0395905_0005495 3300037471 Bacteria 12929
686 Ga0395905_0014937 3300037471 Bacteria 7407
687 Ga0395905_0038630 3300037471 Bacteria 4479
688 Ga0395905_0040078 3300037471 Bacteria 4394
689 Ga0395905_0060423 3300037471 Bacteria 3544
690 Ga0395905_0062432 3300037471 Bacteria 3485
691 Ga0395905_0065218 3300037471 Bacteria 3409
692 Ga0395905_0068291 3300037471 Bacteria 3329
693 Ga0395905_0189724 3300037471 Bacteria 1928
694 Ga0395905_0269829 3300037471 Bacteria 1587
695 Ga0395905_0272117 3300037471 Bacteria 1580
696 Ga0395905_0332078 3300037471 Bacteria 1411
697 Ga0395905_0366612 3300037471 Bacteria 1333
698 Ga0395905_0485167 3300037471 Bacteria 1135
699 Ga0395905_0506479 3300037471 Bacteria 1107
700 Ga0395905_0585392 3300037471 Bacteria 1017
701 Ga0395905_1053075 3300037471 Bacteria 717
702 Ga0395905_1083119 3300037471 Bacteria 704
703 Ga0395905_1097162 3300037471 Bacteria 699
704 Ga0395905_1180477 3300037471 Unclassified 669
705 Ga0436364_0871138 3300037853 Bacteria 1462
706 Ga0395901_0000744 3300038443 Bacteria 36793
707 Ga0395901_0001394 3300038443 Bacteria 25270
708 Ga0395901_0001686 3300038443 Bacteria 22797
709 Ga0395901_0002239 3300038443 Bacteria 19733
710 Ga0395901_0005425 3300038443 Bacteria 12903
711 Ga0395901_0014181 3300038443 Bacteria 8114
712 Ga0395901_0038084 3300038443 Bacteria 4974
713 Ga0395901_0044163 3300038443 Bacteria 4622
714 Ga0395901_0091307 3300038443 Bacteria 3188
715 Ga0395901_0109199 3300038443 Bacteria 2904
716 Ga0395901_0132957 3300038443 Bacteria 2614
717 Ga0395901_0150080 3300038443 Bacteria 2449
718 Ga0395901_0177981 3300038443 Bacteria 2230
719 Ga0395901_0186485 3300038443 Bacteria 2175
720 Ga0395901_0194979 3300038443 Bacteria 2124
721 Ga0395901_0305475 3300038443 Bacteria 1649
722 Ga0395901_0321460 3300038443 Bacteria 1601
723 Ga0395901_0602370 3300038443 Unclassified 1108
724 Ga0395901_0637690 3300038443 Bacteria 1070
725 Ga0395901_0657083 3300038443 Bacteria 1051
726 Ga0395901_2030419 3300038443 Bacteria 521
727 Ga0436365_0391299 3300039437 Bacteria 1100
728 Ga0436365_1592653 3300039437 Bacteria 573
729 Ga0436363_1209816 3300039450 Bacteria 1377
730 Ga0436363_1414311 3300039450 Bacteria 1810
731 Ga0436363_1590339 3300039450 Bacteria 1888
732 Ga0439461_0135203 3300041410 Unclassified 626
733 Ga0451839_0381197 3300041496 Bacteria 646
734 Ga0451851_0997760 3300041507 Bacteria 1827
735 Ga0451853_0445709 3300041512 Bacteria 6578
736 Ga0451853_0502246 3300041512 Bacteria 722
737 Ga0451853_0894815 3300041512 Bacteria 1356
738 Ga0439448_0014578 3300042005 Bacteria 2373
739 Ga0439450_046628 3300042008 Bacteria 1020
740 Ga0450906_045499 3300042145 Bacteria 774
741 Ga0439458_0178262 3300042157 Bacteria 576
742 Ga0439460_0250993 3300042461 Bacteria 611
743 Ga0466969_0174737 3300044656 Bacteria 984
744 Ga0466966_0043026 3300044684 Bacteria 2896
745 Ga0466961_0129780 3300044693 Bacteria 1580
746 Ga0466963_0020255 3300044694 Bacteria 4183
747 Ga0466963_0034424 3300044694 Bacteria 3295
748 Ga0466963_0079065 3300044694 Bacteria 2225
749 Ga0466963_0578936 3300044694 Bacteria 793
750 Ga0466964_0001299 3300044706 Bacteria 8521
751 Ga0466964_0011257 3300044706 Bacteria 3379
752 Ga0466964_0237287 3300044706 Bacteria 893
753 Ga0466971_0343242 3300044719 Bacteria 722
754 Ga0466968_0013261 3300044735 Bacteria 3239
755 Ga0466957_0201946 3300044842 Bacteria 1306
756 Ga0466957_0235344 3300044842 Bacteria 1214
757 Ga0466957_0307065 3300044842 Bacteria 1067
758 Ga0466957_0398776 3300044842 Bacteria 941
759 Ga0466957_0460361 3300044842 Unclassified 877
760 Ga0466960_0067728 3300044901 Bacteria 1769
761 Ga0466960_0123435 3300044901 Bacteria 1359
762 Ga0466959_0003201 3300045049 Bacteria 10639
763 Ga0451576_0025325 3300045051 Bacteria 6393
764 Ga0451576_0235236 3300045051 Bacteria 1913
765 Ga0451576_0238671 3300045051 Bacteria 1899
766 Ga0466958_0103604 3300045836 Bacteria 1772
767 Ga0466958_0255350 3300045836 Bacteria 1122
768 Ga0466958_0321918 3300045836 Bacteria 994
769 Ga0466958_0416601 3300045836 Bacteria 868
770 Ga0466967_0000440 3300045976 Bacteria 19889
771 Ga0466967_0029993 3300045976 Bacteria 4559
772 Ga0466967_0040177 3300045976 Bacteria 4026
773 Ga0466967_0049004 3300045976 Bacteria 3692
774 Ga0466967_0075564 3300045976 Bacteria 3028
775 Ga0466967_0174798 3300045976 Bacteria 2023
776 Ga0466967_0314038 3300045976 Bacteria 1510
777 Ga0466967_0362397 3300045976 Bacteria 1405
778 Ga0466967_0405677 3300045976 Bacteria 1327
779 Ga0466967_0491357 3300045976 Bacteria 1203
780 Ga0466967_0495326 3300045976 Bacteria 1198
781 Ga0466967_0657990 3300045976 Bacteria 1036
782 Ga0466967_0811046 3300045976 Bacteria 929
783 Ga0466967_0989259 3300045976 Bacteria 837
784 Ga0466967_1598418 3300045976 Unclassified 649
785 Ga0466967_1731651 3300045976 Bacteria 622
786 Ga0466967_1857199 3300045976 Bacteria 599
787 Ga0495591_056587 3300046458 Bacteria 1054
788 Ga0495629_0284204 3300046459 Bacteria 1135
789 Ga0495629_0303633 3300046459 Bacteria 1093
790 Ga0495638_0571952 3300046460 Bacteria 559
791 Ga0495641_0033614 3300046461 Bacteria 2432
792 Ga0495641_0093315 3300046461 Bacteria 1345
793 Ga0495641_0240345 3300046461 Unclassified 814
794 Ga0495651_0099706 3300046462 Bacteria 2166
795 Ga0495651_0549510 3300046462 Bacteria 734
796 Ga0495651_0561052 3300046462 Bacteria 724
797 Ga0495653_0073227 3300046463 Bacteria 2557
798 Ga0495582_0365606 3300046473 Bacteria 831
799 Ga0495582_0560320 3300046473 Bacteria 661
800 Ga0495605_0059424 3300046474 Bacteria 1836
801 Ga0495605_0161092 3300046474 Bacteria 996
802 Ga0495605_0274673 3300046474 Bacteria 717
803 Ga0495639_0448072 3300046475 Bacteria 655
804 Ga0495639_0554059 3300046475 Bacteria 589
805 Ga0495584_0055035 3300046491 Bacteria 2002
806 Ga0495584_0071372 3300046491 Bacteria 1745
807 Ga0495584_0150913 3300046491 Bacteria 1181
808 Ga0495584_0171194 3300046491 Bacteria 1104
809 Ga0495584_0192627 3300046491 Unclassified 1036
810 Ga0495584_0304288 3300046491 Bacteria 810
811 Ga0495584_0332782 3300046491 Bacteria 771
812 Ga0495585_0131851 3300046492 Bacteria 1315
813 Ga0495596_0074957 3300046500 Bacteria 1314
814 Ga0495596_0334515 3300046500 Bacteria 589
815 Ga0495608_0117136 3300046511 Bacteria 1709
816 Ga0495620_0103725 3300046515 Bacteria 1132
817 Ga0495630_0063267 3300046517 Bacteria 2779
818 Ga0495630_0101602 3300046517 Bacteria 2175
819 Ga0495631_0201316 3300046518 Bacteria 851
820 Ga0495632_0341808 3300046519 Bacteria 659
821 Ga0495637_0064001 3300046520 Bacteria 1501
822 Ga0495644_0130580 3300046523 Bacteria 957
823 Ga0495644_0150737 3300046523 Bacteria 890
