F491005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1161 | 372 | 2323 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100288223|Ga0070713_1002882232 |
| Length | 167 |
| Sequence | VSAAGSTEPQRGGGAGLAGTSAGAVELLIRKVRPNAVVPVRAYSGDAGLDLTSCDRVELAPGERALVPTGLAVAIPQGYAGYVQPRSGLAAKHGISIVNTPGLVDSGYRGELLVSLINTDRDETFVVEEGMRIAQLVILEVPDVELVEVGELPESERGVRGFGSSLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 231 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 234 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 235 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 236 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 237 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 10.42 |
| Rhizosphere | 88.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100288223 | 3300005436 | Bacteria | 1508 |
| 2 | rootH1_10083481 | 3300003316 | Bacteria | 1260 |
| 3 | rootH1_10083481 | 3300003323 | Bacteria | 3926 |
| 4 | Ga0055536_1016854 | 3300003781 | Bacteria | 2420 |
| 5 | Ga0070658_10015018 | 3300005327 | Bacteria | 6199 |
| 6 | Ga0070658_11622738 | 3300005327 | Bacteria | 560 |
| 7 | Ga0070683_100090265 | 3300005329 | Bacteria | 2877 |
| 8 | Ga0070683_100106871 | 3300005329 | Bacteria | 2639 |
| 9 | Ga0070683_100133383 | 3300005329 | Bacteria | 2350 |
| 10 | Ga0070683_100351431 | 3300005329 | Bacteria | 1404 |
| 11 | Ga0070683_100361342 | 3300005329 | Bacteria | 1383 |
| 12 | Ga0070683_101412908 | 3300005329 | Bacteria | 669 |
| 13 | Ga0070690_100022168 | 3300005330 | Bacteria | 3884 |
| 14 | Ga0070680_100011868 | 3300005336 | Bacteria | 6757 |
| 15 | Ga0070680_100045576 | 3300005336 | Bacteria | 3565 |
| 16 | Ga0070680_100113919 | 3300005336 | Bacteria | 2253 |
| 17 | Ga0070680_100275589 | 3300005336 | Bacteria | 1425 |
| 18 | Ga0070680_100277450 | 3300005336 | Bacteria | 1420 |
| 19 | Ga0070680_100387154 | 3300005336 | Bacteria | 1191 |
| 20 | Ga0070680_100491221 | 3300005336 | Unclassified | 1050 |
| 21 | Ga0070680_101261833 | 3300005336 | Unclassified | 639 |
| 22 | Ga0070682_100017679 | 3300005337 | Bacteria | 4159 |
| 23 | Ga0070682_100275234 | 3300005337 | Bacteria | 1225 |
| 24 | Ga0070682_100280796 | 3300005337 | Bacteria | 1214 |
| 25 | Ga0070682_101680932 | 3300005337 | Bacteria | 551 |
| 26 | Ga0068868_100330391 | 3300005338 | Bacteria | 1301 |
| 27 | Ga0070660_100005889 | 3300005339 | Bacteria | 8480 |
| 28 | Ga0070660_100006898 | 3300005339 | Bacteria | 7880 |
| 29 | Ga0070660_100050468 | 3300005339 | Bacteria | 3201 |
| 30 | Ga0070660_100094004 | 3300005339 | Bacteria | 2368 |
| 31 | Ga0070660_100316319 | 3300005339 | Bacteria | 1282 |
| 32 | Ga0070660_100399081 | 3300005339 | Bacteria | 1137 |
| 33 | Ga0070661_100008922 | 3300005344 | Bacteria | 6939 |
| 34 | Ga0070661_100068128 | 3300005344 | Bacteria | 2616 |
| 35 | Ga0070661_100541446 | 3300005344 | Bacteria | 936 |
| 36 | Ga0070661_100682140 | 3300005344 | Bacteria | 836 |
| 37 | Ga0070668_100243128 | 3300005347 | Bacteria | 1492 |
| 38 | Ga0070668_100503123 | 3300005347 | Bacteria | 1049 |
| 39 | Ga0070671_101091040 | 3300005355 | Bacteria | 701 |
| 40 | Ga0070674_100045155 | 3300005356 | Bacteria | 3009 |
| 41 | Ga0070674_100200934 | 3300005356 | Bacteria | 1539 |
| 42 | Ga0070659_100016427 | 3300005366 | Bacteria | 5558 |
| 43 | Ga0070659_100065967 | 3300005366 | Bacteria | 2868 |
| 44 | Ga0070659_100436503 | 3300005366 | Bacteria | 1109 |
| 45 | Ga0070703_10052668 | 3300005406 | Bacteria | 1306 |
| 46 | Ga0070709_10038941 | 3300005434 | Bacteria | 2914 |
| 47 | Ga0070709_10054242 | 3300005434 | Bacteria | 2526 |
| 48 | Ga0070714_100027889 | 3300005435 | Bacteria | 4679 |
| 49 | Ga0070714_100237429 | 3300005435 | Bacteria | 1681 |
| 50 | Ga0070714_100457453 | 3300005435 | Bacteria | 1213 |
| 51 | Ga0070714_100512846 | 3300005435 | Bacteria | 1144 |
| 52 | Ga0070713_100029423 | 3300005436 | Bacteria | 4351 |
| 53 | Ga0070713_100114286 | 3300005436 | Bacteria | 2358 |
| 54 | Ga0070713_100594243 | 3300005436 | Bacteria | 1051 |
| 55 | Ga0070713_101108383 | 3300005436 | Unclassified | 765 |
| 56 | Ga0070710_10145350 | 3300005437 | Unclassified | 1458 |
| 57 | Ga0070710_10347753 | 3300005437 | Bacteria | 980 |
| 58 | Ga0070701_10543217 | 3300005438 | Unclassified | 761 |
| 59 | Ga0070711_100215557 | 3300005439 | Unclassified | 1489 |
| 60 | Ga0070705_100003771 | 3300005440 | Bacteria | 7418 |
| 61 | Ga0070705_100045000 | 3300005440 | Bacteria | 2537 |
| 62 | Ga0070705_100315915 | 3300005440 | Bacteria | 1125 |
| 63 | Ga0070705_101075256 | 3300005440 | Bacteria | 657 |
| 64 | Ga0070705_101342046 | 3300005440 | Bacteria | 594 |
| 65 | Ga0070694_100018073 | 3300005444 | Bacteria | 4468 |
| 66 | Ga0070694_100020899 | 3300005444 | Bacteria | 4177 |
| 67 | Ga0070694_100581936 | 3300005444 | Bacteria | 900 |
| 68 | Ga0070708_100299681 | 3300005445 | Bacteria | 1514 |
| 69 | Ga0070708_100757654 | 3300005445 | Unclassified | 913 |
| 70 | Ga0070663_100342264 | 3300005455 | Bacteria | 1209 |
| 71 | Ga0070663_100533094 | 3300005455 | Bacteria | 979 |
| 72 | Ga0070678_100050944 | 3300005456 | Bacteria | 2998 |
| 73 | Ga0070662_100024466 | 3300005457 | Bacteria | 4160 |
| 74 | Ga0070662_100034689 | 3300005457 | Bacteria | 3559 |
| 75 | Ga0070662_100166874 | 3300005457 | Bacteria | 1726 |
| 76 | Ga0070662_100659583 | 3300005457 | Bacteria | 883 |
| 77 | Ga0070681_10001211 | 3300005458 | Bacteria | 22450 |
| 78 | Ga0070681_10006154 | 3300005458 | Bacteria | 11657 |
| 79 | Ga0070681_10024508 | 3300005458 | Bacteria | 6073 |
| 80 | Ga0070681_10031476 | 3300005458 | Bacteria | 5326 |
| 81 | Ga0070681_10068450 | 3300005458 | Bacteria | 3516 |
| 82 | Ga0070681_10079201 | 3300005458 | Bacteria | 3242 |
| 83 | Ga0070681_10117839 | 3300005458 | Unclassified | 2592 |
| 84 | Ga0070681_10128247 | 3300005458 | Bacteria | 2469 |
| 85 | Ga0070681_10216002 | 3300005458 | Bacteria | 1833 |
| 86 | Ga0070681_10544970 | 3300005458 | Bacteria | 1074 |
| 87 | Ga0070681_10650528 | 3300005458 | Unclassified | 969 |
| 88 | Ga0070706_100009634 | 3300005467 | Bacteria | 8980 |
| 89 | Ga0070706_100036148 | 3300005467 | Bacteria | 4560 |
| 90 | Ga0070706_100191202 | 3300005467 | Bacteria | 1912 |
| 91 | Ga0070706_100428495 | 3300005467 | Bacteria | 1231 |
| 92 | Ga0070706_100788749 | 3300005467 | Bacteria | 880 |
| 93 | Ga0070707_100087885 | 3300005468 | Bacteria | 3006 |
| 94 | Ga0070707_100117452 | 3300005468 | Bacteria | 2582 |
| 95 | Ga0070707_100547674 | 3300005468 | Bacteria | 1119 |
| 96 | Ga0070707_101281840 | 3300005468 | Bacteria | 699 |
| 97 | Ga0070698_100006972 | 3300005471 | Bacteria | 12237 |
| 98 | Ga0070698_100134600 | 3300005471 | Bacteria | 2425 |
| 99 | Ga0070698_101538051 | 3300005471 | Bacteria | 617 |
| 100 | Ga0070699_100033968 | 3300005518 | Bacteria | 4408 |
| 101 | Ga0070699_100139917 | 3300005518 | Unclassified | 2137 |
| 102 | Ga0070699_100186211 | 3300005518 | Bacteria | 1843 |
| 103 | Ga0070699_100700419 | 3300005518 | Bacteria | 925 |
| 104 | Ga0070699_101957396 | 3300005518 | Bacteria | 536 |
| 105 | Ga0070679_100005979 | 3300005530 | Bacteria | 11312 |
| 106 | Ga0070679_100018501 | 3300005530 | Bacteria | 6762 |
| 107 | Ga0070679_100101945 | 3300005530 | Bacteria | 2857 |
| 108 | Ga0070679_100165307 | 3300005530 | Bacteria | 2186 |
| 109 | Ga0070679_100192070 | 3300005530 | Bacteria | 2010 |
| 110 | Ga0070679_100395151 | 3300005530 | Bacteria | 1329 |
| 111 | Ga0070684_100003711 | 3300005535 | Bacteria | 11519 |
| 112 | Ga0070684_100025315 | 3300005535 | Bacteria | 4987 |
| 113 | Ga0070684_100107435 | 3300005535 | Bacteria | 2499 |
| 114 | Ga0070684_100174590 | 3300005535 | Bacteria | 1952 |
| 115 | Ga0070684_100338222 | 3300005535 | Bacteria | 1384 |
| 116 | Ga0070684_100375674 | 3300005535 | Bacteria | 1309 |
| 117 | Ga0070684_100520197 | 3300005535 | Bacteria | 1103 |
| 118 | Ga0070697_100091492 | 3300005536 | Bacteria | 2516 |
| 119 | Ga0070697_100315929 | 3300005536 | Bacteria | 1344 |
| 120 | Ga0068853_100256877 | 3300005539 | Archaea | 1605 |
| 121 | Ga0068853_100337001 | 3300005539 | Bacteria | 1401 |
| 122 | Ga0068853_100434617 | 3300005539 | Bacteria | 1233 |
| 123 | Ga0068853_100652120 | 3300005539 | Bacteria | 1002 |
| 124 | Ga0068853_100756774 | 3300005539 | Bacteria | 929 |
| 125 | Ga0068853_100915149 | 3300005539 | Bacteria | 843 |
| 126 | Ga0070686_101202754 | 3300005544 | Bacteria | 630 |
| 127 | Ga0070695_100014734 | 3300005545 | Bacteria | 4716 |
| 128 | Ga0070695_100282335 | 3300005545 | Bacteria | 1220 |
| 129 | Ga0070695_101000961 | 3300005545 | Unclassified | 680 |
| 130 | Ga0070696_100011162 | 3300005546 | Bacteria | 6011 |
| 131 | Ga0070696_100060489 | 3300005546 | Bacteria | 2648 |
| 132 | Ga0070696_100981743 | 3300005546 | Bacteria | 705 |
| 133 | Ga0070693_101366710 | 3300005547 | Bacteria | 549 |
| 134 | Ga0070665_100000142 | 3300005548 | Bacteria | 133773 |
| 135 | Ga0070665_100072181 | 3300005548 | Bacteria | 3460 |
| 136 | Ga0070704_100008285 | 3300005549 | Bacteria | 6223 |
| 137 | Ga0070704_100247383 | 3300005549 | Bacteria | 1462 |
| 138 | Ga0070704_100249105 | 3300005549 | Bacteria | 1458 |
| 139 | Ga0070704_100389047 | 3300005549 | Bacteria | 1187 |
| 140 | Ga0070704_100441332 | 3300005549 | Bacteria | 1119 |
| 141 | Ga0068855_100036020 | 3300005563 | Bacteria | 5891 |
| 142 | Ga0068855_100095467 | 3300005563 | Bacteria | 3427 |
| 143 | Ga0068855_100130908 | 3300005563 | Bacteria | 2865 |
| 144 | Ga0068855_100144957 | 3300005563 | Bacteria | 2704 |
| 145 | Ga0068855_100196745 | 3300005563 | Bacteria | 2271 |
| 146 | Ga0070664_100109893 | 3300005564 | Bacteria | 2405 |
| 147 | Ga0068857_100036003 | 3300005577 | Bacteria | 4385 |
| 148 | Ga0068857_100071265 | 3300005577 | Bacteria | 3096 |
| 149 | Ga0068857_100186832 | 3300005577 | Bacteria | 1887 |
| 150 | Ga0068857_100415318 | 3300005577 | Bacteria | 1254 |
| 151 | Ga0068857_100444783 | 3300005577 | Bacteria | 1211 |
| 152 | Ga0068854_100191026 | 3300005578 | Bacteria | 1605 |
| 153 | Ga0068854_100863282 | 3300005578 | Unclassified | 793 |
| 154 | Ga0068856_100041648 | 3300005614 | Bacteria | 4515 |
| 155 | Ga0068856_100058145 | 3300005614 | Bacteria | 3818 |
| 156 | Ga0068856_100117044 | 3300005614 | Bacteria | 2666 |
| 157 | Ga0068856_101719086 | 3300005614 | Bacteria | 640 |
| 158 | Ga0070702_100015906 | 3300005615 | Bacteria | 3851 |
| 159 | Ga0070702_100950741 | 3300005615 | Unclassified | 676 |
| 160 | Ga0068852_100109972 | 3300005616 | Bacteria | 2503 |
| 161 | Ga0068852_101746418 | 3300005616 | Bacteria | 645 |
| 162 | Ga0068852_102010131 | 3300005616 | Bacteria | 600 |
| 163 | Ga0068864_101489597 | 3300005618 | Bacteria | 680 |
| 164 | Ga0068866_10511614 | 3300005718 | Bacteria | 796 |
| 165 | Ga0068861_100174548 | 3300005719 | Bacteria | 1784 |
| 166 | Ga0068861_100181348 | 3300005719 | Bacteria | 1753 |
| 167 | Ga0068861_100185501 | 3300005719 | Bacteria | 1735 |
| 168 | Ga0068861_100577336 | 3300005719 | Bacteria | 1028 |
| 169 | Ga0068851_10741341 | 3300005834 | Bacteria | 607 |
| 170 | Ga0068870_10212321 | 3300005840 | Unclassified | 1180 |
| 171 | Ga0068858_100728118 | 3300005842 | Bacteria | 966 |
| 172 | Ga0068858_100744286 | 3300005842 | Bacteria | 955 |
| 173 | Ga0068860_100656249 | 3300005843 | Bacteria | 1057 |
| 174 | Ga0068862_100131447 | 3300005844 | Bacteria | 2214 |
| 175 | Ga0081455_10017728 | 3300005937 | Bacteria | 6813 |
| 176 | Ga0081455_10077687 | 3300005937 | Bacteria | 2730 |
| 177 | Ga0081455_10635467 | 3300005937 | Bacteria | 690 |
| 178 | Ga0081538_10016843 | 3300005981 | Bacteria | 5579 |
| 179 | Ga0081538_10047916 | 3300005981 | Bacteria | 2614 |
| 180 | Ga0081538_10112208 | 3300005981 | Bacteria | 1335 |
| 181 | Ga0081538_10148313 | 3300005981 | Bacteria | 1067 |
| 182 | Ga0081538_10195083 | 3300005981 | Bacteria | 842 |
| 183 | Ga0081540_1004007 | 3300005983 | Bacteria | 11415 |
| 184 | Ga0081539_10020311 | 3300005985 | Bacteria | 4497 |
| 185 | Ga0081539_10030307 | 3300005985 | Bacteria | 3360 |
| 186 | Ga0070717_10167785 | 3300006028 | Bacteria | 1908 |
| 187 | Ga0070717_10229347 | 3300006028 | Bacteria | 1634 |
| 188 | Ga0075365_10058287 | 3300006038 | Bacteria | 2571 |
| 189 | Ga0075432_10059872 | 3300006058 | Bacteria | 1354 |
| 190 | Ga0075432_10073276 | 3300006058 | Unclassified | 1233 |
| 191 | Ga0075432_10176282 | 3300006058 | Bacteria | 834 |
| 192 | Ga0070715_10061469 | 3300006163 | Unclassified | 1649 |
| 193 | Ga0070716_100006808 | 3300006173 | Bacteria | 5602 |
| 194 | Ga0070712_100025054 | 3300006175 | Bacteria | 3960 |
| 195 | Ga0070712_100048361 | 3300006175 | Bacteria | 2948 |
| 196 | Ga0070712_100085325 | 3300006175 | Bacteria | 2298 |
| 197 | Ga0070712_100115895 | 3300006175 | Bacteria | 2008 |
| 198 | Ga0070712_100309241 | 3300006175 | Bacteria | 1282 |
| 199 | Ga0070712_100546091 | 3300006175 | Bacteria | 976 |
| 200 | Ga0097621_100698197 | 3300006237 | Unclassified | 934 |
| 201 | Ga0068871_101333120 | 3300006358 | Unclassified | 675 |
| 202 | Ga0075428_100459735 | 3300006844 | Bacteria | 1363 |
| 203 | Ga0075428_102454767 | 3300006844 | Bacteria | 534 |
| 204 | Ga0075430_100002108 | 3300006846 | Bacteria | 16435 |
| 205 | Ga0075430_100810498 | 3300006846 | Bacteria | 771 |
| 206 | Ga0075431_100054564 | 3300006847 | Bacteria | 4121 |
| 207 | Ga0075431_100197507 | 3300006847 | Bacteria | 2059 |
| 208 | Ga0075431_101051129 | 3300006847 | Bacteria | 780 |
| 209 | Ga0075433_10033888 | 3300006852 | Bacteria | 4381 |
| 210 | Ga0075433_10078996 | 3300006852 | Bacteria | 2899 |
| 211 | Ga0075433_10519534 | 3300006852 | Unclassified | 1047 |
| 212 | Ga0075433_10803364 | 3300006852 | Unclassified | 822 |
| 213 | Ga0075434_100005176 | 3300006871 | Bacteria | 11840 |
| 214 | Ga0075434_100082259 | 3300006871 | Bacteria | 3217 |
| 215 | Ga0075434_100271564 | 3300006871 | Bacteria | 1715 |
| 216 | Ga0075434_100427497 | 3300006871 | Bacteria | 1346 |
| 217 | Ga0075429_101096219 | 3300006880 | Unclassified | 695 |
| 218 | Ga0075429_101905878 | 3300006880 | Bacteria | 515 |