824 Ga0495663_0023132 3300046525 Bacteria 1799
825 Ga0495663_0041814 3300046525 Bacteria 1395
826 Ga0495642_0100070 3300046528 Bacteria 1233
827 Ga0495642_0231845 3300046528 Bacteria 806
828 Ga0495642_0274694 3300046528 Bacteria 738
829 Ga0495652_0142926 3300046529 Bacteria 1880
830 Ga0495652_0416419 3300046529 Bacteria 948
831 Ga0495652_0529233 3300046529 Bacteria 813
832 Ga0495654_0083258 3300046530 Bacteria 1496
833 Ga0495640_0409083 3300046533 Unclassified 832
834 Ga0495586_0059389 3300046535 Bacteria 2078
835 Ga0495587_0598103 3300046536 Bacteria 607
836 Ga0495598_0102051 3300046537 Unclassified 951
837 Ga0495609_0053530 3300046538 Bacteria 1794
838 Ga0495609_0216168 3300046538 Bacteria 797
839 Ga0495621_0031666 3300046539 Bacteria 1816
840 Ga0495645_0521355 3300046543 Bacteria 740
841 Ga0495667_0074628 3300046559 Bacteria 2208
842 Ga0495656_0063740 3300046615 Bacteria 1616
843 Ga0495656_0071083 3300046615 Bacteria 1546
844 Ga0495656_0215078 3300046615 Bacteria 959
845 Ga0495668_0361926 3300046616 Bacteria 796
846 Ga0495668_0407645 3300046616 Unclassified 747
847 Ga0495634_0056762 3300046642 Bacteria 2615
848 Ga0495611_0054307 3300046648 Bacteria 1811
849 Ga0495611_0189665 3300046648 Bacteria 960
850 Ga0495625_0537379 3300046660 Bacteria 710
851 Ga0495635_0427188 3300046663 Bacteria 878
852 Ga0495659_0002526 3300046664 Bacteria 5908
853 Ga0495659_0002767 3300046664 Bacteria 5644
854 Ga0495659_0401102 3300046664 Bacteria 592
855 Ga0495661_0290585 3300046665 Bacteria 821
856 Ga0495661_0526390 3300046665 Bacteria 561
857 Ga0495657_0425758 3300046675 Bacteria 779
858 Ga0495657_0443279 3300046675 Bacteria 761
859 Ga0495657_0703588 3300046675 Bacteria 581
860 Ga0495599_0122154 3300046678 Bacteria 1619
861 Ga0495599_0205190 3300046678 Unclassified 1210
862 Ga0495599_0481515 3300046678 Bacteria 732
863 Ga0495599_0539669 3300046678 Unclassified 684
864 Ga0495623_0223598 3300046679 Bacteria 1071
865 Ga0495647_0104093 3300046681 Bacteria 1178
866 Ga0495658_0073103 3300046683 Bacteria 1995
867 Ga0495658_0266198 3300046683 Bacteria 1080
868 Ga0495658_0994874 3300046683 Bacteria 535
869 Ga0495669_0248301 3300046684 Bacteria 855
870 Ga0495613_0641869 3300046689 Bacteria 703
871 Ga0495613_0646903 3300046689 Bacteria 700
872 Ga0495613_0882208 3300046689 Unclassified 580
873 Ga0495670_0350016 3300046691 Bacteria 795
874 Ga0495671_0323506 3300046692 Bacteria 740
875 Ga0495589_0156513 3300046794 Unclassified 1087
876 Ga0495589_0161345 3300046794 Bacteria 1068
877 Ga0495589_0199337 3300046794 Bacteria 945
878 Ga0495589_0235671 3300046794 Bacteria 857
879 Ga0495600_0395794 3300046809 Bacteria 860
880 Ga0495600_0567940 3300046809 Bacteria 692
881 Ga0495581_0219271 3300047315 Bacteria 1112
882 Ga0495604_0539361 3300047317 Bacteria 753
883 Ga0495676_1047527 3300047321 Bacteria 520
884 Ga0495680_0134301 3300047322 Bacteria 1815
885 Ga0495683_0138622 3300047323 Bacteria 1142
886 Ga0495683_0395180 3300047323 Bacteria 576
887 Ga0495677_0187729 3300047445 Bacteria 802
888 Ga0495685_072911 3300047447 Bacteria 1149
889 Ga0495684_0330206 3300047471 Bacteria 1088
890 Ga0496100_0004854 3300048903 Bacteria 7181
891 Ga0496100_0029788 3300048903 Bacteria 3379
892 Ga0496100_0042219 3300048903 Bacteria 2912
893 Ga0496100_0109415 3300048903 Bacteria 1917
894 Ga0496100_0129304 3300048903 Bacteria 1777
895 Ga0496100_1220653 3300048903 Bacteria 593
896 Ga0496100_1334287 3300048903 Bacteria 566
897 Ga0496101_0004861 3300048904 Bacteria 8524
898 Ga0496101_0071942 3300048904 Bacteria 2537
899 Ga0496101_0144838 3300048904 Unclassified 1814
900 Ga0496101_0153005 3300048904 Bacteria 1765
901 Ga0496101_0442174 3300048904 Bacteria 1026
902 Ga0496101_0468301 3300048904 Bacteria 994
903 Ga0496102_0018069 3300048905 Bacteria 6190
904 Ga0496102_0039707 3300048905 Bacteria 4254
905 Ga0496102_0181864 3300048905 Bacteria 1981
906 Ga0496102_0187419 3300048905 Bacteria 1950
907 Ga0496102_0368080 3300048905 Bacteria 1353
908 Ga0496102_0500024 3300048905 Bacteria 1138
909 Ga0496102_0511136 3300048905 Bacteria 1124
910 Ga0496102_1050091 3300048905 Bacteria 735
911 Ga0496103_0055918 3300048906 Bacteria 2448
912 Ga0496103_0075386 3300048906 Bacteria 2116
913 Ga0496103_0100145 3300048906 Bacteria 1834
914 Ga0496103_0161799 3300048906 Bacteria 1436
915 Ga0496103_0340742 3300048906 Bacteria 964
916 Ga0496103_0460412 3300048906 Bacteria 815
917 Ga0496103_0583137 3300048906 Bacteria 713
918 Ga0496104_0024445 3300048907 Bacteria 5556
919 Ga0496104_0027429 3300048907 Bacteria 5270
920 Ga0496104_0056269 3300048907 Bacteria 3719
921 Ga0496104_0059751 3300048907 Bacteria 3609
922 Ga0496104_0097950 3300048907 Bacteria 2807
923 Ga0496105_0000362 3300048908 Bacteria 30061
924 Ga0496105_0006218 3300048908 Bacteria 9160
925 Ga0496105_0007486 3300048908 Bacteria 8457
926 Ga0496105_0024596 3300048908 Bacteria 4894
927 Ga0496105_0728031 3300048908 Bacteria 759
928 Ga0496106_0008454 3300048909 Bacteria 7617
929 Ga0496106_0025194 3300048909 Bacteria 4425
930 Ga0496106_0094409 3300048909 Bacteria 2312
931 Ga0496106_0106130 3300048909 Bacteria 2183
932 Ga0496106_0525933 3300048909 Unclassified 950
933 Ga0496107_0029355 3300048910 Bacteria 3911
934 Ga0496107_0045645 3300048910 Bacteria 3152
935 Ga0496107_0054716 3300048910 Bacteria 2881
936 Ga0496107_0086712 3300048910 Bacteria 2285
937 Ga0496107_0201704 3300048910 Bacteria 1478
938 Ga0496107_0282598 3300048910 Bacteria 1235
939 Ga0496107_0433753 3300048910 Bacteria 977
940 Ga0496107_0502089 3300048910 Unclassified 900
941 Ga0496107_0555385 3300048910 Unclassified 850
942 Ga0496108_0003918 3300048911 Bacteria 11953
943 Ga0496108_0004739 3300048911 Bacteria 10967
944 Ga0496108_0049211 3300048911 Bacteria 3525
945 Ga0496108_0102220 3300048911 Bacteria 2445
946 Ga0496108_0110036 3300048911 Bacteria 2355
947 Ga0496108_0183025 3300048911 Bacteria 1815
948 Ga0496108_0332960 3300048911 Bacteria 1324
949 Ga0496108_0525167 3300048911 Bacteria 1033
950 Ga0496109_0004197 3300048912 Bacteria 12013
951 Ga0496109_0009486 3300048912 Bacteria 8298
952 Ga0496109_0013491 3300048912 Bacteria 7089
953 Ga0496109_0070870 3300048912 Bacteria 3199
954 Ga0496109_0080397 3300048912 Bacteria 3003
955 Ga0496109_0089241 3300048912 Bacteria 2850
956 Ga0496109_0090901 3300048912 Bacteria 2823
957 Ga0496109_0109270 3300048912 Bacteria 2570
958 Ga0496109_0434561 3300048912 Bacteria 1240
959 Ga0496109_1343413 3300048912 Unclassified 650
960 Ga0496110_0002026 3300048913 Bacteria 15085
961 Ga0496110_0004908 3300048913 Bacteria 10439
962 Ga0496110_0012389 3300048913 Bacteria 7011
963 Ga0496110_0039758 3300048913 Bacteria 4096
964 Ga0496110_0049929 3300048913 Bacteria 3672
965 Ga0496110_0172781 3300048913 Bacteria 1961
966 Ga0496110_0294973 3300048913 Bacteria 1477
967 Ga0496110_0409318 3300048913 Bacteria 1236
968 Ga0496110_1825587 3300048913 Bacteria 518
969 Ga0496111_0000234 3300048914 Bacteria 26582
970 Ga0496111_0024062 3300048914 Bacteria 4283
971 Ga0496111_0077048 3300048914 Bacteria 2431
972 Ga0496111_0146812 3300048914 Bacteria 1749
973 Ga0496111_0162502 3300048914 Bacteria 1658
974 Ga0496111_0216613 3300048914 Bacteria 1422
975 Ga0496111_0316027 3300048914 Bacteria 1157
976 Ga0496111_0859554 3300048914 Bacteria 654
977 Ga0496112_0008602 3300048915 Bacteria 9147
978 Ga0496112_0048339 3300048915 Bacteria 4171
979 Ga0496112_0083854 3300048915 Bacteria 3152
980 Ga0496112_0170361 3300048915 Bacteria 2142
981 Ga0496112_0496639 3300048915 Bacteria 1156
982 Ga0496112_0538607 3300048915 Bacteria 1102
983 Ga0496112_0654208 3300048915 Bacteria 980
984 Ga0496112_0733247 3300048915 Unclassified 915
985 Ga0496112_0880070 3300048915 Bacteria 818
986 Ga0496112_1178217 3300048915 Unclassified 683
987 Ga0496113_0004778 3300048916 Bacteria 8368
988 Ga0496113_0090832 3300048916 Bacteria 2353
989 Ga0496113_0102804 3300048916 Bacteria 2216
990 Ga0496113_0119808 3300048916 Bacteria 2056
991 Ga0496113_0289671 3300048916 Bacteria 1310
992 Ga0496113_0534534 3300048916 Bacteria 941
993 Ga0496113_0559567 3300048916 Unclassified 917
994 Ga0496113_0653127 3300048916 Bacteria 841
995 Ga0496113_0982998 3300048916 Unclassified 665
996 Ga0496113_1090813 3300048916 Bacteria 626
997 Ga0496114_0008661 3300048917 Bacteria 8064
998 Ga0496114_0025592 3300048917 Bacteria 4825
999 Ga0496114_0052175 3300048917 Bacteria 3407
1000 Ga0496114_0092542 3300048917 Bacteria 2569
1001 Ga0496114_0112924 3300048917 Bacteria 2329
1002 Ga0496114_0113075 3300048917 Bacteria 2327
1003 Ga0496114_0952694 3300048917 Bacteria 741
1004 Ga0496114_0992694 3300048917 Bacteria 723
1005 Ga0496114_1047833 3300048917 Bacteria 700
1006 Ga0496114_1373804 3300048917 Bacteria 594
1007 Ga0496115_0006662 3300048918 Bacteria 8478
1008 Ga0496115_0035182 3300048918 Bacteria 3961
1009 Ga0496115_0283998 3300048918 Bacteria 1358
1010 Ga0496115_0675028 3300048918 Bacteria 814
1011 Ga0501031_0005539 3300049568 Bacteria 8221
1012 Ga0501032_0846496 3300049569 Bacteria 577
1013 Ga0501033_0089532 3300049570 Bacteria 2251
1014 Ga0501033_0209922 3300049570 Bacteria 1389
1015 Ga0501034_0022281 3300049571 Unclassified 6457
1016 Ga0501034_0312104 3300049571 Bacteria 1507
1017 Ga0501034_0506786 3300049571 Bacteria 1120
1018 Ga0501036_0362841 3300049572 Bacteria 1209
1019 Ga0501038_0326396 3300049574 Bacteria 1200
1020 Ga0501038_0359966 3300049574 Bacteria 1132
1021 Ga0501039_0029160 3300049575 Bacteria 4250
1022 Ga0501039_0617783 3300049575 Bacteria 849
1023 Ga0501040_0077248 3300049576 Bacteria 2303
1024 Ga0501040_0097892 3300049576 Bacteria 2044
1025 Ga0501040_0340948 3300049576 Bacteria 1073
1026 Ga0501040_0350231 3300049576 Bacteria 1058
1027 Ga0501040_0411289 3300049576 Unclassified 972
1028 Ga0501041_0037607 3300049577 Bacteria 2933
1029 Ga0501041_0327737 3300049577 Bacteria 966
1030 Ga0501042_0101102 3300049578 Bacteria 2073
1031 Ga0501042_0103146 3300049578 Bacteria 2052
1032 Ga0501042_0188294 3300049578 Bacteria 1489
1033 Ga0501042_0674274 3300049578 Bacteria 752
1034 Ga0501046_0121636 3300049580 Bacteria 1985
1035 Ga0501046_0218106 3300049580 Bacteria 1414
1036 Ga0501048_0065397 3300049582 Bacteria 2571
1037 Ga0501048_0388624 3300049582 Unclassified 997
1038 Ga0501067_0000516 3300049583 Bacteria 21125
1039 Ga0501067_0002005 3300049583 Bacteria 11218
1040 Ga0501067_0013292 3300049583 Bacteria 4559
1041 Ga0501067_0106281 3300049583 Unclassified 1560
1042 Ga0501067_0560960 3300049583 Unclassified 640
1043 Ga0501068_0061002 3300049584 Bacteria 2290
1044 Ga0501068_0101621 3300049584 Bacteria 1783
1045 Ga0501068_0106001 3300049584 Bacteria 1745
1046 Ga0501068_0127574 3300049584 Bacteria 1589
1047 Ga0501068_0137718 3300049584 Bacteria 1529
1048 Ga0501068_0212395 3300049584 Bacteria 1229
1049 Ga0501069_0002134 3300049585 Bacteria 9961
1050 Ga0501069_0005912 3300049585 Bacteria 6378
1051 Ga0501069_0009763 3300049585 Bacteria 5072
1052 Ga0501069_0091708 3300049585 Bacteria 1718
1053 Ga0501069_0091958 3300049585 Bacteria 1716
1054 Ga0501069_0197710 3300049585 Bacteria 1164
1055 Ga0501070_0101991 3300049586 Bacteria 2373
1056 Ga0501070_0229662 3300049586 Bacteria 1520
1057 Ga0501070_0462373 3300049586 Bacteria 1022
1058 Ga0501070_1027226 3300049586 Bacteria 638
1059 Ga0501071_0347474 3300049587 Bacteria 1128
1060 Ga0501072_0053709 3300049588 Bacteria 3173
1061 Ga0501072_0346053 3300049588 Bacteria 1180
1062 Ga0501072_0954676 3300049588 Unclassified 669
1063 Ga0501074_0050935 3300049590 Bacteria 2988
1064 Ga0501074_0237438 3300049590 Bacteria 1297
1065 Ga0501074_0435217 3300049590 Bacteria 930
1066 Ga0501075_0001511 3300049591 Bacteria 15174
1067 Ga0501075_0252956 3300049591 Bacteria 1343
1068 Ga0501075_0274193 3300049591 Bacteria 1285
1069 Ga0501075_0347315 3300049591 Bacteria 1131
1070 Ga0501076_0086706 3300049592 Bacteria 2516
1071 Ga0501076_0182798 3300049592 Bacteria 1709
1072 Ga0501076_0480063 3300049592 Bacteria 1024
1073 Ga0501076_0884446 3300049592 Bacteria 737
1074 Ga0501077_0013534 3300049593 Bacteria 5117
1075 Ga0501077_0025788 3300049593 Bacteria 3730
1076 Ga0501077_0077243 3300049593 Bacteria 2109
1077 Ga0501077_0802151 3300049593 Bacteria 605
1078 Ga0501079_0053626 3300049741 Bacteria 3110
1079 Ga0501079_0135589 3300049741 Bacteria 1916
1080 Ga0501079_0171800 3300049741 Bacteria 1690
1081 Ga0501079_0364694 3300049741 Bacteria 1132
1082 Ga0501080_0051650 3300049742 Bacteria 3826
1083 Ga0501080_0054010 3300049742 Bacteria 3741
1084 Ga0501081_0014393 3300049743 Bacteria 5218
1085 Ga0501081_0068523 3300049743 Bacteria 2470
1086 Ga0501081_0073390 3300049743 Bacteria 2386
1087 Ga0501081_0260113 3300049743 Bacteria 1268
1088 Ga0501081_0471865 3300049743 Bacteria 933
1089 Ga0501081_0676490 3300049743 Bacteria 774
1090 Ga0501081_0695485 3300049743 Bacteria 763
1091 Ga0501083_0044613 3300049744 Bacteria 3001
1092 Ga0501083_0789379 3300049744 Bacteria 618
1093 Ga0501035_0221553 3300049822 Bacteria 1615
1094 Ga0501035_0700708 3300049822 Bacteria 817
1095 Ga0501044_0716125 3300049823 Bacteria 885
1096 Ga0501045_0026802 3300049824 Bacteria 4148
1097 Ga0501045_0105902 3300049824 Bacteria 2084
1098 Ga0501045_0339917 3300049824 Bacteria 1117