| 219 | Ga0068865_100168492 | 3300006881 | Bacteria | 1677 |
| 220 | Ga0075436_100000947 | 3300006914 | Bacteria | 19413 |
| 221 | Ga0075435_100002357 | 3300007076 | Bacteria | 12519 |
| 222 | Ga0075435_100021556 | 3300007076 | Bacteria | 4958 |
| 223 | Ga0075435_100030973 | 3300007076 | Bacteria | 4211 |
| 224 | Ga0075435_100444515 | 3300007076 | Unclassified | 1118 |
| 225 | Ga0105240_10286551 | 3300009093 | Bacteria | 1890 |
| 226 | Ga0105240_10324900 | 3300009093 | Bacteria | 1752 |
| 227 | Ga0105240_10393176 | 3300009093 | Bacteria | 1563 |
| 228 | Ga0105240_11360004 | 3300009093 | Bacteria | 747 |
| 229 | Ga0111539_10007332 | 3300009094 | Bacteria | 14124 |
| 230 | Ga0111539_10010679 | 3300009094 | Bacteria | 11564 |
| 231 | Ga0111539_10159167 | 3300009094 | Bacteria | 2641 |
| 232 | Ga0105245_10012746 | 3300009098 | Bacteria | 7321 |
| 233 | Ga0105245_10122058 | 3300009098 | Bacteria | 2435 |
| 234 | Ga0105245_10236379 | 3300009098 | Archaea | 1769 |
| 235 | Ga0105245_10262077 | 3300009098 | Unclassified | 1683 |
| 236 | Ga0105245_10585833 | 3300009098 | Bacteria | 1140 |
| 237 | Ga0105245_10660783 | 3300009098 | Unclassified | 1076 |
| 238 | Ga0114129_10017065 | 3300009147 | Bacteria | 10335 |
| 239 | Ga0114129_10039336 | 3300009147 | Bacteria | 6666 |
| 240 | Ga0114129_10041692 | 3300009147 | Bacteria | 6465 |
| 241 | Ga0114129_10189661 | 3300009147 | Bacteria | 2792 |
| 242 | Ga0114129_10194674 | 3300009147 | Bacteria | 2750 |
| 243 | Ga0114129_10269908 | 3300009147 | Bacteria | 2276 |
| 244 | Ga0114129_10411492 | 3300009147 | Bacteria | 1781 |
| 245 | Ga0114129_10568928 | 3300009147 | Bacteria | 1472 |
| 246 | Ga0114129_10687902 | 3300009147 | Unclassified | 1316 |
| 247 | Ga0114129_11293096 | 3300009147 | Bacteria | 904 |
| 248 | Ga0114129_12106237 | 3300009147 | Unclassified | 680 |
| 249 | Ga0105243_10075875 | 3300009148 | Bacteria | 2730 |
| 250 | Ga0105243_10157419 | 3300009148 | Bacteria | 1955 |
| 251 | Ga0105243_10214655 | 3300009148 | Bacteria | 1696 |
| 252 | Ga0105243_10625258 | 3300009148 | Bacteria | 1040 |
| 253 | Ga0105241_10458424 | 3300009174 | Bacteria | 1129 |
| 254 | Ga0105242_10405602 | 3300009176 | Bacteria | 1273 |
| 255 | Ga0105248_10024828 | 3300009177 | Bacteria | 6664 |
| 256 | Ga0105237_10052617 | 3300009545 | Bacteria | 4087 |
| 257 | Ga0105237_10126052 | 3300009545 | Bacteria | 2555 |
| 258 | Ga0105237_10331478 | 3300009545 | Bacteria | 1526 |
| 259 | Ga0105237_10812354 | 3300009545 | Bacteria | 942 |
| 260 | Ga0105238_10167719 | 3300009551 | Bacteria | 2172 |
| 261 | Ga0105238_11004558 | 3300009551 | Unclassified | 855 |
| 262 | Ga0105238_11198556 | 3300009551 | Unclassified | 784 |
| 263 | Ga0105249_10010851 | 3300009553 | Bacteria | 8006 |
| 264 | Ga0105249_10071305 | 3300009553 | Bacteria | 3209 |
| 265 | Ga0105249_10153800 | 3300009553 | Bacteria | 2217 |
| 266 | Ga0105249_10564101 | 3300009553 | Bacteria | 1190 |
| 267 | Ga0105249_10938293 | 3300009553 | Bacteria | 933 |
| 268 | Ga0105239_10038088 | 3300010375 | Bacteria | 5268 |
| 269 | Ga0105239_10195213 | 3300010375 | Bacteria | 2267 |
| 270 | Ga0105239_10279255 | 3300010375 | Bacteria | 1880 |
| 271 | Ga0105239_10428923 | 3300010375 | Bacteria | 1498 |
| 272 | Ga0105239_10954450 | 3300010375 | Bacteria | 985 |
| 273 | Ga0105239_11643418 | 3300010375 | Bacteria | 743 |
| 274 | Ga0105239_11834665 | 3300010375 | Bacteria | 703 |
| 275 | Ga0105239_13085444 | 3300010375 | Bacteria | 543 |
| 276 | Ga0105246_10012450 | 3300011119 | Bacteria | 5311 |
| 277 | Ga0105246_11186414 | 3300011119 | Bacteria | 702 |
| 278 | Ga0154010_174948 | 3300013062 | Bacteria | 854 |
| 279 | Ga0157373_10085393 | 3300013100 | Bacteria | 2225 |
| 280 | Ga0157373_10433225 | 3300013100 | Bacteria | 945 |
| 281 | Ga0157371_10230787 | 3300013102 | Bacteria | 1330 |
| 282 | Ga0157371_10421269 | 3300013102 | Bacteria | 979 |
| 283 | Ga0157370_10023626 | 3300013104 | Bacteria | 6101 |
| 284 | Ga0157370_10132064 | 3300013104 | Bacteria | 2329 |
| 285 | Ga0157370_10141219 | 3300013104 | Bacteria | 2244 |
| 286 | Ga0157370_10180672 | 3300013104 | Bacteria | 1961 |
| 287 | Ga0157370_10797802 | 3300013104 | Bacteria | 859 |
| 288 | Ga0157369_10019033 | 3300013105 | Bacteria | 7688 |
| 289 | Ga0157369_10071417 | 3300013105 | Bacteria | 3727 |
| 290 | Ga0157369_10179200 | 3300013105 | Bacteria | 2230 |
| 291 | Ga0157369_10216570 | 3300013105 | Bacteria | 2006 |
| 292 | Ga0157369_11064392 | 3300013105 | Bacteria | 827 |
| 293 | Ga0157374_10196026 | 3300013296 | Bacteria | 1977 |
| 294 | Ga0157374_10961010 | 3300013296 | Bacteria | 873 |
| 295 | Ga0157378_11250738 | 3300013297 | Bacteria | 783 |
| 296 | Ga0163162_10155009 | 3300013306 | Bacteria | 2410 |
| 297 | Ga0163162_10207142 | 3300013306 | Bacteria | 2090 |
| 298 | Ga0157372_10034055 | 3300013307 | Bacteria | 5597 |
| 299 | Ga0157372_10072877 | 3300013307 | Bacteria | 3870 |
| 300 | Ga0157372_10140424 | 3300013307 | Bacteria | 2782 |
| 301 | Ga0157372_10344712 | 3300013307 | Bacteria | 1735 |
| 302 | Ga0157372_10383457 | 3300013307 | Bacteria | 1637 |
| 303 | Ga0157372_10386050 | 3300013307 | Bacteria | 1632 |
| 304 | Ga0157372_10396235 | 3300013307 | Bacteria | 1609 |
| 305 | Ga0157372_10962358 | 3300013307 | Bacteria | 989 |
| 306 | Ga0157375_10213871 | 3300013308 | Bacteria | 2085 |
| 307 | Ga0157375_10353724 | 3300013308 | Bacteria | 1635 |
| 308 | Ga0157375_10385089 | 3300013308 | Bacteria | 1569 |
| 309 | Ga0157375_10440914 | 3300013308 | Bacteria | 1468 |
| 310 | Ga0157375_13353484 | 3300013308 | Bacteria | 534 |
| 311 | Ga0163163_10363098 | 3300014325 | Unclassified | 1505 |
| 312 | Ga0157380_10625154 | 3300014326 | Bacteria | 1070 |
| 313 | Ga0182008_10000487 | 3300014497 | Bacteria | 29903 |
| 314 | Ga0182008_10285942 | 3300014497 | Unclassified | 859 |
| 315 | Ga0157377_10620612 | 3300014745 | Bacteria | 774 |
| 316 | Ga0182007_10010452 | 3300015262 | Bacteria | 3663 |
| 317 | Ga0182007_10131856 | 3300015262 | Bacteria | 841 |
| 318 | Ga0163161_10090047 | 3300017792 | Bacteria | 2270 |
| 319 | Ga0163161_10287801 | 3300017792 | Bacteria | 1291 |
| 320 | Ga0206356_11060558 | 3300020070 | Bacteria | 971 |
| 321 | Ga0206356_11537578 | 3300020070 | Bacteria | 2051 |
| 322 | Ga0206354_10308263 | 3300020081 | Bacteria | 4394 |
| 323 | Ga0206354_10578468 | 3300020081 | Bacteria | 1263 |
| 324 | Ga0206354_11268256 | 3300020081 | Bacteria | 2488 |
| 325 | Ga0206354_11547566 | 3300020081 | Bacteria | 1557 |
| 326 | Ga0206353_10116331 | 3300020082 | Bacteria | 1517 |
| 327 | Ga0206353_10302908 | 3300020082 | Bacteria | 1609 |
| 328 | Ga0206353_10850770 | 3300020082 | Bacteria | 868 |
| 329 | Ga0206353_10926494 | 3300020082 | Bacteria | 1412 |
| 330 | Ga0206353_10938317 | 3300020082 | Bacteria | 2345 |
| 331 | Ga0206353_11810256 | 3300020082 | Bacteria | 3863 |
| 332 | Ga0207653_10005347 | 3300025885 | Bacteria | 4013 |
| 333 | Ga0207692_10177496 | 3300025898 | Unclassified | 1239 |
| 334 | Ga0207642_10060751 | 3300025899 | Bacteria | 1754 |
| 335 | Ga0207685_10099454 | 3300025905 | Bacteria | 1241 |
| 336 | Ga0207699_10029805 | 3300025906 | Bacteria | 3046 |
| 337 | Ga0207699_10060017 | 3300025906 | Bacteria | 2281 |
| 338 | Ga0207699_10194100 | 3300025906 | Bacteria | 1372 |
| 339 | Ga0207699_10623354 | 3300025906 | Bacteria | 786 |
| 340 | Ga0207643_10074177 | 3300025908 | Bacteria | 1962 |
| 341 | Ga0207705_10090402 | 3300025909 | Bacteria | 2241 |
| 342 | Ga0207705_10113187 | 3300025909 | Bacteria | 2007 |
| 343 | Ga0207705_10817174 | 3300025909 | Bacteria | 723 |
| 344 | Ga0207684_10000595 | 3300025910 | Bacteria | 43323 |
| 345 | Ga0207684_10071641 | 3300025910 | Bacteria | 2944 |
| 346 | Ga0207684_10138858 | 3300025910 | Bacteria | 2088 |
| 347 | Ga0207684_10238457 | 3300025910 | Bacteria | 1569 |
| 348 | Ga0207684_10249809 | 3300025910 | Bacteria | 1530 |
| 349 | Ga0207684_10554929 | 3300025910 | Unclassified | 983 |
| 350 | Ga0207654_10127579 | 3300025911 | Bacteria | 1606 |
| 351 | Ga0207707_10007562 | 3300025912 | Bacteria | 9465 |
| 352 | Ga0207707_10031713 | 3300025912 | Bacteria | 4625 |
| 353 | Ga0207707_10052819 | 3300025912 | Bacteria | 3537 |
| 354 | Ga0207707_10055911 | 3300025912 | Bacteria | 3433 |
| 355 | Ga0207707_10070608 | 3300025912 | Bacteria | 3043 |
| 356 | Ga0207707_10070905 | 3300025912 | Bacteria | 3036 |
| 357 | Ga0207707_10144845 | 3300025912 | Unclassified | 2077 |
| 358 | Ga0207707_10235412 | 3300025912 | Bacteria | 1593 |
| 359 | Ga0207695_10040640 | 3300025913 | Bacteria | 4983 |
| 360 | Ga0207695_10171531 | 3300025913 | Bacteria | 2095 |
| 361 | Ga0207695_10478732 | 3300025913 | Bacteria | 1127 |
| 362 | Ga0207671_10076666 | 3300025914 | Bacteria | 2502 |
| 363 | Ga0207671_10094543 | 3300025914 | Bacteria | 2256 |
| 364 | Ga0207671_10624215 | 3300025914 | Bacteria | 859 |
| 365 | Ga0207693_10001581 | 3300025915 | Bacteria | 20145 |
| 366 | Ga0207693_10004236 | 3300025915 | Bacteria | 12165 |
| 367 | Ga0207693_10021377 | 3300025915 | Bacteria | 5142 |
| 368 | Ga0207693_10035810 | 3300025915 | Bacteria | 3912 |
| 369 | Ga0207693_10530506 | 3300025915 | Bacteria | 918 |
| 370 | Ga0207663_10002524 | 3300025916 | Bacteria | 8806 |
| 371 | Ga0207663_10524872 | 3300025916 | Unclassified | 923 |
| 372 | Ga0207663_10814915 | 3300025916 | Bacteria | 744 |
| 373 | Ga0207660_10017445 | 3300025917 | Bacteria | 4770 |
| 374 | Ga0207660_10017816 | 3300025917 | Bacteria | 4726 |
| 375 | Ga0207660_10027344 | 3300025917 | Bacteria | 3891 |
| 376 | Ga0207660_10087307 | 3300025917 | Bacteria | 2304 |
| 377 | Ga0207660_10128402 | 3300025917 | Bacteria | 1927 |
| 378 | Ga0207660_10272021 | 3300025917 | Bacteria | 1342 |
| 379 | Ga0207660_10310095 | 3300025917 | Bacteria | 1258 |
| 380 | Ga0207660_10387616 | 3300025917 | Bacteria | 1124 |
| 381 | Ga0207660_10524030 | 3300025917 | Bacteria | 963 |
| 382 | Ga0207662_10391450 | 3300025918 | Bacteria | 941 |
| 383 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 384 | Ga0207657_10003977 | 3300025919 | Bacteria | 15705 |
| 385 | Ga0207657_10005514 | 3300025919 | Bacteria | 13210 |
| 386 | Ga0207657_10011616 | 3300025919 | Bacteria | 8734 |
| 387 | Ga0207657_10011988 | 3300025919 | Bacteria | 8576 |
| 388 | Ga0207657_10037356 | 3300025919 | Bacteria | 4338 |
| 389 | Ga0207657_10156420 | 3300025919 | Bacteria | 1854 |
| 390 | Ga0207657_10588267 | 3300025919 | Bacteria | 869 |
| 391 | Ga0207649_10034276 | 3300025920 | Bacteria | 3040 |
| 392 | Ga0207649_10039292 | 3300025920 | Bacteria | 2868 |
| 393 | Ga0207649_10129540 | 3300025920 | Bacteria | 1712 |
| 394 | Ga0207649_10408685 | 3300025920 | Bacteria | 1017 |
| 395 | Ga0207649_10690636 | 3300025920 | Bacteria | 791 |
| 396 | Ga0207652_10004445 | 3300025921 | Bacteria | 11420 |
| 397 | Ga0207652_10038262 | 3300025921 | Bacteria | 4065 |
| 398 | Ga0207652_10040882 | 3300025921 | Bacteria | 3939 |
| 399 | Ga0207652_10063362 | 3300025921 | Bacteria | 3197 |
| 400 | Ga0207652_10111726 | 3300025921 | Bacteria | 2424 |
| 401 | Ga0207652_10123670 | 3300025921 | Bacteria | 2304 |
| 402 | Ga0207652_10135715 | 3300025921 | Bacteria | 2197 |
| 403 | Ga0207652_10252087 | 3300025921 | Bacteria | 1592 |
| 404 | Ga0207652_10876169 | 3300025921 | Bacteria | 794 |
| 405 | Ga0207646_10006870 | 3300025922 | Bacteria | 11686 |
| 406 | Ga0207646_10205607 | 3300025922 | Bacteria | 1778 |
| 407 | Ga0207646_10252758 | 3300025922 | Unclassified | 1592 |
| 408 | Ga0207646_10527296 | 3300025922 | Bacteria | 1063 |
| 409 | Ga0207681_10684717 | 3300025923 | Bacteria | 852 |
| 410 | Ga0207694_11323152 | 3300025924 | Bacteria | 609 |
| 411 | Ga0207687_10015768 | 3300025927 | Bacteria | 4959 |
| 412 | Ga0207687_10043101 | 3300025927 | Bacteria | 3108 |
| 413 | Ga0207687_10210682 | 3300025927 | Bacteria | 1524 |
| 414 | Ga0207687_10354102 | 3300025927 | Bacteria | 1197 |
| 415 | Ga0207687_10518585 | 3300025927 | Bacteria | 997 |
| 416 | Ga0207687_10923300 | 3300025927 | Bacteria | 747 |
| 417 | Ga0207700_10000006 | 3300025928 | Bacteria | 348187 |
| 418 | Ga0207700_10379106 | 3300025928 | Bacteria | 1236 |
| 419 | Ga0207700_10465286 | 3300025928 | Bacteria | 1116 |
| 420 | Ga0207664_10024170 | 3300025929 | Bacteria | 4564 |
| 421 | Ga0207664_10128676 | 3300025929 | Bacteria | 2129 |
| 422 | Ga0207664_10133843 | 3300025929 | Bacteria | 2089 |
| 423 | Ga0207664_10164041 | 3300025929 | Bacteria | 1897 |
| 424 | Ga0207664_10345051 | 3300025929 | Bacteria | 1317 |
| 425 | Ga0207664_10552500 | 3300025929 | Bacteria | 1033 |
| 426 | Ga0207664_10628038 | 3300025929 | Bacteria | 965 |
| 427 | Ga0207644_11697620 | 3300025931 | Bacteria | 529 |
| 428 | Ga0207690_10035494 | 3300025932 | Bacteria | 3221 |
| 429 | Ga0207690_10074440 | 3300025932 | Bacteria | 2352 |
| 430 | Ga0207690_10147847 | 3300025932 | Bacteria | 1739 |
| 431 | Ga0207690_10291788 | 3300025932 | Unclassified | 1273 |
| 432 | Ga0207690_10413442 | 3300025932 | Bacteria | 1078 |
| 433 | Ga0207690_11300703 | 3300025932 | Bacteria | 608 |
| 434 | Ga0207690_11386188 | 3300025932 | Bacteria | 588 |
| 435 | Ga0207706_10028155 | 3300025933 | Bacteria | 5020 |
| 436 | Ga0207706_10268610 | 3300025933 | Bacteria | 1489 |
| 437 | Ga0207706_10396740 | 3300025933 | Unclassified | 1196 |
| 438 | Ga0207686_10316494 | 3300025934 | Bacteria | 1164 |
| 439 | Ga0207709_10603517 | 3300025935 | Bacteria | 869 |
| 440 | Ga0207669_10019902 | 3300025937 | Bacteria | 3506 |
| 441 | Ga0207665_10010466 | 3300025939 | Bacteria | 6095 |
| 442 | Ga0207665_10034758 | 3300025939 | Bacteria | 3344 |
| 443 | Ga0207665_10079012 | 3300025939 | Bacteria | 2261 |
| 444 | Ga0207691_10141984 | 3300025940 | Bacteria | 2116 |
| 445 | Ga0207711_10153738 | 3300025941 | Bacteria | 2078 |
| 446 | Ga0207711_10483011 | 3300025941 | Unclassified | 1154 |
| 447 | Ga0207689_10650157 | 3300025942 | Unclassified | 888 |
| 448 | Ga0207689_11175867 | 3300025942 | Bacteria | 646 |
| 449 | Ga0207661_10058628 | 3300025944 | Bacteria | 3099 |