1099 Ga0501045_0536261 3300049824 Unclassified 868
1100 nmdc:mga03683_209626_c1 3300050489 Unclassified 896
1101 nmdc:mga0yw44_84245_c1 3300050492 Bacteria 1998
1102 nmdc:mga05p37_198233_c1 3300050507 Bacteria 2433
1103 nmdc:mga05p37_22096_c1 3300050507 Bacteria 7712
1104 nmdc:mga05p37_222809_c1 3300050507 Bacteria 2275
1105 nmdc:mga05p37_311590_c1 3300050507 Bacteria 1865
1106 nmdc:mga05p37_373966_c1 3300050507 Bacteria 1671
1107 nmdc:mga05p37_476221_c1 3300050507 Bacteria 1439
1108 nmdc:mga05p37_51857_c1 3300050507 Bacteria 5045
1109 nmdc:mga05p37_912398_c1 3300050507 Bacteria 945
1110 nmdc:mga05p37_95829_c1 3300050507 Bacteria 3656
1111 nmdc:mga09592_110903_c1 3300050508 Bacteria 2354
1112 nmdc:mga09592_1238188_c1 3300050508 Bacteria 616
1113 nmdc:mga09592_808836_c1 3300050508 Bacteria 792
1114 nmdc:mga0qj67_70230_c1 3300050509 Bacteria 2794
1115 nmdc:mga06r32_10292_c1 3300050510 Bacteria 8436
1116 nmdc:mga06r32_35917_c1 3300050510 Bacteria 4678
1117 nmdc:mga06r32_839059_c1 3300050510 Bacteria 878
1118 nmdc:mga08y16_1277_c1 3300050511 Bacteria 25005
1119 nmdc:mga08y16_128055_c1 3300050511 Bacteria 2641
1120 nmdc:mga08y16_152954_c1 3300050511 Bacteria 2398
1121 nmdc:mga08y16_16896_c1 3300050511 Bacteria 7684
1122 nmdc:mga0n895_18537_c1 3300050512 Bacteria 6444
1123 nmdc:mga0n895_355298_c1 3300050512 Bacteria 1484
1124 nmdc:mga0n895_59212_c1 3300050512 Bacteria 3779
1125 nmdc:mga0n895_746982_c1 3300050512 Bacteria 972
1126 nmdc:mga0n895_81554_c1 3300050512 Bacteria 3224
1127 nmdc:mga0n895_907474_c1 3300050512 Bacteria 866
1128 nmdc:mga0rr50_11683_c1 3300050513 Bacteria 5636
1129 nmdc:mga0rr50_22577_c1 3300050513 Bacteria 4322
1130 nmdc:mga0rr50_51730_c1 3300050513 Bacteria 3050
1131 nmdc:mga0rr50_7865_c1 3300050513 Bacteria 6611
1132 nmdc:mga08x19_138809_c1 3300050514 Bacteria 1641
1133 nmdc:mga08x19_480679_c1 3300050514 Unclassified 876
1134 nmdc:mga0a205_1137170_c1 3300050515 Unclassified 628
1135 nmdc:mga0a205_201139_c1 3300050515 Bacteria 1883
1136 nmdc:mga0a205_205732_c1 3300050515 Bacteria 1857
1137 nmdc:mga0a205_259530_c1 3300050515 Bacteria 1615
1138 nmdc:mga0a205_59765_c1 3300050515 Bacteria 3682
1139 Ga0495601_0048243 3300053077 Bacteria 2682
1140 Ga0495601_0457784 3300053077 Bacteria 825
1141 Ga0495655_0076522 3300053083 Bacteria 947
1142 Ga0495655_0174574 3300053083 Unclassified 690
1143 Ga0495619_0023122 3300053085 Bacteria 3982
1144 Ga0500559_0059937 3300053136 Bacteria 1695
1145 Ga0501084_0024420 3300054114 Bacteria 5042
1146 Ga0501084_0485933 3300054114 Bacteria 1044
1147 Ga0501084_0651266 3300054114 Bacteria 889
1148 Ga0501084_0762415 3300054114 Bacteria 815
1149 Ga0501082_0061990 3300060353 Bacteria 3218
1150 Ga0501082_0078946 3300060353 Bacteria 2839
1151 Ga0501082_0398081 3300060353 Bacteria 1202
1152 Ga0501082_0433542 3300060353 Bacteria 1148
1153 Ga0501082_0829395 3300060353 Bacteria 809
1154 Ga0466962_0535403 3300061719 Bacteria 594
1155 Ga0530510_0028917 3300061734 Bacteria 3975
1156 Ga0530510_0047997 3300061734 Bacteria 3086
1157 Ga0530510_0140524 3300061734 Bacteria 1779
1158 Ga0530510_0182490 3300061734 Bacteria 1556
1159 Ga0530510_0534851 3300061734 Bacteria 889
1160 Ga0530510_0704103 3300061734 Unclassified 770
1161 Ga0530510_1025049 3300061734 Bacteria 632
1162 Ga0530510_1405019 3300061734 Bacteria 536
1163 Ga0070713_100288223
1164 rootH1_10083481
1165 Ga0055536_1016854
1166 Ga0070658_10015018
1167 Ga0070658_11622738
1168 Ga0070683_100090265
1169 Ga0070683_100106871
1170 Ga0070683_100133383
1171 Ga0070683_100351431
1172 Ga0070683_100361342
1173 Ga0070683_101412908
1174 Ga0070690_100022168
1175 Ga0070680_100011868
1176 Ga0070680_100045576
1177 Ga0070680_100113919
1178 Ga0070680_100275589
1179 Ga0070680_100277450
1180 Ga0070680_100387154
1181 Ga0070680_100491221
1182 Ga0070680_101261833
1183 Ga0070682_100017679
1184 Ga0070682_100275234
1185 Ga0070682_100280796
1186 Ga0070682_101680932
1187 Ga0068868_100330391
1188 Ga0070660_100005889
1189 Ga0070660_100006898
1190 Ga0070660_100050468
1191 Ga0070660_100094004
1192 Ga0070660_100316319
1193 Ga0070660_100399081
1194 Ga0070661_100008922
1195 Ga0070661_100068128
1196 Ga0070661_100541446
1197 Ga0070661_100682140
1198 Ga0070668_100243128
1199 Ga0070668_100503123
1200 Ga0070671_101091040
1201 Ga0070674_100045155
1202 Ga0070674_100200934
1203 Ga0070659_100016427
1204 Ga0070659_100065967
1205 Ga0070659_100436503
1206 Ga0070703_10052668
1207 Ga0070709_10038941
1208 Ga0070709_10054242
1209 Ga0070714_100027889
1210 Ga0070714_100237429
1211 Ga0070714_100457453
1212 Ga0070714_100512846
1213 Ga0070713_100029423
1214 Ga0070713_100114286
1215 Ga0070713_100594243
1216 Ga0070713_101108383
1217 Ga0070710_10145350
1218 Ga0070710_10347753
1219 Ga0070701_10543217
1220 Ga0070711_100215557
1221 Ga0070705_100003771
1222 Ga0070705_100045000
1223 Ga0070705_100315915
1224 Ga0070705_101075256
1225 Ga0070705_101342046
1226 Ga0070694_100018073
1227 Ga0070694_100020899
1228 Ga0070694_100581936
1229 Ga0070708_100299681
1230 Ga0070708_100757654
1231 Ga0070663_100342264
1232 Ga0070663_100533094
1233 Ga0070678_100050944
1234 Ga0070662_100024466
1235 Ga0070662_100034689
1236 Ga0070662_100166874
1237 Ga0070662_100659583
1238 Ga0070681_10001211
1239 Ga0070681_10006154
1240 Ga0070681_10024508
1241 Ga0070681_10031476
1242 Ga0070681_10068450
1243 Ga0070681_10079201
1244 Ga0070681_10117839
1245 Ga0070681_10128247
1246 Ga0070681_10216002
1247 Ga0070681_10544970
1248 Ga0070681_10650528
1249 Ga0070706_100009634
1250 Ga0070706_100036148
1251 Ga0070706_100191202
1252 Ga0070706_100428495
1253 Ga0070706_100788749
1254 Ga0070707_100087885
1255 Ga0070707_100117452
1256 Ga0070707_100547674
1257 Ga0070707_101281840
1258 Ga0070698_100006972
1259 Ga0070698_100134600
1260 Ga0070698_101538051
1261 Ga0070699_100033968
1262 Ga0070699_100139917
1263 Ga0070699_100186211
1264 Ga0070699_100700419
1265 Ga0070699_101957396
1266 Ga0070679_100005979
1267 Ga0070679_100018501
1268 Ga0070679_100101945
1269 Ga0070679_100165307
1270 Ga0070679_100192070
1271 Ga0070679_100395151
1272 Ga0070684_100003711
1273 Ga0070684_100025315
1274 Ga0070684_100107435
1275 Ga0070684_100174590
1276 Ga0070684_100338222
1277 Ga0070684_100375674
1278 Ga0070684_100520197
1279 Ga0070697_100091492
1280 Ga0070697_100315929
1281 Ga0068853_100256877
1282 Ga0068853_100337001
1283 Ga0068853_100434617
1284 Ga0068853_100652120
1285 Ga0068853_100756774
1286 Ga0068853_100915149
1287 Ga0070686_101202754
1288 Ga0070695_100014734
1289 Ga0070695_100282335
1290 Ga0070695_101000961
1291 Ga0070696_100011162
1292 Ga0070696_100060489
1293 Ga0070696_100981743