| 450 | Ga0207661_10283668 | 3300025944 | Bacteria | 1481 |
| 451 | Ga0207661_10326308 | 3300025944 | Bacteria | 1381 |
| 452 | Ga0207661_10399046 | 3300025944 | Bacteria | 1247 |
| 453 | Ga0207661_11138459 | 3300025944 | Bacteria | 718 |
| 454 | Ga0207661_11536714 | 3300025944 | Unclassified | 610 |
| 455 | Ga0207679_10046972 | 3300025945 | Bacteria | 3134 |
| 456 | Ga0207679_10891072 | 3300025945 | Bacteria | 814 |
| 457 | Ga0207667_10023514 | 3300025949 | Bacteria | 6785 |
| 458 | Ga0207667_10066221 | 3300025949 | Bacteria | 3766 |
| 459 | Ga0207667_10141333 | 3300025949 | Bacteria | 2478 |
| 460 | Ga0207667_10175364 | 3300025949 | Bacteria | 2203 |
| 461 | Ga0207667_10196978 | 3300025949 | Bacteria | 2067 |
| 462 | Ga0207667_10831886 | 3300025949 | Bacteria | 918 |
| 463 | Ga0207667_10857212 | 3300025949 | Bacteria | 902 |
| 464 | Ga0207712_10041383 | 3300025961 | Bacteria | 3166 |
| 465 | Ga0207712_10042305 | 3300025961 | Bacteria | 3136 |
| 466 | Ga0207712_10171094 | 3300025961 | Bacteria | 1698 |
| 467 | Ga0207712_10346154 | 3300025961 | Bacteria | 1234 |
| 468 | Ga0207712_10650795 | 3300025961 | Bacteria | 916 |
| 469 | Ga0207668_10200428 | 3300025972 | Bacteria | 1589 |
| 470 | Ga0207668_10356110 | 3300025972 | Bacteria | 1225 |
| 471 | Ga0207668_10695739 | 3300025972 | Bacteria | 893 |
| 472 | Ga0207640_10028669 | 3300025981 | Bacteria | 3407 |
| 473 | Ga0207640_10073364 | 3300025981 | Bacteria | 2312 |
| 474 | Ga0207640_10456106 | 3300025981 | Bacteria | 1055 |
| 475 | Ga0207640_10824017 | 3300025981 | Bacteria | 806 |
| 476 | Ga0207640_11094706 | 3300025981 | Bacteria | 705 |
| 477 | Ga0207677_10037372 | 3300026023 | Bacteria | 3173 |
| 478 | Ga0207677_10869014 | 3300026023 | Bacteria | 811 |
| 479 | Ga0207677_11521322 | 3300026023 | Bacteria | 618 |
| 480 | Ga0207677_11760576 | 3300026023 | Bacteria | 575 |
| 481 | Ga0207703_10607933 | 3300026035 | Bacteria | 1034 |
| 482 | Ga0207639_10240708 | 3300026041 | Bacteria | 1573 |
| 483 | Ga0207639_10385106 | 3300026041 | Bacteria | 1260 |
| 484 | Ga0207639_10495588 | 3300026041 | Bacteria | 1115 |
| 485 | Ga0207639_10564102 | 3300026041 | Bacteria | 1047 |
| 486 | Ga0207639_10602056 | 3300026041 | Bacteria | 1014 |
| 487 | Ga0207639_11560812 | 3300026041 | Bacteria | 619 |
| 488 | Ga0207678_10611761 | 3300026067 | Bacteria | 956 |
| 489 | Ga0207708_10218915 | 3300026075 | Bacteria | 1525 |
| 490 | Ga0207708_10266663 | 3300026075 | Bacteria | 1384 |
| 491 | Ga0207708_10618096 | 3300026075 | Bacteria | 919 |
| 492 | Ga0207708_11111129 | 3300026075 | Bacteria | 689 |
| 493 | Ga0207702_10037364 | 3300026078 | Bacteria | 4064 |
| 494 | Ga0207702_10061916 | 3300026078 | Bacteria | 3194 |
| 495 | Ga0207702_10516857 | 3300026078 | Bacteria | 1165 |
| 496 | Ga0207702_10583072 | 3300026078 | Bacteria | 1096 |
| 497 | Ga0207702_10932911 | 3300026078 | Bacteria | 860 |
| 498 | Ga0207641_10433505 | 3300026088 | Bacteria | 1268 |
| 499 | Ga0207648_10721958 | 3300026089 | Bacteria | 924 |
| 500 | Ga0207648_10752708 | 3300026089 | Bacteria | 905 |
| 501 | Ga0207676_10266344 | 3300026095 | Bacteria | 1550 |
| 502 | Ga0207674_10006223 | 3300026116 | Bacteria | 14068 |
| 503 | Ga0207674_10059284 | 3300026116 | Bacteria | 3874 |
| 504 | Ga0207674_10107454 | 3300026116 | Bacteria | 2767 |
| 505 | Ga0207674_10112588 | 3300026116 | Bacteria | 2695 |
| 506 | Ga0207674_10292048 | 3300026116 | Bacteria | 1579 |
| 507 | Ga0207674_10508544 | 3300026116 | Bacteria | 1164 |
| 508 | Ga0207675_100030764 | 3300026118 | Bacteria | 4999 |
| 509 | Ga0207675_100061187 | 3300026118 | Bacteria | 3515 |
| 510 | Ga0207675_100096696 | 3300026118 | Bacteria | 2780 |
| 511 | Ga0207675_100520179 | 3300026118 | Bacteria | 1186 |
| 512 | Ga0207683_10011124 | 3300026121 | Bacteria | 7669 |
| 513 | Ga0207683_10815666 | 3300026121 | Bacteria | 866 |
| 514 | Ga0207683_11780766 | 3300026121 | Bacteria | 565 |
| 515 | Ga0209998_10009501 | 3300027717 | Bacteria | 2019 |
| 516 | Ga0207428_10000551 | 3300027907 | Bacteria | 44433 |
| 517 | Ga0207428_10009220 | 3300027907 | Bacteria | 8864 |
| 518 | Ga0207428_10038045 | 3300027907 | Bacteria | 3914 |
| 519 | Ga0268266_10000081 | 3300028379 | Bacteria | 207431 |
| 520 | Ga0268266_10236597 | 3300028379 | Bacteria | 1684 |
| 521 | Ga0268265_10278422 | 3300028380 | Bacteria | 1496 |
| 522 | Ga0268264_10353395 | 3300028381 | Bacteria | 1400 |
| 523 | Ga0268264_10463017 | 3300028381 | Bacteria | 1230 |
| 524 | Ga0265326_10084701 | 3300028558 | Bacteria | 897 |
| 525 | Ga0265319_1152429 | 3300028563 | Bacteria | 715 |
| 526 | Ga0265318_10018736 | 3300028577 | Bacteria | 2819 |
| 527 | Ga0265318_10038357 | 3300028577 | Bacteria | 1832 |
| 528 | Ga0265318_10159727 | 3300028577 | Bacteria | 826 |
| 529 | Ga0265323_10084124 | 3300028653 | Bacteria | 1072 |
| 530 | Ga0265322_10011308 | 3300028654 | Bacteria | 2589 |
| 531 | Ga0265338_10013856 | 3300028800 | Bacteria | 9057 |
| 532 | Ga0265338_10045873 | 3300028800 | Bacteria | 4013 |
| 533 | Ga0265338_10060846 | 3300028800 | Bacteria | 3313 |
| 534 | Ga0265330_10074404 | 3300031235 | Bacteria | 1468 |
| 535 | Ga0265332_10049793 | 3300031238 | Bacteria | 1801 |
| 536 | Ga0265325_10042525 | 3300031241 | Bacteria | 2375 |
| 537 | Ga0265329_10073297 | 3300031242 | Bacteria | 1083 |
| 538 | Ga0265340_10030522 | 3300031247 | Bacteria | 2701 |
| 539 | Ga0265340_10175885 | 3300031247 | Bacteria | 969 |
| 540 | Ga0265339_10007462 | 3300031249 | Bacteria | 7067 |
| 541 | Ga0265339_10090713 | 3300031249 | Bacteria | 1602 |
| 542 | Ga0265331_10068331 | 3300031250 | Bacteria | 1666 |
| 543 | Ga0265331_10170982 | 3300031250 | Unclassified | 983 |
| 544 | Ga0265327_10003047 | 3300031251 | Bacteria | 16584 |
| 545 | Ga0265327_10076032 | 3300031251 | Bacteria | 1669 |
| 546 | Ga0265316_10002206 | 3300031344 | Bacteria | 20468 |
| 547 | Ga0265316_10066278 | 3300031344 | Bacteria | 2795 |
| 548 | Ga0265316_10643000 | 3300031344 | Bacteria | 750 |
| 549 | Ga0265316_10879438 | 3300031344 | Bacteria | 626 |
| 550 | Ga0307408_100010016 | 3300031548 | Bacteria | 6246 |
| 551 | Ga0307408_100183990 | 3300031548 | Bacteria | 1678 |
| 552 | Ga0307408_100243604 | 3300031548 | Unclassified | 1479 |
| 553 | Ga0265313_10061225 | 3300031595 | Bacteria | 1762 |
| 554 | Ga0265314_10003413 | 3300031711 | Bacteria | 15378 |
| 555 | Ga0265314_10032486 | 3300031711 | Bacteria | 3839 |
| 556 | Ga0265314_10086123 | 3300031711 | Bacteria | 2058 |
| 557 | Ga0265342_10069720 | 3300031712 | Bacteria | 2052 |
| 558 | Ga0307405_10005839 | 3300031731 | Bacteria | 5992 |
| 559 | Ga0307405_10012720 | 3300031731 | Bacteria | 4468 |
| 560 | Ga0307405_11198283 | 3300031731 | Bacteria | 657 |
| 561 | Ga0307413_10002950 | 3300031824 | Bacteria | 7039 |
| 562 | Ga0307413_10077315 | 3300031824 | Bacteria | 2119 |
| 563 | Ga0307413_11540270 | 3300031824 | Bacteria | 589 |
| 564 | Ga0307410_10002995 | 3300031852 | Bacteria | 8333 |
| 565 | Ga0307410_10062021 | 3300031852 | Bacteria | 2560 |
| 566 | Ga0307410_11443735 | 3300031852 | Bacteria | 605 |
| 567 | Ga0307406_10002763 | 3300031901 | Bacteria | 9576 |
| 568 | Ga0307406_10116774 | 3300031901 | Bacteria | 1847 |
| 569 | Ga0307406_10189494 | 3300031901 | Bacteria | 1504 |
| 570 | Ga0307406_10853611 | 3300031901 | Bacteria | 772 |
| 571 | Ga0307407_10004116 | 3300031903 | Bacteria | 6121 |
| 572 | Ga0307407_10097586 | 3300031903 | Bacteria | 1817 |
| 573 | Ga0307407_10916440 | 3300031903 | Unclassified | 673 |
| 574 | Ga0307412_11177375 | 3300031911 | Bacteria | 685 |
| 575 | Ga0307409_100009005 | 3300031995 | Bacteria | 6104 |
| 576 | Ga0307409_100011218 | 3300031995 | Bacteria | 5633 |
| 577 | Ga0307409_100294676 | 3300031995 | Bacteria | 1506 |
| 578 | Ga0307409_100394792 | 3300031995 | Bacteria | 1319 |
| 579 | Ga0307409_100472312 | 3300031995 | Bacteria | 1215 |
| 580 | Ga0307409_100703459 | 3300031995 | Bacteria | 1010 |
| 581 | Ga0307409_101369944 | 3300031995 | Bacteria | 733 |
| 582 | Ga0307416_100001425 | 3300032002 | Bacteria | 12993 |
| 583 | Ga0307416_100021273 | 3300032002 | Bacteria | 4652 |
| 584 | Ga0307416_100043845 | 3300032002 | Bacteria | 3507 |
| 585 | Ga0307414_10171377 | 3300032004 | Bacteria | 1735 |
| 586 | Ga0307414_10489136 | 3300032004 | Bacteria | 1087 |
| 587 | Ga0307414_10964300 | 3300032004 | Bacteria | 784 |
| 588 | Ga0307411_10003163 | 3300032005 | Bacteria | 7563 |
| 589 | Ga0307411_10791480 | 3300032005 | Bacteria | 834 |
| 590 | Ga0307415_100000286 | 3300032126 | Bacteria | 21920 |
| 591 | Ga0307415_100004173 | 3300032126 | Bacteria | 7457 |
| 592 | Ga0307415_100347416 | 3300032126 | Bacteria | 1247 |
| 593 | Ga0373930_0018229 | 3300034816 | Bacteria | 1347 |
| 594 | Ga0373948_0007410 | 3300034817 | Bacteria | 1844 |
| 595 | Ga0373948_0077709 | 3300034817 | Bacteria | 753 |
| 596 | Ga0373950_0002783 | 3300034818 | Bacteria | 2445 |
| 597 | Ga0373958_0002498 | 3300034819 | Bacteria | 2588 |
| 598 | Ga0373938_0003711 | 3300034957 | Bacteria | 2516 |
| 599 | Ga0373928_0014717 | 3300035084 | Bacteria | 1585 |
| 600 | Ga0373928_0179446 | 3300035084 | Bacteria | 601 |
| 601 | Ga0373929_0019235 | 3300035085 | Bacteria | 1365 |
| 602 | Ga0373949_0002911 | 3300035090 | Bacteria | 4220 |
| 603 | Ga0373951_0012208 | 3300035091 | Bacteria | 1931 |
| 604 | Ga0373952_0004699 | 3300035092 | Bacteria | 2482 |
| 605 | Ga0373932_0002305 | 3300035112 | Bacteria | 4852 |
| 606 | Ga0373939_0000998 | 3300035114 | Bacteria | 7006 |
| 607 | Ga0373939_0032710 | 3300035114 | Bacteria | 1514 |
| 608 | Ga0373939_0033574 | 3300035114 | Bacteria | 1500 |
| 609 | Ga0373941_0011207 | 3300035115 | Bacteria | 2311 |
| 610 | Ga0373941_0059477 | 3300035115 | Bacteria | 1239 |
| 611 | Ga0373960_0000459 | 3300035121 | Bacteria | 8026 |
| 612 | Ga0373943_0031688 | 3300035170 | Bacteria | 2510 |
| 613 | Ga0373942_0004263 | 3300035207 | Bacteria | 3329 |
| 614 | Ga0373961_0007365 | 3300035241 | Bacteria | 2660 |
| 615 | Ga0373961_0153153 | 3300035241 | Bacteria | 787 |
| 616 | Ga0373962_0011891 | 3300035242 | Bacteria | 2187 |
| 617 | Ga0316574_0164656 | 3300035398 | Bacteria | 1428 |
| 618 | Ga0373931_0005838 | 3300035691 | Bacteria | 5727 |
| 619 | Ga0373931_0062040 | 3300035691 | Bacteria | 2017 |
| 620 | Ga0373931_0140921 | 3300035691 | Bacteria | 1396 |
| 621 | Ga0373931_0865138 | 3300035691 | Bacteria | 606 |
| 622 | Ga0373935_0083041 | 3300035692 | Bacteria | 2085 |
| 623 | Ga0373937_0087073 | 3300036401 | Bacteria | 2891 |
| 624 | Ga0395899_0001614 | 3300037312 | Bacteria | 18846 |
| 625 | Ga0395899_0003283 | 3300037312 | Bacteria | 12824 |
| 626 | Ga0395899_0014311 | 3300037312 | Bacteria | 6056 |
| 627 | Ga0395899_0016263 | 3300037312 | Bacteria | 5671 |
| 628 | Ga0395899_0025572 | 3300037312 | Bacteria | 4455 |
| 629 | Ga0395899_0027903 | 3300037312 | Bacteria | 4252 |
| 630 | Ga0395899_0039999 | 3300037312 | Bacteria | 3508 |
| 631 | Ga0395899_0106454 | 3300037312 | Bacteria | 2019 |
| 632 | Ga0395899_0109783 | 3300037312 | Bacteria | 1984 |
| 633 | Ga0395899_0119318 | 3300037312 | Bacteria | 1891 |
| 634 | Ga0395899_0234401 | 3300037312 | Unclassified | 1266 |
| 635 | Ga0395900_0004680 | 3300037418 | Bacteria | 14424 |
| 636 | Ga0395900_0005323 | 3300037418 | Bacteria | 13489 |
| 637 | Ga0395900_0010115 | 3300037418 | Bacteria | 9647 |
| 638 | Ga0395900_0016923 | 3300037418 | Bacteria | 7442 |
| 639 | Ga0395900_0018889 | 3300037418 | Bacteria | 7031 |
| 640 | Ga0395900_0044318 | 3300037418 | Bacteria | 4584 |
| 641 | Ga0395900_0049100 | 3300037418 | Bacteria | 4347 |
| 642 | Ga0395900_0066125 | 3300037418 | Bacteria | 3715 |
| 643 | Ga0395900_0073000 | 3300037418 | Bacteria | 3527 |
| 644 | Ga0395900_0081470 | 3300037418 | Bacteria | 3325 |
| 645 | Ga0395900_0085975 | 3300037418 | Bacteria | 3232 |
| 646 | Ga0395900_0126305 | 3300037418 | Bacteria | 2623 |
| 647 | Ga0395900_0131713 | 3300037418 | Bacteria | 2562 |
| 648 | Ga0395900_0143157 | 3300037418 | Bacteria | 2447 |
| 649 | Ga0395900_0193215 | 3300037418 | Bacteria | 2063 |
| 650 | Ga0395900_0228390 | 3300037418 | Bacteria | 1873 |
| 651 | Ga0395900_0346593 | 3300037418 | Bacteria | 1459 |
| 652 | Ga0395900_0444000 | 3300037418 | Bacteria | 1254 |
| 653 | Ga0395900_0583789 | 3300037418 | Unclassified | 1059 |
| 654 | Ga0395900_0640890 | 3300037418 | Bacteria | 1000 |
| 655 | Ga0395900_0645091 | 3300037418 | Bacteria | 996 |
| 656 | Ga0395900_0755906 | 3300037418 | Bacteria | 902 |
| 657 | Ga0395900_1065083 | 3300037418 | Bacteria | 727 |
| 658 | Ga0395900_1465796 | 3300037418 | Bacteria | 595 |
| 659 | Ga0395900_1619754 | 3300037418 | Bacteria | 559 |
| 660 | Ga0395898_0002616 | 3300037466 | Bacteria | 20962 |
| 661 | Ga0395898_0005906 | 3300037466 | Bacteria | 13162 |
| 662 | Ga0395898_0007257 | 3300037466 | Bacteria | 11761 |
| 663 | Ga0395898_0019563 | 3300037466 | Bacteria | 6888 |
| 664 | Ga0395898_0025937 | 3300037466 | Bacteria | 5902 |
| 665 | Ga0395898_0032324 | 3300037466 | Bacteria | 5223 |
| 666 | Ga0395898_0052482 | 3300037466 | Bacteria | 3983 |
| 667 | Ga0395898_0070467 | 3300037466 | Bacteria | 3379 |
| 668 | Ga0395898_0101435 | 3300037466 | Bacteria | 2763 |
| 669 | Ga0395898_0104976 | 3300037466 | Bacteria | 2709 |
| 670 | Ga0395898_0111475 | 3300037466 | Bacteria | 2622 |
| 671 | Ga0395898_0149383 | 3300037466 | Bacteria | 2236 |
| 672 | Ga0395898_0218653 | 3300037466 | Bacteria | 1817 |
| 673 | Ga0395898_0291240 | 3300037466 | Unclassified | 1557 |
| 674 | Ga0395898_0309631 | 3300037466 | Bacteria | 1506 |
| 675 | Ga0395898_0382788 | 3300037466 | Bacteria | 1342 |
| 676 | Ga0395898_0405998 | 3300037466 | Bacteria | 1299 |
| 677 | Ga0395898_0432054 | 3300037466 | Bacteria | 1255 |
| 678 | Ga0395898_0655311 | 3300037466 | Bacteria | 992 |
| 679 | Ga0395898_0668770 | 3300037466 | Bacteria | 981 |
| 680 | Ga0395898_0693237 | 3300037466 | Bacteria | 960 |
| 681 | Ga0395898_0826227 | 3300037466 | Unclassified | 866 |
| 682 | Ga0395898_1272535 | 3300037466 | Bacteria | 665 |
| 683 | Ga0395898_1421871 | 3300037466 | Unclassified | 621 |