1294 Ga0070693_101366710
1295 Ga0070665_100000142
1296 Ga0070665_100072181
1297 Ga0070704_100008285
1298 Ga0070704_100247383
1299 Ga0070704_100249105
1300 Ga0070704_100389047
1301 Ga0070704_100441332
1302 Ga0068855_100036020
1303 Ga0068855_100095467
1304 Ga0068855_100130908
1305 Ga0068855_100144957
1306 Ga0068855_100196745
1307 Ga0070664_100109893
1308 Ga0068857_100036003
1309 Ga0068857_100071265
1310 Ga0068857_100186832
1311 Ga0068857_100415318
1312 Ga0068857_100444783
1313 Ga0068854_100191026
1314 Ga0068854_100863282
1315 Ga0068856_100041648
1316 Ga0068856_100058145
1317 Ga0068856_100117044
1318 Ga0068856_101719086
1319 Ga0070702_100015906
1320 Ga0070702_100950741
1321 Ga0068852_100109972
1322 Ga0068852_101746418
1323 Ga0068852_102010131
1324 Ga0068864_101489597
1325 Ga0068866_10511614
1326 Ga0068861_100174548
1327 Ga0068861_100181348
1328 Ga0068861_100185501
1329 Ga0068861_100577336
1330 Ga0068851_10741341
1331 Ga0068870_10212321
1332 Ga0068858_100728118
1333 Ga0068858_100744286
1334 Ga0068860_100656249
1335 Ga0068862_100131447
1336 Ga0081455_10017728
1337 Ga0081455_10077687
1338 Ga0081455_10635467
1339 Ga0081538_10016843
1340 Ga0081538_10047916
1341 Ga0081538_10112208
1342 Ga0081538_10148313
1343 Ga0081538_10195083
1344 Ga0081540_1004007
1345 Ga0081539_10020311
1346 Ga0081539_10030307
1347 Ga0070717_10167785
1348 Ga0070717_10229347
1349 Ga0075365_10058287
1350 Ga0075432_10059872
1351 Ga0075432_10073276
1352 Ga0075432_10176282
1353 Ga0070715_10061469
1354 Ga0070716_100006808
1355 Ga0070712_100025054
1356 Ga0070712_100048361
1357 Ga0070712_100085325
1358 Ga0070712_100115895
1359 Ga0070712_100309241
1360 Ga0070712_100546091
1361 Ga0097621_100698197
1362 Ga0068871_101333120
1363 Ga0075428_100459735
1364 Ga0075428_102454767
1365 Ga0075430_100002108
1366 Ga0075430_100810498
1367 Ga0075431_100054564
1368 Ga0075431_100197507
1369 Ga0075431_101051129
1370 Ga0075433_10033888
1371 Ga0075433_10078996
1372 Ga0075433_10519534
1373 Ga0075433_10803364
1374 Ga0075434_100005176
1375 Ga0075434_100082259
1376 Ga0075434_100271564
1377 Ga0075434_100427497
1378 Ga0075429_101096219
1379 Ga0075429_101905878
1380 Ga0068865_100168492
1381 Ga0075436_100000947
1382 Ga0075435_100002357
1383 Ga0075435_100021556
1384 Ga0075435_100030973
1385 Ga0075435_100444515
1386 Ga0105240_10286551
1387 Ga0105240_10324900
1388 Ga0105240_10393176
1389 Ga0105240_11360004
1390 Ga0111539_10007332
1391 Ga0111539_10010679
1392 Ga0111539_10159167
1393 Ga0105245_10012746
1394 Ga0105245_10122058
1395 Ga0105245_10236379
1396 Ga0105245_10262077
1397 Ga0105245_10585833
1398 Ga0105245_10660783
1399 Ga0114129_10017065
1400 Ga0114129_10039336
1401 Ga0114129_10041692
1402 Ga0114129_10189661
1403 Ga0114129_10194674
1404 Ga0114129_10269908
1405 Ga0114129_10411492
1406 Ga0114129_10568928
1407 Ga0114129_10687902
1408 Ga0114129_11293096
1409 Ga0114129_12106237
1410 Ga0105243_10075875
1411 Ga0105243_10157419
1412 Ga0105243_10214655
1413 Ga0105243_10625258
1414 Ga0105241_10458424
1415 Ga0105242_10405602
1416 Ga0105248_10024828
1417 Ga0105237_10052617
1418 Ga0105237_10126052
1419 Ga0105237_10331478
1420 Ga0105237_10812354
1421 Ga0105238_10167719
1422 Ga0105238_11004558
1423 Ga0105238_11198556
1424 Ga0105249_10010851
1425 Ga0105249_10071305
1426 Ga0105249_10153800
1427 Ga0105249_10564101
1428 Ga0105249_10938293
1429 Ga0105239_10038088
1430 Ga0105239_10195213
1431 Ga0105239_10279255
1432 Ga0105239_10428923
1433 Ga0105239_10954450
1434 Ga0105239_11643418
1435 Ga0105239_11834665
1436 Ga0105239_13085444
1437 Ga0105246_10012450
1438 Ga0105246_11186414
1439 Ga0154010_174948
1440 Ga0157373_10085393
1441 Ga0157373_10433225
1442 Ga0157371_10230787
1443 Ga0157371_10421269
1444 Ga0157370_10023626
1445 Ga0157370_10132064
1446 Ga0157370_10141219
1447 Ga0157370_10180672
1448 Ga0157370_10797802
1449 Ga0157369_10019033
1450 Ga0157369_10071417
1451 Ga0157369_10179200
1452 Ga0157369_10216570
1453 Ga0157369_11064392
1454 Ga0157374_10196026
1455 Ga0157374_10961010
1456 Ga0157378_11250738
1457 Ga0163162_10155009
1458 Ga0163162_10207142
1459 Ga0157372_10034055
1460 Ga0157372_10072877
1461 Ga0157372_10140424
1462 Ga0157372_10344712
1463 Ga0157372_10383457
1464 Ga0157372_10386050
1465 Ga0157372_10396235
1466 Ga0157372_10962358
1467 Ga0157375_10213871
1468 Ga0157375_10353724
1469 Ga0157375_10385089
1470 Ga0157375_10440914
1471 Ga0157375_13353484
1472 Ga0163163_10363098
1473 Ga0157380_10625154
1474 Ga0182008_10000487
1475 Ga0182008_10285942
1476 Ga0157377_10620612
1477 Ga0182007_10010452
1478 Ga0182007_10131856
1479 Ga0163161_10090047
1480 Ga0163161_10287801
1481 Ga0206356_11060558
1482 Ga0206356_11537578
1483 Ga0206354_10308263
1484 Ga0206354_10578468
1485 Ga0206354_11268256
1486 Ga0206354_11547566
1487 Ga0206353_10116331
1488 Ga0206353_10302908
1489 Ga0206353_10850770
1490 Ga0206353_10926494
1491 Ga0206353_10938317
1492 Ga0206353_11810256
1493 Ga0207653_10005347
1494 Ga0207692_10177496
1495 Ga0207642_10060751
1496 Ga0207685_10099454
1497 Ga0207699_10029805
1498 Ga0207699_10060017
1499 Ga0207699_10194100
1500 Ga0207699_10623354
1501 Ga0207643_10074177
1502 Ga0207705_10090402
1503 Ga0207705_10113187
1504 Ga0207705_10817174
1505 Ga0207684_10000595
1506 Ga0207684_10071641
1507 Ga0207684_10138858
1508 Ga0207684_10238457
1509 Ga0207684_10249809
1510 Ga0207684_10554929
1511 Ga0207654_10127579
1512 Ga0207707_10007562
1513 Ga0207707_10031713
1514 Ga0207707_10052819
1515 Ga0207707_10055911
1516 Ga0207707_10070608
1517 Ga0207707_10070905
1518 Ga0207707_10144845
1519 Ga0207707_10235412
1520 Ga0207695_10040640
1521 Ga0207695_10171531
1522 Ga0207695_10478732
1523 Ga0207671_10076666
1524 Ga0207671_10094543
1525 Ga0207671_10624215
1526 Ga0207693_10001581
1527 Ga0207693_10004236
1528 Ga0207693_10021377
1529 Ga0207693_10035810
1530 Ga0207693_10530506
1531 Ga0207663_10002524
1532 Ga0207663_10524872
1533 Ga0207663_10814915
1534 Ga0207660_10017445
1535 Ga0207660_10017816
1536 Ga0207660_10027344
1537 Ga0207660_10087307
1538 Ga0207660_10128402
1539 Ga0207660_10272021
1540 Ga0207660_10310095
1541 Ga0207660_10387616
1542 Ga0207660_10524030
1543 Ga0207662_10391450
1544 Ga0207657_10000054
1545 Ga0207657_10003977
1546 Ga0207657_10005514
1547 Ga0207657_10011616
1548 Ga0207657_10011988
1549 Ga0207657_10037356
1550 Ga0207657_10156420
1551 Ga0207657_10588267
1552 Ga0207649_10034276
1553 Ga0207649_10039292
1554 Ga0207649_10129540
1555 Ga0207649_10408685
1556 Ga0207649_10690636
1557 Ga0207652_10004445
1558 Ga0207652_10038262
1559 Ga0207652_10040882
1560 Ga0207652_10063362
1561 Ga0207652_10111726
1562 Ga0207652_10123670