| 684 | Ga0395905_0003496 | 3300037471 | Bacteria | 16767 |
| 685 | Ga0395905_0005495 | 3300037471 | Bacteria | 12929 |
| 686 | Ga0395905_0014937 | 3300037471 | Bacteria | 7407 |
| 687 | Ga0395905_0038630 | 3300037471 | Bacteria | 4479 |
| 688 | Ga0395905_0040078 | 3300037471 | Bacteria | 4394 |
| 689 | Ga0395905_0060423 | 3300037471 | Bacteria | 3544 |
| 690 | Ga0395905_0062432 | 3300037471 | Bacteria | 3485 |
| 691 | Ga0395905_0065218 | 3300037471 | Bacteria | 3409 |
| 692 | Ga0395905_0068291 | 3300037471 | Bacteria | 3329 |
| 693 | Ga0395905_0189724 | 3300037471 | Bacteria | 1928 |
| 694 | Ga0395905_0269829 | 3300037471 | Bacteria | 1587 |
| 695 | Ga0395905_0272117 | 3300037471 | Bacteria | 1580 |
| 696 | Ga0395905_0332078 | 3300037471 | Bacteria | 1411 |
| 697 | Ga0395905_0366612 | 3300037471 | Bacteria | 1333 |
| 698 | Ga0395905_0485167 | 3300037471 | Bacteria | 1135 |
| 699 | Ga0395905_0506479 | 3300037471 | Bacteria | 1107 |
| 700 | Ga0395905_0585392 | 3300037471 | Bacteria | 1017 |
| 701 | Ga0395905_1053075 | 3300037471 | Bacteria | 717 |
| 702 | Ga0395905_1083119 | 3300037471 | Bacteria | 704 |
| 703 | Ga0395905_1097162 | 3300037471 | Bacteria | 699 |
| 704 | Ga0395905_1180477 | 3300037471 | Unclassified | 669 |
| 705 | Ga0436364_0871138 | 3300037853 | Bacteria | 1462 |
| 706 | Ga0395901_0000744 | 3300038443 | Bacteria | 36793 |
| 707 | Ga0395901_0001394 | 3300038443 | Bacteria | 25270 |
| 708 | Ga0395901_0001686 | 3300038443 | Bacteria | 22797 |
| 709 | Ga0395901_0002239 | 3300038443 | Bacteria | 19733 |
| 710 | Ga0395901_0005425 | 3300038443 | Bacteria | 12903 |
| 711 | Ga0395901_0014181 | 3300038443 | Bacteria | 8114 |
| 712 | Ga0395901_0038084 | 3300038443 | Bacteria | 4974 |
| 713 | Ga0395901_0044163 | 3300038443 | Bacteria | 4622 |
| 714 | Ga0395901_0091307 | 3300038443 | Bacteria | 3188 |
| 715 | Ga0395901_0109199 | 3300038443 | Bacteria | 2904 |
| 716 | Ga0395901_0132957 | 3300038443 | Bacteria | 2614 |
| 717 | Ga0395901_0150080 | 3300038443 | Bacteria | 2449 |
| 718 | Ga0395901_0177981 | 3300038443 | Bacteria | 2230 |
| 719 | Ga0395901_0186485 | 3300038443 | Bacteria | 2175 |
| 720 | Ga0395901_0194979 | 3300038443 | Bacteria | 2124 |
| 721 | Ga0395901_0305475 | 3300038443 | Bacteria | 1649 |
| 722 | Ga0395901_0321460 | 3300038443 | Bacteria | 1601 |
| 723 | Ga0395901_0602370 | 3300038443 | Unclassified | 1108 |
| 724 | Ga0395901_0637690 | 3300038443 | Bacteria | 1070 |
| 725 | Ga0395901_0657083 | 3300038443 | Bacteria | 1051 |
| 726 | Ga0395901_2030419 | 3300038443 | Bacteria | 521 |
| 727 | Ga0436365_0391299 | 3300039437 | Bacteria | 1100 |
| 728 | Ga0436365_1592653 | 3300039437 | Bacteria | 573 |
| 729 | Ga0436363_1209816 | 3300039450 | Bacteria | 1377 |
| 730 | Ga0436363_1414311 | 3300039450 | Bacteria | 1810 |
| 731 | Ga0436363_1590339 | 3300039450 | Bacteria | 1888 |
| 732 | Ga0439461_0135203 | 3300041410 | Unclassified | 626 |
| 733 | Ga0451839_0381197 | 3300041496 | Bacteria | 646 |
| 734 | Ga0451851_0997760 | 3300041507 | Bacteria | 1827 |
| 735 | Ga0451853_0445709 | 3300041512 | Bacteria | 6578 |
| 736 | Ga0451853_0502246 | 3300041512 | Bacteria | 722 |
| 737 | Ga0451853_0894815 | 3300041512 | Bacteria | 1356 |
| 738 | Ga0439448_0014578 | 3300042005 | Bacteria | 2373 |
| 739 | Ga0439450_046628 | 3300042008 | Bacteria | 1020 |
| 740 | Ga0450906_045499 | 3300042145 | Bacteria | 774 |
| 741 | Ga0439458_0178262 | 3300042157 | Bacteria | 576 |
| 742 | Ga0439460_0250993 | 3300042461 | Bacteria | 611 |
| 743 | Ga0466969_0174737 | 3300044656 | Bacteria | 984 |
| 744 | Ga0466966_0043026 | 3300044684 | Bacteria | 2896 |
| 745 | Ga0466961_0129780 | 3300044693 | Bacteria | 1580 |
| 746 | Ga0466963_0020255 | 3300044694 | Bacteria | 4183 |
| 747 | Ga0466963_0034424 | 3300044694 | Bacteria | 3295 |
| 748 | Ga0466963_0079065 | 3300044694 | Bacteria | 2225 |
| 749 | Ga0466963_0578936 | 3300044694 | Bacteria | 793 |
| 750 | Ga0466964_0001299 | 3300044706 | Bacteria | 8521 |
| 751 | Ga0466964_0011257 | 3300044706 | Bacteria | 3379 |
| 752 | Ga0466964_0237287 | 3300044706 | Bacteria | 893 |
| 753 | Ga0466971_0343242 | 3300044719 | Bacteria | 722 |
| 754 | Ga0466968_0013261 | 3300044735 | Bacteria | 3239 |
| 755 | Ga0466957_0201946 | 3300044842 | Bacteria | 1306 |
| 756 | Ga0466957_0235344 | 3300044842 | Bacteria | 1214 |
| 757 | Ga0466957_0307065 | 3300044842 | Bacteria | 1067 |
| 758 | Ga0466957_0398776 | 3300044842 | Bacteria | 941 |
| 759 | Ga0466957_0460361 | 3300044842 | Unclassified | 877 |
| 760 | Ga0466960_0067728 | 3300044901 | Bacteria | 1769 |
| 761 | Ga0466960_0123435 | 3300044901 | Bacteria | 1359 |
| 762 | Ga0466959_0003201 | 3300045049 | Bacteria | 10639 |
| 763 | Ga0451576_0025325 | 3300045051 | Bacteria | 6393 |
| 764 | Ga0451576_0235236 | 3300045051 | Bacteria | 1913 |
| 765 | Ga0451576_0238671 | 3300045051 | Bacteria | 1899 |
| 766 | Ga0466958_0103604 | 3300045836 | Bacteria | 1772 |
| 767 | Ga0466958_0255350 | 3300045836 | Bacteria | 1122 |
| 768 | Ga0466958_0321918 | 3300045836 | Bacteria | 994 |
| 769 | Ga0466958_0416601 | 3300045836 | Bacteria | 868 |
| 770 | Ga0466967_0000440 | 3300045976 | Bacteria | 19889 |
| 771 | Ga0466967_0029993 | 3300045976 | Bacteria | 4559 |
| 772 | Ga0466967_0040177 | 3300045976 | Bacteria | 4026 |
| 773 | Ga0466967_0049004 | 3300045976 | Bacteria | 3692 |
| 774 | Ga0466967_0075564 | 3300045976 | Bacteria | 3028 |
| 775 | Ga0466967_0174798 | 3300045976 | Bacteria | 2023 |
| 776 | Ga0466967_0314038 | 3300045976 | Bacteria | 1510 |
| 777 | Ga0466967_0362397 | 3300045976 | Bacteria | 1405 |
| 778 | Ga0466967_0405677 | 3300045976 | Bacteria | 1327 |
| 779 | Ga0466967_0491357 | 3300045976 | Bacteria | 1203 |
| 780 | Ga0466967_0495326 | 3300045976 | Bacteria | 1198 |
| 781 | Ga0466967_0657990 | 3300045976 | Bacteria | 1036 |
| 782 | Ga0466967_0811046 | 3300045976 | Bacteria | 929 |
| 783 | Ga0466967_0989259 | 3300045976 | Bacteria | 837 |
| 784 | Ga0466967_1598418 | 3300045976 | Unclassified | 649 |
| 785 | Ga0466967_1731651 | 3300045976 | Bacteria | 622 |
| 786 | Ga0466967_1857199 | 3300045976 | Bacteria | 599 |
| 787 | Ga0495591_056587 | 3300046458 | Bacteria | 1054 |
| 788 | Ga0495629_0284204 | 3300046459 | Bacteria | 1135 |
| 789 | Ga0495629_0303633 | 3300046459 | Bacteria | 1093 |
| 790 | Ga0495638_0571952 | 3300046460 | Bacteria | 559 |
| 791 | Ga0495641_0033614 | 3300046461 | Bacteria | 2432 |
| 792 | Ga0495641_0093315 | 3300046461 | Bacteria | 1345 |
| 793 | Ga0495641_0240345 | 3300046461 | Unclassified | 814 |
| 794 | Ga0495651_0099706 | 3300046462 | Bacteria | 2166 |
| 795 | Ga0495651_0549510 | 3300046462 | Bacteria | 734 |
| 796 | Ga0495651_0561052 | 3300046462 | Bacteria | 724 |
| 797 | Ga0495653_0073227 | 3300046463 | Bacteria | 2557 |
| 798 | Ga0495582_0365606 | 3300046473 | Bacteria | 831 |
| 799 | Ga0495582_0560320 | 3300046473 | Bacteria | 661 |
| 800 | Ga0495605_0059424 | 3300046474 | Bacteria | 1836 |
| 801 | Ga0495605_0161092 | 3300046474 | Bacteria | 996 |
| 802 | Ga0495605_0274673 | 3300046474 | Bacteria | 717 |
| 803 | Ga0495639_0448072 | 3300046475 | Bacteria | 655 |
| 804 | Ga0495639_0554059 | 3300046475 | Bacteria | 589 |
| 805 | Ga0495584_0055035 | 3300046491 | Bacteria | 2002 |
| 806 | Ga0495584_0071372 | 3300046491 | Bacteria | 1745 |
| 807 | Ga0495584_0150913 | 3300046491 | Bacteria | 1181 |
| 808 | Ga0495584_0171194 | 3300046491 | Bacteria | 1104 |
| 809 | Ga0495584_0192627 | 3300046491 | Unclassified | 1036 |
| 810 | Ga0495584_0304288 | 3300046491 | Bacteria | 810 |
| 811 | Ga0495584_0332782 | 3300046491 | Bacteria | 771 |
| 812 | Ga0495585_0131851 | 3300046492 | Bacteria | 1315 |
| 813 | Ga0495596_0074957 | 3300046500 | Bacteria | 1314 |
| 814 | Ga0495596_0334515 | 3300046500 | Bacteria | 589 |
| 815 | Ga0495608_0117136 | 3300046511 | Bacteria | 1709 |
| 816 | Ga0495620_0103725 | 3300046515 | Bacteria | 1132 |
| 817 | Ga0495630_0063267 | 3300046517 | Bacteria | 2779 |
| 818 | Ga0495630_0101602 | 3300046517 | Bacteria | 2175 |
| 819 | Ga0495631_0201316 | 3300046518 | Bacteria | 851 |
| 820 | Ga0495632_0341808 | 3300046519 | Bacteria | 659 |
| 821 | Ga0495637_0064001 | 3300046520 | Bacteria | 1501 |
| 822 | Ga0495644_0130580 | 3300046523 | Bacteria | 957 |
| 823 | Ga0495644_0150737 | 3300046523 | Bacteria | 890 |
| 824 | Ga0495663_0023132 | 3300046525 | Bacteria | 1799 |
| 825 | Ga0495663_0041814 | 3300046525 | Bacteria | 1395 |
| 826 | Ga0495642_0100070 | 3300046528 | Bacteria | 1233 |
| 827 | Ga0495642_0231845 | 3300046528 | Bacteria | 806 |
| 828 | Ga0495642_0274694 | 3300046528 | Bacteria | 738 |
| 829 | Ga0495652_0142926 | 3300046529 | Bacteria | 1880 |
| 830 | Ga0495652_0416419 | 3300046529 | Bacteria | 948 |
| 831 | Ga0495652_0529233 | 3300046529 | Bacteria | 813 |
| 832 | Ga0495654_0083258 | 3300046530 | Bacteria | 1496 |
| 833 | Ga0495640_0409083 | 3300046533 | Unclassified | 832 |
| 834 | Ga0495586_0059389 | 3300046535 | Bacteria | 2078 |
| 835 | Ga0495587_0598103 | 3300046536 | Bacteria | 607 |
| 836 | Ga0495598_0102051 | 3300046537 | Unclassified | 951 |
| 837 | Ga0495609_0053530 | 3300046538 | Bacteria | 1794 |
| 838 | Ga0495609_0216168 | 3300046538 | Bacteria | 797 |
| 839 | Ga0495621_0031666 | 3300046539 | Bacteria | 1816 |
| 840 | Ga0495645_0521355 | 3300046543 | Bacteria | 740 |
| 841 | Ga0495667_0074628 | 3300046559 | Bacteria | 2208 |
| 842 | Ga0495656_0063740 | 3300046615 | Bacteria | 1616 |
| 843 | Ga0495656_0071083 | 3300046615 | Bacteria | 1546 |
| 844 | Ga0495656_0215078 | 3300046615 | Bacteria | 959 |
| 845 | Ga0495668_0361926 | 3300046616 | Bacteria | 796 |
| 846 | Ga0495668_0407645 | 3300046616 | Unclassified | 747 |
| 847 | Ga0495634_0056762 | 3300046642 | Bacteria | 2615 |
| 848 | Ga0495611_0054307 | 3300046648 | Bacteria | 1811 |
| 849 | Ga0495611_0189665 | 3300046648 | Bacteria | 960 |
| 850 | Ga0495625_0537379 | 3300046660 | Bacteria | 710 |
| 851 | Ga0495635_0427188 | 3300046663 | Bacteria | 878 |
| 852 | Ga0495659_0002526 | 3300046664 | Bacteria | 5908 |
| 853 | Ga0495659_0002767 | 3300046664 | Bacteria | 5644 |
| 854 | Ga0495659_0401102 | 3300046664 | Bacteria | 592 |
| 855 | Ga0495661_0290585 | 3300046665 | Bacteria | 821 |
| 856 | Ga0495661_0526390 | 3300046665 | Bacteria | 561 |
| 857 | Ga0495657_0425758 | 3300046675 | Bacteria | 779 |
| 858 | Ga0495657_0443279 | 3300046675 | Bacteria | 761 |
| 859 | Ga0495657_0703588 | 3300046675 | Bacteria | 581 |
| 860 | Ga0495599_0122154 | 3300046678 | Bacteria | 1619 |
| 861 | Ga0495599_0205190 | 3300046678 | Unclassified | 1210 |
| 862 | Ga0495599_0481515 | 3300046678 | Bacteria | 732 |
| 863 | Ga0495599_0539669 | 3300046678 | Unclassified | 684 |
| 864 | Ga0495623_0223598 | 3300046679 | Bacteria | 1071 |
| 865 | Ga0495647_0104093 | 3300046681 | Bacteria | 1178 |
| 866 | Ga0495658_0073103 | 3300046683 | Bacteria | 1995 |
| 867 | Ga0495658_0266198 | 3300046683 | Bacteria | 1080 |
| 868 | Ga0495658_0994874 | 3300046683 | Bacteria | 535 |
| 869 | Ga0495669_0248301 | 3300046684 | Bacteria | 855 |
| 870 | Ga0495613_0641869 | 3300046689 | Bacteria | 703 |
| 871 | Ga0495613_0646903 | 3300046689 | Bacteria | 700 |
| 872 | Ga0495613_0882208 | 3300046689 | Unclassified | 580 |
| 873 | Ga0495670_0350016 | 3300046691 | Bacteria | 795 |
| 874 | Ga0495671_0323506 | 3300046692 | Bacteria | 740 |
| 875 | Ga0495589_0156513 | 3300046794 | Unclassified | 1087 |
| 876 | Ga0495589_0161345 | 3300046794 | Bacteria | 1068 |
| 877 | Ga0495589_0199337 | 3300046794 | Bacteria | 945 |
| 878 | Ga0495589_0235671 | 3300046794 | Bacteria | 857 |
| 879 | Ga0495600_0395794 | 3300046809 | Bacteria | 860 |
| 880 | Ga0495600_0567940 | 3300046809 | Bacteria | 692 |
| 881 | Ga0495581_0219271 | 3300047315 | Bacteria | 1112 |
| 882 | Ga0495604_0539361 | 3300047317 | Bacteria | 753 |
| 883 | Ga0495676_1047527 | 3300047321 | Bacteria | 520 |
| 884 | Ga0495680_0134301 | 3300047322 | Bacteria | 1815 |
| 885 | Ga0495683_0138622 | 3300047323 | Bacteria | 1142 |
| 886 | Ga0495683_0395180 | 3300047323 | Bacteria | 576 |
| 887 | Ga0495677_0187729 | 3300047445 | Bacteria | 802 |
| 888 | Ga0495685_072911 | 3300047447 | Bacteria | 1149 |
| 889 | Ga0495684_0330206 | 3300047471 | Bacteria | 1088 |
| 890 | Ga0496100_0004854 | 3300048903 | Bacteria | 7181 |
| 891 | Ga0496100_0029788 | 3300048903 | Bacteria | 3379 |
| 892 | Ga0496100_0042219 | 3300048903 | Bacteria | 2912 |
| 893 | Ga0496100_0109415 | 3300048903 | Bacteria | 1917 |
| 894 | Ga0496100_0129304 | 3300048903 | Bacteria | 1777 |
| 895 | Ga0496100_1220653 | 3300048903 | Bacteria | 593 |
| 896 | Ga0496100_1334287 | 3300048903 | Bacteria | 566 |
| 897 | Ga0496101_0004861 | 3300048904 | Bacteria | 8524 |
| 898 | Ga0496101_0071942 | 3300048904 | Bacteria | 2537 |
| 899 | Ga0496101_0144838 | 3300048904 | Unclassified | 1814 |
| 900 | Ga0496101_0153005 | 3300048904 | Bacteria | 1765 |
| 901 | Ga0496101_0442174 | 3300048904 | Bacteria | 1026 |
| 902 | Ga0496101_0468301 | 3300048904 | Bacteria | 994 |
| 903 | Ga0496102_0018069 | 3300048905 | Bacteria | 6190 |
| 904 | Ga0496102_0039707 | 3300048905 | Bacteria | 4254 |
| 905 | Ga0496102_0181864 | 3300048905 | Bacteria | 1981 |
| 906 | Ga0496102_0187419 | 3300048905 | Bacteria | 1950 |
| 907 | Ga0496102_0368080 | 3300048905 | Bacteria | 1353 |
| 908 | Ga0496102_0500024 | 3300048905 | Bacteria | 1138 |
| 909 | Ga0496102_0511136 | 3300048905 | Bacteria | 1124 |
| 910 | Ga0496102_1050091 | 3300048905 | Bacteria | 735 |
| 911 | Ga0496103_0055918 | 3300048906 | Bacteria | 2448 |
| 912 | Ga0496103_0075386 | 3300048906 | Bacteria | 2116 |
| 913 | Ga0496103_0100145 | 3300048906 | Bacteria | 1834 |
| 914 | Ga0496103_0161799 | 3300048906 | Bacteria | 1436 |
| 915 | Ga0496103_0340742 | 3300048906 | Bacteria | 964 |
| 916 | Ga0496103_0460412 | 3300048906 | Bacteria | 815 |
| 917 | Ga0496103_0583137 | 3300048906 | Bacteria | 713 |
| 918 | Ga0496104_0024445 | 3300048907 | Bacteria | 5556 |
| 919 | Ga0496104_0027429 | 3300048907 | Bacteria | 5270 |
| 920 | Ga0496104_0056269 | 3300048907 | Bacteria | 3719 |
| 921 | Ga0496104_0059751 | 3300048907 | Bacteria | 3609 |
| 922 | Ga0496104_0097950 | 3300048907 | Bacteria | 2807 |
| 923 | Ga0496105_0000362 | 3300048908 | Bacteria | 30061 |
| 924 | Ga0496105_0006218 | 3300048908 | Bacteria | 9160 |
| 925 | Ga0496105_0007486 | 3300048908 | Bacteria | 8457 |
| 926 | Ga0496105_0024596 | 3300048908 | Bacteria | 4894 |
| 927 | Ga0496105_0728031 | 3300048908 | Bacteria | 759 |
| 928 | Ga0496106_0008454 | 3300048909 | Bacteria | 7617 |
| 929 | Ga0496106_0025194 | 3300048909 | Bacteria | 4425 |
| 930 | Ga0496106_0094409 | 3300048909 | Bacteria | 2312 |
| 931 | Ga0496106_0106130 | 3300048909 | Bacteria | 2183 |
| 932 | Ga0496106_0525933 | 3300048909 | Unclassified | 950 |
| 933 | Ga0496107_0029355 | 3300048910 | Bacteria | 3911 |
| 934 | Ga0496107_0045645 | 3300048910 | Bacteria | 3152 |
| 935 | Ga0496107_0054716 | 3300048910 | Bacteria | 2881 |
| 936 | Ga0496107_0086712 | 3300048910 | Bacteria | 2285 |
| 937 | Ga0496107_0201704 | 3300048910 | Bacteria | 1478 |
| 938 | Ga0496107_0282598 | 3300048910 | Bacteria | 1235 |
| 939 | Ga0496107_0433753 | 3300048910 | Bacteria | 977 |
| 940 | Ga0496107_0502089 | 3300048910 | Unclassified | 900 |
| 941 | Ga0496107_0555385 | 3300048910 | Unclassified | 850 |
| 942 | Ga0496108_0003918 | 3300048911 | Bacteria | 11953 |
| 943 | Ga0496108_0004739 | 3300048911 | Bacteria | 10967 |
| 944 | Ga0496108_0049211 | 3300048911 | Bacteria | 3525 |
| 945 | Ga0496108_0102220 | 3300048911 | Bacteria | 2445 |
| 946 | Ga0496108_0110036 | 3300048911 | Bacteria | 2355 |
| 947 | Ga0496108_0183025 | 3300048911 | Bacteria | 1815 |
| 948 | Ga0496108_0332960 | 3300048911 | Bacteria | 1324 |
| 949 | Ga0496108_0525167 | 3300048911 | Bacteria | 1033 |
| 950 | Ga0496109_0004197 | 3300048912 | Bacteria | 12013 |
| 951 | Ga0496109_0009486 | 3300048912 | Bacteria | 8298 |
| 952 | Ga0496109_0013491 | 3300048912 | Bacteria | 7089 |
| 953 | Ga0496109_0070870 | 3300048912 | Bacteria | 3199 |
| 954 | Ga0496109_0080397 | 3300048912 | Bacteria | 3003 |
| 955 | Ga0496109_0089241 | 3300048912 | Bacteria | 2850 |
| 956 | Ga0496109_0090901 | 3300048912 | Bacteria | 2823 |
| 957 | Ga0496109_0109270 | 3300048912 | Bacteria | 2570 |
| 958 | Ga0496109_0434561 | 3300048912 | Bacteria | 1240 |
| 959 | Ga0496109_1343413 | 3300048912 | Unclassified | 650 |
| 960 | Ga0496110_0002026 | 3300048913 | Bacteria | 15085 |
| 961 | Ga0496110_0004908 | 3300048913 | Bacteria | 10439 |
| 962 | Ga0496110_0012389 | 3300048913 | Bacteria | 7011 |
| 963 | Ga0496110_0039758 | 3300048913 | Bacteria | 4096 |
| 964 | Ga0496110_0049929 | 3300048913 | Bacteria | 3672 |
| 965 | Ga0496110_0172781 | 3300048913 | Bacteria | 1961 |
| 966 | Ga0496110_0294973 | 3300048913 | Bacteria | 1477 |
| 967 | Ga0496110_0409318 | 3300048913 | Bacteria | 1236 |
| 968 | Ga0496110_1825587 | 3300048913 | Bacteria | 518 |
| 969 | Ga0496111_0000234 | 3300048914 | Bacteria | 26582 |
| 970 | Ga0496111_0024062 | 3300048914 | Bacteria | 4283 |
| 971 | Ga0496111_0077048 | 3300048914 | Bacteria | 2431 |
| 972 | Ga0496111_0146812 | 3300048914 | Bacteria | 1749 |
| 973 | Ga0496111_0162502 | 3300048914 | Bacteria | 1658 |
| 974 | Ga0496111_0216613 | 3300048914 | Bacteria | 1422 |
| 975 | Ga0496111_0316027 | 3300048914 | Bacteria | 1157 |
| 976 | Ga0496111_0859554 | 3300048914 | Bacteria | 654 |
| 977 | Ga0496112_0008602 | 3300048915 | Bacteria | 9147 |
| 978 | Ga0496112_0048339 | 3300048915 | Bacteria | 4171 |
| 979 | Ga0496112_0083854 | 3300048915 | Bacteria | 3152 |
| 980 | Ga0496112_0170361 | 3300048915 | Bacteria | 2142 |
| 981 | Ga0496112_0496639 | 3300048915 | Bacteria | 1156 |
| 982 | Ga0496112_0538607 | 3300048915 | Bacteria | 1102 |
| 983 | Ga0496112_0654208 | 3300048915 | Bacteria | 980 |
| 984 | Ga0496112_0733247 | 3300048915 | Unclassified | 915 |
| 985 | Ga0496112_0880070 | 3300048915 | Bacteria | 818 |
| 986 | Ga0496112_1178217 | 3300048915 | Unclassified | 683 |
| 987 | Ga0496113_0004778 | 3300048916 | Bacteria | 8368 |
| 988 | Ga0496113_0090832 | 3300048916 | Bacteria | 2353 |
| 989 | Ga0496113_0102804 | 3300048916 | Bacteria | 2216 |
| 990 | Ga0496113_0119808 | 3300048916 | Bacteria | 2056 |
| 991 | Ga0496113_0289671 | 3300048916 | Bacteria | 1310 |
| 992 | Ga0496113_0534534 | 3300048916 | Bacteria | 941 |
| 993 | Ga0496113_0559567 | 3300048916 | Unclassified | 917 |
| 994 | Ga0496113_0653127 | 3300048916 | Bacteria | 841 |
| 995 | Ga0496113_0982998 | 3300048916 | Unclassified | 665 |
| 996 | Ga0496113_1090813 | 3300048916 | Bacteria | 626 |
| 997 | Ga0496114_0008661 | 3300048917 | Bacteria | 8064 |
| 998 | Ga0496114_0025592 | 3300048917 | Bacteria | 4825 |
| 999 | Ga0496114_0052175 | 3300048917 | Bacteria | 3407 |
| 1000 | Ga0496114_0092542 | 3300048917 | Bacteria | 2569 |
| 1001 | Ga0496114_0112924 | 3300048917 | Bacteria | 2329 |
| 1002 | Ga0496114_0113075 | 3300048917 | Bacteria | 2327 |
| 1003 | Ga0496114_0952694 | 3300048917 | Bacteria | 741 |
| 1004 | Ga0496114_0992694 | 3300048917 | Bacteria | 723 |
| 1005 | Ga0496114_1047833 | 3300048917 | Bacteria | 700 |
| 1006 | Ga0496114_1373804 | 3300048917 | Bacteria | 594 |
| 1007 | Ga0496115_0006662 | 3300048918 | Bacteria | 8478 |
| 1008 | Ga0496115_0035182 | 3300048918 | Bacteria | 3961 |
| 1009 | Ga0496115_0283998 | 3300048918 | Bacteria | 1358 |
| 1010 | Ga0496115_0675028 | 3300048918 | Bacteria | 814 |
| 1011 | Ga0501031_0005539 | 3300049568 | Bacteria | 8221 |
| 1012 | Ga0501032_0846496 | 3300049569 | Bacteria | 577 |
| 1013 | Ga0501033_0089532 | 3300049570 | Bacteria | 2251 |
| 1014 | Ga0501033_0209922 | 3300049570 | Bacteria | 1389 |
| 1015 | Ga0501034_0022281 | 3300049571 | Unclassified | 6457 |
| 1016 | Ga0501034_0312104 | 3300049571 | Bacteria | 1507 |
| 1017 | Ga0501034_0506786 | 3300049571 | Bacteria | 1120 |
| 1018 | Ga0501036_0362841 | 3300049572 | Bacteria | 1209 |
| 1019 | Ga0501038_0326396 | 3300049574 | Bacteria | 1200 |
| 1020 | Ga0501038_0359966 | 3300049574 | Bacteria | 1132 |
| 1021 | Ga0501039_0029160 | 3300049575 | Bacteria | 4250 |
| 1022 | Ga0501039_0617783 | 3300049575 | Bacteria | 849 |
| 1023 | Ga0501040_0077248 | 3300049576 | Bacteria | 2303 |
| 1024 | Ga0501040_0097892 | 3300049576 | Bacteria | 2044 |
| 1025 | Ga0501040_0340948 | 3300049576 | Bacteria | 1073 |
| 1026 | Ga0501040_0350231 | 3300049576 | Bacteria | 1058 |
| 1027 | Ga0501040_0411289 | 3300049576 | Unclassified | 972 |
| 1028 | Ga0501041_0037607 | 3300049577 | Bacteria | 2933 |
| 1029 | Ga0501041_0327737 | 3300049577 | Bacteria | 966 |
| 1030 | Ga0501042_0101102 | 3300049578 | Bacteria | 2073 |
| 1031 | Ga0501042_0103146 | 3300049578 | Bacteria | 2052 |
| 1032 | Ga0501042_0188294 | 3300049578 | Bacteria | 1489 |
| 1033 | Ga0501042_0674274 | 3300049578 | Bacteria | 752 |
| 1034 | Ga0501046_0121636 | 3300049580 | Bacteria | 1985 |
| 1035 | Ga0501046_0218106 | 3300049580 | Bacteria | 1414 |
| 1036 | Ga0501048_0065397 | 3300049582 | Bacteria | 2571 |
| 1037 | Ga0501048_0388624 | 3300049582 | Unclassified | 997 |
| 1038 | Ga0501067_0000516 | 3300049583 | Bacteria | 21125 |
| 1039 | Ga0501067_0002005 | 3300049583 | Bacteria | 11218 |
| 1040 | Ga0501067_0013292 | 3300049583 | Bacteria | 4559 |
| 1041 | Ga0501067_0106281 | 3300049583 | Unclassified | 1560 |
| 1042 | Ga0501067_0560960 | 3300049583 | Unclassified | 640 |
| 1043 | Ga0501068_0061002 | 3300049584 | Bacteria | 2290 |
| 1044 | Ga0501068_0101621 | 3300049584 | Bacteria | 1783 |
| 1045 | Ga0501068_0106001 | 3300049584 | Bacteria | 1745 |
| 1046 | Ga0501068_0127574 | 3300049584 | Bacteria | 1589 |
| 1047 | Ga0501068_0137718 | 3300049584 | Bacteria | 1529 |
| 1048 | Ga0501068_0212395 | 3300049584 | Bacteria | 1229 |
| 1049 | Ga0501069_0002134 | 3300049585 | Bacteria | 9961 |
| 1050 | Ga0501069_0005912 | 3300049585 | Bacteria | 6378 |
| 1051 | Ga0501069_0009763 | 3300049585 | Bacteria | 5072 |
| 1052 | Ga0501069_0091708 | 3300049585 | Bacteria | 1718 |
| 1053 | Ga0501069_0091958 | 3300049585 | Bacteria | 1716 |
| 1054 | Ga0501069_0197710 | 3300049585 | Bacteria | 1164 |
| 1055 | Ga0501070_0101991 | 3300049586 | Bacteria | 2373 |
| 1056 | Ga0501070_0229662 | 3300049586 | Bacteria | 1520 |
| 1057 | Ga0501070_0462373 | 3300049586 | Bacteria | 1022 |
| 1058 | Ga0501070_1027226 | 3300049586 | Bacteria | 638 |
| 1059 | Ga0501071_0347474 | 3300049587 | Bacteria | 1128 |
| 1060 | Ga0501072_0053709 | 3300049588 | Bacteria | 3173 |
| 1061 | Ga0501072_0346053 | 3300049588 | Bacteria | 1180 |
| 1062 | Ga0501072_0954676 | 3300049588 | Unclassified | 669 |
| 1063 | Ga0501074_0050935 | 3300049590 | Bacteria | 2988 |
| 1064 | Ga0501074_0237438 | 3300049590 | Bacteria | 1297 |
| 1065 | Ga0501074_0435217 | 3300049590 | Bacteria | 930 |
| 1066 | Ga0501075_0001511 | 3300049591 | Bacteria | 15174 |
| 1067 | Ga0501075_0252956 | 3300049591 | Bacteria | 1343 |
| 1068 | Ga0501075_0274193 | 3300049591 | Bacteria | 1285 |
| 1069 | Ga0501075_0347315 | 3300049591 | Bacteria | 1131 |
| 1070 | Ga0501076_0086706 | 3300049592 | Bacteria | 2516 |
| 1071 | Ga0501076_0182798 | 3300049592 | Bacteria | 1709 |
| 1072 | Ga0501076_0480063 | 3300049592 | Bacteria | 1024 |
| 1073 | Ga0501076_0884446 | 3300049592 | Bacteria | 737 |
| 1074 | Ga0501077_0013534 | 3300049593 | Bacteria | 5117 |
| 1075 | Ga0501077_0025788 | 3300049593 | Bacteria | 3730 |
| 1076 | Ga0501077_0077243 | 3300049593 | Bacteria | 2109 |
| 1077 | Ga0501077_0802151 | 3300049593 | Bacteria | 605 |
| 1078 | Ga0501079_0053626 | 3300049741 | Bacteria | 3110 |
| 1079 | Ga0501079_0135589 | 3300049741 | Bacteria | 1916 |
| 1080 | Ga0501079_0171800 | 3300049741 | Bacteria | 1690 |
| 1081 | Ga0501079_0364694 | 3300049741 | Bacteria | 1132 |
| 1082 | Ga0501080_0051650 | 3300049742 | Bacteria | 3826 |
| 1083 | Ga0501080_0054010 | 3300049742 | Bacteria | 3741 |
| 1084 | Ga0501081_0014393 | 3300049743 | Bacteria | 5218 |
| 1085 | Ga0501081_0068523 | 3300049743 | Bacteria | 2470 |
| 1086 | Ga0501081_0073390 | 3300049743 | Bacteria | 2386 |
| 1087 | Ga0501081_0260113 | 3300049743 | Bacteria | 1268 |
| 1088 | Ga0501081_0471865 | 3300049743 | Bacteria | 933 |
| 1089 | Ga0501081_0676490 | 3300049743 | Bacteria | 774 |
| 1090 | Ga0501081_0695485 | 3300049743 | Bacteria | 763 |
| 1091 | Ga0501083_0044613 | 3300049744 | Bacteria | 3001 |
| 1092 | Ga0501083_0789379 | 3300049744 | Bacteria | 618 |
| 1093 | Ga0501035_0221553 | 3300049822 | Bacteria | 1615 |
| 1094 | Ga0501035_0700708 | 3300049822 | Bacteria | 817 |
| 1095 | Ga0501044_0716125 | 3300049823 | Bacteria | 885 |
| 1096 | Ga0501045_0026802 | 3300049824 | Bacteria | 4148 |
| 1097 | Ga0501045_0105902 | 3300049824 | Bacteria | 2084 |
| 1098 | Ga0501045_0339917 | 3300049824 | Bacteria | 1117 |
| 1099 | Ga0501045_0536261 | 3300049824 | Unclassified | 868 |
| 1100 | nmdc:mga03683_209626_c1 | 3300050489 | Unclassified | 896 |
| 1101 | nmdc:mga0yw44_84245_c1 | 3300050492 | Bacteria | 1998 |
| 1102 | nmdc:mga05p37_198233_c1 | 3300050507 | Bacteria | 2433 |
| 1103 | nmdc:mga05p37_22096_c1 | 3300050507 | Bacteria | 7712 |
| 1104 | nmdc:mga05p37_222809_c1 | 3300050507 | Bacteria | 2275 |
| 1105 | nmdc:mga05p37_311590_c1 | 3300050507 | Bacteria | 1865 |
| 1106 | nmdc:mga05p37_373966_c1 | 3300050507 | Bacteria | 1671 |
| 1107 | nmdc:mga05p37_476221_c1 | 3300050507 | Bacteria | 1439 |
| 1108 | nmdc:mga05p37_51857_c1 | 3300050507 | Bacteria | 5045 |
| 1109 | nmdc:mga05p37_912398_c1 | 3300050507 | Bacteria | 945 |
| 1110 | nmdc:mga05p37_95829_c1 | 3300050507 | Bacteria | 3656 |
| 1111 | nmdc:mga09592_110903_c1 | 3300050508 | Bacteria | 2354 |
| 1112 | nmdc:mga09592_1238188_c1 | 3300050508 | Bacteria | 616 |
| 1113 | nmdc:mga09592_808836_c1 | 3300050508 | Bacteria | 792 |
| 1114 | nmdc:mga0qj67_70230_c1 | 3300050509 | Bacteria | 2794 |
| 1115 | nmdc:mga06r32_10292_c1 | 3300050510 | Bacteria | 8436 |
| 1116 | nmdc:mga06r32_35917_c1 | 3300050510 | Bacteria | 4678 |
| 1117 | nmdc:mga06r32_839059_c1 | 3300050510 | Bacteria | 878 |
| 1118 | nmdc:mga08y16_1277_c1 | 3300050511 | Bacteria | 25005 |
| 1119 | nmdc:mga08y16_128055_c1 | 3300050511 | Bacteria | 2641 |
| 1120 | nmdc:mga08y16_152954_c1 | 3300050511 | Bacteria | 2398 |
| 1121 | nmdc:mga08y16_16896_c1 | 3300050511 | Bacteria | 7684 |
| 1122 | nmdc:mga0n895_18537_c1 | 3300050512 | Bacteria | 6444 |
| 1123 | nmdc:mga0n895_355298_c1 | 3300050512 | Bacteria | 1484 |
| 1124 | nmdc:mga0n895_59212_c1 | 3300050512 | Bacteria | 3779 |
| 1125 | nmdc:mga0n895_746982_c1 | 3300050512 | Bacteria | 972 |
| 1126 | nmdc:mga0n895_81554_c1 | 3300050512 | Bacteria | 3224 |
| 1127 | nmdc:mga0n895_907474_c1 | 3300050512 | Bacteria | 866 |
| 1128 | nmdc:mga0rr50_11683_c1 | 3300050513 | Bacteria | 5636 |
| 1129 | nmdc:mga0rr50_22577_c1 | 3300050513 | Bacteria | 4322 |
| 1130 | nmdc:mga0rr50_51730_c1 | 3300050513 | Bacteria | 3050 |
| 1131 | nmdc:mga0rr50_7865_c1 | 3300050513 | Bacteria | 6611 |
| 1132 | nmdc:mga08x19_138809_c1 | 3300050514 | Bacteria | 1641 |
| 1133 | nmdc:mga08x19_480679_c1 | 3300050514 | Unclassified | 876 |
| 1134 | nmdc:mga0a205_1137170_c1 | 3300050515 | Unclassified | 628 |
| 1135 | nmdc:mga0a205_201139_c1 | 3300050515 | Bacteria | 1883 |
| 1136 | nmdc:mga0a205_205732_c1 | 3300050515 | Bacteria | 1857 |
| 1137 | nmdc:mga0a205_259530_c1 | 3300050515 | Bacteria | 1615 |
| 1138 | nmdc:mga0a205_59765_c1 | 3300050515 | Bacteria | 3682 |
| 1139 | Ga0495601_0048243 | 3300053077 | Bacteria | 2682 |
| 1140 | Ga0495601_0457784 | 3300053077 | Bacteria | 825 |
| 1141 | Ga0495655_0076522 | 3300053083 | Bacteria | 947 |
| 1142 | Ga0495655_0174574 | 3300053083 | Unclassified | 690 |
| 1143 | Ga0495619_0023122 | 3300053085 | Bacteria | 3982 |
| 1144 | Ga0500559_0059937 | 3300053136 | Bacteria | 1695 |
| 1145 | Ga0501084_0024420 | 3300054114 | Bacteria | 5042 |
| 1146 | Ga0501084_0485933 | 3300054114 | Bacteria | 1044 |
| 1147 | Ga0501084_0651266 | 3300054114 | Bacteria | 889 |
| 1148 | Ga0501084_0762415 | 3300054114 | Bacteria | 815 |
| 1149 | Ga0501082_0061990 | 3300060353 | Bacteria | 3218 |