1563 Ga0207652_10135715
1564 Ga0207652_10252087
1565 Ga0207652_10876169
1566 Ga0207646_10006870
1567 Ga0207646_10205607
1568 Ga0207646_10252758
1569 Ga0207646_10527296
1570 Ga0207681_10684717
1571 Ga0207694_11323152
1572 Ga0207687_10015768
1573 Ga0207687_10043101
1574 Ga0207687_10210682
1575 Ga0207687_10354102
1576 Ga0207687_10518585
1577 Ga0207687_10923300
1578 Ga0207700_10000006
1579 Ga0207700_10379106
1580 Ga0207700_10465286
1581 Ga0207664_10024170
1582 Ga0207664_10128676
1583 Ga0207664_10133843
1584 Ga0207664_10164041
1585 Ga0207664_10345051
1586 Ga0207664_10552500
1587 Ga0207664_10628038
1588 Ga0207644_11697620
1589 Ga0207690_10035494
1590 Ga0207690_10074440
1591 Ga0207690_10147847
1592 Ga0207690_10291788
1593 Ga0207690_10413442
1594 Ga0207690_11300703
1595 Ga0207690_11386188
1596 Ga0207706_10028155
1597 Ga0207706_10268610
1598 Ga0207706_10396740
1599 Ga0207686_10316494
1600 Ga0207709_10603517
1601 Ga0207669_10019902
1602 Ga0207665_10010466
1603 Ga0207665_10034758
1604 Ga0207665_10079012
1605 Ga0207691_10141984
1606 Ga0207711_10153738
1607 Ga0207711_10483011
1608 Ga0207689_10650157
1609 Ga0207689_11175867
1610 Ga0207661_10058628
1611 Ga0207661_10283668
1612 Ga0207661_10326308
1613 Ga0207661_10399046
1614 Ga0207661_11138459
1615 Ga0207661_11536714
1616 Ga0207679_10046972
1617 Ga0207679_10891072
1618 Ga0207667_10023514
1619 Ga0207667_10066221
1620 Ga0207667_10141333
1621 Ga0207667_10175364
1622 Ga0207667_10196978
1623 Ga0207667_10831886
1624 Ga0207667_10857212
1625 Ga0207712_10041383
1626 Ga0207712_10042305
1627 Ga0207712_10171094
1628 Ga0207712_10346154
1629 Ga0207712_10650795
1630 Ga0207668_10200428
1631 Ga0207668_10356110
1632 Ga0207668_10695739
1633 Ga0207640_10028669
1634 Ga0207640_10073364
1635 Ga0207640_10456106
1636 Ga0207640_10824017
1637 Ga0207640_11094706
1638 Ga0207677_10037372
1639 Ga0207677_10869014
1640 Ga0207677_11521322
1641 Ga0207677_11760576
1642 Ga0207703_10607933
1643 Ga0207639_10240708
1644 Ga0207639_10385106
1645 Ga0207639_10495588
1646 Ga0207639_10564102
1647 Ga0207639_10602056
1648 Ga0207639_11560812
1649 Ga0207678_10611761
1650 Ga0207708_10218915
1651 Ga0207708_10266663
1652 Ga0207708_10618096
1653 Ga0207708_11111129
1654 Ga0207702_10037364
1655 Ga0207702_10061916
1656 Ga0207702_10516857
1657 Ga0207702_10583072
1658 Ga0207702_10932911
1659 Ga0207641_10433505
1660 Ga0207648_10721958
1661 Ga0207648_10752708
1662 Ga0207676_10266344
1663 Ga0207674_10006223
1664 Ga0207674_10059284
1665 Ga0207674_10107454
1666 Ga0207674_10112588
1667 Ga0207674_10292048
1668 Ga0207674_10508544
1669 Ga0207675_100030764
1670 Ga0207675_100061187
1671 Ga0207675_100096696
1672 Ga0207675_100520179
1673 Ga0207683_10011124
1674 Ga0207683_10815666
1675 Ga0207683_11780766
1676 Ga0209998_10009501
1677 Ga0207428_10000551
1678 Ga0207428_10009220
1679 Ga0207428_10038045
1680 Ga0268266_10000081
1681 Ga0268266_10236597
1682 Ga0268265_10278422
1683 Ga0268264_10353395
1684 Ga0268264_10463017
1685 Ga0265326_10084701
1686 Ga0265319_1152429
1687 Ga0265318_10018736
1688 Ga0265318_10038357
1689 Ga0265318_10159727
1690 Ga0265323_10084124
1691 Ga0265322_10011308
1692 Ga0265338_10013856
1693 Ga0265338_10045873
1694 Ga0265338_10060846
1695 Ga0265330_10074404
1696 Ga0265332_10049793
1697 Ga0265325_10042525
1698 Ga0265329_10073297
1699 Ga0265340_10030522
1700 Ga0265340_10175885
1701 Ga0265339_10007462
1702 Ga0265339_10090713
1703 Ga0265331_10068331
1704 Ga0265331_10170982
1705 Ga0265327_10003047
1706 Ga0265327_10076032
1707 Ga0265316_10002206
1708 Ga0265316_10066278
1709 Ga0265316_10643000
1710 Ga0265316_10879438
1711 Ga0307408_100010016
1712 Ga0307408_100183990
1713 Ga0307408_100243604
1714 Ga0265313_10061225
1715 Ga0265314_10003413
1716 Ga0265314_10032486
1717 Ga0265314_10086123
1718 Ga0265342_10069720
1719 Ga0307405_10005839
1720 Ga0307405_10012720
1721 Ga0307405_11198283
1722 Ga0307413_10002950
1723 Ga0307413_10077315
1724 Ga0307413_11540270
1725 Ga0307410_10002995
1726 Ga0307410_10062021
1727 Ga0307410_11443735
1728 Ga0307406_10002763
1729 Ga0307406_10116774
1730 Ga0307406_10189494
1731 Ga0307406_10853611
1732 Ga0307407_10004116
1733 Ga0307407_10097586
1734 Ga0307407_10916440
1735 Ga0307412_11177375
1736 Ga0307409_100009005
1737 Ga0307409_100011218
1738 Ga0307409_100294676
1739 Ga0307409_100394792
1740 Ga0307409_100472312
1741 Ga0307409_100703459
1742 Ga0307409_101369944
1743 Ga0307416_100001425
1744 Ga0307416_100021273
1745 Ga0307416_100043845
1746 Ga0307414_10171377
1747 Ga0307414_10489136
1748 Ga0307414_10964300
1749 Ga0307411_10003163
1750 Ga0307411_10791480
1751 Ga0307415_100000286
1752 Ga0307415_100004173
1753 Ga0307415_100347416
1754 Ga0373930_0018229
1755 Ga0373948_0007410
1756 Ga0373948_0077709
1757 Ga0373950_0002783
1758 Ga0373958_0002498
1759 Ga0373938_0003711
1760 Ga0373928_0014717
1761 Ga0373928_0179446
1762 Ga0373929_0019235
1763 Ga0373949_0002911
1764 Ga0373951_0012208
1765 Ga0373952_0004699
1766 Ga0373932_0002305
1767 Ga0373939_0000998
1768 Ga0373939_0032710
1769 Ga0373939_0033574
1770 Ga0373941_0011207
1771 Ga0373941_0059477
1772 Ga0373960_0000459
1773 Ga0373943_0031688
1774 Ga0373942_0004263
1775 Ga0373961_0007365
1776 Ga0373961_0153153
1777 Ga0373962_0011891
1778 Ga0316574_0164656
1779 Ga0373931_0005838
1780 Ga0373931_0062040
1781 Ga0373931_0140921
1782 Ga0373931_0865138
1783 Ga0373935_0083041
1784 Ga0373937_0087073
1785 Ga0395899_0001614
1786 Ga0395899_0003283
1787 Ga0395899_0014311
1788 Ga0395899_0016263
1789 Ga0395899_0025572
1790 Ga0395899_0027903
1791 Ga0395899_0039999
1792 Ga0395899_0106454
1793 Ga0395899_0109783
1794 Ga0395899_0119318
1795 Ga0395899_0234401
1796 Ga0395900_0004680
1797 Ga0395900_0005323
1798 Ga0395900_0010115
1799 Ga0395900_0016923
1800 Ga0395900_0018889
1801 Ga0395900_0044318
1802 Ga0395900_0049100
1803 Ga0395900_0066125
1804 Ga0395900_0073000
1805 Ga0395900_0081470
1806 Ga0395900_0085975
1807 Ga0395900_0126305
1808 Ga0395900_0131713
1809 Ga0395900_0143157
1810 Ga0395900_0193215
1811 Ga0395900_0228390
1812 Ga0395900_0346593
1813 Ga0395900_0444000
1814 Ga0395900_0583789
1815 Ga0395900_0640890
1816 Ga0395900_0645091
1817 Ga0395900_0755906
1818 Ga0395900_1065083
1819 Ga0395900_1465796
1820 Ga0395900_1619754
1821 Ga0395898_0002616
1822 Ga0395898_0005906
1823 Ga0395898_0007257
1824 Ga0395898_0019563
1825 Ga0395898_0025937
1826 Ga0395898_0032324
1827 Ga0395898_0052482
1828 Ga0395898_0070467
1829 Ga0395898_0101435
1830 Ga0395898_0104976
1831 Ga0395898_0111475
1832 Ga0395898_0149383
1833 Ga0395898_0218653
1834 Ga0395898_0291240
1835 Ga0395898_0309631
1836 Ga0395898_0382788
1837 Ga0395898_0405998