| 1150 | Ga0501082_0078946 | 3300060353 | Bacteria | 2839 |
| 1151 | Ga0501082_0398081 | 3300060353 | Bacteria | 1202 |
| 1152 | Ga0501082_0433542 | 3300060353 | Bacteria | 1148 |
| 1153 | Ga0501082_0829395 | 3300060353 | Bacteria | 809 |
| 1154 | Ga0466962_0535403 | 3300061719 | Bacteria | 594 |
| 1155 | Ga0530510_0028917 | 3300061734 | Bacteria | 3975 |
| 1156 | Ga0530510_0047997 | 3300061734 | Bacteria | 3086 |
| 1157 | Ga0530510_0140524 | 3300061734 | Bacteria | 1779 |
| 1158 | Ga0530510_0182490 | 3300061734 | Bacteria | 1556 |
| 1159 | Ga0530510_0534851 | 3300061734 | Bacteria | 889 |
| 1160 | Ga0530510_0704103 | 3300061734 | Unclassified | 770 |
| 1161 | Ga0530510_1025049 | 3300061734 | Bacteria | 632 |
| 1162 | Ga0530510_1405019 | 3300061734 | Bacteria | 536 |
| 1163 | Ga0070713_100288223 | |||
| 1164 | rootH1_10083481 | |||
| 1165 | Ga0055536_1016854 | |||
| 1166 | Ga0070658_10015018 | |||
| 1167 | Ga0070658_11622738 | |||
| 1168 | Ga0070683_100090265 | |||
| 1169 | Ga0070683_100106871 | |||
| 1170 | Ga0070683_100133383 | |||
| 1171 | Ga0070683_100351431 | |||
| 1172 | Ga0070683_100361342 | |||
| 1173 | Ga0070683_101412908 | |||
| 1174 | Ga0070690_100022168 | |||
| 1175 | Ga0070680_100011868 | |||
| 1176 | Ga0070680_100045576 | |||
| 1177 | Ga0070680_100113919 | |||
| 1178 | Ga0070680_100275589 | |||
| 1179 | Ga0070680_100277450 | |||
| 1180 | Ga0070680_100387154 | |||
| 1181 | Ga0070680_100491221 | |||
| 1182 | Ga0070680_101261833 | |||
| 1183 | Ga0070682_100017679 | |||
| 1184 | Ga0070682_100275234 | |||
| 1185 | Ga0070682_100280796 | |||
| 1186 | Ga0070682_101680932 | |||
| 1187 | Ga0068868_100330391 | |||
| 1188 | Ga0070660_100005889 | |||
| 1189 | Ga0070660_100006898 | |||
| 1190 | Ga0070660_100050468 | |||
| 1191 | Ga0070660_100094004 | |||
| 1192 | Ga0070660_100316319 | |||
| 1193 | Ga0070660_100399081 | |||
| 1194 | Ga0070661_100008922 | |||
| 1195 | Ga0070661_100068128 | |||
| 1196 | Ga0070661_100541446 | |||
| 1197 | Ga0070661_100682140 | |||
| 1198 | Ga0070668_100243128 | |||
| 1199 | Ga0070668_100503123 | |||
| 1200 | Ga0070671_101091040 | |||
| 1201 | Ga0070674_100045155 | |||
| 1202 | Ga0070674_100200934 | |||
| 1203 | Ga0070659_100016427 | |||
| 1204 | Ga0070659_100065967 | |||
| 1205 | Ga0070659_100436503 | |||
| 1206 | Ga0070703_10052668 | |||
| 1207 | Ga0070709_10038941 | |||
| 1208 | Ga0070709_10054242 | |||
| 1209 | Ga0070714_100027889 | |||
| 1210 | Ga0070714_100237429 | |||
| 1211 | Ga0070714_100457453 | |||
| 1212 | Ga0070714_100512846 | |||
| 1213 | Ga0070713_100029423 | |||
| 1214 | Ga0070713_100114286 | |||
| 1215 | Ga0070713_100594243 | |||
| 1216 | Ga0070713_101108383 | |||
| 1217 | Ga0070710_10145350 | |||
| 1218 | Ga0070710_10347753 | |||
| 1219 | Ga0070701_10543217 | |||
| 1220 | Ga0070711_100215557 | |||
| 1221 | Ga0070705_100003771 | |||
| 1222 | Ga0070705_100045000 | |||
| 1223 | Ga0070705_100315915 | |||
| 1224 | Ga0070705_101075256 | |||
| 1225 | Ga0070705_101342046 | |||
| 1226 | Ga0070694_100018073 | |||
| 1227 | Ga0070694_100020899 | |||
| 1228 | Ga0070694_100581936 | |||
| 1229 | Ga0070708_100299681 | |||
| 1230 | Ga0070708_100757654 | |||
| 1231 | Ga0070663_100342264 | |||
| 1232 | Ga0070663_100533094 | |||
| 1233 | Ga0070678_100050944 | |||
| 1234 | Ga0070662_100024466 | |||
| 1235 | Ga0070662_100034689 | |||
| 1236 | Ga0070662_100166874 | |||
| 1237 | Ga0070662_100659583 | |||
| 1238 | Ga0070681_10001211 | |||
| 1239 | Ga0070681_10006154 | |||
| 1240 | Ga0070681_10024508 | |||
| 1241 | Ga0070681_10031476 | |||
| 1242 | Ga0070681_10068450 | |||
| 1243 | Ga0070681_10079201 | |||
| 1244 | Ga0070681_10117839 | |||
| 1245 | Ga0070681_10128247 | |||
| 1246 | Ga0070681_10216002 | |||
| 1247 | Ga0070681_10544970 | |||
| 1248 | Ga0070681_10650528 | |||
| 1249 | Ga0070706_100009634 | |||
| 1250 | Ga0070706_100036148 | |||
| 1251 | Ga0070706_100191202 | |||
| 1252 | Ga0070706_100428495 | |||
| 1253 | Ga0070706_100788749 | |||
| 1254 | Ga0070707_100087885 | |||
| 1255 | Ga0070707_100117452 | |||
| 1256 | Ga0070707_100547674 | |||
| 1257 | Ga0070707_101281840 | |||
| 1258 | Ga0070698_100006972 | |||
| 1259 | Ga0070698_100134600 | |||
| 1260 | Ga0070698_101538051 | |||
| 1261 | Ga0070699_100033968 | |||
| 1262 | Ga0070699_100139917 | |||
| 1263 | Ga0070699_100186211 | |||
| 1264 | Ga0070699_100700419 | |||
| 1265 | Ga0070699_101957396 | |||
| 1266 | Ga0070679_100005979 | |||
| 1267 | Ga0070679_100018501 | |||
| 1268 | Ga0070679_100101945 | |||
| 1269 | Ga0070679_100165307 | |||
| 1270 | Ga0070679_100192070 | |||
| 1271 | Ga0070679_100395151 | |||
| 1272 | Ga0070684_100003711 | |||
| 1273 | Ga0070684_100025315 | |||
| 1274 | Ga0070684_100107435 | |||
| 1275 | Ga0070684_100174590 | |||
| 1276 | Ga0070684_100338222 | |||
| 1277 | Ga0070684_100375674 | |||
| 1278 | Ga0070684_100520197 | |||
| 1279 | Ga0070697_100091492 | |||
| 1280 | Ga0070697_100315929 | |||
| 1281 | Ga0068853_100256877 | |||
| 1282 | Ga0068853_100337001 | |||
| 1283 | Ga0068853_100434617 | |||
| 1284 | Ga0068853_100652120 | |||
| 1285 | Ga0068853_100756774 | |||
| 1286 | Ga0068853_100915149 | |||
| 1287 | Ga0070686_101202754 | |||
| 1288 | Ga0070695_100014734 | |||
| 1289 | Ga0070695_100282335 | |||
| 1290 | Ga0070695_101000961 | |||
| 1291 | Ga0070696_100011162 | |||
| 1292 | Ga0070696_100060489 | |||
| 1293 | Ga0070696_100981743 | |||
| 1294 | Ga0070693_101366710 | |||
| 1295 | Ga0070665_100000142 | |||
| 1296 | Ga0070665_100072181 | |||
| 1297 | Ga0070704_100008285 | |||
| 1298 | Ga0070704_100247383 | |||
| 1299 | Ga0070704_100249105 | |||
| 1300 | Ga0070704_100389047 | |||
| 1301 | Ga0070704_100441332 | |||
| 1302 | Ga0068855_100036020 | |||
| 1303 | Ga0068855_100095467 | |||
| 1304 | Ga0068855_100130908 | |||
| 1305 | Ga0068855_100144957 | |||
| 1306 | Ga0068855_100196745 | |||
| 1307 | Ga0070664_100109893 | |||
| 1308 | Ga0068857_100036003 | |||
| 1309 | Ga0068857_100071265 | |||
| 1310 | Ga0068857_100186832 | |||
| 1311 | Ga0068857_100415318 | |||
| 1312 | Ga0068857_100444783 | |||
| 1313 | Ga0068854_100191026 | |||
| 1314 | Ga0068854_100863282 | |||
| 1315 | Ga0068856_100041648 | |||
| 1316 | Ga0068856_100058145 | |||
| 1317 | Ga0068856_100117044 | |||
| 1318 | Ga0068856_101719086 | |||
| 1319 | Ga0070702_100015906 | |||
| 1320 | Ga0070702_100950741 | |||
| 1321 | Ga0068852_100109972 | |||
| 1322 | Ga0068852_101746418 | |||
| 1323 | Ga0068852_102010131 | |||
| 1324 | Ga0068864_101489597 | |||
| 1325 | Ga0068866_10511614 | |||
| 1326 | Ga0068861_100174548 | |||
| 1327 | Ga0068861_100181348 | |||
| 1328 | Ga0068861_100185501 | |||
| 1329 | Ga0068861_100577336 | |||
| 1330 | Ga0068851_10741341 | |||
| 1331 | Ga0068870_10212321 | |||
| 1332 | Ga0068858_100728118 | |||
| 1333 | Ga0068858_100744286 | |||
| 1334 | Ga0068860_100656249 | |||
| 1335 | Ga0068862_100131447 | |||
| 1336 | Ga0081455_10017728 | |||
| 1337 | Ga0081455_10077687 | |||
| 1338 | Ga0081455_10635467 | |||
| 1339 | Ga0081538_10016843 | |||
| 1340 | Ga0081538_10047916 | |||
| 1341 | Ga0081538_10112208 | |||
| 1342 | Ga0081538_10148313 | |||
| 1343 | Ga0081538_10195083 | |||
| 1344 | Ga0081540_1004007 | |||
| 1345 | Ga0081539_10020311 | |||
| 1346 | Ga0081539_10030307 | |||
| 1347 | Ga0070717_10167785 | |||
| 1348 | Ga0070717_10229347 | |||
| 1349 | Ga0075365_10058287 | |||
| 1350 | Ga0075432_10059872 | |||
| 1351 | Ga0075432_10073276 | |||
| 1352 | Ga0075432_10176282 | |||
| 1353 | Ga0070715_10061469 | |||
| 1354 | Ga0070716_100006808 | |||
| 1355 | Ga0070712_100025054 | |||
| 1356 | Ga0070712_100048361 | |||
| 1357 | Ga0070712_100085325 | |||
| 1358 | Ga0070712_100115895 | |||
| 1359 | Ga0070712_100309241 | |||
| 1360 | Ga0070712_100546091 | |||
| 1361 | Ga0097621_100698197 | |||
| 1362 | Ga0068871_101333120 | |||
| 1363 | Ga0075428_100459735 | |||
| 1364 | Ga0075428_102454767 | |||
| 1365 | Ga0075430_100002108 | |||
| 1366 | Ga0075430_100810498 | |||
| 1367 | Ga0075431_100054564 | |||
| 1368 | Ga0075431_100197507 | |||
| 1369 | Ga0075431_101051129 | |||
| 1370 | Ga0075433_10033888 | |||
| 1371 | Ga0075433_10078996 | |||
| 1372 | Ga0075433_10519534 | |||
| 1373 | Ga0075433_10803364 | |||
| 1374 | Ga0075434_100005176 | |||
| 1375 | Ga0075434_100082259 | |||
| 1376 | Ga0075434_100271564 | |||
| 1377 | Ga0075434_100427497 | |||
| 1378 | Ga0075429_101096219 | |||
| 1379 | Ga0075429_101905878 | |||
| 1380 | Ga0068865_100168492 | |||
| 1381 | Ga0075436_100000947 | |||
| 1382 | Ga0075435_100002357 | |||
| 1383 | Ga0075435_100021556 | |||
| 1384 | Ga0075435_100030973 | |||
| 1385 | Ga0075435_100444515 | |||
| 1386 | Ga0105240_10286551 | |||
| 1387 | Ga0105240_10324900 | |||
| 1388 | Ga0105240_10393176 | |||
| 1389 | Ga0105240_11360004 | |||
| 1390 | Ga0111539_10007332 | |||
| 1391 | Ga0111539_10010679 | |||
| 1392 | Ga0111539_10159167 | |||
| 1393 | Ga0105245_10012746 | |||
| 1394 | Ga0105245_10122058 | |||
| 1395 | Ga0105245_10236379 | |||
| 1396 | Ga0105245_10262077 | |||
| 1397 | Ga0105245_10585833 | |||
| 1398 | Ga0105245_10660783 | |||
| 1399 | Ga0114129_10017065 | |||
| 1400 | Ga0114129_10039336 | |||
| 1401 | Ga0114129_10041692 | |||
| 1402 | Ga0114129_10189661 | |||
| 1403 | Ga0114129_10194674 | |||
| 1404 | Ga0114129_10269908 | |||
| 1405 | Ga0114129_10411492 | |||
| 1406 | Ga0114129_10568928 | |||
| 1407 | Ga0114129_10687902 | |||
| 1408 | Ga0114129_11293096 | |||
| 1409 | Ga0114129_12106237 | |||
| 1410 | Ga0105243_10075875 | |||
| 1411 | Ga0105243_10157419 | |||
| 1412 | Ga0105243_10214655 | |||
| 1413 | Ga0105243_10625258 | |||
| 1414 | Ga0105241_10458424 | |||
| 1415 | Ga0105242_10405602 | |||
| 1416 | Ga0105248_10024828 | |||
| 1417 | Ga0105237_10052617 | |||
| 1418 | Ga0105237_10126052 | |||
| 1419 | Ga0105237_10331478 | |||
| 1420 | Ga0105237_10812354 | |||
| 1421 | Ga0105238_10167719 | |||
| 1422 | Ga0105238_11004558 | |||
| 1423 | Ga0105238_11198556 | |||
| 1424 | Ga0105249_10010851 | |||
| 1425 | Ga0105249_10071305 | |||
| 1426 | Ga0105249_10153800 | |||
| 1427 | Ga0105249_10564101 | |||
| 1428 | Ga0105249_10938293 | |||
| 1429 | Ga0105239_10038088 | |||
| 1430 | Ga0105239_10195213 | |||
| 1431 | Ga0105239_10279255 | |||
| 1432 | Ga0105239_10428923 | |||
| 1433 | Ga0105239_10954450 | |||
| 1434 | Ga0105239_11643418 | |||
| 1435 | Ga0105239_11834665 | |||
| 1436 | Ga0105239_13085444 | |||
| 1437 | Ga0105246_10012450 | |||
| 1438 | Ga0105246_11186414 | |||
| 1439 | Ga0154010_174948 | |||
| 1440 | Ga0157373_10085393 | |||
| 1441 | Ga0157373_10433225 | |||
| 1442 | Ga0157371_10230787 | |||
| 1443 | Ga0157371_10421269 | |||
| 1444 | Ga0157370_10023626 | |||
| 1445 | Ga0157370_10132064 | |||
| 1446 | Ga0157370_10141219 | |||
| 1447 | Ga0157370_10180672 | |||
| 1448 | Ga0157370_10797802 | |||
| 1449 | Ga0157369_10019033 | |||
| 1450 | Ga0157369_10071417 | |||
| 1451 | Ga0157369_10179200 | |||
| 1452 | Ga0157369_10216570 | |||
| 1453 | Ga0157369_11064392 | |||
| 1454 | Ga0157374_10196026 | |||
| 1455 | Ga0157374_10961010 | |||
| 1456 | Ga0157378_11250738 | |||
| 1457 | Ga0163162_10155009 | |||
| 1458 | Ga0163162_10207142 | |||
| 1459 | Ga0157372_10034055 | |||
| 1460 | Ga0157372_10072877 | |||
| 1461 | Ga0157372_10140424 | |||
| 1462 | Ga0157372_10344712 | |||
| 1463 | Ga0157372_10383457 | |||
| 1464 | Ga0157372_10386050 | |||
| 1465 | Ga0157372_10396235 | |||
| 1466 | Ga0157372_10962358 | |||
| 1467 | Ga0157375_10213871 | |||
| 1468 | Ga0157375_10353724 | |||
| 1469 | Ga0157375_10385089 | |||
| 1470 | Ga0157375_10440914 | |||
| 1471 | Ga0157375_13353484 | |||
| 1472 | Ga0163163_10363098 | |||
| 1473 | Ga0157380_10625154 | |||
| 1474 | Ga0182008_10000487 | |||
| 1475 | Ga0182008_10285942 | |||
| 1476 | Ga0157377_10620612 | |||
| 1477 | Ga0182007_10010452 | |||
| 1478 | Ga0182007_10131856 | |||
| 1479 | Ga0163161_10090047 | |||
| 1480 | Ga0163161_10287801 | |||
| 1481 | Ga0206356_11060558 | |||
| 1482 | Ga0206356_11537578 | |||
| 1483 | Ga0206354_10308263 | |||
| 1484 | Ga0206354_10578468 | |||
| 1485 | Ga0206354_11268256 | |||
| 1486 | Ga0206354_11547566 | |||
| 1487 | Ga0206353_10116331 | |||
| 1488 | Ga0206353_10302908 | |||
| 1489 | Ga0206353_10850770 | |||
| 1490 | Ga0206353_10926494 | |||
| 1491 | Ga0206353_10938317 | |||
| 1492 | Ga0206353_11810256 | |||
| 1493 | Ga0207653_10005347 | |||
| 1494 | Ga0207692_10177496 | |||
| 1495 | Ga0207642_10060751 | |||
| 1496 | Ga0207685_10099454 | |||
| 1497 | Ga0207699_10029805 | |||
| 1498 | Ga0207699_10060017 | |||
| 1499 | Ga0207699_10194100 | |||
| 1500 | Ga0207699_10623354 | |||
| 1501 | Ga0207643_10074177 | |||
| 1502 | Ga0207705_10090402 | |||
| 1503 | Ga0207705_10113187 | |||
| 1504 | Ga0207705_10817174 | |||
| 1505 | Ga0207684_10000595 | |||
| 1506 | Ga0207684_10071641 | |||
| 1507 | Ga0207684_10138858 | |||
| 1508 | Ga0207684_10238457 | |||
| 1509 | Ga0207684_10249809 | |||
| 1510 | Ga0207684_10554929 | |||
| 1511 | Ga0207654_10127579 | |||
| 1512 | Ga0207707_10007562 | |||
| 1513 | Ga0207707_10031713 | |||
| 1514 | Ga0207707_10052819 | |||
| 1515 | Ga0207707_10055911 | |||
| 1516 | Ga0207707_10070608 | |||
| 1517 | Ga0207707_10070905 | |||
| 1518 | Ga0207707_10144845 | |||
| 1519 | Ga0207707_10235412 | |||
| 1520 | Ga0207695_10040640 | |||
| 1521 | Ga0207695_10171531 | |||
| 1522 | Ga0207695_10478732 | |||
| 1523 | Ga0207671_10076666 | |||
| 1524 | Ga0207671_10094543 | |||
| 1525 | Ga0207671_10624215 | |||
| 1526 | Ga0207693_10001581 | |||
| 1527 | Ga0207693_10004236 | |||
| 1528 | Ga0207693_10021377 | |||
| 1529 | Ga0207693_10035810 | |||
| 1530 | Ga0207693_10530506 | |||
| 1531 | Ga0207663_10002524 | |||
| 1532 | Ga0207663_10524872 | |||
| 1533 | Ga0207663_10814915 | |||
| 1534 | Ga0207660_10017445 | |||
| 1535 | Ga0207660_10017816 | |||
| 1536 | Ga0207660_10027344 | |||
| 1537 | Ga0207660_10087307 | |||
| 1538 | Ga0207660_10128402 | |||
| 1539 | Ga0207660_10272021 | |||
| 1540 | Ga0207660_10310095 | |||
| 1541 | Ga0207660_10387616 | |||
| 1542 | Ga0207660_10524030 | |||
| 1543 | Ga0207662_10391450 | |||
| 1544 | Ga0207657_10000054 | |||