1838 Ga0395898_0432054
1839 Ga0395898_0655311
1840 Ga0395898_0668770
1841 Ga0395898_0693237
1842 Ga0395898_0826227
1843 Ga0395898_1272535
1844 Ga0395898_1421871
1845 Ga0395905_0003496
1846 Ga0395905_0005495
1847 Ga0395905_0014937
1848 Ga0395905_0038630
1849 Ga0395905_0040078
1850 Ga0395905_0060423
1851 Ga0395905_0062432
1852 Ga0395905_0065218
1853 Ga0395905_0068291
1854 Ga0395905_0189724
1855 Ga0395905_0269829
1856 Ga0395905_0272117
1857 Ga0395905_0332078
1858 Ga0395905_0366612
1859 Ga0395905_0485167
1860 Ga0395905_0506479
1861 Ga0395905_0585392
1862 Ga0395905_1053075
1863 Ga0395905_1083119
1864 Ga0395905_1097162
1865 Ga0395905_1180477
1866 Ga0436364_0871138
1867 Ga0395901_0000744
1868 Ga0395901_0001394
1869 Ga0395901_0001686
1870 Ga0395901_0002239
1871 Ga0395901_0005425
1872 Ga0395901_0014181
1873 Ga0395901_0038084
1874 Ga0395901_0044163
1875 Ga0395901_0091307
1876 Ga0395901_0109199
1877 Ga0395901_0132957
1878 Ga0395901_0150080
1879 Ga0395901_0177981
1880 Ga0395901_0186485
1881 Ga0395901_0194979
1882 Ga0395901_0305475
1883 Ga0395901_0321460
1884 Ga0395901_0602370
1885 Ga0395901_0637690
1886 Ga0395901_0657083
1887 Ga0395901_2030419
1888 Ga0436365_0391299
1889 Ga0436365_1592653
1890 Ga0436363_1209816
1891 Ga0436363_1414311
1892 Ga0436363_1590339
1893 Ga0439461_0135203
1894 Ga0451839_0381197
1895 Ga0451851_0997760
1896 Ga0451853_0445709
1897 Ga0451853_0502246
1898 Ga0451853_0894815
1899 Ga0439448_0014578
1900 Ga0439450_046628
1901 Ga0450906_045499
1902 Ga0439458_0178262
1903 Ga0439460_0250993
1904 Ga0466969_0174737
1905 Ga0466966_0043026
1906 Ga0466961_0129780
1907 Ga0466963_0020255
1908 Ga0466963_0034424
1909 Ga0466963_0079065
1910 Ga0466963_0578936
1911 Ga0466964_0001299
1912 Ga0466964_0011257
1913 Ga0466964_0237287
1914 Ga0466971_0343242
1915 Ga0466968_0013261
1916 Ga0466957_0201946
1917 Ga0466957_0235344
1918 Ga0466957_0307065
1919 Ga0466957_0398776
1920 Ga0466957_0460361
1921 Ga0466960_0067728
1922 Ga0466960_0123435
1923 Ga0466959_0003201
1924 Ga0451576_0025325
1925 Ga0451576_0235236
1926 Ga0451576_0238671
1927 Ga0466958_0103604
1928 Ga0466958_0255350
1929 Ga0466958_0321918
1930 Ga0466958_0416601
1931 Ga0466967_0000440
1932 Ga0466967_0029993
1933 Ga0466967_0040177
1934 Ga0466967_0049004
1935 Ga0466967_0075564
1936 Ga0466967_0174798
1937 Ga0466967_0314038
1938 Ga0466967_0362397
1939 Ga0466967_0405677
1940 Ga0466967_0491357
1941 Ga0466967_0495326
1942 Ga0466967_0657990
1943 Ga0466967_0811046
1944 Ga0466967_0989259
1945 Ga0466967_1598418
1946 Ga0466967_1731651
1947 Ga0466967_1857199
1948 Ga0495591_056587
1949 Ga0495629_0284204
1950 Ga0495629_0303633
1951 Ga0495638_0571952
1952 Ga0495641_0033614
1953 Ga0495641_0093315
1954 Ga0495641_0240345
1955 Ga0495651_0099706
1956 Ga0495651_0549510
1957 Ga0495651_0561052
1958 Ga0495653_0073227
1959 Ga0495582_0365606
1960 Ga0495582_0560320
1961 Ga0495605_0059424
1962 Ga0495605_0161092
1963 Ga0495605_0274673
1964 Ga0495639_0448072
1965 Ga0495639_0554059
1966 Ga0495584_0055035
1967 Ga0495584_0071372
1968 Ga0495584_0150913
1969 Ga0495584_0171194
1970 Ga0495584_0192627
1971 Ga0495584_0304288
1972 Ga0495584_0332782
1973 Ga0495585_0131851
1974 Ga0495596_0074957
1975 Ga0495596_0334515
1976 Ga0495608_0117136
1977 Ga0495620_0103725
1978 Ga0495630_0063267
1979 Ga0495630_0101602
1980 Ga0495631_0201316
1981 Ga0495632_0341808
1982 Ga0495637_0064001
1983 Ga0495644_0130580
1984 Ga0495644_0150737
1985 Ga0495663_0023132
1986 Ga0495663_0041814
1987 Ga0495642_0100070
1988 Ga0495642_0231845
1989 Ga0495642_0274694
1990 Ga0495652_0142926
1991 Ga0495652_0416419
1992 Ga0495652_0529233
1993 Ga0495654_0083258
1994 Ga0495640_0409083
1995 Ga0495586_0059389
1996 Ga0495587_0598103
1997 Ga0495598_0102051
1998 Ga0495609_0053530
1999 Ga0495609_0216168
2000 Ga0495621_0031666
2001 Ga0495645_0521355
2002 Ga0495667_0074628
2003 Ga0495656_0063740
2004 Ga0495656_0071083
2005 Ga0495656_0215078
2006 Ga0495668_0361926
2007 Ga0495668_0407645
2008 Ga0495634_0056762
2009 Ga0495611_0054307
2010 Ga0495611_0189665
2011 Ga0495625_0537379
2012 Ga0495635_0427188
2013 Ga0495659_0002526
2014 Ga0495659_0002767
2015 Ga0495659_0401102
2016 Ga0495661_0290585
2017 Ga0495661_0526390
2018 Ga0495657_0425758
2019 Ga0495657_0443279
2020 Ga0495657_0703588
2021 Ga0495599_0122154
2022 Ga0495599_0205190
2023 Ga0495599_0481515
2024 Ga0495599_0539669
2025 Ga0495623_0223598
2026 Ga0495647_0104093
2027 Ga0495658_0073103
2028 Ga0495658_0266198
2029 Ga0495658_0994874
2030 Ga0495669_0248301
2031 Ga0495613_0641869
2032 Ga0495613_0646903
2033 Ga0495613_0882208
2034 Ga0495670_0350016
2035 Ga0495671_0323506
2036 Ga0495589_0156513
2037 Ga0495589_0161345
2038 Ga0495589_0199337
2039 Ga0495589_0235671
2040 Ga0495600_0395794
2041 Ga0495600_0567940
2042 Ga0495581_0219271
2043 Ga0495604_0539361
2044 Ga0495676_1047527
2045 Ga0495680_0134301
2046 Ga0495683_0138622
2047 Ga0495683_0395180
2048 Ga0495677_0187729
2049 Ga0495685_072911
2050 Ga0495684_0330206
2051 Ga0496100_0004854
2052 Ga0496100_0029788
2053 Ga0496100_0042219
2054 Ga0496100_0109415
2055 Ga0496100_0129304
2056 Ga0496100_1220653
2057 Ga0496100_1334287
2058 Ga0496101_0004861
2059 Ga0496101_0071942
2060 Ga0496101_0144838
2061 Ga0496101_0153005
2062 Ga0496101_0442174
2063 Ga0496101_0468301
2064 Ga0496102_0018069
2065 Ga0496102_0039707
2066 Ga0496102_0181864
2067 Ga0496102_0187419
2068 Ga0496102_0368080
2069 Ga0496102_0500024
2070 Ga0496102_0511136
2071 Ga0496102_1050091
2072 Ga0496103_0055918
2073 Ga0496103_0075386
2074 Ga0496103_0100145
2075 Ga0496103_0161799
2076 Ga0496103_0340742
2077 Ga0496103_0460412
2078 Ga0496103_0583137
2079 Ga0496104_0024445
2080 Ga0496104_0027429
2081 Ga0496104_0056269
2082 Ga0496104_0059751
2083 Ga0496104_0097950
2084 Ga0496105_0000362
2085 Ga0496105_0006218
2086 Ga0496105_0007486
2087 Ga0496105_0024596
2088 Ga0496105_0728031
2089 Ga0496106_0008454
2090 Ga0496106_0025194
2091 Ga0496106_0094409
2092 Ga0496106_0106130
2093 Ga0496106_0525933
2094 Ga0496107_0029355
2095 Ga0496107_0045645
2096 Ga0496107_0054716
2097 Ga0496107_0086712
2098 Ga0496107_0201704
2099 Ga0496107_0282598
2100 Ga0496107_0433753
2101 Ga0496107_0502089
2102 Ga0496107_0555385
2103 Ga0496108_0003918
2104 Ga0496108_0004739
2105 Ga0496108_0049211
2106 Ga0496108_0102220
2107 Ga0496108_0110036
2108 Ga0496108_0183025
2109 Ga0496108_0332960
2110 Ga0496108_0525167
2111 Ga0496109_0004197
2112 Ga0496109_0009486
2113 Ga0496109_0013491
2114 Ga0496109_0070870
2115 Ga0496109_0080397
2116 Ga0496109_0089241
2117 Ga0496109_0090901
2118 Ga0496109_0109270
2119 Ga0496109_0434561
2120 Ga0496109_1343413
2121 Ga0496110_0002026
2122 Ga0496110_0004908
2123 Ga0496110_0012389
2124 Ga0496110_0039758
2125 Ga0496110_0049929
2126 Ga0496110_0172781
2127 Ga0496110_0294973
2128 Ga0496110_0409318
2129 Ga0496110_1825587
2130 Ga0496111_0000234
2131 Ga0496111_0024062
2132 Ga0496111_0077048
2133 Ga0496111_0146812
2134 Ga0496111_0162502
2135 Ga0496111_0216613
2136 Ga0496111_0316027
2137 Ga0496111_0859554
2138 Ga0496112_0008602
2139 Ga0496112_0048339
2140 Ga0496112_0083854
2141 Ga0496112_0170361
2142 Ga0496112_0496639
2143 Ga0496112_0538607
2144 Ga0496112_0654208
2145 Ga0496112_0733247
2146 Ga0496112_0880070
2147 Ga0496112_1178217
2148 Ga0496113_0004778
2149 Ga0496113_0090832
2150 Ga0496113_0102804
2151 Ga0496113_0119808
2152 Ga0496113_0289671
2153 Ga0496113_0534534
2154 Ga0496113_0559567
2155 Ga0496113_0653127
2156 Ga0496113_0982998
2157 Ga0496113_1090813
2158 Ga0496114_0008661
2159 Ga0496114_0025592
2160 Ga0496114_0052175
2161 Ga0496114_0092542
2162 Ga0496114_0112924
2163 Ga0496114_0113075
2164 Ga0496114_0952694
2165 Ga0496114_0992694
2166 Ga0496114_1047833
2167 Ga0496114_1373804
2168 Ga0496115_0006662
2169 Ga0496115_0035182
2170 Ga0496115_0283998
2171 Ga0496115_0675028
2172 Ga0501031_0005539
2173 Ga0501032_0846496
2174 Ga0501033_0089532
2175 Ga0501033_0209922
2176 Ga0501034_0022281
2177 Ga0501034_0312104
2178 Ga0501034_0506786
2179 Ga0501036_0362841
2180 Ga0501038_0326396
2181 Ga0501038_0359966
2182 Ga0501039_0029160
2183 Ga0501039_0617783
2184 Ga0501040_0077248
2185 Ga0501040_0097892
2186 Ga0501040_0340948
2187 Ga0501040_0350231
2188 Ga0501040_0411289
2189 Ga0501041_0037607
2190 Ga0501041_0327737
2191 Ga0501042_0101102
2192 Ga0501042_0103146
2193 Ga0501042_0188294
2194 Ga0501042_0674274
2195 Ga0501046_0121636
2196 Ga0501046_0218106
2197 Ga0501048_0065397
2198 Ga0501048_0388624
2199 Ga0501067_0000516
2200 Ga0501067_0002005
2201 Ga0501067_0013292
2202 Ga0501067_0106281
2203 Ga0501067_0560960
2204 Ga0501068_0061002
2205 Ga0501068_0101621
2206 Ga0501068_0106001
2207 Ga0501068_0127574
2208 Ga0501068_0137718
2209 Ga0501068_0212395
2210 Ga0501069_0002134
2211 Ga0501069_0005912
2212 Ga0501069_0009763
2213 Ga0501069_0091708
2214 Ga0501069_0091958
2215 Ga0501069_0197710
2216 Ga0501070_0101991
2217 Ga0501070_0229662
2218 Ga0501070_0462373
2219 Ga0501070_1027226
2220 Ga0501071_0347474
2221 Ga0501072_0053709
2222 Ga0501072_0346053
2223 Ga0501072_0954676
2224 Ga0501074_0050935
2225 Ga0501074_0237438
2226 Ga0501074_0435217
2227 Ga0501075_0001511
2228 Ga0501075_0252956
2229 Ga0501075_0274193
2230 Ga0501075_0347315
2231 Ga0501076_0086706
2232 Ga0501076_0182798
2233 Ga0501076_0480063
2234 Ga0501076_0884446
2235 Ga0501077_0013534
2236 Ga0501077_0025788
2237 Ga0501077_0077243
2238 Ga0501077_0802151
2239 Ga0501079_0053626
2240 Ga0501079_0135589
2241 Ga0501079_0171800
2242 Ga0501079_0364694
2243 Ga0501080_0051650
2244 Ga0501080_0054010
2245 Ga0501081_0014393
2246 Ga0501081_0068523
2247 Ga0501081_0073390
2248 Ga0501081_0260113
2249 Ga0501081_0471865
2250 Ga0501081_0676490
2251 Ga0501081_0695485
2252 Ga0501083_0044613
2253 Ga0501083_0789379
2254 Ga0501035_0221553
2255 Ga0501035_0700708
2256 Ga0501044_0716125
2257 Ga0501045_0026802
2258 Ga0501045_0105902
2259 Ga0501045_0339917
2260 Ga0501045_0536261
2261 nmdc:mga03683_209626_c1
2262 nmdc:mga0yw44_84245_c1
2263 nmdc:mga05p37_198233_c1
2264 nmdc:mga05p37_22096_c1
2265 nmdc:mga05p37_222809_c1
2266 nmdc:mga05p37_311590_c1
2267 nmdc:mga05p37_373966_c1
2268 nmdc:mga05p37_476221_c1
2269 nmdc:mga05p37_51857_c1
2270 nmdc:mga05p37_912398_c1
2271 nmdc:mga05p37_95829_c1
2272 nmdc:mga09592_110903_c1
2273 nmdc:mga09592_1238188_c1
2274 nmdc:mga09592_808836_c1
2275 nmdc:mga0qj67_70230_c1
2276 nmdc:mga06r32_10292_c1
2277 nmdc:mga06r32_35917_c1
2278 nmdc:mga06r32_839059_c1
2279 nmdc:mga08y16_1277_c1
2280 nmdc:mga08y16_128055_c1
2281 nmdc:mga08y16_152954_c1
2282 nmdc:mga08y16_16896_c1
2283 nmdc:mga0n895_18537_c1
2284 nmdc:mga0n895_355298_c1
2285 nmdc:mga0n895_59212_c1
2286 nmdc:mga0n895_746982_c1
2287 nmdc:mga0n895_81554_c1
2288 nmdc:mga0n895_907474_c1
2289 nmdc:mga0rr50_11683_c1
2290 nmdc:mga0rr50_22577_c1
2291 nmdc:mga0rr50_51730_c1
2292 nmdc:mga0rr50_7865_c1
2293 nmdc:mga08x19_138809_c1
2294 nmdc:mga08x19_480679_c1
2295 nmdc:mga0a205_1137170_c1
2296 nmdc:mga0a205_201139_c1
2297 nmdc:mga0a205_205732_c1
2298 nmdc:mga0a205_259530_c1
2299 nmdc:mga0a205_59765_c1
2300 Ga0495601_0048243
2301 Ga0495601_0457784
2302 Ga0495655_0076522
2303 Ga0495655_0174574
2304 Ga0495619_0023122
2305 Ga0500559_0059937
2306 Ga0501084_0024420
2307 Ga0501084_0485933
2308 Ga0501084_0651266
2309 Ga0501084_0762415
2310 Ga0501082_0061990
2311 Ga0501082_0078946
2312 Ga0501082_0398081
2313 Ga0501082_0433542
2314 Ga0501082_0829395
2315 Ga0466962_0535403
2316 Ga0530510_0028917
2317 Ga0530510_0047997
2318 Ga0530510_0140524
2319 Ga0530510_0182490
2320 Ga0530510_0534851
2321 Ga0530510_0704103
2322 Ga0530510_1025049
2323 Ga0530510_1405019

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

34

166

0.95

PF22769

DCD

dCTP deaminase-like

19

141

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5edd-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant 0.9809 2 128
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9808 2 128
1sm8-assembly1.cif.gz_C m. tuberculosis dutpase complexed with chromium and dutp 0.9786 1 129
3i93-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase stop138t mutant 0.9778 1 128
1slh-assembly1.cif.gz_B mycobacterium tuberculosis dutpase complexed with magnesium and dudp 0.9766 2 128
ID Description Score Start End Superfamily
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9813 1 128 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9761 1 129 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9688 1 129 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9442 3 131 2.70.40.10
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9294 16 118 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A7V9BGE2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9941 7 120 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A059WW43-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.984 1 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2E9CZE5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9826 4 116 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A059WPA8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9822 1 130 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A6I5CJI7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9817 5 134 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map