| 1545 | Ga0207657_10003977 | |||
| 1546 | Ga0207657_10005514 | |||
| 1547 | Ga0207657_10011616 | |||
| 1548 | Ga0207657_10011988 | |||
| 1549 | Ga0207657_10037356 | |||
| 1550 | Ga0207657_10156420 | |||
| 1551 | Ga0207657_10588267 | |||
| 1552 | Ga0207649_10034276 | |||
| 1553 | Ga0207649_10039292 | |||
| 1554 | Ga0207649_10129540 | |||
| 1555 | Ga0207649_10408685 | |||
| 1556 | Ga0207649_10690636 | |||
| 1557 | Ga0207652_10004445 | |||
| 1558 | Ga0207652_10038262 | |||
| 1559 | Ga0207652_10040882 | |||
| 1560 | Ga0207652_10063362 | |||
| 1561 | Ga0207652_10111726 | |||
| 1562 | Ga0207652_10123670 | |||
| 1563 | Ga0207652_10135715 | |||
| 1564 | Ga0207652_10252087 | |||
| 1565 | Ga0207652_10876169 | |||
| 1566 | Ga0207646_10006870 | |||
| 1567 | Ga0207646_10205607 | |||
| 1568 | Ga0207646_10252758 | |||
| 1569 | Ga0207646_10527296 | |||
| 1570 | Ga0207681_10684717 | |||
| 1571 | Ga0207694_11323152 | |||
| 1572 | Ga0207687_10015768 | |||
| 1573 | Ga0207687_10043101 | |||
| 1574 | Ga0207687_10210682 | |||
| 1575 | Ga0207687_10354102 | |||
| 1576 | Ga0207687_10518585 | |||
| 1577 | Ga0207687_10923300 | |||
| 1578 | Ga0207700_10000006 | |||
| 1579 | Ga0207700_10379106 | |||
| 1580 | Ga0207700_10465286 | |||
| 1581 | Ga0207664_10024170 | |||
| 1582 | Ga0207664_10128676 | |||
| 1583 | Ga0207664_10133843 | |||
| 1584 | Ga0207664_10164041 | |||
| 1585 | Ga0207664_10345051 | |||
| 1586 | Ga0207664_10552500 | |||
| 1587 | Ga0207664_10628038 | |||
| 1588 | Ga0207644_11697620 | |||
| 1589 | Ga0207690_10035494 | |||
| 1590 | Ga0207690_10074440 | |||
| 1591 | Ga0207690_10147847 | |||
| 1592 | Ga0207690_10291788 | |||
| 1593 | Ga0207690_10413442 | |||
| 1594 | Ga0207690_11300703 | |||
| 1595 | Ga0207690_11386188 | |||
| 1596 | Ga0207706_10028155 | |||
| 1597 | Ga0207706_10268610 | |||
| 1598 | Ga0207706_10396740 | |||
| 1599 | Ga0207686_10316494 | |||
| 1600 | Ga0207709_10603517 | |||
| 1601 | Ga0207669_10019902 | |||
| 1602 | Ga0207665_10010466 | |||
| 1603 | Ga0207665_10034758 | |||
| 1604 | Ga0207665_10079012 | |||
| 1605 | Ga0207691_10141984 | |||
| 1606 | Ga0207711_10153738 | |||
| 1607 | Ga0207711_10483011 | |||
| 1608 | Ga0207689_10650157 | |||
| 1609 | Ga0207689_11175867 | |||
| 1610 | Ga0207661_10058628 | |||
| 1611 | Ga0207661_10283668 | |||
| 1612 | Ga0207661_10326308 | |||
| 1613 | Ga0207661_10399046 | |||
| 1614 | Ga0207661_11138459 | |||
| 1615 | Ga0207661_11536714 | |||
| 1616 | Ga0207679_10046972 | |||
| 1617 | Ga0207679_10891072 | |||
| 1618 | Ga0207667_10023514 | |||
| 1619 | Ga0207667_10066221 | |||
| 1620 | Ga0207667_10141333 | |||
| 1621 | Ga0207667_10175364 | |||
| 1622 | Ga0207667_10196978 | |||
| 1623 | Ga0207667_10831886 | |||
| 1624 | Ga0207667_10857212 | |||
| 1625 | Ga0207712_10041383 | |||
| 1626 | Ga0207712_10042305 | |||
| 1627 | Ga0207712_10171094 | |||
| 1628 | Ga0207712_10346154 | |||
| 1629 | Ga0207712_10650795 | |||
| 1630 | Ga0207668_10200428 | |||
| 1631 | Ga0207668_10356110 | |||
| 1632 | Ga0207668_10695739 | |||
| 1633 | Ga0207640_10028669 | |||
| 1634 | Ga0207640_10073364 | |||
| 1635 | Ga0207640_10456106 | |||
| 1636 | Ga0207640_10824017 | |||
| 1637 | Ga0207640_11094706 | |||
| 1638 | Ga0207677_10037372 | |||
| 1639 | Ga0207677_10869014 | |||
| 1640 | Ga0207677_11521322 | |||
| 1641 | Ga0207677_11760576 | |||
| 1642 | Ga0207703_10607933 | |||
| 1643 | Ga0207639_10240708 | |||
| 1644 | Ga0207639_10385106 | |||
| 1645 | Ga0207639_10495588 | |||
| 1646 | Ga0207639_10564102 | |||
| 1647 | Ga0207639_10602056 | |||
| 1648 | Ga0207639_11560812 | |||
| 1649 | Ga0207678_10611761 | |||
| 1650 | Ga0207708_10218915 | |||
| 1651 | Ga0207708_10266663 | |||
| 1652 | Ga0207708_10618096 | |||
| 1653 | Ga0207708_11111129 | |||
| 1654 | Ga0207702_10037364 | |||
| 1655 | Ga0207702_10061916 | |||
| 1656 | Ga0207702_10516857 | |||
| 1657 | Ga0207702_10583072 | |||
| 1658 | Ga0207702_10932911 | |||
| 1659 | Ga0207641_10433505 | |||
| 1660 | Ga0207648_10721958 | |||
| 1661 | Ga0207648_10752708 | |||
| 1662 | Ga0207676_10266344 | |||
| 1663 | Ga0207674_10006223 | |||
| 1664 | Ga0207674_10059284 | |||
| 1665 | Ga0207674_10107454 | |||
| 1666 | Ga0207674_10112588 | |||
| 1667 | Ga0207674_10292048 | |||
| 1668 | Ga0207674_10508544 | |||
| 1669 | Ga0207675_100030764 | |||
| 1670 | Ga0207675_100061187 | |||
| 1671 | Ga0207675_100096696 | |||
| 1672 | Ga0207675_100520179 | |||
| 1673 | Ga0207683_10011124 | |||
| 1674 | Ga0207683_10815666 | |||
| 1675 | Ga0207683_11780766 | |||
| 1676 | Ga0209998_10009501 | |||
| 1677 | Ga0207428_10000551 | |||
| 1678 | Ga0207428_10009220 | |||
| 1679 | Ga0207428_10038045 | |||
| 1680 | Ga0268266_10000081 | |||
| 1681 | Ga0268266_10236597 | |||
| 1682 | Ga0268265_10278422 | |||
| 1683 | Ga0268264_10353395 | |||
| 1684 | Ga0268264_10463017 | |||
| 1685 | Ga0265326_10084701 | |||
| 1686 | Ga0265319_1152429 | |||
| 1687 | Ga0265318_10018736 | |||
| 1688 | Ga0265318_10038357 | |||
| 1689 | Ga0265318_10159727 | |||
| 1690 | Ga0265323_10084124 | |||
| 1691 | Ga0265322_10011308 | |||
| 1692 | Ga0265338_10013856 | |||
| 1693 | Ga0265338_10045873 | |||
| 1694 | Ga0265338_10060846 | |||
| 1695 | Ga0265330_10074404 | |||
| 1696 | Ga0265332_10049793 | |||
| 1697 | Ga0265325_10042525 | |||
| 1698 | Ga0265329_10073297 | |||
| 1699 | Ga0265340_10030522 | |||
| 1700 | Ga0265340_10175885 | |||
| 1701 | Ga0265339_10007462 | |||
| 1702 | Ga0265339_10090713 | |||
| 1703 | Ga0265331_10068331 | |||
| 1704 | Ga0265331_10170982 | |||
| 1705 | Ga0265327_10003047 | |||
| 1706 | Ga0265327_10076032 | |||
| 1707 | Ga0265316_10002206 | |||
| 1708 | Ga0265316_10066278 | |||
| 1709 | Ga0265316_10643000 | |||
| 1710 | Ga0265316_10879438 | |||
| 1711 | Ga0307408_100010016 | |||
| 1712 | Ga0307408_100183990 | |||
| 1713 | Ga0307408_100243604 | |||
| 1714 | Ga0265313_10061225 | |||
| 1715 | Ga0265314_10003413 | |||
| 1716 | Ga0265314_10032486 | |||
| 1717 | Ga0265314_10086123 | |||
| 1718 | Ga0265342_10069720 | |||
| 1719 | Ga0307405_10005839 | |||
| 1720 | Ga0307405_10012720 | |||
| 1721 | Ga0307405_11198283 | |||
| 1722 | Ga0307413_10002950 | |||
| 1723 | Ga0307413_10077315 | |||
| 1724 | Ga0307413_11540270 | |||
| 1725 | Ga0307410_10002995 | |||
| 1726 | Ga0307410_10062021 | |||
| 1727 | Ga0307410_11443735 | |||
| 1728 | Ga0307406_10002763 | |||
| 1729 | Ga0307406_10116774 | |||
| 1730 | Ga0307406_10189494 | |||
| 1731 | Ga0307406_10853611 | |||
| 1732 | Ga0307407_10004116 | |||
| 1733 | Ga0307407_10097586 | |||
| 1734 | Ga0307407_10916440 | |||
| 1735 | Ga0307412_11177375 | |||
| 1736 | Ga0307409_100009005 | |||
| 1737 | Ga0307409_100011218 | |||
| 1738 | Ga0307409_100294676 | |||
| 1739 | Ga0307409_100394792 | |||
| 1740 | Ga0307409_100472312 | |||
| 1741 | Ga0307409_100703459 | |||
| 1742 | Ga0307409_101369944 | |||
| 1743 | Ga0307416_100001425 | |||
| 1744 | Ga0307416_100021273 | |||
| 1745 | Ga0307416_100043845 | |||
| 1746 | Ga0307414_10171377 | |||
| 1747 | Ga0307414_10489136 | |||
| 1748 | Ga0307414_10964300 | |||
| 1749 | Ga0307411_10003163 | |||
| 1750 | Ga0307411_10791480 | |||
| 1751 | Ga0307415_100000286 | |||
| 1752 | Ga0307415_100004173 | |||
| 1753 | Ga0307415_100347416 | |||
| 1754 | Ga0373930_0018229 | |||
| 1755 | Ga0373948_0007410 | |||
| 1756 | Ga0373948_0077709 | |||
| 1757 | Ga0373950_0002783 | |||
| 1758 | Ga0373958_0002498 | |||
| 1759 | Ga0373938_0003711 | |||
| 1760 | Ga0373928_0014717 | |||
| 1761 | Ga0373928_0179446 | |||
| 1762 | Ga0373929_0019235 | |||
| 1763 | Ga0373949_0002911 | |||
| 1764 | Ga0373951_0012208 | |||
| 1765 | Ga0373952_0004699 | |||
| 1766 | Ga0373932_0002305 | |||
| 1767 | Ga0373939_0000998 | |||
| 1768 | Ga0373939_0032710 | |||
| 1769 | Ga0373939_0033574 | |||
| 1770 | Ga0373941_0011207 | |||
| 1771 | Ga0373941_0059477 | |||
| 1772 | Ga0373960_0000459 | |||
| 1773 | Ga0373943_0031688 | |||
| 1774 | Ga0373942_0004263 | |||
| 1775 | Ga0373961_0007365 | |||
| 1776 | Ga0373961_0153153 | |||
| 1777 | Ga0373962_0011891 | |||
| 1778 | Ga0316574_0164656 | |||
| 1779 | Ga0373931_0005838 | |||
| 1780 | Ga0373931_0062040 | |||
| 1781 | Ga0373931_0140921 | |||
| 1782 | Ga0373931_0865138 | |||
| 1783 | Ga0373935_0083041 | |||
| 1784 | Ga0373937_0087073 | |||
| 1785 | Ga0395899_0001614 | |||
| 1786 | Ga0395899_0003283 | |||
| 1787 | Ga0395899_0014311 | |||
| 1788 | Ga0395899_0016263 | |||
| 1789 | Ga0395899_0025572 | |||
| 1790 | Ga0395899_0027903 | |||
| 1791 | Ga0395899_0039999 | |||
| 1792 | Ga0395899_0106454 | |||
| 1793 | Ga0395899_0109783 | |||
| 1794 | Ga0395899_0119318 | |||
| 1795 | Ga0395899_0234401 | |||
| 1796 | Ga0395900_0004680 | |||
| 1797 | Ga0395900_0005323 | |||
| 1798 | Ga0395900_0010115 | |||
| 1799 | Ga0395900_0016923 | |||
| 1800 | Ga0395900_0018889 | |||
| 1801 | Ga0395900_0044318 | |||
| 1802 | Ga0395900_0049100 | |||
| 1803 | Ga0395900_0066125 | |||
| 1804 | Ga0395900_0073000 | |||
| 1805 | Ga0395900_0081470 | |||
| 1806 | Ga0395900_0085975 | |||
| 1807 | Ga0395900_0126305 | |||
| 1808 | Ga0395900_0131713 | |||
| 1809 | Ga0395900_0143157 | |||
| 1810 | Ga0395900_0193215 | |||
| 1811 | Ga0395900_0228390 | |||
| 1812 | Ga0395900_0346593 | |||
| 1813 | Ga0395900_0444000 | |||
| 1814 | Ga0395900_0583789 | |||
| 1815 | Ga0395900_0640890 | |||
| 1816 | Ga0395900_0645091 | |||
| 1817 | Ga0395900_0755906 | |||
| 1818 | Ga0395900_1065083 | |||
| 1819 | Ga0395900_1465796 | |||
| 1820 | Ga0395900_1619754 | |||
| 1821 | Ga0395898_0002616 | |||
| 1822 | Ga0395898_0005906 | |||
| 1823 | Ga0395898_0007257 | |||
| 1824 | Ga0395898_0019563 | |||
| 1825 | Ga0395898_0025937 | |||
| 1826 | Ga0395898_0032324 | |||
| 1827 | Ga0395898_0052482 | |||
| 1828 | Ga0395898_0070467 | |||
| 1829 | Ga0395898_0101435 | |||
| 1830 | Ga0395898_0104976 | |||
| 1831 | Ga0395898_0111475 | |||
| 1832 | Ga0395898_0149383 | |||
| 1833 | Ga0395898_0218653 | |||
| 1834 | Ga0395898_0291240 | |||
| 1835 | Ga0395898_0309631 | |||
| 1836 | Ga0395898_0382788 | |||
| 1837 | Ga0395898_0405998 | |||
| 1838 | Ga0395898_0432054 | |||
| 1839 | Ga0395898_0655311 | |||
| 1840 | Ga0395898_0668770 | |||
| 1841 | Ga0395898_0693237 | |||
| 1842 | Ga0395898_0826227 | |||
| 1843 | Ga0395898_1272535 | |||
| 1844 | Ga0395898_1421871 | |||
| 1845 | Ga0395905_0003496 | |||
| 1846 | Ga0395905_0005495 | |||
| 1847 | Ga0395905_0014937 | |||
| 1848 | Ga0395905_0038630 | |||
| 1849 | Ga0395905_0040078 | |||
| 1850 | Ga0395905_0060423 | |||
| 1851 | Ga0395905_0062432 | |||
| 1852 | Ga0395905_0065218 | |||
| 1853 | Ga0395905_0068291 | |||
| 1854 | Ga0395905_0189724 | |||
| 1855 | Ga0395905_0269829 | |||
| 1856 | Ga0395905_0272117 | |||
| 1857 | Ga0395905_0332078 | |||
| 1858 | Ga0395905_0366612 | |||
| 1859 | Ga0395905_0485167 | |||
| 1860 | Ga0395905_0506479 | |||
| 1861 | Ga0395905_0585392 | |||
| 1862 | Ga0395905_1053075 | |||
| 1863 | Ga0395905_1083119 | |||
| 1864 | Ga0395905_1097162 | |||
| 1865 | Ga0395905_1180477 | |||
| 1866 | Ga0436364_0871138 | |||
| 1867 | Ga0395901_0000744 | |||
| 1868 | Ga0395901_0001394 | |||
| 1869 | Ga0395901_0001686 | |||
| 1870 | Ga0395901_0002239 | |||
| 1871 | Ga0395901_0005425 | |||
| 1872 | Ga0395901_0014181 | |||
| 1873 | Ga0395901_0038084 | |||
| 1874 | Ga0395901_0044163 | |||
| 1875 | Ga0395901_0091307 | |||
| 1876 | Ga0395901_0109199 | |||
| 1877 | Ga0395901_0132957 | |||
| 1878 | Ga0395901_0150080 | |||
| 1879 | Ga0395901_0177981 | |||
| 1880 | Ga0395901_0186485 | |||
| 1881 | Ga0395901_0194979 | |||
| 1882 | Ga0395901_0305475 | |||
| 1883 | Ga0395901_0321460 | |||
| 1884 | Ga0395901_0602370 | |||
| 1885 | Ga0395901_0637690 | |||
| 1886 | Ga0395901_0657083 | |||
| 1887 | Ga0395901_2030419 | |||
| 1888 | Ga0436365_0391299 | |||
| 1889 | Ga0436365_1592653 | |||
| 1890 | Ga0436363_1209816 | |||
| 1891 | Ga0436363_1414311 | |||
| 1892 | Ga0436363_1590339 | |||
| 1893 | Ga0439461_0135203 | |||
| 1894 | Ga0451839_0381197 | |||
| 1895 | Ga0451851_0997760 | |||
| 1896 | Ga0451853_0445709 | |||
| 1897 | Ga0451853_0502246 | |||
| 1898 | Ga0451853_0894815 | |||
| 1899 | Ga0439448_0014578 | |||
| 1900 | Ga0439450_046628 | |||
| 1901 | Ga0450906_045499 | |||
| 1902 | Ga0439458_0178262 | |||
| 1903 | Ga0439460_0250993 | |||
| 1904 | Ga0466969_0174737 | |||
| 1905 | Ga0466966_0043026 | |||
| 1906 | Ga0466961_0129780 | |||
| 1907 | Ga0466963_0020255 | |||
| 1908 | Ga0466963_0034424 | |||
| 1909 | Ga0466963_0079065 | |||
| 1910 | Ga0466963_0578936 | |||
| 1911 | Ga0466964_0001299 | |||
| 1912 | Ga0466964_0011257 | |||
| 1913 | Ga0466964_0237287 | |||
| 1914 | Ga0466971_0343242 | |||
| 1915 | Ga0466968_0013261 | |||
| 1916 | Ga0466957_0201946 | |||
| 1917 | Ga0466957_0235344 | |||
| 1918 | Ga0466957_0307065 | |||
| 1919 | Ga0466957_0398776 | |||
| 1920 | Ga0466957_0460361 | |||
| 1921 | Ga0466960_0067728 | |||
| 1922 | Ga0466960_0123435 | |||
| 1923 | Ga0466959_0003201 | |||
| 1924 | Ga0451576_0025325 | |||
| 1925 | Ga0451576_0235236 | |||
| 1926 | Ga0451576_0238671 | |||
| 1927 | Ga0466958_0103604 | |||
| 1928 | Ga0466958_0255350 | |||
| 1929 | Ga0466958_0321918 | |||
| 1930 | Ga0466958_0416601 | |||
| 1931 | Ga0466967_0000440 | |||
| 1932 | Ga0466967_0029993 | |||
| 1933 | Ga0466967_0040177 | |||
| 1934 | Ga0466967_0049004 | |||
| 1935 | Ga0466967_0075564 | |||
| 1936 | Ga0466967_0174798 | |||
| 1937 | Ga0466967_0314038 | |||
| 1938 | Ga0466967_0362397 | |||
| 1939 | Ga0466967_0405677 | |||
| 1940 | Ga0466967_0491357 | |||
| 1941 | Ga0466967_0495326 | |||
| 1942 | Ga0466967_0657990 | |||
| 1943 | Ga0466967_0811046 | |||
| 1944 | Ga0466967_0989259 | |||
| 1945 | Ga0466967_1598418 | |||
| 1946 | Ga0466967_1731651 | |||
| 1947 | Ga0466967_1857199 | |||
| 1948 | Ga0495591_056587 | |||
| 1949 | Ga0495629_0284204 | |||
| 1950 | Ga0495629_0303633 | |||
| 1951 | Ga0495638_0571952 | |||
| 1952 | Ga0495641_0033614 | |||
| 1953 | Ga0495641_0093315 | |||
| 1954 | Ga0495641_0240345 | |||
| 1955 | Ga0495651_0099706 | |||
| 1956 | Ga0495651_0549510 | |||
| 1957 | Ga0495651_0561052 | |||
| 1958 | Ga0495653_0073227 | |||
| 1959 | Ga0495582_0365606 | |||
| 1960 | Ga0495582_0560320 | |||
| 1961 | Ga0495605_0059424 | |||
| 1962 | Ga0495605_0161092 | |||
| 1963 | Ga0495605_0274673 | |||
| 1964 | Ga0495639_0448072 | |||
| 1965 | Ga0495639_0554059 | |||
| 1966 | Ga0495584_0055035 | |||
| 1967 | Ga0495584_0071372 | |||
| 1968 | Ga0495584_0150913 | |||
| 1969 | Ga0495584_0171194 | |||
| 1970 | Ga0495584_0192627 | |||
| 1971 | Ga0495584_0304288 | |||
| 1972 | Ga0495584_0332782 | |||
| 1973 | Ga0495585_0131851 | |||
| 1974 | Ga0495596_0074957 | |||
| 1975 | Ga0495596_0334515 | |||
| 1976 | Ga0495608_0117136 | |||
| 1977 | Ga0495620_0103725 | |||
| 1978 | Ga0495630_0063267 | |||
| 1979 | Ga0495630_0101602 | |||
| 1980 | Ga0495631_0201316 | |||
| 1981 | Ga0495632_0341808 | |||
| 1982 | Ga0495637_0064001 | |||
| 1983 | Ga0495644_0130580 | |||
| 1984 | Ga0495644_0150737 | |||
| 1985 | Ga0495663_0023132 | |||
| 1986 | Ga0495663_0041814 | |||
| 1987 | Ga0495642_0100070 | |||
| 1988 | Ga0495642_0231845 | |||
| 1989 | Ga0495642_0274694 | |||
| 1990 | Ga0495652_0142926 | |||
| 1991 | Ga0495652_0416419 | |||
| 1992 | Ga0495652_0529233 | |||
| 1993 | Ga0495654_0083258 | |||
| 1994 | Ga0495640_0409083 | |||
| 1995 | Ga0495586_0059389 | |||
| 1996 | Ga0495587_0598103 | |||
| 1997 | Ga0495598_0102051 | |||
| 1998 | Ga0495609_0053530 | |||
| 1999 | Ga0495609_0216168 | |||
| 2000 | Ga0495621_0031666 | |||
| 2001 | Ga0495645_0521355 | |||
| 2002 | Ga0495667_0074628 | |||
| 2003 | Ga0495656_0063740 | |||
| 2004 | Ga0495656_0071083 | |||
| 2005 | Ga0495656_0215078 | |||
| 2006 | Ga0495668_0361926 | |||
| 2007 | Ga0495668_0407645 | |||
| 2008 | Ga0495634_0056762 | |||
| 2009 | Ga0495611_0054307 | |||
| 2010 | Ga0495611_0189665 | |||
| 2011 | Ga0495625_0537379 | |||
| 2012 | Ga0495635_0427188 | |||
| 2013 | Ga0495659_0002526 | |||
| 2014 | Ga0495659_0002767 | |||
| 2015 | Ga0495659_0401102 | |||
| 2016 | Ga0495661_0290585 | |||
| 2017 | Ga0495661_0526390 | |||
| 2018 | Ga0495657_0425758 | |||
| 2019 | Ga0495657_0443279 | |||
| 2020 | Ga0495657_0703588 | |||
| 2021 | Ga0495599_0122154 | |||
| 2022 | Ga0495599_0205190 | |||
| 2023 | Ga0495599_0481515 | |||
| 2024 | Ga0495599_0539669 | |||
| 2025 | Ga0495623_0223598 | |||
| 2026 | Ga0495647_0104093 | |||
| 2027 | Ga0495658_0073103 | |||
| 2028 | Ga0495658_0266198 | |||
| 2029 | Ga0495658_0994874 | |||
| 2030 | Ga0495669_0248301 | |||
| 2031 | Ga0495613_0641869 | |||
| 2032 | Ga0495613_0646903 | |||
| 2033 | Ga0495613_0882208 | |||
| 2034 | Ga0495670_0350016 | |||
| 2035 | Ga0495671_0323506 | |||
| 2036 | Ga0495589_0156513 | |||
| 2037 | Ga0495589_0161345 | |||
| 2038 | Ga0495589_0199337 | |||
| 2039 | Ga0495589_0235671 | |||
| 2040 | Ga0495600_0395794 | |||
| 2041 | Ga0495600_0567940 | |||
| 2042 | Ga0495581_0219271 | |||
| 2043 | Ga0495604_0539361 | |||
| 2044 | Ga0495676_1047527 | |||
| 2045 | Ga0495680_0134301 | |||
| 2046 | Ga0495683_0138622 | |||
| 2047 | Ga0495683_0395180 | |||
| 2048 | Ga0495677_0187729 | |||
| 2049 | Ga0495685_072911 | |||
| 2050 | Ga0495684_0330206 | |||
| 2051 | Ga0496100_0004854 | |||
| 2052 | Ga0496100_0029788 | |||
| 2053 | Ga0496100_0042219 | |||
| 2054 | Ga0496100_0109415 | |||
| 2055 | Ga0496100_0129304 | |||
| 2056 | Ga0496100_1220653 | |||
| 2057 | Ga0496100_1334287 | |||
| 2058 | Ga0496101_0004861 | |||
| 2059 | Ga0496101_0071942 | |||
| 2060 | Ga0496101_0144838 | |||
| 2061 | Ga0496101_0153005 | |||
| 2062 | Ga0496101_0442174 | |||
| 2063 | Ga0496101_0468301 | |||
| 2064 | Ga0496102_0018069 | |||
| 2065 | Ga0496102_0039707 | |||
| 2066 | Ga0496102_0181864 | |||
| 2067 | Ga0496102_0187419 | |||
| 2068 | Ga0496102_0368080 | |||
| 2069 | Ga0496102_0500024 | |||
| 2070 | Ga0496102_0511136 | |||
| 2071 | Ga0496102_1050091 | |||
| 2072 | Ga0496103_0055918 | |||
| 2073 | Ga0496103_0075386 | |||
| 2074 | Ga0496103_0100145 | |||
| 2075 | Ga0496103_0161799 | |||
| 2076 | Ga0496103_0340742 | |||
| 2077 | Ga0496103_0460412 | |||
| 2078 | Ga0496103_0583137 | |||
| 2079 | Ga0496104_0024445 | |||
| 2080 | Ga0496104_0027429 | |||
| 2081 | Ga0496104_0056269 | |||
| 2082 | Ga0496104_0059751 | |||
| 2083 | Ga0496104_0097950 | |||
| 2084 | Ga0496105_0000362 | |||
| 2085 | Ga0496105_0006218 | |||
| 2086 | Ga0496105_0007486 | |||
| 2087 | Ga0496105_0024596 | |||
| 2088 | Ga0496105_0728031 | |||
| 2089 | Ga0496106_0008454 | |||
| 2090 | Ga0496106_0025194 | |||
| 2091 | Ga0496106_0094409 | |||
| 2092 | Ga0496106_0106130 | |||
| 2093 | Ga0496106_0525933 | |||
| 2094 | Ga0496107_0029355 | |||
| 2095 | Ga0496107_0045645 | |||
| 2096 | Ga0496107_0054716 | |||
| 2097 | Ga0496107_0086712 | |||
| 2098 | Ga0496107_0201704 | |||
| 2099 | Ga0496107_0282598 | |||
| 2100 | Ga0496107_0433753 | |||
| 2101 | Ga0496107_0502089 | |||
| 2102 | Ga0496107_0555385 | |||
| 2103 | Ga0496108_0003918 | |||
| 2104 | Ga0496108_0004739 | |||
| 2105 | Ga0496108_0049211 | |||
| 2106 | Ga0496108_0102220 | |||
| 2107 | Ga0496108_0110036 | |||
| 2108 | Ga0496108_0183025 | |||
| 2109 | Ga0496108_0332960 | |||
| 2110 | Ga0496108_0525167 | |||
| 2111 | Ga0496109_0004197 | |||
| 2112 | Ga0496109_0009486 | |||
| 2113 | Ga0496109_0013491 | |||
| 2114 | Ga0496109_0070870 | |||
| 2115 | Ga0496109_0080397 | |||
| 2116 | Ga0496109_0089241 | |||
| 2117 | Ga0496109_0090901 | |||
| 2118 | Ga0496109_0109270 | |||
| 2119 | Ga0496109_0434561 | |||
| 2120 | Ga0496109_1343413 | |||
| 2121 | Ga0496110_0002026 | |||
| 2122 | Ga0496110_0004908 | |||
| 2123 | Ga0496110_0012389 | |||
| 2124 | Ga0496110_0039758 | |||
| 2125 | Ga0496110_0049929 | |||
| 2126 | Ga0496110_0172781 | |||
| 2127 | Ga0496110_0294973 | |||
| 2128 | Ga0496110_0409318 | |||
| 2129 | Ga0496110_1825587 | |||
| 2130 | Ga0496111_0000234 | |||
| 2131 | Ga0496111_0024062 | |||
| 2132 | Ga0496111_0077048 | |||
| 2133 | Ga0496111_0146812 | |||
| 2134 | Ga0496111_0162502 | |||
| 2135 | Ga0496111_0216613 | |||
| 2136 | Ga0496111_0316027 | |||
| 2137 | Ga0496111_0859554 | |||
| 2138 | Ga0496112_0008602 | |||
| 2139 | Ga0496112_0048339 | |||
| 2140 | Ga0496112_0083854 | |||
| 2141 | Ga0496112_0170361 | |||
| 2142 | Ga0496112_0496639 | |||
| 2143 | Ga0496112_0538607 | |||
| 2144 | Ga0496112_0654208 | |||
| 2145 | Ga0496112_0733247 | |||
| 2146 | Ga0496112_0880070 | |||
| 2147 | Ga0496112_1178217 | |||
| 2148 | Ga0496113_0004778 | |||
| 2149 | Ga0496113_0090832 | |||
| 2150 | Ga0496113_0102804 | |||
| 2151 | Ga0496113_0119808 | |||
| 2152 | Ga0496113_0289671 | |||
| 2153 | Ga0496113_0534534 | |||
| 2154 | Ga0496113_0559567 | |||
| 2155 | Ga0496113_0653127 | |||
| 2156 | Ga0496113_0982998 | |||
| 2157 | Ga0496113_1090813 | |||
| 2158 | Ga0496114_0008661 | |||
| 2159 | Ga0496114_0025592 | |||
| 2160 | Ga0496114_0052175 | |||
| 2161 | Ga0496114_0092542 | |||
| 2162 | Ga0496114_0112924 | |||
| 2163 | Ga0496114_0113075 | |||
| 2164 | Ga0496114_0952694 | |||
| 2165 | Ga0496114_0992694 | |||
| 2166 | Ga0496114_1047833 | |||
| 2167 | Ga0496114_1373804 | |||
| 2168 | Ga0496115_0006662 | |||
| 2169 | Ga0496115_0035182 | |||
| 2170 | Ga0496115_0283998 | |||
| 2171 | Ga0496115_0675028 | |||
| 2172 | Ga0501031_0005539 | |||
| 2173 | Ga0501032_0846496 | |||
| 2174 | Ga0501033_0089532 | |||
| 2175 | Ga0501033_0209922 | |||
| 2176 | Ga0501034_0022281 | |||
| 2177 | Ga0501034_0312104 | |||
| 2178 | Ga0501034_0506786 | |||
| 2179 | Ga0501036_0362841 | |||
| 2180 | Ga0501038_0326396 | |||
| 2181 | Ga0501038_0359966 | |||
| 2182 | Ga0501039_0029160 | |||
| 2183 | Ga0501039_0617783 | |||
| 2184 | Ga0501040_0077248 | |||
| 2185 | Ga0501040_0097892 | |||
| 2186 | Ga0501040_0340948 | |||
| 2187 | Ga0501040_0350231 | |||
| 2188 | Ga0501040_0411289 | |||
| 2189 | Ga0501041_0037607 | |||
| 2190 | Ga0501041_0327737 | |||
| 2191 | Ga0501042_0101102 | |||
| 2192 | Ga0501042_0103146 | |||
| 2193 | Ga0501042_0188294 | |||
| 2194 | Ga0501042_0674274 | |||
| 2195 | Ga0501046_0121636 | |||
| 2196 | Ga0501046_0218106 | |||
| 2197 | Ga0501048_0065397 | |||
| 2198 | Ga0501048_0388624 | |||
| 2199 | Ga0501067_0000516 | |||
| 2200 | Ga0501067_0002005 | |||
| 2201 | Ga0501067_0013292 | |||
| 2202 | Ga0501067_0106281 | |||
| 2203 | Ga0501067_0560960 | |||
| 2204 | Ga0501068_0061002 | |||
| 2205 | Ga0501068_0101621 | |||
| 2206 | Ga0501068_0106001 | |||
| 2207 | Ga0501068_0127574 | |||
| 2208 | Ga0501068_0137718 | |||
| 2209 | Ga0501068_0212395 | |||
| 2210 | Ga0501069_0002134 | |||
| 2211 | Ga0501069_0005912 | |||
| 2212 | Ga0501069_0009763 | |||
| 2213 | Ga0501069_0091708 | |||
| 2214 | Ga0501069_0091958 | |||
| 2215 | Ga0501069_0197710 | |||
| 2216 | Ga0501070_0101991 | |||
| 2217 | Ga0501070_0229662 | |||
| 2218 | Ga0501070_0462373 | |||
| 2219 | Ga0501070_1027226 | |||
| 2220 | Ga0501071_0347474 | |||
| 2221 | Ga0501072_0053709 | |||
| 2222 | Ga0501072_0346053 | |||
| 2223 | Ga0501072_0954676 | |||
| 2224 | Ga0501074_0050935 | |||
| 2225 | Ga0501074_0237438 | |||
| 2226 | Ga0501074_0435217 | |||
| 2227 | Ga0501075_0001511 | |||
| 2228 | Ga0501075_0252956 | |||
| 2229 | Ga0501075_0274193 | |||
| 2230 | Ga0501075_0347315 | |||
| 2231 | Ga0501076_0086706 | |||
| 2232 | Ga0501076_0182798 | |||
| 2233 | Ga0501076_0480063 | |||
| 2234 | Ga0501076_0884446 | |||
| 2235 | Ga0501077_0013534 | |||
| 2236 | Ga0501077_0025788 | |||
| 2237 | Ga0501077_0077243 | |||
| 2238 | Ga0501077_0802151 | |||
| 2239 | Ga0501079_0053626 | |||
| 2240 | Ga0501079_0135589 | |||
| 2241 | Ga0501079_0171800 | |||
| 2242 | Ga0501079_0364694 | |||
| 2243 | Ga0501080_0051650 | |||
| 2244 | Ga0501080_0054010 | |||
| 2245 | Ga0501081_0014393 | |||
| 2246 | Ga0501081_0068523 | |||
| 2247 | Ga0501081_0073390 | |||
| 2248 | Ga0501081_0260113 | |||
| 2249 | Ga0501081_0471865 | |||
| 2250 | Ga0501081_0676490 | |||
| 2251 | Ga0501081_0695485 | |||
| 2252 | Ga0501083_0044613 | |||
| 2253 | Ga0501083_0789379 | |||
| 2254 | Ga0501035_0221553 | |||
| 2255 | Ga0501035_0700708 | |||
| 2256 | Ga0501044_0716125 | |||
| 2257 | Ga0501045_0026802 | |||
| 2258 | Ga0501045_0105902 | |||
| 2259 | Ga0501045_0339917 | |||
| 2260 | Ga0501045_0536261 | |||
| 2261 | nmdc:mga03683_209626_c1 | |||
| 2262 | nmdc:mga0yw44_84245_c1 | |||
| 2263 | nmdc:mga05p37_198233_c1 | |||
| 2264 | nmdc:mga05p37_22096_c1 | |||
| 2265 | nmdc:mga05p37_222809_c1 | |||
| 2266 | nmdc:mga05p37_311590_c1 | |||
| 2267 | nmdc:mga05p37_373966_c1 | |||
| 2268 | nmdc:mga05p37_476221_c1 | |||
| 2269 | nmdc:mga05p37_51857_c1 | |||
| 2270 | nmdc:mga05p37_912398_c1 | |||
| 2271 | nmdc:mga05p37_95829_c1 | |||
| 2272 | nmdc:mga09592_110903_c1 | |||
| 2273 | nmdc:mga09592_1238188_c1 | |||
| 2274 | nmdc:mga09592_808836_c1 | |||
| 2275 | nmdc:mga0qj67_70230_c1 | |||
| 2276 | nmdc:mga06r32_10292_c1 | |||
| 2277 | nmdc:mga06r32_35917_c1 | |||
| 2278 | nmdc:mga06r32_839059_c1 | |||
| 2279 | nmdc:mga08y16_1277_c1 | |||
| 2280 | nmdc:mga08y16_128055_c1 | |||
| 2281 | nmdc:mga08y16_152954_c1 | |||
| 2282 | nmdc:mga08y16_16896_c1 | |||
| 2283 | nmdc:mga0n895_18537_c1 | |||
| 2284 | nmdc:mga0n895_355298_c1 | |||
| 2285 | nmdc:mga0n895_59212_c1 | |||
| 2286 | nmdc:mga0n895_746982_c1 | |||
| 2287 | nmdc:mga0n895_81554_c1 | |||
| 2288 | nmdc:mga0n895_907474_c1 | |||
| 2289 | nmdc:mga0rr50_11683_c1 | |||
| 2290 | nmdc:mga0rr50_22577_c1 | |||
| 2291 | nmdc:mga0rr50_51730_c1 | |||
| 2292 | nmdc:mga0rr50_7865_c1 | |||
| 2293 | nmdc:mga08x19_138809_c1 | |||
| 2294 | nmdc:mga08x19_480679_c1 | |||
| 2295 | nmdc:mga0a205_1137170_c1 | |||
| 2296 | nmdc:mga0a205_201139_c1 | |||
| 2297 | nmdc:mga0a205_205732_c1 | |||
| 2298 | nmdc:mga0a205_259530_c1 | |||
| 2299 | nmdc:mga0a205_59765_c1 | |||
| 2300 | Ga0495601_0048243 | |||
| 2301 | Ga0495601_0457784 | |||
| 2302 | Ga0495655_0076522 | |||
| 2303 | Ga0495655_0174574 | |||
| 2304 | Ga0495619_0023122 | |||
| 2305 | Ga0500559_0059937 | |||
| 2306 | Ga0501084_0024420 | |||
| 2307 | Ga0501084_0485933 | |||
| 2308 | Ga0501084_0651266 | |||
| 2309 | Ga0501084_0762415 | |||
| 2310 | Ga0501082_0061990 | |||
| 2311 | Ga0501082_0078946 | |||
| 2312 | Ga0501082_0398081 | |||
| 2313 | Ga0501082_0433542 | |||
| 2314 | Ga0501082_0829395 | |||
| 2315 | Ga0466962_0535403 | |||
| 2316 | Ga0530510_0028917 | |||
| 2317 | Ga0530510_0047997 | |||
| 2318 | Ga0530510_0140524 | |||
| 2319 | Ga0530510_0182490 | |||
| 2320 | Ga0530510_0534851 | |||
| 2321 | Ga0530510_0704103 | |||
| 2322 | Ga0530510_1025049 | |||
| 2323 | Ga0530510_1405019 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5edd-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant | 0.9809 | 2 | 128 |
| 3h6d-assembly1.cif.gz_A | structure of the mycobacterium tuberculosis dutpase d28n mutant | 0.9808 | 2 | 128 |
| 1sm8-assembly1.cif.gz_C | m. tuberculosis dutpase complexed with chromium and dutp | 0.9786 | 1 | 129 |
| 3i93-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis dutpase stop138t mutant | 0.9778 | 1 | 128 |
| 1slh-assembly1.cif.gz_B | mycobacterium tuberculosis dutpase complexed with magnesium and dudp | 0.9766 | 2 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sjnC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9813 | 1 | 128 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9761 | 1 | 129 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9688 | 1 | 129 | 2.70.40.10 |
| 2p9oA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9442 | 3 | 131 | 2.70.40.10 |
| 2d4lA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9294 | 16 | 118 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9BGE2-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9941 | 7 | 120 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A059WW43-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.984 | 1 | 126 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A2E9CZE5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9826 | 4 | 116 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A059WPA8-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9822 | 1 | 130 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A6I5CJI7-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9817 | 5 | 134 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |