F490999
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1160 | 356 | 2320 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0385645|Ga0496114_0385645_505_798 |
| Length | 97 |
| Sequence | MKGWSSAPFGDAVTQLMEKNHFTYRSLGERTGLSAGYLNHIVHGNRPIPDLEVVKRIASALGVVPEYFREMRVRAIAETLEAGPTSEIDRAYKKLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 209 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 214 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 215 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 216 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 217 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 218 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 224 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 227 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 1.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 4.05 |
| Rhizosphere | 94.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496114_0385645 | 3300048917 | Bacteria | 1241 |
| 2 | ARSoilYngRDRAFT_c03869 | 3300000042 | Unclassified | 563 |
| 3 | ARcpr5yngRDRAFT_c004304 | 3300000043 | Bacteria | 1352 |
| 4 | ARSoilOldRDRAFT_c002253 | 3300000044 | Bacteria | 1717 |
| 5 | ARCol0yngRDRAFT_1003723 | 3300000652 | Unclassified | 1112 |
| 6 | JGI24744J21845_10065760 | 3300002077 | Unclassified | 662 |
| 7 | JGI24033J26618_1022814 | 3300002155 | Bacteria | 811 |
| 8 | JGI24751J29686_10023172 | 3300002459 | Bacteria | 1287 |
| 9 | JGI25406J46586_10104778 | 3300003203 | Unclassified | 841 |
| 10 | rootH2_10071422 | 3300003320 | Unclassified | 2602 |
| 11 | rootL2_10040196 | 3300003322 | Bacteria | 2184 |
| 12 | Ga0058860_11509346 | 3300004801 | Bacteria | 577 |
| 13 | Ga0070658_10008374 | 3300005327 | Bacteria | 8314 |
| 14 | Ga0070658_10551943 | 3300005327 | Bacteria | 997 |
| 15 | Ga0070658_11358569 | 3300005327 | Unclassified | 617 |
| 16 | Ga0070676_10266110 | 3300005328 | Bacteria | 1150 |
| 17 | Ga0070676_10407999 | 3300005328 | Bacteria | 947 |
| 18 | Ga0070683_100037857 | 3300005329 | Bacteria | 4417 |
| 19 | Ga0070683_100102866 | 3300005329 | Bacteria | 2691 |
| 20 | Ga0070683_100103528 | 3300005329 | Bacteria | 2683 |
| 21 | Ga0070683_100130023 | 3300005329 | Bacteria | 2383 |
| 22 | Ga0070683_100507894 | 3300005329 | Bacteria | 1152 |
| 23 | Ga0070683_100525014 | 3300005329 | Bacteria | 1131 |
| 24 | Ga0070683_101204746 | 3300005329 | Unclassified | 728 |
| 25 | Ga0070670_100001301 | 3300005331 | Bacteria | 19889 |
| 26 | Ga0070670_100125655 | 3300005331 | Bacteria | 2213 |
| 27 | Ga0070670_100883783 | 3300005331 | Bacteria | 809 |
| 28 | Ga0068869_100301087 | 3300005334 | Bacteria | 1295 |
| 29 | Ga0068869_100750244 | 3300005334 | Bacteria | 836 |
| 30 | Ga0070680_100020158 | 3300005336 | Bacteria | 5290 |
| 31 | Ga0070680_100126947 | 3300005336 | Bacteria | 2131 |
| 32 | Ga0070680_100333749 | 3300005336 | Bacteria | 1288 |
| 33 | Ga0070680_100373401 | 3300005336 | Bacteria | 1214 |
| 34 | Ga0070680_101573002 | 3300005336 | Unclassified | 569 |
| 35 | Ga0070682_100103411 | 3300005337 | Bacteria | 1885 |
| 36 | Ga0070682_100219665 | 3300005337 | Bacteria | 1352 |
| 37 | Ga0070682_100543301 | 3300005337 | Bacteria | 908 |
| 38 | Ga0068868_100120012 | 3300005338 | Bacteria | 2144 |
| 39 | Ga0068868_100361933 | 3300005338 | Bacteria | 1245 |
| 40 | Ga0068868_100772725 | 3300005338 | Bacteria | 865 |
| 41 | Ga0070660_100016342 | 3300005339 | Bacteria | 5385 |
| 42 | Ga0070660_100612089 | 3300005339 | Bacteria | 911 |
| 43 | Ga0070660_100994314 | 3300005339 | Bacteria | 709 |
| 44 | Ga0070660_101424199 | 3300005339 | Bacteria | 589 |
| 45 | Ga0070660_101527020 | 3300005339 | Bacteria | 568 |
| 46 | Ga0070689_100050025 | 3300005340 | Bacteria | 3228 |
| 47 | Ga0070689_100235485 | 3300005340 | Bacteria | 1506 |
| 48 | Ga0070689_101656022 | 3300005340 | Bacteria | 582 |
| 49 | Ga0070691_10135354 | 3300005341 | Bacteria | 1251 |
| 50 | Ga0070691_10179864 | 3300005341 | Bacteria | 1100 |
| 51 | Ga0070687_100157581 | 3300005343 | Bacteria | 1339 |
| 52 | Ga0070687_100585681 | 3300005343 | Bacteria | 764 |
| 53 | Ga0070661_100229374 | 3300005344 | Bacteria | 1427 |
| 54 | Ga0070661_100239943 | 3300005344 | Bacteria | 1395 |
| 55 | Ga0070661_100300406 | 3300005344 | Bacteria | 1250 |
| 56 | Ga0070661_101451515 | 3300005344 | Unclassified | 578 |
| 57 | Ga0070692_10009786 | 3300005345 | Bacteria | 4339 |
| 58 | Ga0070668_100321546 | 3300005347 | Bacteria | 1303 |
| 59 | Ga0070668_100919385 | 3300005347 | Bacteria | 783 |
| 60 | Ga0070669_100223550 | 3300005353 | Bacteria | 1489 |
| 61 | Ga0070669_100407918 | 3300005353 | Bacteria | 1113 |
| 62 | Ga0070669_101070545 | 3300005353 | Bacteria | 694 |
| 63 | Ga0070669_101730012 | 3300005353 | Unclassified | 545 |
| 64 | Ga0070675_100046193 | 3300005354 | Bacteria | 3565 |
| 65 | Ga0070675_100200288 | 3300005354 | Bacteria | 1733 |
| 66 | Ga0070675_100918025 | 3300005354 | Bacteria | 803 |
| 67 | Ga0070674_100003504 | 3300005356 | Bacteria | 8811 |
| 68 | Ga0070674_100036141 | 3300005356 | Bacteria | 3313 |
| 69 | Ga0070674_100081411 | 3300005356 | Bacteria | 2314 |
| 70 | Ga0070674_100156721 | 3300005356 | Bacteria | 1724 |
| 71 | Ga0070674_100255346 | 3300005356 | Bacteria | 1379 |
| 72 | Ga0070674_100781979 | 3300005356 | Bacteria | 823 |
| 73 | Ga0070673_100068448 | 3300005364 | Bacteria | 2843 |
| 74 | Ga0070673_101609535 | 3300005364 | Unclassified | 614 |
| 75 | Ga0070688_100002904 | 3300005365 | Bacteria | 8740 |
| 76 | Ga0070659_100351870 | 3300005366 | Bacteria | 1236 |
| 77 | Ga0070659_100425065 | 3300005366 | Bacteria | 1124 |
| 78 | Ga0070659_101190245 | 3300005366 | Bacteria | 674 |
| 79 | Ga0070667_102333135 | 3300005367 | Bacteria | 504 |
| 80 | Ga0070714_100331440 | 3300005435 | Bacteria | 1425 |
| 81 | Ga0070701_10148499 | 3300005438 | Bacteria | 1347 |
| 82 | Ga0070701_10418642 | 3300005438 | Bacteria | 853 |
| 83 | Ga0070701_10481625 | 3300005438 | Unclassified | 802 |
| 84 | Ga0070701_10518137 | 3300005438 | Unclassified | 777 |
| 85 | Ga0070701_11036797 | 3300005438 | Unclassified | 574 |
| 86 | Ga0070701_11123273 | 3300005438 | Bacteria | 554 |
| 87 | Ga0070711_100683099 | 3300005439 | Bacteria | 863 |
| 88 | Ga0070711_101161858 | 3300005439 | Bacteria | 667 |
| 89 | Ga0070705_100802049 | 3300005440 | Unclassified | 749 |
| 90 | Ga0070700_100533381 | 3300005441 | Unclassified | 909 |
| 91 | Ga0070700_100761905 | 3300005441 | Bacteria | 776 |
| 92 | Ga0070700_100830572 | 3300005441 | Bacteria | 747 |
| 93 | Ga0070700_101356317 | 3300005441 | Unclassified | 599 |
| 94 | Ga0070694_101390200 | 3300005444 | Bacteria | 592 |
| 95 | Ga0070708_100474977 | 3300005445 | Bacteria | 1180 |
| 96 | Ga0070663_100427979 | 3300005455 | Bacteria | 1087 |
| 97 | Ga0070678_100041082 | 3300005456 | Bacteria | 3276 |
| 98 | Ga0070678_100043835 | 3300005456 | Bacteria | 3190 |
| 99 | Ga0070678_100317860 | 3300005456 | Bacteria | 1329 |
| 100 | Ga0070678_101180906 | 3300005456 | Unclassified | 709 |
| 101 | Ga0070662_100253411 | 3300005457 | Bacteria | 1416 |
| 102 | Ga0070662_100295276 | 3300005457 | Bacteria | 1315 |
| 103 | Ga0070681_10079765 | 3300005458 | Bacteria | 3229 |
| 104 | Ga0070681_10303323 | 3300005458 | Bacteria | 1506 |
| 105 | Ga0070681_10356085 | 3300005458 | Bacteria | 1374 |
| 106 | Ga0070681_10943718 | 3300005458 | Unclassified | 782 |
| 107 | Ga0068867_100089836 | 3300005459 | Bacteria | 2330 |
| 108 | Ga0068867_100181897 | 3300005459 | Bacteria | 1672 |
| 109 | Ga0068867_100441348 | 3300005459 | Unclassified | 1107 |
| 110 | Ga0068867_100564383 | 3300005459 | Bacteria | 988 |
| 111 | Ga0068867_101153566 | 3300005459 | Unclassified | 710 |
| 112 | Ga0068867_101700904 | 3300005459 | Bacteria | 592 |
| 113 | Ga0070685_10007193 | 3300005466 | Bacteria | 5688 |
| 114 | Ga0070685_10183543 | 3300005466 | Bacteria | 1349 |
| 115 | Ga0070685_10351105 | 3300005466 | Bacteria | 1008 |
| 116 | Ga0070685_10394768 | 3300005466 | Bacteria | 957 |
| 117 | Ga0070699_100104231 | 3300005518 | Bacteria | 2488 |
| 118 | Ga0070699_102186667 | 3300005518 | Bacteria | 505 |
| 119 | Ga0070679_100028843 | 3300005530 | Bacteria | 5474 |
| 120 | Ga0070679_100068458 | 3300005530 | Bacteria | 3541 |
| 121 | Ga0070679_100174876 | 3300005530 | Bacteria | 2119 |
| 122 | Ga0070679_100320188 | 3300005530 | Bacteria | 1500 |
| 123 | Ga0070684_100021957 | 3300005535 | Bacteria | 5317 |
| 124 | Ga0070684_100027954 | 3300005535 | Bacteria | 4767 |
| 125 | Ga0070684_100033420 | 3300005535 | Bacteria | 4391 |
| 126 | Ga0070684_100068165 | 3300005535 | Bacteria | 3127 |
| 127 | Ga0070684_100070931 | 3300005535 | Bacteria | 3066 |
| 128 | Ga0070684_100089953 | 3300005535 | Bacteria | 2729 |
| 129 | Ga0070684_100129098 | 3300005535 | Bacteria | 2279 |
| 130 | Ga0070684_100134494 | 3300005535 | Bacteria | 2232 |
| 131 | Ga0070684_100136570 | 3300005535 | Bacteria | 2215 |
| 132 | Ga0070684_100593465 | 3300005535 | Bacteria | 1029 |
| 133 | Ga0070684_100752755 | 3300005535 | Bacteria | 910 |
| 134 | Ga0070684_101023050 | 3300005535 | Bacteria | 775 |
| 135 | Ga0070684_101329322 | 3300005535 | Bacteria | 677 |
| 136 | Ga0070697_100997591 | 3300005536 | Bacteria | 744 |
| 137 | Ga0068853_100078651 | 3300005539 | Bacteria | 2883 |
| 138 | Ga0068853_100098678 | 3300005539 | Bacteria | 2579 |
| 139 | Ga0068853_100100648 | 3300005539 | Bacteria | 2555 |
| 140 | Ga0070672_100509507 | 3300005543 | Bacteria | 1042 |
| 141 | Ga0070672_100565938 | 3300005543 | Bacteria | 988 |
| 142 | Ga0070672_100636693 | 3300005543 | Bacteria | 931 |
| 143 | Ga0070672_101113242 | 3300005543 | Bacteria | 702 |
| 144 | Ga0070672_101261169 | 3300005543 | Unclassified | 659 |
| 145 | Ga0070686_100148829 | 3300005544 | Bacteria | 1638 |
| 146 | Ga0070686_100200261 | 3300005544 | Bacteria | 1431 |
| 147 | Ga0070686_100601243 | 3300005544 | Bacteria | 867 |
| 148 | Ga0070695_100028444 | 3300005545 | Bacteria | 3469 |
| 149 | Ga0070695_100335062 | 3300005545 | Bacteria | 1129 |
| 150 | Ga0070696_100112797 | 3300005546 | Bacteria | 1960 |
| 151 | Ga0070693_100048091 | 3300005547 | Bacteria | 2428 |
| 152 | Ga0070693_100060007 | 3300005547 | Bacteria | 2207 |
| 153 | Ga0070693_100122335 | 3300005547 | Bacteria | 1616 |
| 154 | Ga0070693_100744495 | 3300005547 | Bacteria | 722 |
| 155 | Ga0070693_100746455 | 3300005547 | Bacteria | 721 |
| 156 | Ga0070693_100804718 | 3300005547 | Bacteria | 697 |
| 157 | Ga0070665_100027593 | 3300005548 | Bacteria | 5718 |
| 158 | Ga0070704_100040624 | 3300005549 | Bacteria | 3204 |
| 159 | Ga0070704_100265538 | 3300005549 | Unclassified | 1416 |
| 160 | Ga0068855_100034552 | 3300005563 | Bacteria | 6028 |
| 161 | Ga0068855_100688794 | 3300005563 | Bacteria | 1095 |
| 162 | Ga0068855_101221327 | 3300005563 | Bacteria | 781 |
| 163 | Ga0070664_100061983 | 3300005564 | Bacteria | 3188 |
| 164 | Ga0070664_100121618 | 3300005564 | Bacteria | 2286 |
| 165 | Ga0070664_100308032 | 3300005564 | Bacteria | 1432 |
| 166 | Ga0070664_100600117 | 3300005564 | Bacteria | 1021 |
| 167 | Ga0070664_100625950 | 3300005564 | Bacteria | 999 |
| 168 | Ga0070664_100728979 | 3300005564 | Bacteria | 924 |
| 169 | Ga0070664_101464425 | 3300005564 | Unclassified | 646 |
| 170 | Ga0070664_102125861 | 3300005564 | Bacteria | 533 |
| 171 | Ga0070664_102134198 | 3300005564 | Bacteria | 532 |
| 172 | Ga0068857_100052275 | 3300005577 | Bacteria | 3625 |
| 173 | Ga0068857_100073839 | 3300005577 | Bacteria | 3039 |
| 174 | Ga0068857_100154574 | 3300005577 | Bacteria | 2080 |
| 175 | Ga0068857_100335696 | 3300005577 | Bacteria | 1398 |
| 176 | Ga0068857_100352293 | 3300005577 | Unclassified | 1363 |
| 177 | Ga0068857_100883461 | 3300005577 | Unclassified | 856 |
| 178 | Ga0068857_101158083 | 3300005577 | Bacteria | 748 |
| 179 | Ga0068854_100065623 | 3300005578 | Bacteria | 2639 |
| 180 | Ga0068854_100083986 | 3300005578 | Bacteria | 2355 |
| 181 | Ga0068854_100574823 | 3300005578 | Unclassified | 959 |
| 182 | Ga0068856_100133345 | 3300005614 | Bacteria | 2489 |
| 183 | Ga0070702_100086712 | 3300005615 | Bacteria | 1889 |
| 184 | Ga0070702_100280009 | 3300005615 | Bacteria | 1145 |
| 185 | Ga0070702_100354406 | 3300005615 | Bacteria | 1035 |
| 186 | Ga0070702_100813596 | 3300005615 | Bacteria | 724 |
| 187 | Ga0068852_100112286 | 3300005616 | Bacteria | 2480 |
| 188 | Ga0068852_101153500 | 3300005616 | Bacteria | 795 |
| 189 | Ga0068859_101792894 | 3300005617 | Bacteria | 678 |
| 190 | Ga0068864_100125522 | 3300005618 | Bacteria | 2299 |
| 191 | Ga0068864_101393888 | 3300005618 | Bacteria | 703 |
| 192 | Ga0068864_102370575 | 3300005618 | Bacteria | 537 |
| 193 | Ga0068866_10036005 | 3300005718 | Bacteria | 2422 |
| 194 | Ga0068861_100308882 | 3300005719 | Bacteria | 1373 |
| 195 | Ga0068861_100312646 | 3300005719 | Bacteria | 1365 |
| 196 | Ga0068861_100859923 | 3300005719 | Bacteria | 856 |
| 197 | Ga0068861_102154543 | 3300005719 | Bacteria | 558 |
| 198 | Ga0068851_10358625 | 3300005834 | Bacteria | 850 |
| 199 | Ga0068851_10499731 | 3300005834 | Bacteria | 729 |
| 200 | Ga0068870_10000314 | 3300005840 | Bacteria | 18000 |
| 201 | Ga0068870_10093905 | 3300005840 | Bacteria | 1683 |
| 202 | Ga0068870_10359043 | 3300005840 | Bacteria | 937 |
| 203 | Ga0068858_100521033 | 3300005842 | Bacteria | 1150 |
| 204 | Ga0068858_101076723 | 3300005842 | Bacteria | 789 |
| 205 | Ga0068860_100829038 | 3300005843 | Bacteria | 939 |
| 206 | Ga0068860_101073424 | 3300005843 | Bacteria | 824 |
| 207 | Ga0068862_100332626 | 3300005844 | Bacteria | 1405 |
| 208 | Ga0068862_100954823 | 3300005844 | Unclassified | 846 |
| 209 | Ga0081455_10006933 | 3300005937 | Bacteria | 12048 |
| 210 | Ga0081455_10022098 | 3300005937 | Bacteria | 5954 |
| 211 | Ga0081455_10045327 | 3300005937 | Bacteria | 3827 |
| 212 | Ga0081455_10147563 | 3300005937 | Bacteria | 1817 |
| 213 | Ga0081455_10184313 | 3300005937 | Bacteria | 1578 |
| 214 | Ga0081455_10259983 | 3300005937 | Bacteria | 1265 |
| 215 | Ga0081455_10321337 | 3300005937 | Unclassified | 1102 |
| 216 | Ga0081455_10331918 | 3300005937 | Bacteria | 1079 |
| 217 | Ga0081455_10516061 | 3300005937 | Unclassified | 799 |
| 218 | Ga0081455_10550496 | 3300005937 | Bacteria | 763 |
| 219 | Ga0081455_10649104 | 3300005937 | Unclassified | 680 |
| 220 | Ga0081538_10049846 | 3300005981 | Bacteria | 2536 |
| 221 | Ga0081538_10128433 | 3300005981 | Bacteria | 1198 |
| 222 | Ga0081539_10010651 | 3300005985 | Bacteria | 7422 |
| 223 | Ga0081539_10158747 | 3300005985 | Bacteria | 1080 |
| 224 | Ga0075365_10084679 | 3300006038 | Bacteria | 2152 |
| 225 | Ga0075365_10306601 | 3300006038 | Bacteria | 1118 |
| 226 | Ga0075364_10078387 | 3300006051 | Bacteria | 2182 |
| 227 | Ga0075364_10493385 | 3300006051 | Bacteria | 837 |
| 228 | Ga0075432_10112650 | 3300006058 | Bacteria | 1015 |
| 229 | Ga0097621_100442884 | 3300006237 | Unclassified | 1169 |
| 230 | Ga0097621_101201728 | 3300006237 | Bacteria | 714 |
| 231 | Ga0068871_100122618 | 3300006358 | Bacteria | 2197 |
| 232 | Ga0068871_101815974 | 3300006358 | Bacteria | 579 |
| 233 | Ga0075428_100001303 | 3300006844 | Bacteria | 26471 |
| 234 | Ga0075428_100034856 | 3300006844 | Bacteria | 5550 |
| 235 | Ga0075428_100088862 | 3300006844 | Bacteria | 3370 |
| 236 | Ga0075428_100099485 | 3300006844 | Bacteria | 3171 |
| 237 | Ga0075428_100995469 | 3300006844 | Bacteria | 888 |
| 238 | Ga0075430_100012393 | 3300006846 | Bacteria | 7253 |
| 239 | Ga0075430_100033910 | 3300006846 | Bacteria | 4333 |
| 240 | Ga0075430_100302656 | 3300006846 | Bacteria | 1322 |
| 241 | Ga0075430_101802463 | 3300006846 | Unclassified | 502 |
| 242 | Ga0075431_100002708 | 3300006847 | Bacteria | 17182 |
| 243 | Ga0075431_100568439 | 3300006847 | Bacteria | 1120 |
| 244 | Ga0075431_101106383 | 3300006847 | Unclassified | 757 |
| 245 | Ga0075433_10123536 | 3300006852 | Bacteria | 2300 |
| 246 | Ga0075433_10470356 | 3300006852 | Unclassified | 1107 |
| 247 | Ga0075433_10485944 | 3300006852 | Bacteria | 1088 |
| 248 | Ga0075433_10651745 | 3300006852 | Unclassified | 923 |
| 249 | Ga0075433_10776089 | 3300006852 | Bacteria | 838 |
| 250 | Ga0075434_100047520 | 3300006871 | Bacteria | 4259 |
| 251 | Ga0075434_100423707 | 3300006871 | Bacteria | 1352 |
| 252 | Ga0075434_101780842 | 3300006871 | Bacteria | 623 |
| 253 | Ga0075434_101930691 | 3300006871 | Bacteria | 596 |
| 254 | Ga0075429_100032058 | 3300006880 | Bacteria | 4568 |
| 255 | Ga0075429_100049289 | 3300006880 | Bacteria | 3662 |
| 256 | Ga0075429_100063378 | 3300006880 | Bacteria | 3220 |
| 257 | Ga0075429_100067690 | 3300006880 | Bacteria | 3108 |
| 258 | Ga0068865_100131240 | 3300006881 | Bacteria | 1877 |
| 259 | Ga0068865_100184103 | 3300006881 | Bacteria | 1610 |
| 260 | Ga0068865_100279574 | 3300006881 | Bacteria | 1328 |
| 261 | Ga0068865_100428041 | 3300006881 | Bacteria | 1090 |
| 262 | Ga0068865_100527831 | 3300006881 | Bacteria | 988 |
| 263 | Ga0068865_100563172 | 3300006881 | Bacteria | 958 |
| 264 | Ga0068865_101082435 | 3300006881 | Bacteria | 705 |
| 265 | Ga0068865_101192904 | 3300006881 | Bacteria | 673 |
| 266 | Ga0075436_100034374 | 3300006914 | Bacteria | 3496 |
| 267 | Ga0075436_100186227 | 3300006914 | Unclassified | 1468 |
| 268 | Ga0097620_101793142 | 3300006931 | Bacteria | 678 |
| 269 | Ga0075435_100845124 | 3300007076 | Bacteria | 797 |
| 270 | Ga0075435_101971977 | 3300007076 | Bacteria | 513 |
| 271 | Ga0105240_10056968 | 3300009093 | Bacteria | 4887 |
| 272 | Ga0105240_11267498 | 3300009093 | Bacteria | 778 |
| 273 | Ga0111539_10003299 | 3300009094 | Bacteria | 21326 |
| 274 | Ga0111539_10004030 | 3300009094 | Bacteria | 19288 |
| 275 | Ga0111539_10006384 | 3300009094 | Bacteria | 15204 |
| 276 | Ga0111539_10043904 | 3300009094 | Bacteria | 5357 |
| 277 | Ga0111539_10143609 | 3300009094 | Bacteria | 2794 |
| 278 | Ga0111539_10186756 | 3300009094 | Bacteria | 2420 |
| 279 | Ga0111539_10571106 | 3300009094 | Bacteria | 1317 |
| 280 | Ga0111539_10887431 | 3300009094 | Bacteria | 1037 |
| 281 | Ga0111539_10896376 | 3300009094 | Bacteria | 1031 |
| 282 | Ga0111539_10988800 | 3300009094 | Bacteria | 978 |
| 283 | Ga0105245_10013227 | 3300009098 | Bacteria | 7191 |
| 284 | Ga0105245_10015075 | 3300009098 | Bacteria | 6735 |
| 285 | Ga0105245_10029446 | 3300009098 | Bacteria | 4851 |
| 286 | Ga0105245_10134576 | 3300009098 | Bacteria | 2321 |
| 287 | Ga0105245_10196789 | 3300009098 | Bacteria | 1934 |
| 288 | Ga0105245_10375936 | 3300009098 | Bacteria | 1414 |
| 289 | Ga0105245_11509357 | 3300009098 | Bacteria | 723 |
| 290 | Ga0105245_12335388 | 3300009098 | Unclassified | 588 |
| 291 | Ga0105247_11213972 | 3300009101 | Bacteria | 601 |
| 292 | Ga0114129_10010739 | 3300009147 | Bacteria | 13052 |
| 293 | Ga0114129_10044815 | 3300009147 | Bacteria | 6221 |
| 294 | Ga0114129_10160423 | 3300009147 | Bacteria | 3072 |
| 295 | Ga0114129_10363852 | 3300009147 | Bacteria | 1913 |
| 296 | Ga0114129_10422564 | 3300009147 | Bacteria | 1753 |
| 297 | Ga0114129_10952676 | 3300009147 | Bacteria | 1084 |
| 298 | Ga0114129_11098605 | 3300009147 | Unclassified | 996 |
| 299 | Ga0114129_11784119 | 3300009147 | Bacteria | 749 |
| 300 | Ga0114129_11816537 | 3300009147 | Bacteria | 741 |
| 301 | Ga0114129_11954222 | 3300009147 | Unclassified | 710 |
| 302 | Ga0114129_12108078 | 3300009147 | Unclassified | 680 |
| 303 | Ga0114129_12871667 | 3300009147 | Bacteria | 571 |
| 304 | Ga0114129_13193677 | 3300009147 | Bacteria | 533 |
| 305 | Ga0105243_10089998 | 3300009148 | Bacteria | 2525 |
| 306 | Ga0105243_10103030 | 3300009148 | Bacteria | 2373 |
| 307 | Ga0105243_10222820 | 3300009148 | Unclassified | 1668 |
| 308 | Ga0105243_10354291 | 3300009148 | Bacteria | 1349 |
| 309 | Ga0105243_10406725 | 3300009148 | Bacteria | 1266 |
| 310 | Ga0105243_10733933 | 3300009148 | Bacteria | 966 |
| 311 | Ga0105243_10734701 | 3300009148 | Bacteria | 966 |
| 312 | Ga0105243_11501754 | 3300009148 | Bacteria | 697 |
| 313 | Ga0105243_11640183 | 3300009148 | Unclassified | 671 |
| 314 | Ga0105241_10748508 | 3300009174 | Bacteria | 896 |
| 315 | Ga0105241_11927793 | 3300009174 | Unclassified | 580 |
| 316 | Ga0105242_10052183 | 3300009176 | Bacteria | 3336 |
| 317 | Ga0105242_10112254 | 3300009176 | Bacteria | 2326 |
| 318 | Ga0105242_10178987 | 3300009176 | Bacteria | 1869 |
| 319 | Ga0105242_10353535 | 3300009176 | Bacteria | 1358 |
| 320 | Ga0105242_11664473 | 3300009176 | Bacteria | 673 |
| 321 | Ga0105242_12713597 | 3300009176 | Unclassified | 545 |
| 322 | Ga0105248_10076402 | 3300009177 | Bacteria | 3764 |
| 323 | Ga0105248_11680983 | 3300009177 | Bacteria | 720 |
| 324 | Ga0105249_10083457 | 3300009553 | Bacteria | 2974 |
| 325 | Ga0105249_10100359 | 3300009553 | Bacteria | 2721 |
| 326 | Ga0105249_10171797 | 3300009553 | Bacteria | 2103 |
| 327 | Ga0105249_10271389 | 3300009553 | Bacteria | 1690 |
| 328 | Ga0105249_11195266 | 3300009553 | Bacteria | 831 |
| 329 | Ga0105249_12443964 | 3300009553 | Bacteria | 595 |
| 330 | Ga0105249_13496306 | 3300009553 | Bacteria | 506 |
| 331 | Ga0105239_10061175 | 3300010375 | Bacteria | 4132 |
| 332 | Ga0105239_10088866 | 3300010375 | Bacteria | 3407 |
| 333 | Ga0105239_10096392 | 3300010375 | Bacteria | 3268 |
| 334 | Ga0105239_10154842 | 3300010375 | Unclassified | 2559 |
| 335 | Ga0105239_13218489 | 3300010375 | Bacteria | 532 |
| 336 | Ga0105246_10025997 | 3300011119 | Bacteria | 3818 |
| 337 | Ga0105246_10139771 | 3300011119 | Unclassified | 1820 |
| 338 | Ga0105246_10175203 | 3300011119 | Unclassified | 1646 |
| 339 | Ga0105246_10333983 | 3300011119 | Bacteria | 1236 |
| 340 | Ga0105246_10351532 | 3300011119 | Bacteria | 1208 |
| 341 | Ga0105246_10365596 | 3300011119 | Bacteria | 1187 |
| 342 | Ga0105246_10743007 | 3300011119 | Bacteria | 865 |
| 343 | Ga0105246_10975591 | 3300011119 | Bacteria | 765 |
| 344 | Ga0105246_11682063 | 3300011119 | Unclassified | 602 |
| 345 | Ga0105246_12351164 | 3300011119 | Bacteria | 522 |
| 346 | Ga0157342_1062535 | 3300012507 | Bacteria | 549 |
| 347 | Ga0157373_10596717 | 3300013100 | Bacteria | 804 |
| 348 | Ga0157373_10881182 | 3300013100 | Bacteria | 663 |
| 349 | Ga0157371_10149916 | 3300013102 | Bacteria | 1663 |
| 350 | Ga0157370_10033295 | 3300013104 | Bacteria | 5024 |
| 351 | Ga0157370_10350013 | 3300013104 | Bacteria | 1362 |
| 352 | Ga0157370_10573459 | 3300013104 | Bacteria | 1034 |
| 353 | Ga0157374_10984962 | 3300013296 | Bacteria | 862 |
| 354 | Ga0157374_11662497 | 3300013296 | Unclassified | 663 |
| 355 | Ga0157374_12802303 | 3300013296 | Bacteria | 515 |
| 356 | Ga0157378_10719185 | 3300013297 | Unclassified | 1019 |
| 357 | Ga0157378_11717905 | 3300013297 | Unclassified | 675 |
| 358 | Ga0163162_10334291 | 3300013306 | Bacteria | 1647 |
| 359 | Ga0163162_10341744 | 3300013306 | Bacteria | 1629 |
| 360 | Ga0163162_13319678 | 3300013306 | Bacteria | 515 |
| 361 | Ga0157372_10172325 | 3300013307 | Bacteria | 2504 |
| 362 | Ga0157375_10951958 | 3300013308 | Bacteria | 1000 |
| 363 | Ga0157375_11413949 | 3300013308 | Bacteria | 820 |
| 364 | Ga0157375_11506130 | 3300013308 | Unclassified | 794 |
| 365 | Ga0157375_11548347 | 3300013308 | Unclassified | 783 |
| 366 | Ga0157375_11686417 | 3300013308 | Bacteria | 750 |
| 367 | Ga0163163_10196044 | 3300014325 | Bacteria | 2067 |
| 368 | Ga0157380_10273875 | 3300014326 | Bacteria | 1540 |
| 369 | Ga0157380_10307737 | 3300014326 | Bacteria | 1463 |
| 370 | Ga0157380_11150343 | 3300014326 | Unclassified | 817 |
| 371 | Ga0157380_12988236 | 3300014326 | Bacteria | 539 |
| 372 | Ga0157377_10059463 | 3300014745 | Bacteria | 2178 |
| 373 | Ga0157377_10064493 | 3300014745 | Bacteria | 2101 |
| 374 | Ga0157377_10517929 | 3300014745 | Bacteria | 837 |
| 375 | Ga0157377_11380409 | 3300014745 | Unclassified | 555 |
| 376 | Ga0157379_10371995 | 3300014968 | Bacteria | 1310 |
| 377 | Ga0157376_10532420 | 3300014969 | Bacteria | 1160 |
| 378 | Ga0157376_10824899 | 3300014969 | Unclassified | 941 |
| 379 | Ga0157376_11203027 | 3300014969 | Bacteria | 786 |
| 380 | Ga0163161_10571931 | 3300017792 | Bacteria | 928 |
| 381 | Ga0163161_11122300 | 3300017792 | Bacteria | 677 |
| 382 | Ga0197907_10085909 | 3300020069 | Unclassified | 1532 |
| 383 | Ga0206356_11077094 | 3300020070 | Bacteria | 2150 |
| 384 | Ga0206356_11105661 | 3300020070 | Bacteria | 1986 |
| 385 | Ga0206355_1025702 | 3300020076 | Bacteria | 634 |
| 386 | Ga0206355_1160160 | 3300020076 | Unclassified | 624 |
| 387 | Ga0206352_11172591 | 3300020078 | Bacteria | 1059 |
| 388 | Ga0206350_10334532 | 3300020080 | Bacteria | 1256 |
| 389 | Ga0206354_10793628 | 3300020081 | Bacteria | 3108 |
| 390 | Ga0206354_11430998 | 3300020081 | Bacteria | 2789 |
| 391 | Ga0206353_10828983 | 3300020082 | Unclassified | 825 |
| 392 | Ga0206353_11822418 | 3300020082 | Bacteria | 780 |
| 393 | Ga0206353_11909465 | 3300020082 | Bacteria | 4171 |
| 394 | Ga0206353_11930517 | 3300020082 | Bacteria | 5513 |
| 395 | Ga0154015_1632745 | 3300020610 | Bacteria | 656 |
| 396 | Ga0224712_10129633 | 3300022467 | Unclassified | 1100 |
| 397 | Ga0207682_10434040 | 3300025893 | Bacteria | 621 |
| 398 | Ga0207642_10202870 | 3300025899 | Bacteria | 1096 |
| 399 | Ga0207642_10449887 | 3300025899 | Bacteria | 780 |
| 400 | Ga0207710_10647796 | 3300025900 | Bacteria | 553 |
| 401 | Ga0207688_10001991 | 3300025901 | Bacteria | 10955 |
| 402 | Ga0207688_10024376 | 3300025901 | Bacteria | 3317 |
| 403 | Ga0207688_10091080 | 3300025901 | Bacteria | 1751 |
| 404 | Ga0207688_10233448 | 3300025901 | Bacteria | 1111 |
| 405 | Ga0207688_10627789 | 3300025901 | Bacteria | 678 |
| 406 | Ga0207680_11144248 | 3300025903 | Bacteria | 556 |
| 407 | Ga0207647_10264398 | 3300025904 | Unclassified | 984 |
| 408 | Ga0207647_10460521 | 3300025904 | Unclassified | 712 |
| 409 | Ga0207645_10040177 | 3300025907 | Bacteria | 2996 |
| 410 | Ga0207645_10155157 | 3300025907 | Bacteria | 1496 |
| 411 | Ga0207645_10259557 | 3300025907 | Unclassified | 1151 |
| 412 | Ga0207645_10831474 | 3300025907 | Bacteria | 628 |
| 413 | Ga0207643_10002509 | 3300025908 | Bacteria | 9923 |
| 414 | Ga0207643_10008679 | 3300025908 | Bacteria | 5452 |
| 415 | Ga0207643_10026604 | 3300025908 | Bacteria | 3203 |
| 416 | Ga0207643_10085602 | 3300025908 | Unclassified | 1831 |
| 417 | Ga0207643_10244095 | 3300025908 | Bacteria | 1105 |
| 418 | Ga0207643_11105561 | 3300025908 | Bacteria | 511 |
| 419 | Ga0207705_10111197 | 3300025909 | Bacteria | 2024 |
| 420 | Ga0207705_10718579 | 3300025909 | Unclassified | 776 |
| 421 | Ga0207705_11226465 | 3300025909 | Unclassified | 575 |
| 422 | Ga0207684_11673760 | 3300025910 | Bacteria | 513 |
| 423 | Ga0207654_10713073 | 3300025911 | Bacteria | 721 |
| 424 | Ga0207707_10039946 | 3300025912 | Bacteria | 4099 |
| 425 | Ga0207707_10076138 | 3300025912 | Bacteria | 2928 |
| 426 | Ga0207707_10119502 | 3300025912 | Bacteria | 2303 |
| 427 | Ga0207707_11274483 | 3300025912 | Unclassified | 592 |
| 428 | Ga0207707_11558423 | 3300025912 | Bacteria | 522 |
| 429 | Ga0207695_10529602 | 3300025913 | Bacteria | 1060 |
| 430 | Ga0207695_11101380 | 3300025913 | Bacteria | 674 |
| 431 | Ga0207663_11002107 | 3300025916 | Bacteria | 670 |
| 432 | Ga0207660_10051686 | 3300025917 | Bacteria | 2922 |
| 433 | Ga0207660_10162583 | 3300025917 | Bacteria | 1723 |
| 434 | Ga0207660_10227258 | 3300025917 | Bacteria | 1466 |
| 435 | Ga0207660_10240319 | 3300025917 | Bacteria | 1426 |
| 436 | Ga0207660_10463547 | 3300025917 | Bacteria | 1025 |
| 437 | Ga0207662_10222222 | 3300025918 | Bacteria | 1230 |
| 438 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 439 | Ga0207657_10254646 | 3300025919 | Bacteria | 1398 |
| 440 | Ga0207657_10705595 | 3300025919 | Bacteria | 783 |
| 441 | Ga0207657_10759290 | 3300025919 | Bacteria | 751 |
| 442 | Ga0207649_10085355 | 3300025920 | Bacteria | 2054 |
| 443 | Ga0207649_10171418 | 3300025920 | Bacteria | 1512 |
| 444 | Ga0207649_10291676 | 3300025920 | Bacteria | 1190 |
| 445 | Ga0207649_10845844 | 3300025920 | Bacteria | 716 |
| 446 | Ga0207649_10859341 | 3300025920 | Unclassified | 710 |
| 447 | Ga0207649_10929413 | 3300025920 | Unclassified | 683 |
| 448 | Ga0207652_10033046 | 3300025921 | Bacteria | 4354 |
| 449 | Ga0207652_10074422 | 3300025921 | Bacteria | 2957 |
| 450 | Ga0207652_10108706 | 3300025921 | Bacteria | 2457 |
| 451 | Ga0207652_10704876 | 3300025921 | Bacteria | 900 |
| 452 | Ga0207652_10989795 | 3300025921 | Unclassified | 739 |
| 453 | Ga0207681_10714654 | 3300025923 | Bacteria | 834 |
| 454 | Ga0207650_10007062 | 3300025925 | Bacteria | 7656 |
| 455 | Ga0207650_10165300 | 3300025925 | Bacteria | 1756 |
| 456 | Ga0207659_10155495 | 3300025926 | Bacteria | 1790 |
| 457 | Ga0207659_10291846 | 3300025926 | Bacteria | 1336 |
| 458 | Ga0207659_10813420 | 3300025926 | Bacteria | 803 |
| 459 | Ga0207659_11295080 | 3300025926 | Unclassified | 626 |
| 460 | Ga0207687_10012184 | 3300025927 | Bacteria | 5625 |
| 461 | Ga0207687_10099918 | 3300025927 | Bacteria | 2133 |
| 462 | Ga0207687_10204167 | 3300025927 | Bacteria | 1547 |
| 463 | Ga0207687_10915436 | 3300025927 | Bacteria | 751 |
| 464 | Ga0207687_11610264 | 3300025927 | Unclassified | 557 |
| 465 | Ga0207664_10011249 | 3300025929 | Bacteria | 6349 |
| 466 | Ga0207664_10567371 | 3300025929 | Bacteria | 1019 |
| 467 | Ga0207690_10221492 | 3300025932 | Bacteria | 1448 |
| 468 | Ga0207706_10063067 | 3300025933 | Bacteria | 3263 |
| 469 | Ga0207706_10116957 | 3300025933 | Bacteria | 2345 |
| 470 | Ga0207706_10561091 | 3300025933 | Bacteria | 982 |
| 471 | Ga0207686_10549569 | 3300025934 | Bacteria | 903 |
| 472 | Ga0207686_10555364 | 3300025934 | Bacteria | 898 |
| 473 | Ga0207686_11623723 | 3300025934 | Bacteria | 534 |
| 474 | Ga0207709_10067618 | 3300025935 | Bacteria | 2255 |
| 475 | Ga0207709_10837245 | 3300025935 | Unclassified | 745 |
| 476 | Ga0207709_10899644 | 3300025935 | Bacteria | 719 |
| 477 | Ga0207670_10624877 | 3300025936 | Bacteria | 886 |
| 478 | Ga0207670_11237922 | 3300025936 | Unclassified | 632 |
| 479 | Ga0207669_10066597 | 3300025937 | Bacteria | 2240 |
| 480 | Ga0207669_10104921 | 3300025937 | Bacteria | 1879 |
| 481 | Ga0207669_10254974 | 3300025937 | Bacteria | 1309 |
| 482 | Ga0207669_10344698 | 3300025937 | Bacteria | 1148 |
| 483 | Ga0207669_10720788 | 3300025937 | Bacteria | 821 |
| 484 | Ga0207669_11529408 | 3300025937 | Bacteria | 569 |
| 485 | Ga0207704_10099604 | 3300025938 | Bacteria | 1934 |
| 486 | Ga0207704_10162040 | 3300025938 | Bacteria | 1593 |
| 487 | Ga0207704_10197928 | 3300025938 | Bacteria | 1468 |
| 488 | Ga0207704_10354543 | 3300025938 | Bacteria | 1143 |
| 489 | Ga0207704_10779764 | 3300025938 | Bacteria | 797 |
| 490 | Ga0207691_10063570 | 3300025940 | Bacteria | 3347 |
| 491 | Ga0207691_10465928 | 3300025940 | Bacteria | 1074 |
| 492 | Ga0207691_10602484 | 3300025940 | Unclassified | 930 |
| 493 | Ga0207691_10608664 | 3300025940 | Bacteria | 925 |
| 494 | Ga0207689_10023381 | 3300025942 | Bacteria | 5188 |
| 495 | Ga0207689_10027661 | 3300025942 | Bacteria | 4746 |
| 496 | Ga0207689_10589648 | 3300025942 | Bacteria | 935 |
| 497 | Ga0207689_10784014 | 3300025942 | Bacteria | 805 |
| 498 | Ga0207661_10007306 | 3300025944 | Bacteria | 7858 |
| 499 | Ga0207661_10039832 | 3300025944 | Bacteria | 3690 |
| 500 | Ga0207661_10043058 | 3300025944 | Bacteria | 3562 |
| 501 | Ga0207661_10064710 | 3300025944 | Bacteria | 2965 |
| 502 | Ga0207661_10073776 | 3300025944 | Bacteria | 2796 |
| 503 | Ga0207661_10100031 | 3300025944 | Bacteria | 2433 |
| 504 | Ga0207661_10258994 | 3300025944 | Bacteria | 1549 |
| 505 | Ga0207679_10091288 | 3300025945 | Bacteria | 2357 |
| 506 | Ga0207679_10250932 | 3300025945 | Unclassified | 1504 |
| 507 | Ga0207679_10514052 | 3300025945 | Bacteria | 1070 |
| 508 | Ga0207679_10622403 | 3300025945 | Bacteria | 974 |
| 509 | Ga0207679_10680872 | 3300025945 | Bacteria | 932 |
| 510 | Ga0207679_10915438 | 3300025945 | Bacteria | 802 |
| 511 | Ga0207679_12085320 | 3300025945 | Bacteria | 515 |
| 512 | Ga0207667_10015039 | 3300025949 | Bacteria | 8802 |
| 513 | Ga0207667_11136832 | 3300025949 | Bacteria | 763 |
| 514 | Ga0207667_11659602 | 3300025949 | Unclassified | 607 |
| 515 | Ga0207667_12096909 | 3300025949 | Bacteria | 524 |
| 516 | Ga0207712_10083469 | 3300025961 | Bacteria | 2332 |
| 517 | Ga0207712_10103665 | 3300025961 | Bacteria | 2120 |
| 518 | Ga0207712_10250607 | 3300025961 | Bacteria | 1431 |
| 519 | Ga0207712_11704001 | 3300025961 | Unclassified | 565 |
| 520 | Ga0207668_10077833 | 3300025972 | Bacteria | 2393 |
| 521 | Ga0207668_10207128 | 3300025972 | Unclassified | 1566 |
| 522 | Ga0207668_11060362 | 3300025972 | Bacteria | 726 |
| 523 | Ga0207640_10108593 | 3300025981 | Bacteria | 1961 |
| 524 | Ga0207640_10857812 | 3300025981 | Bacteria | 790 |
| 525 | Ga0207677_10144452 | 3300026023 | Bacteria | 1826 |
| 526 | Ga0207677_10294225 | 3300026023 | Bacteria | 1339 |
| 527 | Ga0207677_10554268 | 3300026023 | Bacteria | 1002 |
| 528 | Ga0207677_10630911 | 3300026023 | Bacteria | 944 |
| 529 | Ga0207677_11252898 | 3300026023 | Bacteria | 680 |
| 530 | Ga0207703_11063014 | 3300026035 | Bacteria | 777 |
| 531 | Ga0207639_10225586 | 3300026041 | Unclassified | 1621 |
| 532 | Ga0207639_10277708 | 3300026041 | Bacteria | 1472 |
| 533 | Ga0207639_11065630 | 3300026041 | Unclassified | 758 |
| 534 | Ga0207639_11572892 | 3300026041 | Unclassified | 617 |
| 535 | Ga0207678_10157709 | 3300026067 | Bacteria | 1938 |
| 536 | Ga0207678_11757252 | 3300026067 | Bacteria | 544 |
| 537 | Ga0207678_11809559 | 3300026067 | Unclassified | 534 |
| 538 | Ga0207708_10058798 | 3300026075 | Bacteria | 2933 |
| 539 | Ga0207708_10389622 | 3300026075 | Bacteria | 1150 |
| 540 | Ga0207708_11088043 | 3300026075 | Bacteria | 697 |
| 541 | Ga0207702_10460933 | 3300026078 | Bacteria | 1234 |
| 542 | Ga0207702_12068355 | 3300026078 | Bacteria | 559 |
| 543 | Ga0207641_10801404 | 3300026088 | Bacteria | 932 |
| 544 | Ga0207648_10069046 | 3300026089 | Bacteria | 3079 |
| 545 | Ga0207648_10129248 | 3300026089 | Bacteria | 2223 |
| 546 | Ga0207648_10213047 | 3300026089 | Bacteria | 1715 |
| 547 | Ga0207648_10290811 | 3300026089 | Bacteria | 1463 |
| 548 | Ga0207648_10387792 | 3300026089 | Unclassified | 1264 |
| 549 | Ga0207648_10833752 | 3300026089 | Bacteria | 859 |
| 550 | Ga0207648_11499738 | 3300026089 | Bacteria | 634 |
| 551 | Ga0207676_10598686 | 3300026095 | Bacteria | 1058 |
| 552 | Ga0207676_10778309 | 3300026095 | Bacteria | 932 |
| 553 | Ga0207676_11581384 | 3300026095 | Bacteria | 653 |
| 554 | Ga0207674_10002093 | 3300026116 | Bacteria | 25273 |
| 555 | Ga0207674_10018243 | 3300026116 | Bacteria | 7632 |
| 556 | Ga0207674_10059218 | 3300026116 | Bacteria | 3876 |
| 557 | Ga0207674_10145617 | 3300026116 | Bacteria | 2327 |
| 558 | Ga0207674_10151009 | 3300026116 | Unclassified | 2280 |
| 559 | Ga0207674_10446753 | 3300026116 | Bacteria | 1250 |
| 560 | Ga0207675_100105767 | 3300026118 | Bacteria | 2653 |
| 561 | Ga0207675_100110180 | 3300026118 | Bacteria | 2597 |
| 562 | Ga0207675_100401490 | 3300026118 | Bacteria | 1351 |
| 563 | Ga0207683_10015569 | 3300026121 | Bacteria | 6473 |
| 564 | Ga0207683_10041072 | 3300026121 | Bacteria | 4037 |
| 565 | Ga0207683_10271837 | 3300026121 | Bacteria | 1548 |
| 566 | Ga0207683_10420899 | 3300026121 | Bacteria | 1230 |
| 567 | Ga0207683_10905603 | 3300026121 | Bacteria | 819 |
| 568 | Ga0207683_11071811 | 3300026121 | Bacteria | 748 |
| 569 | Ga0207683_11126103 | 3300026121 | Bacteria | 728 |
| 570 | Ga0207698_10056700 | 3300026142 | Bacteria | 3026 |
| 571 | Ga0207698_10095721 | 3300026142 | Bacteria | 2445 |
| 572 | Ga0207428_10000401 | 3300027907 | Bacteria | 53789 |
| 573 | Ga0207428_10009137 | 3300027907 | Bacteria | 8907 |
| 574 | Ga0207428_10050027 | 3300027907 | Bacteria | 3345 |
| 575 | Ga0207428_10109876 | 3300027907 | Bacteria | 2123 |
| 576 | Ga0207428_10306901 | 3300027907 | Bacteria | 1174 |
| 577 | Ga0207428_10389957 | 3300027907 | Bacteria | 1021 |
| 578 | Ga0268266_12155903 | 3300028379 | Unclassified | 530 |
| 579 | Ga0268265_10545035 | 3300028380 | Unclassified | 1100 |
| 580 | Ga0268265_11832194 | 3300028380 | Bacteria | 613 |
| 581 | Ga0268264_11166965 | 3300028381 | Bacteria | 779 |
| 582 | Ga0307408_100133628 | 3300031548 | Bacteria | 1938 |
| 583 | Ga0307405_10050448 | 3300031731 | Bacteria | 2577 |
| 584 | Ga0307405_10050941 | 3300031731 | Bacteria | 2567 |
| 585 | Ga0307413_10074386 | 3300031824 | Bacteria | 2151 |
| 586 | Ga0307410_10012458 | 3300031852 | Bacteria | 4920 |
| 587 | Ga0307410_10088032 | 3300031852 | Bacteria | 2198 |
| 588 | Ga0307410_10376759 | 3300031852 | Bacteria | 1141 |
| 589 | Ga0307410_11037767 | 3300031852 | Bacteria | 708 |
| 590 | Ga0307406_10068566 | 3300031901 | Bacteria | 2316 |
| 591 | Ga0307406_10078186 | 3300031901 | Bacteria | 2191 |
| 592 | Ga0307406_11778989 | 3300031901 | Bacteria | 547 |
| 593 | Ga0307407_10001948 | 3300031903 | Bacteria | 7819 |
| 594 | Ga0307407_11153674 | 3300031903 | Bacteria | 604 |
| 595 | Ga0307412_10049701 | 3300031911 | Bacteria | 2764 |
| 596 | Ga0307409_100024427 | 3300031995 | Bacteria | 4215 |
| 597 | Ga0307409_100028580 | 3300031995 | Bacteria | 3975 |
| 598 | Ga0307409_101857677 | 3300031995 | Bacteria | 632 |
| 599 | Ga0307416_100006216 | 3300032002 | Bacteria | 7452 |
| 600 | Ga0307416_100064904 | 3300032002 | Bacteria | 2997 |
| 601 | Ga0307416_100186337 | 3300032002 | Bacteria | 1951 |
| 602 | Ga0307416_100763763 | 3300032002 | Bacteria | 1060 |
| 603 | Ga0307414_10169396 | 3300032004 | Bacteria | 1744 |
| 604 | Ga0307414_10331474 | 3300032004 | Bacteria | 1299 |
| 605 | Ga0307414_10534154 | 3300032004 | Bacteria | 1043 |
| 606 | Ga0307411_10036924 | 3300032005 | Bacteria | 3067 |
| 607 | Ga0307415_100000048 | 3300032126 | Bacteria | 51694 |
| 608 | Ga0307415_100090281 | 3300032126 | Bacteria | 2215 |
| 609 | Ga0373946_0390442 | 3300035171 | Bacteria | 701 |
| 610 | Ga0373962_0212986 | 3300035242 | Bacteria | 658 |
| 611 | Ga0373962_0290574 | 3300035242 | Bacteria | 577 |
| 612 | Ga0373931_0911970 | 3300035691 | Bacteria | 591 |
| 613 | Ga0373931_1179277 | 3300035691 | Unclassified | 524 |
| 614 | Ga0395899_0001267 | 3300037312 | Bacteria | 21969 |
| 615 | Ga0395899_0007849 | 3300037312 | Bacteria | 8223 |
| 616 | Ga0395899_0109697 | 3300037312 | Bacteria | 1985 |
| 617 | Ga0395899_0370342 | 3300037312 | Bacteria | 954 |
| 618 | Ga0395900_0002886 | 3300037418 | Bacteria | 18717 |
| 619 | Ga0395900_0027313 | 3300037418 | Bacteria | 5845 |
| 620 | Ga0395900_0034837 | 3300037418 | Bacteria | 5186 |
| 621 | Ga0395900_0060391 | 3300037418 | Bacteria | 3901 |
| 622 | Ga0395900_0065948 | 3300037418 | Bacteria | 3720 |
| 623 | Ga0395900_0066781 | 3300037418 | Unclassified | 3696 |
| 624 | Ga0395900_0233297 | 3300037418 | Bacteria | 1849 |
| 625 | Ga0395900_0338229 | 3300037418 | Bacteria | 1481 |
| 626 | Ga0395898_0001276 | 3300037466 | Bacteria | 37111 |
| 627 | Ga0395898_0038785 | 3300037466 | Bacteria | 4719 |
| 628 | Ga0395898_0076090 | 3300037466 | Bacteria | 3241 |
| 629 | Ga0395898_0121509 | 3300037466 | Bacteria | 2502 |
| 630 | Ga0395898_0290795 | 3300037466 | Bacteria | 1559 |
| 631 | Ga0395898_0434028 | 3300037466 | Bacteria | 1251 |
| 632 | Ga0395898_0478993 | 3300037466 | Bacteria | 1184 |
| 633 | Ga0395898_1623705 | 3300037466 | Bacteria | 570 |
| 634 | Ga0395905_0001281 | 3300037471 | Bacteria | 31019 |
| 635 | Ga0395905_0018402 | 3300037471 | Bacteria | 6630 |
| 636 | Ga0395905_0064515 | 3300037471 | Bacteria | 3427 |
| 637 | Ga0395905_0323752 | 3300037471 | Unclassified | 1431 |
| 638 | Ga0395905_0647610 | 3300037471 | Bacteria | 958 |
| 639 | Ga0395905_0648832 | 3300037471 | Bacteria | 957 |
| 640 | Ga0395905_0781437 | 3300037471 | Unclassified | 858 |
| 641 | Ga0395905_1375500 | 3300037471 | Bacteria | 610 |
| 642 | Ga0395901_0001957 | 3300038443 | Bacteria | 21190 |
| 643 | Ga0395901_0020142 | 3300038443 | Bacteria | 6826 |
| 644 | Ga0395901_0135873 | 3300038443 | Bacteria | 2584 |
| 645 | Ga0395901_0191483 | 3300038443 | Bacteria | 2145 |
| 646 | Ga0395901_0263620 | 3300038443 | Bacteria | 1793 |
| 647 | Ga0395901_0336015 | 3300038443 | Unclassified | 1561 |
| 648 | Ga0395901_0796873 | 3300038443 | Bacteria | 934 |
| 649 | Ga0395901_0819152 | 3300038443 | Unclassified | 918 |
| 650 | Ga0439439_0060092 | 3300041406 | Bacteria | 1008 |
| 651 | Ga0451807_1804249 | 3300041486 | Bacteria | 559 |
| 652 | Ga0451839_0318159 | 3300041496 | Unclassified | 533 |
| 653 | Ga0451845_0926056 | 3300041501 | Bacteria | 719 |
| 654 | Ga0451849_0021204 | 3300041505 | Bacteria | 1047 |
| 655 | Ga0451853_3202839 | 3300041512 | Bacteria | 2507 |
| 656 | Ga0439448_0106769 | 3300042005 | Unclassified | 954 |
| 657 | Ga0439448_0222463 | 3300042005 | Bacteria | 664 |
| 658 | Ga0439448_0366107 | 3300042005 | Unclassified | 515 |
| 659 | Ga0439456_036207 | 3300042013 | Bacteria | 1064 |
| 660 | Ga0439463_086856 | 3300042016 | Unclassified | 805 |
| 661 | Ga0439463_121816 | 3300042016 | Bacteria | 674 |
| 662 | Ga0450920_064267 | 3300042122 | Bacteria | 743 |
| 663 | Ga0450920_068154 | 3300042122 | Unclassified | 723 |
| 664 | Ga0450923_054348 | 3300042125 | Unclassified | 865 |
| 665 | Ga0450903_066322 | 3300042138 | Bacteria | 522 |
| 666 | Ga0450906_048518 | 3300042145 | Bacteria | 749 |
| 667 | Ga0439446_0090789 | 3300042156 | Bacteria | 956 |
| 668 | Ga0439458_0050149 | 3300042157 | Bacteria | 1029 |
| 669 | Ga0439458_0086793 | 3300042157 | Bacteria | 802 |
| 670 | Ga0439434_0027687 | 3300042435 | Bacteria | 1714 |
| 671 | Ga0439460_0169385 | 3300042461 | Unclassified | 735 |
| 672 | Ga0450916_087189 | 3300042530 | Unclassified | 539 |
| 673 | Ga0450918_005450 | 3300042531 | Bacteria | 2288 |
| 674 | Ga0450918_064542 | 3300042531 | Bacteria | 680 |
| 675 | Ga0451577_0518193 | 3300042876 | Bacteria | 1083 |
| 676 | Ga0466972_0517172 | 3300044658 | Bacteria | 562 |
| 677 | Ga0466965_0573514 | 3300044683 | Bacteria | 639 |
| 678 | Ga0466965_0821123 | 3300044683 | Bacteria | 539 |
| 679 | Ga0466966_0367792 | 3300044684 | Bacteria | 864 |
| 680 | Ga0466963_0041023 | 3300044694 | Bacteria | 3034 |
| 681 | Ga0466963_0196061 | 3300044694 | Bacteria | 1412 |
| 682 | Ga0466968_0097698 | 3300044735 | Bacteria | 1308 |
| 683 | Ga0466957_0218230 | 3300044842 | Unclassified | 1258 |
| 684 | Ga0466960_0020509 | 3300044901 | Bacteria | 2928 |
| 685 | Ga0451576_0207388 | 3300045051 | Unclassified | 2046 |
| 686 | Ga0466967_0063451 | 3300045976 | Bacteria | 3283 |
| 687 | Ga0495617_085647 | 3300046452 | Bacteria | 1031 |
| 688 | Ga0495627_054819 | 3300046453 | Unclassified | 1191 |
| 689 | Ga0495592_0680571 | 3300046454 | Bacteria | 620 |
| 690 | Ga0495603_0013529 | 3300046455 | Bacteria | 4935 |
| 691 | Ga0495603_0046215 | 3300046455 | Bacteria | 2595 |
| 692 | Ga0495590_0112501 | 3300046457 | Bacteria | 972 |
| 693 | Ga0495590_0140363 | 3300046457 | Archaea | 872 |
| 694 | Ga0495641_0098171 | 3300046461 | Bacteria | 1307 |
| 695 | Ga0495582_0028288 | 3300046473 | Bacteria | 3076 |
| 696 | Ga0495605_0100506 | 3300046474 | Bacteria | 1330 |
| 697 | Ga0495605_0168527 | 3300046474 | Bacteria | 968 |
| 698 | Ga0495584_0286789 | 3300046491 | Bacteria | 836 |
| 699 | Ga0495585_0102558 | 3300046492 | Unclassified | 1529 |
| 700 | Ga0495585_0228463 | 3300046492 | Bacteria | 936 |
| 701 | Ga0495596_0071797 | 3300046500 | Bacteria | 1344 |
| 702 | Ga0495596_0083222 | 3300046500 | Bacteria | 1242 |
| 703 | Ga0495596_0101511 | 3300046500 | Unclassified | 1117 |
| 704 | Ga0495596_0154386 | 3300046500 | Bacteria | 892 |
| 705 | Ga0495583_0108090 | 3300046506 | Unclassified | 1181 |
| 706 | Ga0495616_0289418 | 3300046513 | Bacteria | 694 |
| 707 | Ga0495620_0090038 | 3300046515 | Unclassified | 1232 |
| 708 | Ga0495620_0250784 | 3300046515 | Unclassified | 675 |
| 709 | Ga0495631_0110522 | 3300046518 | Bacteria | 1182 |
| 710 | Ga0495632_0373764 | 3300046519 | Bacteria | 625 |
| 711 | Ga0495637_0129783 | 3300046520 | Bacteria | 963 |
| 712 | Ga0495637_0133482 | 3300046520 | Unclassified | 946 |
| 713 | Ga0495643_0333014 | 3300046522 | Bacteria | 684 |
| 714 | Ga0495644_0046431 | 3300046523 | Bacteria | 1632 |
| 715 | Ga0495644_0229737 | 3300046523 | Bacteria | 718 |
| 716 | Ga0495644_0390616 | 3300046523 | Bacteria | 550 |
| 717 | Ga0495663_0004676 | 3300046525 | Bacteria | 3835 |
| 718 | Ga0495663_0040106 | 3300046525 | Unclassified | 1420 |
| 719 | Ga0495663_0149605 | 3300046525 | Bacteria | 796 |
| 720 | Ga0495663_0233650 | 3300046525 | Archaea | 649 |
| 721 | Ga0495642_0430060 | 3300046528 | Unclassified | 583 |
| 722 | Ga0495652_0312872 | 3300046529 | Bacteria | 1137 |
| 723 | Ga0495654_0308257 | 3300046530 | Unclassified | 645 |
| 724 | Ga0495665_0194446 | 3300046531 | Bacteria | 1052 |
| 725 | Ga0495587_0642715 | 3300046536 | Bacteria | 583 |
| 726 | Ga0495598_0012933 | 3300046537 | Bacteria | 2059 |
| 727 | Ga0495598_0407442 | 3300046537 | Bacteria | 532 |
| 728 | Ga0495598_0440279 | 3300046537 | Unclassified | 515 |
| 729 | Ga0495609_0144655 | 3300046538 | Bacteria | 1013 |
| 730 | Ga0495609_0453173 | 3300046538 | Unclassified | 509 |
| 731 | Ga0495621_0074773 | 3300046539 | Unclassified | 1254 |
| 732 | Ga0495621_0155546 | 3300046539 | Bacteria | 902 |
| 733 | Ga0495621_0378071 | 3300046539 | Bacteria | 598 |
| 734 | Ga0495597_0300703 | 3300046542 | Unclassified | 622 |
| 735 | Ga0495597_0318428 | 3300046542 | Bacteria | 601 |
| 736 | Ga0495597_0334741 | 3300046542 | Bacteria | 583 |
| 737 | Ga0495633_0297989 | 3300046558 | Unclassified | 733 |
| 738 | Ga0495656_0137860 | 3300046615 | Unclassified | 1167 |
| 739 | Ga0495656_0242782 | 3300046615 | Bacteria | 907 |
| 740 | Ga0495656_0406429 | 3300046615 | Bacteria | 713 |
| 741 | Ga0495656_0421376 | 3300046615 | Unclassified | 700 |
| 742 | Ga0495668_0378630 | 3300046616 | Unclassified | 777 |
| 743 | Ga0495611_0049281 | 3300046648 | Unclassified | 1895 |
| 744 | Ga0495611_0152182 | 3300046648 | Bacteria | 1080 |
| 745 | Ga0495659_0048780 | 3300046664 | Unclassified | 1535 |
| 746 | Ga0495659_0161064 | 3300046664 | Bacteria | 906 |
| 747 | Ga0495659_0184467 | 3300046664 | Bacteria | 851 |
| 748 | Ga0495661_0308516 | 3300046665 | Bacteria | 790 |
| 749 | Ga0495588_0024053 | 3300046674 | Bacteria | 3023 |
| 750 | Ga0495588_0093632 | 3300046674 | Bacteria | 1575 |
| 751 | Ga0495588_0724431 | 3300046674 | Unclassified | 520 |
| 752 | Ga0495599_0791774 | 3300046678 | Bacteria | 542 |
| 753 | Ga0495669_0273298 | 3300046684 | Bacteria | 812 |
| 754 | Ga0495613_0330815 | 3300046689 | Bacteria | 1050 |
| 755 | Ga0495670_0065142 | 3300046691 | Unclassified | 1836 |
| 756 | Ga0495670_0105833 | 3300046691 | Bacteria | 1453 |
| 757 | Ga0495670_0480464 | 3300046691 | Bacteria | 674 |
| 758 | Ga0495670_0715252 | 3300046691 | Unclassified | 546 |
| 759 | Ga0495671_0374451 | 3300046692 | Unclassified | 682 |
| 760 | Ga0495649_0280587 | 3300046694 | Unclassified | 851 |
| 761 | Ga0495589_0079726 | 3300046794 | Unclassified | 1593 |
| 762 | Ga0495589_0081993 | 3300046794 | Bacteria | 1569 |
| 763 | Ga0495589_0186200 | 3300046794 | Unclassified | 983 |
| 764 | Ga0495589_0248661 | 3300046794 | Bacteria | 831 |
| 765 | Ga0495589_0311574 | 3300046794 | Bacteria | 728 |
| 766 | Ga0495600_0793625 | 3300046809 | Bacteria | 564 |
| 767 | Ga0495660_0079438 | 3300046810 | Bacteria | 1723 |
| 768 | Ga0495581_0283482 | 3300047315 | Bacteria | 968 |
| 769 | Ga0495581_0812960 | 3300047315 | Unclassified | 536 |
| 770 | Ga0495604_0630258 | 3300047317 | Unclassified | 685 |
| 771 | Ga0495636_0154959 | 3300047318 | Bacteria | 1030 |
| 772 | Ga0495676_0023919 | 3300047321 | Bacteria | 5294 |
| 773 | Ga0495680_0303581 | 3300047322 | Unclassified | 1120 |
| 774 | Ga0495683_0370665 | 3300047323 | Bacteria | 601 |
| 775 | Ga0495677_0080032 | 3300047445 | Bacteria | 1224 |
| 776 | Ga0495677_0252653 | 3300047445 | Bacteria | 689 |
| 777 | Ga0495679_074607 | 3300047446 | Bacteria | 971 |
| 778 | Ga0495679_194794 | 3300047446 | Unclassified | 534 |
| 779 | Ga0495673_0267120 | 3300047469 | Unclassified | 621 |
| 780 | Ga0495681_0212711 | 3300047470 | Bacteria | 779 |
| 781 | Ga0495615_0031877 | 3300048090 | Unclassified | 1267 |
| 782 | Ga0495626_0054070 | 3300048091 | Bacteria | 1845 |
| 783 | Ga0495626_0108280 | 3300048091 | Unclassified | 1206 |
| 784 | Ga0496101_0280678 | 3300048904 | Bacteria | 1302 |
| 785 | Ga0496101_1096919 | 3300048904 | Bacteria | 625 |
| 786 | Ga0496102_0028791 | 3300048905 | Bacteria | 4966 |
| 787 | Ga0496102_0423380 | 3300048905 | Bacteria | 1251 |
| 788 | Ga0496102_1732351 | 3300048905 | Bacteria | 542 |
| 789 | Ga0496103_0106691 | 3300048906 | Bacteria | 1777 |
| 790 | Ga0496103_0449432 | 3300048906 | Bacteria | 827 |
| 791 | Ga0496104_0727418 | 3300048907 | Bacteria | 900 |
| 792 | Ga0496104_0860734 | 3300048907 | Bacteria | 812 |
| 793 | Ga0496105_0878004 | 3300048908 | Unclassified | 677 |
| 794 | Ga0496105_0969202 | 3300048908 | Unclassified | 638 |
| 795 | Ga0496106_0120703 | 3300048909 | Bacteria | 2049 |
| 796 | Ga0496106_0175479 | 3300048909 | Bacteria | 1700 |
| 797 | Ga0496106_0482540 | 3300048909 | Bacteria | 996 |
| 798 | Ga0496107_0542351 | 3300048910 | Bacteria | 862 |
| 799 | Ga0496107_0752435 | 3300048910 | Bacteria | 715 |
| 800 | Ga0496108_0040312 | 3300048911 | Bacteria | 3892 |
| 801 | Ga0496108_0068710 | 3300048911 | Bacteria | 2989 |
| 802 | Ga0496108_0299078 | 3300048911 | Bacteria | 1402 |
| 803 | Ga0496108_1068807 | 3300048911 | Unclassified | 687 |
| 804 | Ga0496109_0022743 | 3300048912 | Bacteria | 5554 |
| 805 | Ga0496109_0060318 | 3300048912 | Bacteria | 3466 |
| 806 | Ga0496109_0127383 | 3300048912 | Bacteria | 2374 |
| 807 | Ga0496109_0277844 | 3300048912 | Bacteria | 1578 |
| 808 | Ga0496109_0337591 | 3300048912 | Bacteria | 1423 |
| 809 | Ga0496109_1564420 | 3300048912 | Unclassified | 594 |
| 810 | Ga0496110_0001407 | 3300048913 | Bacteria | 17382 |
| 811 | Ga0496110_0127487 | 3300048913 | Bacteria | 2296 |
| 812 | Ga0496110_0230115 | 3300048913 | Bacteria | 1686 |
| 813 | Ga0496110_0287119 | 3300048913 | Bacteria | 1498 |
| 814 | Ga0496110_0304871 | 3300048913 | Bacteria | 1451 |
| 815 | Ga0496111_0000429 | 3300048914 | Bacteria | 21251 |
| 816 | Ga0496111_0021603 | 3300048914 | Bacteria | 4497 |
| 817 | Ga0496111_0295934 | 3300048914 | Bacteria | 1200 |
| 818 | Ga0496111_0300145 | 3300048914 | Bacteria | 1191 |
| 819 | Ga0496111_1336123 | 3300048914 | Unclassified | 504 |
| 820 | Ga0496112_0133792 | 3300048915 | Bacteria | 2450 |
| 821 | Ga0496112_0175855 | 3300048915 | Bacteria | 2106 |
| 822 | Ga0496113_0090032 | 3300048916 | Bacteria | 2363 |
| 823 | Ga0496113_0119174 | 3300048916 | Bacteria | 2062 |
| 824 | Ga0496113_0350260 | 3300048916 | Bacteria | 1185 |
| 825 | Ga0496113_1092764 | 3300048916 | Unclassified | 626 |
| 826 | Ga0496113_1141349 | 3300048916 | Unclassified | 610 |
| 827 | Ga0496114_1307762 | 3300048917 | Bacteria | 612 |
| 828 | Ga0496115_1456003 | 3300048918 | Unclassified | 503 |
| 829 | Ga0501031_0017526 | 3300049568 | Bacteria | 4655 |
| 830 | Ga0501031_0091998 | 3300049568 | Bacteria | 1979 |
| 831 | Ga0501031_0303888 | 3300049568 | Unclassified | 1034 |
| 832 | Ga0501032_0024682 | 3300049569 | Bacteria | 4148 |
| 833 | Ga0501032_0184612 | 3300049569 | Bacteria | 1365 |
| 834 | Ga0501032_0225685 | 3300049569 | Bacteria | 1218 |
| 835 | Ga0501032_0240974 | 3300049569 | Bacteria | 1175 |
| 836 | Ga0501033_0020457 | 3300049570 | Bacteria | 4999 |
| 837 | Ga0501033_0085797 | 3300049570 | Bacteria | 2305 |
| 838 | Ga0501033_0277089 | 3300049570 | Bacteria | 1185 |
| 839 | Ga0501033_0709822 | 3300049570 | Bacteria | 684 |
| 840 | Ga0501034_0235388 | 3300049571 | Bacteria | 1779 |
| 841 | Ga0501034_0458509 | 3300049571 | Bacteria | 1192 |
| 842 | Ga0501034_0943534 | 3300049571 | Bacteria | 749 |
| 843 | Ga0501036_0010942 | 3300049572 | Bacteria | 7500 |
| 844 | Ga0501036_0061610 | 3300049572 | Bacteria | 3178 |
| 845 | Ga0501036_0099059 | 3300049572 | Bacteria | 2465 |
| 846 | Ga0501036_0145794 | 3300049572 | Bacteria | 1997 |
| 847 | Ga0501036_0395671 | 3300049572 | Bacteria | 1153 |
| 848 | Ga0501036_0471274 | 3300049572 | Bacteria | 1045 |
| 849 | Ga0501036_0881109 | 3300049572 | Unclassified | 735 |
| 850 | Ga0501037_0224497 | 3300049573 | Bacteria | 1320 |
| 851 | Ga0501037_0305204 | 3300049573 | Bacteria | 1104 |
| 852 | Ga0501037_0435921 | 3300049573 | Bacteria | 895 |
| 853 | Ga0501037_1148808 | 3300049573 | Unclassified | 502 |
| 854 | Ga0501038_0022437 | 3300049574 | Bacteria | 5656 |
| 855 | Ga0501038_0027917 | 3300049574 | Bacteria | 5016 |
| 856 | Ga0501038_0334649 | 3300049574 | Bacteria | 1182 |
| 857 | Ga0501038_0424149 | 3300049574 | Bacteria | 1026 |
| 858 | Ga0501038_1326751 | 3300049574 | Bacteria | 519 |
| 859 | Ga0501039_0002212 | 3300049575 | Bacteria | 14387 |
| 860 | Ga0501039_0032683 | 3300049575 | Bacteria | 4012 |
| 861 | Ga0501039_0095908 | 3300049575 | Bacteria | 2312 |
| 862 | Ga0501039_0243431 | 3300049575 | Bacteria | 1414 |
| 863 | Ga0501039_0254316 | 3300049575 | Bacteria | 1381 |
| 864 | Ga0501039_0902689 | 3300049575 | Bacteria | 688 |
| 865 | Ga0501040_0004806 | 3300049576 | Bacteria | 8754 |
| 866 | Ga0501040_0026839 | 3300049576 | Bacteria | 3875 |
| 867 | Ga0501040_0037267 | 3300049576 | Bacteria | 3303 |
| 868 | Ga0501040_0077947 | 3300049576 | Bacteria | 2293 |
| 869 | Ga0501040_0139227 | 3300049576 | Bacteria | 1709 |
| 870 | Ga0501040_0181381 | 3300049576 | Bacteria | 1493 |
| 871 | Ga0501040_0476048 | 3300049576 | Bacteria | 899 |
| 872 | Ga0501040_0480602 | 3300049576 | Bacteria | 895 |
| 873 | Ga0501040_0750421 | 3300049576 | Bacteria | 706 |
| 874 | Ga0501040_1068370 | 3300049576 | Bacteria | 585 |
| 875 | Ga0501041_0005164 | 3300049577 | Bacteria | 7618 |
| 876 | Ga0501041_0019292 | 3300049577 | Bacteria | 4071 |
| 877 | Ga0501041_0049701 | 3300049577 | Bacteria | 2554 |
| 878 | Ga0501041_0084776 | 3300049577 | Bacteria | 1953 |
| 879 | Ga0501041_0188418 | 3300049577 | Bacteria | 1292 |
| 880 | Ga0501041_0286064 | 3300049577 | Bacteria | 1038 |
| 881 | Ga0501041_0485140 | 3300049577 | Bacteria | 786 |
| 882 | Ga0501042_0018108 | 3300049578 | Bacteria | 4872 |
| 883 | Ga0501042_0026164 | 3300049578 | Bacteria | 4102 |
| 884 | Ga0501042_0165086 | 3300049578 | Unclassified | 1598 |
| 885 | Ga0501042_0175223 | 3300049578 | Bacteria | 1547 |
| 886 | Ga0501042_0279120 | 3300049578 | Bacteria | 1206 |
| 887 | Ga0501042_0538576 | 3300049578 | Bacteria | 848 |
| 888 | Ga0501042_0612707 | 3300049578 | Bacteria | 791 |
| 889 | Ga0501043_0068028 | 3300049579 | Bacteria | 2796 |
| 890 | Ga0501043_0216553 | 3300049579 | Bacteria | 1483 |
| 891 | Ga0501043_0292045 | 3300049579 | Bacteria | 1248 |
| 892 | Ga0501046_0012761 | 3300049580 | Bacteria | 7146 |
| 893 | Ga0501046_0078450 | 3300049580 | Bacteria | 2554 |
| 894 | Ga0501046_0100480 | 3300049580 | Bacteria | 2220 |
| 895 | Ga0501047_0251004 | 3300049581 | Bacteria | 1618 |
| 896 | Ga0501048_0006302 | 3300049582 | Bacteria | 9022 |
| 897 | Ga0501048_0042274 | 3300049582 | Bacteria | 3263 |
| 898 | Ga0501048_0142440 | 3300049582 | Bacteria | 1695 |
| 899 | Ga0501048_0169398 | 3300049582 | Bacteria | 1547 |
| 900 | Ga0501048_0871857 | 3300049582 | Bacteria | 647 |
| 901 | Ga0501048_0976338 | 3300049582 | Bacteria | 609 |
| 902 | Ga0501048_1114084 | 3300049582 | Bacteria | 568 |
| 903 | Ga0501067_0019768 | 3300049583 | Bacteria | 3728 |
| 904 | Ga0501067_0033431 | 3300049583 | Bacteria | 2853 |
| 905 | Ga0501067_0034302 | 3300049583 | Bacteria | 2816 |
| 906 | Ga0501067_0052225 | 3300049583 | Bacteria | 2265 |
| 907 | Ga0501067_0074138 | 3300049583 | Bacteria | 1886 |
| 908 | Ga0501067_0124915 | 3300049583 | Bacteria | 1432 |
| 909 | Ga0501067_0638256 | 3300049583 | Unclassified | 598 |
| 910 | Ga0501067_0655592 | 3300049583 | Bacteria | 589 |
| 911 | Ga0501068_0008679 | 3300049584 | Bacteria | 5667 |
| 912 | Ga0501068_0013162 | 3300049584 | Bacteria | 4703 |
| 913 | Ga0501068_0030506 | 3300049584 | Bacteria | 3198 |
| 914 | Ga0501068_0043231 | 3300049584 | Bacteria | 2710 |
| 915 | Ga0501068_0080912 | 3300049584 | Unclassified | 1993 |
| 916 | Ga0501068_0124228 | 3300049584 | Bacteria | 1611 |
| 917 | Ga0501068_0138056 | 3300049584 | Bacteria | 1527 |
| 918 | Ga0501068_0152299 | 3300049584 | Bacteria | 1454 |
| 919 | Ga0501068_0536747 | 3300049584 | Bacteria | 760 |
| 920 | Ga0501068_0799758 | 3300049584 | Unclassified | 618 |
| 921 | Ga0501068_1067745 | 3300049584 | Bacteria | 534 |
| 922 | Ga0501069_0007796 | 3300049585 | Bacteria | 5622 |
| 923 | Ga0501069_0022300 | 3300049585 | Bacteria | 3443 |
| 924 | Ga0501069_0040981 | 3300049585 | Bacteria | 2558 |
| 925 | Ga0501069_0046889 | 3300049585 | Bacteria | 2398 |
| 926 | Ga0501069_0149432 | 3300049585 | Bacteria | 1342 |
| 927 | Ga0501069_0169046 | 3300049585 | Bacteria | 1261 |
| 928 | Ga0501069_0703316 | 3300049585 | Unclassified | 610 |
| 929 | Ga0501069_0867439 | 3300049585 | Unclassified | 548 |
| 930 | Ga0501070_0020654 | 3300049586 | Bacteria | 5524 |
| 931 | Ga0501070_0048989 | 3300049586 | Bacteria | 3508 |
| 932 | Ga0501070_0176336 | 3300049586 | Bacteria | 1760 |
| 933 | Ga0501070_0412799 | 3300049586 | Bacteria | 1091 |
| 934 | Ga0501070_0645325 | 3300049586 | Bacteria | 841 |
| 935 | Ga0501070_0936911 | 3300049586 | Bacteria | 674 |
| 936 | Ga0501071_0018405 | 3300049587 | Bacteria | 4835 |
| 937 | Ga0501071_0024160 | 3300049587 | Bacteria | 4249 |
| 938 | Ga0501071_0028681 | 3300049587 | Bacteria | 3924 |
| 939 | Ga0501071_0047047 | 3300049587 | Bacteria | 3099 |
| 940 | Ga0501071_0211396 | 3300049587 | Bacteria | 1459 |
| 941 | Ga0501071_0234140 | 3300049587 | Unclassified | 1384 |
| 942 | Ga0501071_0280880 | 3300049587 | Bacteria | 1260 |
| 943 | Ga0501071_0326348 | 3300049587 | Bacteria | 1166 |
| 944 | Ga0501071_0364117 | 3300049587 | Bacteria | 1101 |
| 945 | Ga0501071_0397214 | 3300049587 | Bacteria | 1052 |
| 946 | Ga0501071_0397854 | 3300049587 | Bacteria | 1051 |
| 947 | Ga0501071_0463586 | 3300049587 | Bacteria | 970 |
| 948 | Ga0501071_0565713 | 3300049587 | Bacteria | 873 |
| 949 | Ga0501071_0654296 | 3300049587 | Bacteria | 808 |
| 950 | Ga0501071_0677326 | 3300049587 | Bacteria | 794 |
| 951 | Ga0501071_1267531 | 3300049587 | Unclassified | 569 |
| 952 | Ga0501071_1271416 | 3300049587 | Unclassified | 568 |
| 953 | Ga0501072_0033625 | 3300049588 | Bacteria | 4018 |
| 954 | Ga0501072_0042269 | 3300049588 | Bacteria | 3580 |
| 955 | Ga0501072_0224443 | 3300049588 | Bacteria | 1497 |
| 956 | Ga0501072_0281226 | 3300049588 | Bacteria | 1323 |
| 957 | Ga0501072_0357610 | 3300049588 | Unclassified | 1159 |
| 958 | Ga0501072_0413755 | 3300049588 | Unclassified | 1069 |
| 959 | Ga0501072_0417534 | 3300049588 | Bacteria | 1064 |
| 960 | Ga0501072_0439181 | 3300049588 | Bacteria | 1034 |
| 961 | Ga0501072_0456171 | 3300049588 | Bacteria | 1012 |
| 962 | Ga0501072_0656734 | 3300049588 | Bacteria | 825 |
| 963 | Ga0501072_0846546 | 3300049588 | Bacteria | 715 |
| 964 | Ga0501072_0998220 | 3300049588 | Bacteria | 652 |
| 965 | Ga0501072_1206708 | 3300049588 | Unclassified | 587 |
| 966 | Ga0501073_0107039 | 3300049589 | Bacteria | 1940 |
| 967 | Ga0501073_0147229 | 3300049589 | Bacteria | 1632 |
| 968 | Ga0501074_0006126 | 3300049590 | Bacteria | 8687 |
| 969 | Ga0501074_0013466 | 3300049590 | Bacteria | 5947 |
| 970 | Ga0501074_0104953 | 3300049590 | Bacteria | 2023 |
| 971 | Ga0501074_0162554 | 3300049590 | Bacteria | 1595 |
| 972 | Ga0501074_0210731 | 3300049590 | Bacteria | 1384 |
| 973 | Ga0501074_0507914 | 3300049590 | Bacteria | 854 |
| 974 | Ga0501074_0928348 | 3300049590 | Bacteria | 612 |
| 975 | Ga0501074_1079707 | 3300049590 | Unclassified | 564 |
| 976 | Ga0501075_0003679 | 3300049591 | Bacteria | 10284 |
| 977 | Ga0501075_0013849 | 3300049591 | Bacteria | 5767 |
| 978 | Ga0501075_0115636 | 3300049591 | Bacteria | 2039 |
| 979 | Ga0501075_0243998 | 3300049591 | Bacteria | 1369 |
| 980 | Ga0501075_0262271 | 3300049591 | Bacteria | 1317 |
| 981 | Ga0501075_0534090 | 3300049591 | Bacteria | 895 |
| 982 | Ga0501075_0707745 | 3300049591 | Unclassified | 767 |
| 983 | Ga0501075_0936112 | 3300049591 | Unclassified | 658 |
| 984 | Ga0501075_1197469 | 3300049591 | Unclassified | 576 |
| 985 | Ga0501076_0008472 | 3300049592 | Bacteria | 7536 |
| 986 | Ga0501076_0015191 | 3300049592 | Bacteria | 5816 |
| 987 | Ga0501076_0016399 | 3300049592 | Bacteria | 5617 |
| 988 | Ga0501076_0016982 | 3300049592 | Bacteria | 5525 |
| 989 | Ga0501076_0100138 | 3300049592 | Bacteria | 2335 |
| 990 | Ga0501076_0132771 | 3300049592 | Bacteria | 2020 |
| 991 | Ga0501076_0146069 | 3300049592 | Bacteria | 1923 |
| 992 | Ga0501076_0157680 | 3300049592 | Unclassified | 1848 |
| 993 | Ga0501076_0159606 | 3300049592 | Bacteria | 1837 |
| 994 | Ga0501076_0219158 | 3300049592 | Bacteria | 1555 |
| 995 | Ga0501076_0244055 | 3300049592 | Bacteria | 1469 |
| 996 | Ga0501076_0329809 | 3300049592 | Bacteria | 1252 |
| 997 | Ga0501076_0427588 | 3300049592 | Bacteria | 1090 |
| 998 | Ga0501076_0456519 | 3300049592 | Unclassified | 1052 |
| 999 | Ga0501076_0665851 | 3300049592 | Unclassified | 859 |
| 1000 | Ga0501077_0022574 | 3300049593 | Bacteria | 3986 |
| 1001 | Ga0501077_0041065 | 3300049593 | Bacteria | 2946 |
| 1002 | Ga0501077_0318572 | 3300049593 | Bacteria | 991 |
| 1003 | Ga0501077_0348603 | 3300049593 | Bacteria | 945 |
| 1004 | Ga0501077_0774112 | 3300049593 | Bacteria | 617 |
| 1005 | Ga0501227_161066 | 3300049665 | Bacteria | 624 |
| 1006 | Ga0501079_0006082 | 3300049741 | Bacteria | 9046 |
| 1007 | Ga0501079_0022587 | 3300049741 | Bacteria | 4825 |
| 1008 | Ga0501079_0154836 | 3300049741 | Bacteria | 1786 |
| 1009 | Ga0501079_0160189 | 3300049741 | Bacteria | 1755 |
| 1010 | Ga0501079_0238403 | 3300049741 | Bacteria | 1421 |
| 1011 | Ga0501079_0273204 | 3300049741 | Bacteria | 1321 |
| 1012 | Ga0501079_0457698 | 3300049741 | Bacteria | 1002 |
| 1013 | Ga0501079_0484261 | 3300049741 | Unclassified | 972 |
| 1014 | Ga0501079_0980480 | 3300049741 | Bacteria | 666 |
| 1015 | Ga0501079_1100036 | 3300049741 | Bacteria | 626 |
| 1016 | Ga0501079_1336632 | 3300049741 | Bacteria | 564 |
| 1017 | Ga0501080_0002972 | 3300049742 | Bacteria | 14917 |
| 1018 | Ga0501080_0035360 | 3300049742 | Bacteria | 4662 |
| 1019 | Ga0501080_0156880 | 3300049742 | Bacteria | 2102 |
| 1020 | Ga0501080_0308322 | 3300049742 | Bacteria | 1435 |
| 1021 | Ga0501080_0520091 | 3300049742 | Bacteria | 1062 |
| 1022 | Ga0501080_0911245 | 3300049742 | Bacteria | 766 |
| 1023 | Ga0501080_0932329 | 3300049742 | Bacteria | 756 |
| 1024 | Ga0501080_1770544 | 3300049742 | Bacteria | 520 |
| 1025 | Ga0501081_0016817 | 3300049743 | Bacteria | 4835 |
| 1026 | Ga0501081_0030270 | 3300049743 | Bacteria | 3663 |
| 1027 | Ga0501081_0067384 | 3300049743 | Bacteria | 2491 |
| 1028 | Ga0501081_0082457 | 3300049743 | Bacteria | 2253 |
| 1029 | Ga0501081_0083996 | 3300049743 | Bacteria | 2233 |
| 1030 | Ga0501081_0172817 | 3300049743 | Bacteria | 1560 |
| 1031 | Ga0501081_0388053 | 3300049743 | Bacteria | 1033 |
| 1032 | Ga0501081_0446074 | 3300049743 | Unclassified | 961 |
| 1033 | Ga0501081_0965591 | 3300049743 | Bacteria | 643 |
| 1034 | Ga0501081_1035808 | 3300049743 | Bacteria | 620 |
| 1035 | Ga0501081_1373756 | 3300049743 | Bacteria | 536 |
| 1036 | Ga0501083_0021679 | 3300049744 | Bacteria | 4462 |
| 1037 | Ga0501083_0033656 | 3300049744 | Bacteria | 3508 |
| 1038 | Ga0501083_0438702 | 3300049744 | Bacteria | 850 |
| 1039 | Ga0501083_0594524 | 3300049744 | Bacteria | 720 |
| 1040 | Ga0501083_0796336 | 3300049744 | Bacteria | 615 |
| 1041 | Ga0501083_0947818 | 3300049744 | Bacteria | 560 |
| 1042 | Ga0501035_0027926 | 3300049822 | Bacteria | 5155 |
| 1043 | Ga0501035_0045420 | 3300049822 | Bacteria | 3952 |
| 1044 | Ga0501035_0163984 | 3300049822 | Bacteria | 1923 |
| 1045 | Ga0501035_0556547 | 3300049822 | Bacteria | 939 |
| 1046 | Ga0501035_1039394 | 3300049822 | Unclassified | 642 |
| 1047 | Ga0501044_0080565 | 3300049823 | Bacteria | 3298 |
| 1048 | Ga0501044_0210408 | 3300049823 | Bacteria | 1899 |
| 1049 | Ga0501045_0007918 | 3300049824 | Bacteria | 7400 |
| 1050 | Ga0501045_0009197 | 3300049824 | Bacteria | 6904 |
| 1051 | Ga0501045_0071952 | 3300049824 | Bacteria | 2545 |
| 1052 | Ga0501045_0087248 | 3300049824 | Bacteria | 2303 |
| 1053 | Ga0501045_0797633 | 3300049824 | Bacteria | 695 |
| 1054 | Ga0501045_0981993 | 3300049824 | Unclassified | 619 |
| 1055 | Ga0501045_1211452 | 3300049824 | Bacteria | 551 |
| 1056 | Ga0501212_023168 | 3300049851 | Bacteria | 972 |
| 1057 | nmdc:mga00v17_223732_c1 | 3300050491 | Bacteria | 1219 |
| 1058 | nmdc:mga0yw44_35698_c1 | 3300050492 | Bacteria | 2924 |
| 1059 | nmdc:mga0yw44_87545_c1 | 3300050492 | Unclassified | 1963 |
| 1060 | nmdc:mga05p37_1383058_c1 | 3300050507 | Unclassified | 710 |
| 1061 | nmdc:mga05p37_1515997_c1 | 3300050507 | Bacteria | 666 |
| 1062 | nmdc:mga05p37_1775211_c1 | 3300050507 | Unclassified | 597 |
| 1063 | nmdc:mga05p37_19483_c1 | 3300050507 | Bacteria | 8206 |
| 1064 | nmdc:mga05p37_215759_c1 | 3300050507 | Bacteria | 2318 |
| 1065 | nmdc:mga05p37_24671_c1 | 3300050507 | Bacteria | 7309 |
| 1066 | nmdc:mga05p37_399062_c1 | 3300050507 | Bacteria | 1606 |
| 1067 | nmdc:mga05p37_442608_c1 | 3300050507 | Bacteria | 1507 |
| 1068 | nmdc:mga05p37_5798_c1 | 3300050507 | Bacteria | 14515 |
| 1069 | nmdc:mga09592_36637_c1 | 3300050508 | Bacteria | 4109 |
| 1070 | nmdc:mga09592_37133_c1 | 3300050508 | Bacteria | 4085 |
| 1071 | nmdc:mga09592_420676_c1 | 3300050508 | Bacteria | 1154 |
| 1072 | nmdc:mga09592_65927_c1 | 3300050508 | Bacteria | 3068 |
| 1073 | nmdc:mga0qj67_103939_c1 | 3300050509 | Bacteria | 2291 |
| 1074 | nmdc:mga0qj67_121664_c1 | 3300050509 | Bacteria | 2112 |
| 1075 | nmdc:mga0qj67_1333152_c1 | 3300050509 | Unclassified | 555 |
| 1076 | nmdc:mga0qj67_492082_c1 | 3300050509 | Bacteria | 986 |
| 1077 | nmdc:mga06r32_1446085_c1 | 3300050510 | Unclassified | 628 |
| 1078 | nmdc:mga06r32_317855_c1 | 3300050510 | Bacteria | 1542 |
| 1079 | nmdc:mga06r32_51565_c1 | 3300050510 | Bacteria | 3938 |
| 1080 | nmdc:mga06r32_735327_c1 | 3300050510 | Bacteria | 950 |
| 1081 | nmdc:mga08y16_1002010_c1 | 3300050511 | Unclassified | 815 |
| 1082 | nmdc:mga08y16_221056_c1 | 3300050511 | Bacteria | 1961 |
| 1083 | nmdc:mga08y16_272307_c1 | 3300050511 | Bacteria | 1747 |
| 1084 | nmdc:mga08y16_37087_c1 | 3300050511 | Bacteria | 5119 |
| 1085 | nmdc:mga08y16_556171_c1 | 3300050511 | Bacteria | 1161 |
| 1086 | nmdc:mga08y16_685307_c1 | 3300050511 | Bacteria | 1026 |
| 1087 | nmdc:mga08y16_685895_c1 | 3300050511 | Bacteria | 1026 |
| 1088 | nmdc:mga0n895_1293621_c1 | 3300050512 | Unclassified | 700 |
| 1089 | nmdc:mga0n895_1549327_c1 | 3300050512 | Unclassified | 628 |
| 1090 | nmdc:mga0n895_357403_c1 | 3300050512 | Bacteria | 1479 |
| 1091 | nmdc:mga0n895_594457_c1 | 3300050512 | Bacteria | 1109 |
| 1092 | nmdc:mga0n895_69227_c1 | 3300050512 | Bacteria | 3496 |
| 1093 | nmdc:mga0rr50_107620_c1 | 3300050513 | Bacteria | 2201 |
| 1094 | nmdc:mga0rr50_172342_c2 | 3300050513 | Unclassified | 1331 |
| 1095 | nmdc:mga08x19_1118743_c1 | 3300050514 | Unclassified | 559 |
| 1096 | nmdc:mga08x19_1154895_c1 | 3300050514 | Unclassified | 549 |
| 1097 | nmdc:mga08x19_149941_c1 | 3300050514 | Unclassified | 1578 |
| 1098 | nmdc:mga08x19_303502_c1 | 3300050514 | Bacteria | 1109 |
| 1099 | nmdc:mga08x19_41118_c1 | 3300050514 | Bacteria | 2944 |
| 1100 | nmdc:mga08x19_54456_c1 | 3300050514 | Bacteria | 2575 |
| 1101 | nmdc:mga0a205_216054_c1 | 3300050515 | Bacteria | 1804 |
| 1102 | nmdc:mga0a205_257589_c1 | 3300050515 | Unclassified | 1623 |
| 1103 | nmdc:mga0a205_4243_c1 | 3300050515 | Bacteria | 12854 |
| 1104 | nmdc:mga0a205_704131_c1 | 3300050515 | Bacteria | 860 |
| 1105 | nmdc:mga0a205_716096_c1 | 3300050515 | Unclassified | 850 |
| 1106 | Ga0495601_0529968 | 3300053077 | Bacteria | 759 |
| 1107 | Ga0495655_0043766 | 3300053083 | Bacteria | 1155 |
| 1108 | Ga0495655_0055670 | 3300053083 | Unclassified | 1062 |
| 1109 | Ga0495655_0159155 | 3300053083 | Bacteria | 715 |
| 1110 | Ga0501084_0009849 | 3300054114 | Bacteria | 7898 |
| 1111 | Ga0501084_0015159 | 3300054114 | Bacteria | 6391 |
| 1112 | Ga0501084_0035388 | 3300054114 | Bacteria | 4174 |
| 1113 | Ga0501084_0052553 | 3300054114 | Bacteria | 3409 |
| 1114 | Ga0501084_0113678 | 3300054114 | Bacteria | 2276 |
| 1115 | Ga0501084_0120403 | 3300054114 | Bacteria | 2207 |
| 1116 | Ga0501084_0243077 | 3300054114 | Bacteria | 1519 |
| 1117 | Ga0501084_0356317 | 3300054114 | Bacteria | 1236 |
| 1118 | Ga0501084_0358930 | 3300054114 | Bacteria | 1231 |
| 1119 | Ga0501084_0447723 | 3300054114 | Unclassified | 1092 |
| 1120 | Ga0501084_0564612 | 3300054114 | Bacteria | 961 |
| 1121 | Ga0501084_0577369 | 3300054114 | Unclassified | 950 |
| 1122 | Ga0501084_0646050 | 3300054114 | Bacteria | 893 |
| 1123 | Ga0501084_0880093 | 3300054114 | Bacteria | 753 |
| 1124 | Ga0501084_1023443 | 3300054114 | Bacteria | 694 |
| 1125 | Ga0501084_1032644 | 3300054114 | Bacteria | 691 |
| 1126 | Ga0501082_0002353 | 3300060353 | Bacteria | 16550 |
| 1127 | Ga0501082_0044473 | 3300060353 | Bacteria | 3830 |
| 1128 | Ga0501082_0054855 | 3300060353 | Bacteria | 3435 |
| 1129 | Ga0501082_0175257 | 3300060353 | Bacteria | 1864 |
| 1130 | Ga0501082_0176791 | 3300060353 | Bacteria | 1856 |
| 1131 | Ga0501082_0183806 | 3300060353 | Bacteria | 1819 |
| 1132 | Ga0501082_0219797 | 3300060353 | Bacteria | 1653 |
| 1133 | Ga0501082_0232665 | 3300060353 | Unclassified | 1604 |
| 1134 | Ga0501082_0238964 | 3300060353 | Bacteria | 1581 |
| 1135 | Ga0501082_0310428 | 3300060353 | Bacteria | 1373 |
| 1136 | Ga0501082_0333275 | 3300060353 | Unclassified | 1322 |
| 1137 | Ga0501082_0385491 | 3300060353 | Bacteria | 1223 |
| 1138 | Ga0501082_0856855 | 3300060353 | Bacteria | 795 |
| 1139 | Ga0501082_0999306 | 3300060353 | Bacteria | 731 |
| 1140 | Ga0501082_1001569 | 3300060353 | Bacteria | 731 |
| 1141 | Ga0501082_1224263 | 3300060353 | Bacteria | 656 |
| 1142 | Ga0501082_1238717 | 3300060353 | Bacteria | 652 |
| 1143 | Ga0501082_1834074 | 3300060353 | Bacteria | 529 |
| 1144 | Ga0530510_0029888 | 3300061734 | Bacteria | 3912 |
| 1145 | Ga0530510_0042376 | 3300061734 | Bacteria | 3289 |
| 1146 | Ga0530510_0150317 | 3300061734 | Bacteria | 1719 |
| 1147 | Ga0530510_0169347 | 3300061734 | Bacteria | 1618 |
| 1148 | Ga0530510_0184121 | 3300061734 | Bacteria | 1549 |
| 1149 | Ga0530510_0205172 | 3300061734 | Bacteria | 1465 |
| 1150 | Ga0530510_0205550 | 3300061734 | Bacteria | 1463 |
| 1151 | Ga0530510_0267187 | 3300061734 | Bacteria | 1276 |
| 1152 | Ga0530510_0317083 | 3300061734 | Unclassified | 1168 |
| 1153 | Ga0530510_0390892 | 3300061734 | Bacteria | 1047 |
| 1154 | Ga0530510_0487394 | 3300061734 | Bacteria | 934 |
| 1155 | Ga0530510_0497253 | 3300061734 | Unclassified | 924 |
| 1156 | Ga0530510_0515465 | 3300061734 | Bacteria | 907 |
| 1157 | Ga0530510_0883189 | 3300061734 | Unclassified | 683 |
| 1158 | Ga0530510_1211853 | 3300061734 | Bacteria | 579 |
| 1159 | Ga0530510_1505255 | 3300061734 | Bacteria | 517 |
| 1160 | Ga0530510_1540627 | 3300061734 | Bacteria | 510 |
| 1161 | Ga0496114_0385645 | |||
| 1162 | ARSoilYngRDRAFT_c03869 | |||
| 1163 | ARcpr5yngRDRAFT_c004304 | |||
| 1164 | ARSoilOldRDRAFT_c002253 | |||
| 1165 | ARCol0yngRDRAFT_1003723 | |||
| 1166 | JGI24744J21845_10065760 | |||
| 1167 | JGI24033J26618_1022814 | |||
| 1168 | JGI24751J29686_10023172 | |||
| 1169 | JGI25406J46586_10104778 | |||
| 1170 | rootH2_10071422 | |||
| 1171 | rootL2_10040196 | |||
| 1172 | Ga0058860_11509346 | |||
| 1173 | Ga0070658_10008374 | |||
| 1174 | Ga0070658_10551943 | |||
| 1175 | Ga0070658_11358569 | |||
| 1176 | Ga0070676_10266110 | |||
| 1177 | Ga0070676_10407999 | |||
| 1178 | Ga0070683_100037857 | |||
| 1179 | Ga0070683_100102866 | |||
| 1180 | Ga0070683_100103528 | |||
| 1181 | Ga0070683_100130023 | |||
| 1182 | Ga0070683_100507894 | |||
| 1183 | Ga0070683_100525014 | |||
| 1184 | Ga0070683_101204746 | |||
| 1185 | Ga0070670_100001301 | |||
| 1186 | Ga0070670_100125655 | |||
| 1187 | Ga0070670_100883783 | |||
| 1188 | Ga0068869_100301087 | |||
| 1189 | Ga0068869_100750244 | |||
| 1190 | Ga0070680_100020158 | |||
| 1191 | Ga0070680_100126947 | |||
| 1192 | Ga0070680_100333749 | |||
| 1193 | Ga0070680_100373401 | |||
| 1194 | Ga0070680_101573002 | |||
| 1195 | Ga0070682_100103411 | |||
| 1196 | Ga0070682_100219665 | |||
| 1197 | Ga0070682_100543301 | |||
| 1198 | Ga0068868_100120012 | |||
| 1199 | Ga0068868_100361933 | |||
| 1200 | Ga0068868_100772725 | |||
| 1201 | Ga0070660_100016342 | |||
| 1202 | Ga0070660_100612089 | |||
| 1203 | Ga0070660_100994314 | |||
| 1204 | Ga0070660_101424199 | |||
| 1205 | Ga0070660_101527020 | |||
| 1206 | Ga0070689_100050025 | |||
| 1207 | Ga0070689_100235485 | |||
| 1208 | Ga0070689_101656022 | |||
| 1209 | Ga0070691_10135354 | |||
| 1210 | Ga0070691_10179864 | |||
| 1211 | Ga0070687_100157581 | |||
| 1212 | Ga0070687_100585681 | |||
| 1213 | Ga0070661_100229374 | |||
| 1214 | Ga0070661_100239943 | |||
| 1215 | Ga0070661_100300406 | |||
| 1216 | Ga0070661_101451515 | |||
| 1217 | Ga0070692_10009786 | |||
| 1218 | Ga0070668_100321546 | |||
| 1219 | Ga0070668_100919385 | |||
| 1220 | Ga0070669_100223550 | |||
| 1221 | Ga0070669_100407918 | |||
| 1222 | Ga0070669_101070545 | |||
| 1223 | Ga0070669_101730012 | |||
| 1224 | Ga0070675_100046193 | |||
| 1225 | Ga0070675_100200288 | |||
| 1226 | Ga0070675_100918025 | |||
| 1227 | Ga0070674_100003504 | |||
| 1228 | Ga0070674_100036141 | |||
| 1229 | Ga0070674_100081411 | |||
| 1230 | Ga0070674_100156721 | |||
| 1231 | Ga0070674_100255346 | |||
| 1232 | Ga0070674_100781979 | |||
| 1233 | Ga0070673_100068448 | |||
| 1234 | Ga0070673_101609535 | |||
| 1235 | Ga0070688_100002904 | |||
| 1236 | Ga0070659_100351870 | |||
| 1237 | Ga0070659_100425065 | |||
| 1238 | Ga0070659_101190245 | |||
| 1239 | Ga0070667_102333135 | |||
| 1240 | Ga0070714_100331440 | |||
| 1241 | Ga0070701_10148499 | |||
| 1242 | Ga0070701_10418642 | |||
| 1243 | Ga0070701_10481625 | |||
| 1244 | Ga0070701_10518137 | |||
| 1245 | Ga0070701_11036797 | |||
| 1246 | Ga0070701_11123273 | |||
| 1247 | Ga0070711_100683099 | |||
| 1248 | Ga0070711_101161858 | |||
| 1249 | Ga0070705_100802049 | |||
| 1250 | Ga0070700_100533381 | |||
| 1251 | Ga0070700_100761905 | |||
| 1252 | Ga0070700_100830572 | |||
| 1253 | Ga0070700_101356317 | |||
| 1254 | Ga0070694_101390200 | |||
| 1255 | Ga0070708_100474977 | |||
| 1256 | Ga0070663_100427979 | |||
| 1257 | Ga0070678_100041082 | |||
| 1258 | Ga0070678_100043835 | |||
| 1259 | Ga0070678_100317860 | |||
| 1260 | Ga0070678_101180906 | |||
| 1261 | Ga0070662_100253411 | |||
| 1262 | Ga0070662_100295276 | |||
| 1263 | Ga0070681_10079765 | |||
| 1264 | Ga0070681_10303323 | |||
| 1265 | Ga0070681_10356085 | |||
| 1266 | Ga0070681_10943718 | |||
| 1267 | Ga0068867_100089836 | |||
| 1268 | Ga0068867_100181897 | |||
| 1269 | Ga0068867_100441348 | |||
| 1270 | Ga0068867_100564383 | |||
| 1271 | Ga0068867_101153566 | |||
| 1272 | Ga0068867_101700904 | |||
| 1273 | Ga0070685_10007193 | |||
| 1274 | Ga0070685_10183543 | |||
| 1275 | Ga0070685_10351105 | |||
| 1276 | Ga0070685_10394768 | |||
| 1277 | Ga0070699_100104231 | |||
| 1278 | Ga0070699_102186667 | |||
| 1279 | Ga0070679_100028843 | |||
| 1280 | Ga0070679_100068458 | |||
| 1281 | Ga0070679_100174876 | |||
| 1282 | Ga0070679_100320188 | |||
| 1283 | Ga0070684_100021957 | |||
| 1284 | Ga0070684_100027954 | |||
| 1285 | Ga0070684_100033420 | |||
| 1286 | Ga0070684_100068165 | |||
| 1287 | Ga0070684_100070931 | |||
| 1288 | Ga0070684_100089953 | |||
| 1289 | Ga0070684_100129098 | |||
| 1290 | Ga0070684_100134494 | |||
| 1291 | Ga0070684_100136570 | |||
| 1292 | Ga0070684_100593465 | |||
| 1293 | Ga0070684_100752755 | |||
| 1294 | Ga0070684_101023050 | |||
| 1295 | Ga0070684_101329322 | |||
| 1296 | Ga0070697_100997591 | |||
| 1297 | Ga0068853_100078651 | |||
| 1298 | Ga0068853_100098678 | |||
| 1299 | Ga0068853_100100648 | |||
| 1300 | Ga0070672_100509507 | |||
| 1301 | Ga0070672_100565938 | |||
| 1302 | Ga0070672_100636693 | |||
| 1303 | Ga0070672_101113242 | |||
| 1304 | Ga0070672_101261169 | |||
| 1305 | Ga0070686_100148829 | |||
| 1306 | Ga0070686_100200261 | |||
| 1307 | Ga0070686_100601243 | |||
| 1308 | Ga0070695_100028444 | |||
| 1309 | Ga0070695_100335062 | |||
| 1310 | Ga0070696_100112797 | |||
| 1311 | Ga0070693_100048091 | |||
| 1312 | Ga0070693_100060007 | |||
| 1313 | Ga0070693_100122335 | |||
| 1314 | Ga0070693_100744495 | |||
| 1315 | Ga0070693_100746455 | |||
| 1316 | Ga0070693_100804718 | |||
| 1317 | Ga0070665_100027593 | |||
| 1318 | Ga0070704_100040624 | |||
| 1319 | Ga0070704_100265538 | |||
| 1320 | Ga0068855_100034552 | |||
| 1321 | Ga0068855_100688794 | |||
| 1322 | Ga0068855_101221327 | |||
| 1323 | Ga0070664_100061983 | |||
| 1324 | Ga0070664_100121618 | |||
| 1325 | Ga0070664_100308032 | |||
| 1326 | Ga0070664_100600117 | |||
| 1327 | Ga0070664_100625950 | |||
| 1328 | Ga0070664_100728979 | |||
| 1329 | Ga0070664_101464425 | |||
| 1330 | Ga0070664_102125861 | |||
| 1331 | Ga0070664_102134198 | |||
| 1332 | Ga0068857_100052275 | |||
| 1333 | Ga0068857_100073839 | |||
| 1334 | Ga0068857_100154574 | |||
| 1335 | Ga0068857_100335696 | |||
| 1336 | Ga0068857_100352293 | |||
| 1337 | Ga0068857_100883461 | |||
| 1338 | Ga0068857_101158083 | |||
| 1339 | Ga0068854_100065623 | |||
| 1340 | Ga0068854_100083986 | |||
| 1341 | Ga0068854_100574823 | |||
| 1342 | Ga0068856_100133345 | |||
| 1343 | Ga0070702_100086712 | |||
| 1344 | Ga0070702_100280009 | |||
| 1345 | Ga0070702_100354406 | |||
| 1346 | Ga0070702_100813596 | |||
| 1347 | Ga0068852_100112286 | |||
| 1348 | Ga0068852_101153500 | |||
| 1349 | Ga0068859_101792894 | |||
| 1350 | Ga0068864_100125522 | |||
| 1351 | Ga0068864_101393888 | |||
| 1352 | Ga0068864_102370575 | |||
| 1353 | Ga0068866_10036005 | |||
| 1354 | Ga0068861_100308882 | |||
| 1355 | Ga0068861_100312646 | |||
| 1356 | Ga0068861_100859923 | |||
| 1357 | Ga0068861_102154543 | |||
| 1358 | Ga0068851_10358625 | |||
| 1359 | Ga0068851_10499731 | |||
| 1360 | Ga0068870_10000314 | |||
| 1361 | Ga0068870_10093905 | |||
| 1362 | Ga0068870_10359043 | |||
| 1363 | Ga0068858_100521033 | |||
| 1364 | Ga0068858_101076723 | |||
| 1365 | Ga0068860_100829038 | |||
| 1366 | Ga0068860_101073424 | |||
| 1367 | Ga0068862_100332626 | |||
| 1368 | Ga0068862_100954823 | |||
| 1369 | Ga0081455_10006933 | |||
| 1370 | Ga0081455_10022098 | |||
| 1371 | Ga0081455_10045327 | |||
| 1372 | Ga0081455_10147563 | |||
| 1373 | Ga0081455_10184313 | |||
| 1374 | Ga0081455_10259983 | |||
| 1375 | Ga0081455_10321337 | |||
| 1376 | Ga0081455_10331918 | |||
| 1377 | Ga0081455_10516061 | |||
| 1378 | Ga0081455_10550496 | |||
| 1379 | Ga0081455_10649104 | |||
| 1380 | Ga0081538_10049846 | |||
| 1381 | Ga0081538_10128433 | |||
| 1382 | Ga0081539_10010651 | |||
| 1383 | Ga0081539_10158747 | |||
| 1384 | Ga0075365_10084679 | |||
| 1385 | Ga0075365_10306601 | |||
| 1386 | Ga0075364_10078387 | |||
| 1387 | Ga0075364_10493385 | |||
| 1388 | Ga0075432_10112650 | |||
| 1389 | Ga0097621_100442884 | |||
| 1390 | Ga0097621_101201728 | |||
| 1391 | Ga0068871_100122618 | |||
| 1392 | Ga0068871_101815974 | |||
| 1393 | Ga0075428_100001303 | |||
| 1394 | Ga0075428_100034856 | |||
| 1395 | Ga0075428_100088862 | |||
| 1396 | Ga0075428_100099485 | |||
| 1397 | Ga0075428_100995469 | |||
| 1398 | Ga0075430_100012393 | |||
| 1399 | Ga0075430_100033910 | |||
| 1400 | Ga0075430_100302656 | |||
| 1401 | Ga0075430_101802463 | |||
| 1402 | Ga0075431_100002708 | |||
| 1403 | Ga0075431_100568439 | |||
| 1404 | Ga0075431_101106383 | |||
| 1405 | Ga0075433_10123536 | |||
| 1406 | Ga0075433_10470356 | |||
| 1407 | Ga0075433_10485944 | |||
| 1408 | Ga0075433_10651745 | |||
| 1409 | Ga0075433_10776089 | |||
| 1410 | Ga0075434_100047520 | |||
| 1411 | Ga0075434_100423707 | |||
| 1412 | Ga0075434_101780842 | |||
| 1413 | Ga0075434_101930691 | |||
| 1414 | Ga0075429_100032058 | |||
| 1415 | Ga0075429_100049289 | |||
| 1416 | Ga0075429_100063378 | |||
| 1417 | Ga0075429_100067690 | |||
| 1418 | Ga0068865_100131240 | |||
| 1419 | Ga0068865_100184103 | |||
| 1420 | Ga0068865_100279574 | |||
| 1421 | Ga0068865_100428041 | |||
| 1422 | Ga0068865_100527831 | |||
| 1423 | Ga0068865_100563172 | |||
| 1424 | Ga0068865_101082435 | |||
| 1425 | Ga0068865_101192904 | |||
| 1426 | Ga0075436_100034374 | |||
| 1427 | Ga0075436_100186227 | |||
| 1428 | Ga0097620_101793142 | |||
| 1429 | Ga0075435_100845124 | |||
| 1430 | Ga0075435_101971977 | |||
| 1431 | Ga0105240_10056968 | |||
| 1432 | Ga0105240_11267498 | |||
| 1433 | Ga0111539_10003299 | |||
| 1434 | Ga0111539_10004030 | |||
| 1435 | Ga0111539_10006384 | |||
| 1436 | Ga0111539_10043904 | |||
| 1437 | Ga0111539_10143609 | |||
| 1438 | Ga0111539_10186756 | |||
| 1439 | Ga0111539_10571106 | |||
| 1440 | Ga0111539_10887431 | |||
| 1441 | Ga0111539_10896376 | |||
| 1442 | Ga0111539_10988800 | |||
| 1443 | Ga0105245_10013227 | |||
| 1444 | Ga0105245_10015075 | |||
| 1445 | Ga0105245_10029446 | |||
| 1446 | Ga0105245_10134576 | |||
| 1447 | Ga0105245_10196789 | |||
| 1448 | Ga0105245_10375936 | |||
| 1449 | Ga0105245_11509357 | |||
| 1450 | Ga0105245_12335388 | |||
| 1451 | Ga0105247_11213972 | |||
| 1452 | Ga0114129_10010739 | |||
| 1453 | Ga0114129_10044815 | |||
| 1454 | Ga0114129_10160423 | |||
| 1455 | Ga0114129_10363852 | |||
| 1456 | Ga0114129_10422564 | |||
| 1457 | Ga0114129_10952676 | |||
| 1458 | Ga0114129_11098605 | |||
| 1459 | Ga0114129_11784119 | |||
| 1460 | Ga0114129_11816537 | |||
| 1461 | Ga0114129_11954222 | |||
| 1462 | Ga0114129_12108078 | |||
| 1463 | Ga0114129_12871667 | |||
| 1464 | Ga0114129_13193677 | |||
| 1465 | Ga0105243_10089998 | |||
| 1466 | Ga0105243_10103030 | |||
| 1467 | Ga0105243_10222820 | |||
| 1468 | Ga0105243_10354291 | |||
| 1469 | Ga0105243_10406725 | |||
| 1470 | Ga0105243_10733933 | |||
| 1471 | Ga0105243_10734701 | |||
| 1472 | Ga0105243_11501754 | |||
| 1473 | Ga0105243_11640183 | |||
| 1474 | Ga0105241_10748508 | |||
| 1475 | Ga0105241_11927793 | |||
| 1476 | Ga0105242_10052183 | |||
| 1477 | Ga0105242_10112254 | |||
| 1478 | Ga0105242_10178987 | |||
| 1479 | Ga0105242_10353535 | |||
| 1480 | Ga0105242_11664473 | |||
| 1481 | Ga0105242_12713597 | |||
| 1482 | Ga0105248_10076402 | |||
| 1483 | Ga0105248_11680983 | |||
| 1484 | Ga0105249_10083457 | |||
| 1485 | Ga0105249_10100359 | |||
| 1486 | Ga0105249_10171797 | |||
| 1487 | Ga0105249_10271389 | |||
| 1488 | Ga0105249_11195266 | |||
| 1489 | Ga0105249_12443964 | |||
| 1490 | Ga0105249_13496306 | |||
| 1491 | Ga0105239_10061175 | |||
| 1492 | Ga0105239_10088866 | |||
| 1493 | Ga0105239_10096392 | |||
| 1494 | Ga0105239_10154842 | |||
| 1495 | Ga0105239_13218489 | |||
| 1496 | Ga0105246_10025997 | |||
| 1497 | Ga0105246_10139771 | |||
| 1498 | Ga0105246_10175203 | |||
| 1499 | Ga0105246_10333983 | |||
| 1500 | Ga0105246_10351532 | |||
| 1501 | Ga0105246_10365596 | |||
| 1502 | Ga0105246_10743007 | |||
| 1503 | Ga0105246_10975591 | |||
| 1504 | Ga0105246_11682063 | |||
| 1505 | Ga0105246_12351164 | |||
| 1506 | Ga0157342_1062535 | |||
| 1507 | Ga0157373_10596717 | |||
| 1508 | Ga0157373_10881182 | |||
| 1509 | Ga0157371_10149916 | |||
| 1510 | Ga0157370_10033295 | |||
| 1511 | Ga0157370_10350013 | |||
| 1512 | Ga0157370_10573459 | |||
| 1513 | Ga0157374_10984962 | |||
| 1514 | Ga0157374_11662497 | |||
| 1515 | Ga0157374_12802303 | |||
| 1516 | Ga0157378_10719185 | |||
| 1517 | Ga0157378_11717905 | |||
| 1518 | Ga0163162_10334291 | |||
| 1519 | Ga0163162_10341744 | |||
| 1520 | Ga0163162_13319678 | |||
| 1521 | Ga0157372_10172325 | |||
| 1522 | Ga0157375_10951958 | |||
| 1523 | Ga0157375_11413949 | |||
| 1524 | Ga0157375_11506130 | |||
| 1525 | Ga0157375_11548347 | |||
| 1526 | Ga0157375_11686417 | |||
| 1527 | Ga0163163_10196044 | |||
| 1528 | Ga0157380_10273875 | |||
| 1529 | Ga0157380_10307737 | |||
| 1530 | Ga0157380_11150343 | |||
| 1531 | Ga0157380_12988236 | |||
| 1532 | Ga0157377_10059463 | |||
| 1533 | Ga0157377_10064493 | |||
| 1534 | Ga0157377_10517929 | |||
| 1535 | Ga0157377_11380409 | |||
| 1536 | Ga0157379_10371995 | |||
| 1537 | Ga0157376_10532420 | |||
| 1538 | Ga0157376_10824899 | |||
| 1539 | Ga0157376_11203027 | |||
| 1540 | Ga0163161_10571931 | |||
| 1541 | Ga0163161_11122300 | |||
| 1542 | Ga0197907_10085909 | |||
| 1543 | Ga0206356_11077094 | |||
| 1544 | Ga0206356_11105661 | |||
| 1545 | Ga0206355_1025702 | |||
| 1546 | Ga0206355_1160160 | |||
| 1547 | Ga0206352_11172591 | |||
| 1548 | Ga0206350_10334532 | |||
| 1549 | Ga0206354_10793628 | |||
| 1550 | Ga0206354_11430998 | |||
| 1551 | Ga0206353_10828983 | |||
| 1552 | Ga0206353_11822418 | |||
| 1553 | Ga0206353_11909465 | |||
| 1554 | Ga0206353_11930517 | |||
| 1555 | Ga0154015_1632745 | |||
| 1556 | Ga0224712_10129633 | |||
| 1557 | Ga0207682_10434040 | |||
| 1558 | Ga0207642_10202870 | |||
| 1559 | Ga0207642_10449887 | |||
| 1560 | Ga0207710_10647796 | |||
| 1561 | Ga0207688_10001991 | |||
| 1562 | Ga0207688_10024376 | |||
| 1563 | Ga0207688_10091080 | |||
| 1564 | Ga0207688_10233448 | |||
| 1565 | Ga0207688_10627789 | |||
| 1566 | Ga0207680_11144248 | |||
| 1567 | Ga0207647_10264398 | |||
| 1568 | Ga0207647_10460521 | |||
| 1569 | Ga0207645_10040177 | |||
| 1570 | Ga0207645_10155157 | |||
| 1571 | Ga0207645_10259557 | |||
| 1572 | Ga0207645_10831474 | |||
| 1573 | Ga0207643_10002509 | |||
| 1574 | Ga0207643_10008679 | |||
| 1575 | Ga0207643_10026604 | |||
| 1576 | Ga0207643_10085602 | |||
| 1577 | Ga0207643_10244095 | |||
| 1578 | Ga0207643_11105561 | |||
| 1579 | Ga0207705_10111197 | |||
| 1580 | Ga0207705_10718579 | |||
| 1581 | Ga0207705_11226465 | |||
| 1582 | Ga0207684_11673760 | |||
| 1583 | Ga0207654_10713073 | |||
| 1584 | Ga0207707_10039946 | |||
| 1585 | Ga0207707_10076138 | |||
| 1586 | Ga0207707_10119502 | |||
| 1587 | Ga0207707_11274483 | |||
| 1588 | Ga0207707_11558423 | |||
| 1589 | Ga0207695_10529602 | |||
| 1590 | Ga0207695_11101380 | |||
| 1591 | Ga0207663_11002107 | |||
| 1592 | Ga0207660_10051686 | |||
| 1593 | Ga0207660_10162583 | |||
| 1594 | Ga0207660_10227258 | |||
| 1595 | Ga0207660_10240319 | |||
| 1596 | Ga0207660_10463547 | |||
| 1597 | Ga0207662_10222222 | |||
| 1598 | Ga0207657_10000054 | |||
| 1599 | Ga0207657_10254646 | |||
| 1600 | Ga0207657_10705595 | |||
| 1601 | Ga0207657_10759290 | |||
| 1602 | Ga0207649_10085355 | |||
| 1603 | Ga0207649_10171418 | |||
| 1604 | Ga0207649_10291676 | |||
| 1605 | Ga0207649_10845844 | |||
| 1606 | Ga0207649_10859341 | |||
| 1607 | Ga0207649_10929413 | |||
| 1608 | Ga0207652_10033046 | |||
| 1609 | Ga0207652_10074422 | |||
| 1610 | Ga0207652_10108706 | |||
| 1611 | Ga0207652_10704876 | |||
| 1612 | Ga0207652_10989795 | |||
| 1613 | Ga0207681_10714654 | |||
| 1614 | Ga0207650_10007062 | |||
| 1615 | Ga0207650_10165300 | |||
| 1616 | Ga0207659_10155495 | |||
| 1617 | Ga0207659_10291846 | |||
| 1618 | Ga0207659_10813420 | |||
| 1619 | Ga0207659_11295080 | |||
| 1620 | Ga0207687_10012184 | |||
| 1621 | Ga0207687_10099918 | |||
| 1622 | Ga0207687_10204167 | |||
| 1623 | Ga0207687_10915436 | |||
| 1624 | Ga0207687_11610264 | |||
| 1625 | Ga0207664_10011249 | |||
| 1626 | Ga0207664_10567371 | |||
| 1627 | Ga0207690_10221492 | |||
| 1628 | Ga0207706_10063067 | |||
| 1629 | Ga0207706_10116957 | |||
| 1630 | Ga0207706_10561091 | |||
| 1631 | Ga0207686_10549569 | |||
| 1632 | Ga0207686_10555364 | |||
| 1633 | Ga0207686_11623723 | |||
| 1634 | Ga0207709_10067618 | |||
| 1635 | Ga0207709_10837245 | |||
| 1636 | Ga0207709_10899644 | |||
| 1637 | Ga0207670_10624877 | |||
| 1638 | Ga0207670_11237922 | |||
| 1639 | Ga0207669_10066597 | |||
| 1640 | Ga0207669_10104921 | |||
| 1641 | Ga0207669_10254974 | |||
| 1642 | Ga0207669_10344698 | |||
| 1643 | Ga0207669_10720788 | |||
| 1644 | Ga0207669_11529408 | |||
| 1645 | Ga0207704_10099604 | |||
| 1646 | Ga0207704_10162040 | |||
| 1647 | Ga0207704_10197928 | |||
| 1648 | Ga0207704_10354543 | |||
| 1649 | Ga0207704_10779764 | |||
| 1650 | Ga0207691_10063570 | |||
| 1651 | Ga0207691_10465928 | |||
| 1652 | Ga0207691_10602484 | |||
| 1653 | Ga0207691_10608664 | |||
| 1654 | Ga0207689_10023381 | |||
| 1655 | Ga0207689_10027661 | |||
| 1656 | Ga0207689_10589648 | |||
| 1657 | Ga0207689_10784014 | |||
| 1658 | Ga0207661_10007306 | |||
| 1659 | Ga0207661_10039832 | |||
| 1660 | Ga0207661_10043058 | |||
| 1661 | Ga0207661_10064710 | |||
| 1662 | Ga0207661_10073776 | |||
| 1663 | Ga0207661_10100031 | |||
| 1664 | Ga0207661_10258994 | |||
| 1665 | Ga0207679_10091288 | |||
| 1666 | Ga0207679_10250932 | |||
| 1667 | Ga0207679_10514052 | |||
| 1668 | Ga0207679_10622403 | |||
| 1669 | Ga0207679_10680872 | |||
| 1670 | Ga0207679_10915438 | |||
| 1671 | Ga0207679_12085320 | |||
| 1672 | Ga0207667_10015039 | |||
| 1673 | Ga0207667_11136832 | |||
| 1674 | Ga0207667_11659602 | |||
| 1675 | Ga0207667_12096909 | |||
| 1676 | Ga0207712_10083469 | |||
| 1677 | Ga0207712_10103665 | |||
| 1678 | Ga0207712_10250607 | |||
| 1679 | Ga0207712_11704001 | |||
| 1680 | Ga0207668_10077833 | |||
| 1681 | Ga0207668_10207128 | |||
| 1682 | Ga0207668_11060362 | |||
| 1683 | Ga0207640_10108593 | |||
| 1684 | Ga0207640_10857812 | |||
| 1685 | Ga0207677_10144452 | |||
| 1686 | Ga0207677_10294225 | |||
| 1687 | Ga0207677_10554268 | |||
| 1688 | Ga0207677_10630911 | |||
| 1689 | Ga0207677_11252898 | |||
| 1690 | Ga0207703_11063014 | |||
| 1691 | Ga0207639_10225586 | |||
| 1692 | Ga0207639_10277708 | |||
| 1693 | Ga0207639_11065630 | |||
| 1694 | Ga0207639_11572892 | |||
| 1695 | Ga0207678_10157709 | |||
| 1696 | Ga0207678_11757252 | |||
| 1697 | Ga0207678_11809559 | |||
| 1698 | Ga0207708_10058798 | |||
| 1699 | Ga0207708_10389622 | |||
| 1700 | Ga0207708_11088043 | |||
| 1701 | Ga0207702_10460933 | |||
| 1702 | Ga0207702_12068355 | |||
| 1703 | Ga0207641_10801404 | |||
| 1704 | Ga0207648_10069046 | |||
| 1705 | Ga0207648_10129248 | |||
| 1706 | Ga0207648_10213047 | |||
| 1707 | Ga0207648_10290811 | |||
| 1708 | Ga0207648_10387792 | |||
| 1709 | Ga0207648_10833752 | |||
| 1710 | Ga0207648_11499738 | |||
| 1711 | Ga0207676_10598686 | |||
| 1712 | Ga0207676_10778309 | |||
| 1713 | Ga0207676_11581384 | |||
| 1714 | Ga0207674_10002093 | |||
| 1715 | Ga0207674_10018243 | |||
| 1716 | Ga0207674_10059218 | |||
| 1717 | Ga0207674_10145617 | |||
| 1718 | Ga0207674_10151009 | |||
| 1719 | Ga0207674_10446753 | |||
| 1720 | Ga0207675_100105767 | |||
| 1721 | Ga0207675_100110180 | |||
| 1722 | Ga0207675_100401490 | |||
| 1723 | Ga0207683_10015569 | |||
| 1724 | Ga0207683_10041072 | |||
| 1725 | Ga0207683_10271837 | |||
| 1726 | Ga0207683_10420899 | |||
| 1727 | Ga0207683_10905603 | |||
| 1728 | Ga0207683_11071811 | |||
| 1729 | Ga0207683_11126103 | |||
| 1730 | Ga0207698_10056700 | |||
| 1731 | Ga0207698_10095721 | |||
| 1732 | Ga0207428_10000401 | |||
| 1733 | Ga0207428_10009137 | |||
| 1734 | Ga0207428_10050027 | |||
| 1735 | Ga0207428_10109876 | |||
| 1736 | Ga0207428_10306901 | |||
| 1737 | Ga0207428_10389957 | |||
| 1738 | Ga0268266_12155903 | |||
| 1739 | Ga0268265_10545035 | |||
| 1740 | Ga0268265_11832194 | |||
| 1741 | Ga0268264_11166965 | |||
| 1742 | Ga0307408_100133628 | |||
| 1743 | Ga0307405_10050448 | |||
| 1744 | Ga0307405_10050941 | |||
| 1745 | Ga0307413_10074386 | |||
| 1746 | Ga0307410_10012458 | |||
| 1747 | Ga0307410_10088032 | |||
| 1748 | Ga0307410_10376759 | |||
| 1749 | Ga0307410_11037767 | |||
| 1750 | Ga0307406_10068566 | |||
| 1751 | Ga0307406_10078186 | |||
| 1752 | Ga0307406_11778989 | |||
| 1753 | Ga0307407_10001948 | |||
| 1754 | Ga0307407_11153674 | |||
| 1755 | Ga0307412_10049701 | |||
| 1756 | Ga0307409_100024427 | |||
| 1757 | Ga0307409_100028580 | |||
| 1758 | Ga0307409_101857677 | |||
| 1759 | Ga0307416_100006216 | |||
| 1760 | Ga0307416_100064904 | |||
| 1761 | Ga0307416_100186337 | |||
| 1762 | Ga0307416_100763763 | |||
| 1763 | Ga0307414_10169396 | |||
| 1764 | Ga0307414_10331474 | |||
| 1765 | Ga0307414_10534154 | |||
| 1766 | Ga0307411_10036924 | |||
| 1767 | Ga0307415_100000048 | |||
| 1768 | Ga0307415_100090281 | |||
| 1769 | Ga0373946_0390442 | |||
| 1770 | Ga0373962_0212986 | |||
| 1771 | Ga0373962_0290574 | |||
| 1772 | Ga0373931_0911970 | |||
| 1773 | Ga0373931_1179277 | |||
| 1774 | Ga0395899_0001267 | |||
| 1775 | Ga0395899_0007849 | |||
| 1776 | Ga0395899_0109697 | |||
| 1777 | Ga0395899_0370342 | |||
| 1778 | Ga0395900_0002886 | |||
| 1779 | Ga0395900_0027313 | |||
| 1780 | Ga0395900_0034837 | |||
| 1781 | Ga0395900_0060391 | |||
| 1782 | Ga0395900_0065948 | |||
| 1783 | Ga0395900_0066781 | |||
| 1784 | Ga0395900_0233297 | |||
| 1785 | Ga0395900_0338229 | |||
| 1786 | Ga0395898_0001276 | |||
| 1787 | Ga0395898_0038785 | |||
| 1788 | Ga0395898_0076090 | |||
| 1789 | Ga0395898_0121509 | |||
| 1790 | Ga0395898_0290795 | |||
| 1791 | Ga0395898_0434028 | |||
| 1792 | Ga0395898_0478993 | |||
| 1793 | Ga0395898_1623705 | |||
| 1794 | Ga0395905_0001281 | |||
| 1795 | Ga0395905_0018402 | |||
| 1796 | Ga0395905_0064515 | |||
| 1797 | Ga0395905_0323752 | |||
| 1798 | Ga0395905_0647610 | |||
| 1799 | Ga0395905_0648832 | |||
| 1800 | Ga0395905_0781437 | |||
| 1801 | Ga0395905_1375500 | |||
| 1802 | Ga0395901_0001957 | |||
| 1803 | Ga0395901_0020142 | |||
| 1804 | Ga0395901_0135873 | |||
| 1805 | Ga0395901_0191483 | |||
| 1806 | Ga0395901_0263620 | |||
| 1807 | Ga0395901_0336015 | |||
| 1808 | Ga0395901_0796873 | |||
| 1809 | Ga0395901_0819152 | |||
| 1810 | Ga0439439_0060092 | |||
| 1811 | Ga0451807_1804249 | |||
| 1812 | Ga0451839_0318159 | |||
| 1813 | Ga0451845_0926056 | |||
| 1814 | Ga0451849_0021204 | |||
| 1815 | Ga0451853_3202839 | |||
| 1816 | Ga0439448_0106769 | |||
| 1817 | Ga0439448_0222463 | |||
| 1818 | Ga0439448_0366107 | |||
| 1819 | Ga0439456_036207 | |||
| 1820 | Ga0439463_086856 | |||
| 1821 | Ga0439463_121816 | |||
| 1822 | Ga0450920_064267 | |||
| 1823 | Ga0450920_068154 | |||
| 1824 | Ga0450923_054348 | |||
| 1825 | Ga0450903_066322 | |||
| 1826 | Ga0450906_048518 | |||
| 1827 | Ga0439446_0090789 | |||
| 1828 | Ga0439458_0050149 | |||
| 1829 | Ga0439458_0086793 | |||
| 1830 | Ga0439434_0027687 | |||
| 1831 | Ga0439460_0169385 | |||
| 1832 | Ga0450916_087189 | |||
| 1833 | Ga0450918_005450 | |||
| 1834 | Ga0450918_064542 | |||
| 1835 | Ga0451577_0518193 | |||
| 1836 | Ga0466972_0517172 | |||
| 1837 | Ga0466965_0573514 | |||
| 1838 | Ga0466965_0821123 | |||
| 1839 | Ga0466966_0367792 | |||
| 1840 | Ga0466963_0041023 | |||
| 1841 | Ga0466963_0196061 | |||
| 1842 | Ga0466968_0097698 | |||
| 1843 | Ga0466957_0218230 | |||
| 1844 | Ga0466960_0020509 | |||
| 1845 | Ga0451576_0207388 | |||
| 1846 | Ga0466967_0063451 | |||
| 1847 | Ga0495617_085647 | |||
| 1848 | Ga0495627_054819 | |||
| 1849 | Ga0495592_0680571 | |||
| 1850 | Ga0495603_0013529 | |||
| 1851 | Ga0495603_0046215 | |||
| 1852 | Ga0495590_0112501 | |||
| 1853 | Ga0495590_0140363 | |||
| 1854 | Ga0495641_0098171 | |||
| 1855 | Ga0495582_0028288 | |||
| 1856 | Ga0495605_0100506 | |||
| 1857 | Ga0495605_0168527 | |||
| 1858 | Ga0495584_0286789 | |||
| 1859 | Ga0495585_0102558 | |||
| 1860 | Ga0495585_0228463 | |||
| 1861 | Ga0495596_0071797 | |||
| 1862 | Ga0495596_0083222 | |||
| 1863 | Ga0495596_0101511 | |||
| 1864 | Ga0495596_0154386 | |||
| 1865 | Ga0495583_0108090 | |||
| 1866 | Ga0495616_0289418 | |||
| 1867 | Ga0495620_0090038 | |||
| 1868 | Ga0495620_0250784 | |||
| 1869 | Ga0495631_0110522 | |||
| 1870 | Ga0495632_0373764 | |||
| 1871 | Ga0495637_0129783 | |||
| 1872 | Ga0495637_0133482 | |||
| 1873 | Ga0495643_0333014 | |||
| 1874 | Ga0495644_0046431 | |||
| 1875 | Ga0495644_0229737 | |||
| 1876 | Ga0495644_0390616 | |||
| 1877 | Ga0495663_0004676 | |||
| 1878 | Ga0495663_0040106 | |||
| 1879 | Ga0495663_0149605 | |||
| 1880 | Ga0495663_0233650 | |||
| 1881 | Ga0495642_0430060 | |||
| 1882 | Ga0495652_0312872 | |||
| 1883 | Ga0495654_0308257 | |||
| 1884 | Ga0495665_0194446 | |||
| 1885 | Ga0495587_0642715 | |||
| 1886 | Ga0495598_0012933 | |||
| 1887 | Ga0495598_0407442 | |||
| 1888 | Ga0495598_0440279 | |||
| 1889 | Ga0495609_0144655 | |||
| 1890 | Ga0495609_0453173 | |||
| 1891 | Ga0495621_0074773 | |||
| 1892 | Ga0495621_0155546 | |||
| 1893 | Ga0495621_0378071 | |||
| 1894 | Ga0495597_0300703 | |||
| 1895 | Ga0495597_0318428 | |||
| 1896 | Ga0495597_0334741 | |||
| 1897 | Ga0495633_0297989 | |||
| 1898 | Ga0495656_0137860 | |||
| 1899 | Ga0495656_0242782 | |||
| 1900 | Ga0495656_0406429 | |||
| 1901 | Ga0495656_0421376 | |||
| 1902 | Ga0495668_0378630 | |||
| 1903 | Ga0495611_0049281 | |||
| 1904 | Ga0495611_0152182 | |||
| 1905 | Ga0495659_0048780 | |||
| 1906 | Ga0495659_0161064 | |||
| 1907 | Ga0495659_0184467 | |||
| 1908 | Ga0495661_0308516 | |||
| 1909 | Ga0495588_0024053 | |||
| 1910 | Ga0495588_0093632 | |||
| 1911 | Ga0495588_0724431 | |||
| 1912 | Ga0495599_0791774 | |||
| 1913 | Ga0495669_0273298 | |||
| 1914 | Ga0495613_0330815 | |||
| 1915 | Ga0495670_0065142 | |||
| 1916 | Ga0495670_0105833 | |||
| 1917 | Ga0495670_0480464 | |||
| 1918 | Ga0495670_0715252 | |||
| 1919 | Ga0495671_0374451 | |||
| 1920 | Ga0495649_0280587 | |||
| 1921 | Ga0495589_0079726 | |||
| 1922 | Ga0495589_0081993 | |||
| 1923 | Ga0495589_0186200 | |||
| 1924 | Ga0495589_0248661 | |||
| 1925 | Ga0495589_0311574 | |||
| 1926 | Ga0495600_0793625 | |||
| 1927 | Ga0495660_0079438 | |||
| 1928 | Ga0495581_0283482 | |||
| 1929 | Ga0495581_0812960 | |||
| 1930 | Ga0495604_0630258 | |||
| 1931 | Ga0495636_0154959 | |||
| 1932 | Ga0495676_0023919 | |||
| 1933 | Ga0495680_0303581 | |||
| 1934 | Ga0495683_0370665 | |||
| 1935 | Ga0495677_0080032 | |||
| 1936 | Ga0495677_0252653 | |||
| 1937 | Ga0495679_074607 | |||
| 1938 | Ga0495679_194794 | |||
| 1939 | Ga0495673_0267120 | |||
| 1940 | Ga0495681_0212711 | |||
| 1941 | Ga0495615_0031877 | |||
| 1942 | Ga0495626_0054070 | |||
| 1943 | Ga0495626_0108280 | |||
| 1944 | Ga0496101_0280678 | |||
| 1945 | Ga0496101_1096919 | |||
| 1946 | Ga0496102_0028791 | |||
| 1947 | Ga0496102_0423380 | |||
| 1948 | Ga0496102_1732351 | |||
| 1949 | Ga0496103_0106691 | |||
| 1950 | Ga0496103_0449432 | |||
| 1951 | Ga0496104_0727418 | |||
| 1952 | Ga0496104_0860734 | |||
| 1953 | Ga0496105_0878004 | |||
| 1954 | Ga0496105_0969202 | |||
| 1955 | Ga0496106_0120703 | |||
| 1956 | Ga0496106_0175479 | |||
| 1957 | Ga0496106_0482540 | |||
| 1958 | Ga0496107_0542351 | |||
| 1959 | Ga0496107_0752435 | |||
| 1960 | Ga0496108_0040312 | |||
| 1961 | Ga0496108_0068710 | |||
| 1962 | Ga0496108_0299078 | |||
| 1963 | Ga0496108_1068807 | |||
| 1964 | Ga0496109_0022743 | |||
| 1965 | Ga0496109_0060318 | |||
| 1966 | Ga0496109_0127383 | |||
| 1967 | Ga0496109_0277844 | |||
| 1968 | Ga0496109_0337591 | |||
| 1969 | Ga0496109_1564420 | |||
| 1970 | Ga0496110_0001407 | |||
| 1971 | Ga0496110_0127487 | |||
| 1972 | Ga0496110_0230115 | |||
| 1973 | Ga0496110_0287119 | |||
| 1974 | Ga0496110_0304871 | |||
| 1975 | Ga0496111_0000429 | |||
| 1976 | Ga0496111_0021603 | |||
| 1977 | Ga0496111_0295934 | |||
| 1978 | Ga0496111_0300145 | |||
| 1979 | Ga0496111_1336123 | |||
| 1980 | Ga0496112_0133792 | |||
| 1981 | Ga0496112_0175855 | |||
| 1982 | Ga0496113_0090032 | |||
| 1983 | Ga0496113_0119174 | |||
| 1984 | Ga0496113_0350260 | |||
| 1985 | Ga0496113_1092764 | |||
| 1986 | Ga0496113_1141349 | |||
| 1987 | Ga0496114_1307762 | |||
| 1988 | Ga0496115_1456003 | |||
| 1989 | Ga0501031_0017526 | |||
| 1990 | Ga0501031_0091998 | |||
| 1991 | Ga0501031_0303888 | |||
| 1992 | Ga0501032_0024682 | |||
| 1993 | Ga0501032_0184612 | |||
| 1994 | Ga0501032_0225685 | |||
| 1995 | Ga0501032_0240974 | |||
| 1996 | Ga0501033_0020457 | |||
| 1997 | Ga0501033_0085797 | |||
| 1998 | Ga0501033_0277089 | |||
| 1999 | Ga0501033_0709822 | |||
| 2000 | Ga0501034_0235388 | |||
| 2001 | Ga0501034_0458509 | |||
| 2002 | Ga0501034_0943534 | |||
| 2003 | Ga0501036_0010942 | |||
| 2004 | Ga0501036_0061610 | |||
| 2005 | Ga0501036_0099059 | |||
| 2006 | Ga0501036_0145794 | |||
| 2007 | Ga0501036_0395671 | |||
| 2008 | Ga0501036_0471274 | |||
| 2009 | Ga0501036_0881109 | |||
| 2010 | Ga0501037_0224497 | |||
| 2011 | Ga0501037_0305204 | |||
| 2012 | Ga0501037_0435921 | |||
| 2013 | Ga0501037_1148808 | |||
| 2014 | Ga0501038_0022437 | |||
| 2015 | Ga0501038_0027917 | |||
| 2016 | Ga0501038_0334649 | |||
| 2017 | Ga0501038_0424149 | |||
| 2018 | Ga0501038_1326751 | |||
| 2019 | Ga0501039_0002212 | |||
| 2020 | Ga0501039_0032683 | |||
| 2021 | Ga0501039_0095908 | |||
| 2022 | Ga0501039_0243431 | |||
| 2023 | Ga0501039_0254316 | |||
| 2024 | Ga0501039_0902689 | |||
| 2025 | Ga0501040_0004806 | |||
| 2026 | Ga0501040_0026839 | |||
| 2027 | Ga0501040_0037267 | |||
| 2028 | Ga0501040_0077947 | |||
| 2029 | Ga0501040_0139227 | |||
| 2030 | Ga0501040_0181381 | |||
| 2031 | Ga0501040_0476048 | |||
| 2032 | Ga0501040_0480602 | |||
| 2033 | Ga0501040_0750421 | |||
| 2034 | Ga0501040_1068370 | |||
| 2035 | Ga0501041_0005164 | |||
| 2036 | Ga0501041_0019292 | |||
| 2037 | Ga0501041_0049701 | |||
| 2038 | Ga0501041_0084776 | |||
| 2039 | Ga0501041_0188418 | |||
| 2040 | Ga0501041_0286064 | |||
| 2041 | Ga0501041_0485140 | |||
| 2042 | Ga0501042_0018108 | |||
| 2043 | Ga0501042_0026164 | |||
| 2044 | Ga0501042_0165086 | |||
| 2045 | Ga0501042_0175223 | |||
| 2046 | Ga0501042_0279120 | |||
| 2047 | Ga0501042_0538576 | |||
| 2048 | Ga0501042_0612707 | |||
| 2049 | Ga0501043_0068028 | |||
| 2050 | Ga0501043_0216553 | |||
| 2051 | Ga0501043_0292045 | |||
| 2052 | Ga0501046_0012761 | |||
| 2053 | Ga0501046_0078450 | |||
| 2054 | Ga0501046_0100480 | |||
| 2055 | Ga0501047_0251004 | |||
| 2056 | Ga0501048_0006302 | |||
| 2057 | Ga0501048_0042274 | |||
| 2058 | Ga0501048_0142440 | |||
| 2059 | Ga0501048_0169398 | |||
| 2060 | Ga0501048_0871857 | |||
| 2061 | Ga0501048_0976338 | |||
| 2062 | Ga0501048_1114084 | |||
| 2063 | Ga0501067_0019768 | |||
| 2064 | Ga0501067_0033431 | |||
| 2065 | Ga0501067_0034302 | |||
| 2066 | Ga0501067_0052225 | |||
| 2067 | Ga0501067_0074138 | |||
| 2068 | Ga0501067_0124915 | |||
| 2069 | Ga0501067_0638256 | |||
| 2070 | Ga0501067_0655592 | |||
| 2071 | Ga0501068_0008679 | |||
| 2072 | Ga0501068_0013162 | |||
| 2073 | Ga0501068_0030506 | |||
| 2074 | Ga0501068_0043231 | |||
| 2075 | Ga0501068_0080912 | |||
| 2076 | Ga0501068_0124228 | |||
| 2077 | Ga0501068_0138056 | |||
| 2078 | Ga0501068_0152299 | |||
| 2079 | Ga0501068_0536747 | |||
| 2080 | Ga0501068_0799758 | |||
| 2081 | Ga0501068_1067745 | |||
| 2082 | Ga0501069_0007796 | |||
| 2083 | Ga0501069_0022300 | |||
| 2084 | Ga0501069_0040981 | |||
| 2085 | Ga0501069_0046889 | |||
| 2086 | Ga0501069_0149432 | |||
| 2087 | Ga0501069_0169046 | |||
| 2088 | Ga0501069_0703316 | |||
| 2089 | Ga0501069_0867439 | |||
| 2090 | Ga0501070_0020654 | |||
| 2091 | Ga0501070_0048989 | |||
| 2092 | Ga0501070_0176336 | |||
| 2093 | Ga0501070_0412799 | |||
| 2094 | Ga0501070_0645325 | |||
| 2095 | Ga0501070_0936911 | |||
| 2096 | Ga0501071_0018405 | |||
| 2097 | Ga0501071_0024160 | |||
| 2098 | Ga0501071_0028681 | |||
| 2099 | Ga0501071_0047047 | |||
| 2100 | Ga0501071_0211396 | |||
| 2101 | Ga0501071_0234140 | |||
| 2102 | Ga0501071_0280880 | |||
| 2103 | Ga0501071_0326348 | |||
| 2104 | Ga0501071_0364117 | |||
| 2105 | Ga0501071_0397214 | |||
| 2106 | Ga0501071_0397854 | |||
| 2107 | Ga0501071_0463586 | |||
| 2108 | Ga0501071_0565713 | |||
| 2109 | Ga0501071_0654296 | |||
| 2110 | Ga0501071_0677326 | |||
| 2111 | Ga0501071_1267531 | |||
| 2112 | Ga0501071_1271416 | |||
| 2113 | Ga0501072_0033625 | |||
| 2114 | Ga0501072_0042269 | |||
| 2115 | Ga0501072_0224443 | |||
| 2116 | Ga0501072_0281226 | |||
| 2117 | Ga0501072_0357610 | |||
| 2118 | Ga0501072_0413755 | |||
| 2119 | Ga0501072_0417534 | |||
| 2120 | Ga0501072_0439181 | |||
| 2121 | Ga0501072_0456171 | |||
| 2122 | Ga0501072_0656734 | |||
| 2123 | Ga0501072_0846546 | |||
| 2124 | Ga0501072_0998220 | |||
| 2125 | Ga0501072_1206708 | |||
| 2126 | Ga0501073_0107039 | |||
| 2127 | Ga0501073_0147229 | |||
| 2128 | Ga0501074_0006126 | |||
| 2129 | Ga0501074_0013466 | |||
| 2130 | Ga0501074_0104953 | |||
| 2131 | Ga0501074_0162554 | |||
| 2132 | Ga0501074_0210731 | |||
| 2133 | Ga0501074_0507914 | |||
| 2134 | Ga0501074_0928348 | |||
| 2135 | Ga0501074_1079707 | |||
| 2136 | Ga0501075_0003679 | |||
| 2137 | Ga0501075_0013849 | |||
| 2138 | Ga0501075_0115636 | |||
| 2139 | Ga0501075_0243998 | |||
| 2140 | Ga0501075_0262271 | |||
| 2141 | Ga0501075_0534090 | |||
| 2142 | Ga0501075_0707745 | |||
| 2143 | Ga0501075_0936112 | |||
| 2144 | Ga0501075_1197469 | |||
| 2145 | Ga0501076_0008472 | |||
| 2146 | Ga0501076_0015191 | |||
| 2147 | Ga0501076_0016399 | |||
| 2148 | Ga0501076_0016982 | |||
| 2149 | Ga0501076_0100138 | |||
| 2150 | Ga0501076_0132771 | |||
| 2151 | Ga0501076_0146069 | |||
| 2152 | Ga0501076_0157680 | |||
| 2153 | Ga0501076_0159606 | |||
| 2154 | Ga0501076_0219158 | |||
| 2155 | Ga0501076_0244055 | |||
| 2156 | Ga0501076_0329809 | |||
| 2157 | Ga0501076_0427588 | |||
| 2158 | Ga0501076_0456519 | |||
| 2159 | Ga0501076_0665851 | |||
| 2160 | Ga0501077_0022574 | |||
| 2161 | Ga0501077_0041065 | |||
| 2162 | Ga0501077_0318572 | |||
| 2163 | Ga0501077_0348603 | |||
| 2164 | Ga0501077_0774112 | |||
| 2165 | Ga0501227_161066 | |||
| 2166 | Ga0501079_0006082 | |||
| 2167 | Ga0501079_0022587 | |||
| 2168 | Ga0501079_0154836 | |||
| 2169 | Ga0501079_0160189 | |||
| 2170 | Ga0501079_0238403 | |||
| 2171 | Ga0501079_0273204 | |||
| 2172 | Ga0501079_0457698 | |||
| 2173 | Ga0501079_0484261 | |||
| 2174 | Ga0501079_0980480 | |||
| 2175 | Ga0501079_1100036 | |||
| 2176 | Ga0501079_1336632 | |||
| 2177 | Ga0501080_0002972 | |||
| 2178 | Ga0501080_0035360 | |||
| 2179 | Ga0501080_0156880 | |||
| 2180 | Ga0501080_0308322 | |||
| 2181 | Ga0501080_0520091 | |||
| 2182 | Ga0501080_0911245 | |||
| 2183 | Ga0501080_0932329 | |||
| 2184 | Ga0501080_1770544 | |||
| 2185 | Ga0501081_0016817 | |||
| 2186 | Ga0501081_0030270 | |||
| 2187 | Ga0501081_0067384 | |||
| 2188 | Ga0501081_0082457 | |||
| 2189 | Ga0501081_0083996 | |||
| 2190 | Ga0501081_0172817 | |||
| 2191 | Ga0501081_0388053 | |||
| 2192 | Ga0501081_0446074 | |||
| 2193 | Ga0501081_0965591 | |||
| 2194 | Ga0501081_1035808 | |||
| 2195 | Ga0501081_1373756 | |||
| 2196 | Ga0501083_0021679 | |||
| 2197 | Ga0501083_0033656 | |||
| 2198 | Ga0501083_0438702 | |||
| 2199 | Ga0501083_0594524 | |||
| 2200 | Ga0501083_0796336 | |||
| 2201 | Ga0501083_0947818 | |||
| 2202 | Ga0501035_0027926 | |||
| 2203 | Ga0501035_0045420 | |||
| 2204 | Ga0501035_0163984 | |||
| 2205 | Ga0501035_0556547 | |||
| 2206 | Ga0501035_1039394 | |||
| 2207 | Ga0501044_0080565 | |||
| 2208 | Ga0501044_0210408 | |||
| 2209 | Ga0501045_0007918 | |||
| 2210 | Ga0501045_0009197 | |||
| 2211 | Ga0501045_0071952 | |||
| 2212 | Ga0501045_0087248 | |||
| 2213 | Ga0501045_0797633 | |||
| 2214 | Ga0501045_0981993 | |||
| 2215 | Ga0501045_1211452 | |||
| 2216 | Ga0501212_023168 | |||
| 2217 | nmdc:mga00v17_223732_c1 | |||
| 2218 | nmdc:mga0yw44_35698_c1 | |||
| 2219 | nmdc:mga0yw44_87545_c1 | |||
| 2220 | nmdc:mga05p37_1383058_c1 | |||
| 2221 | nmdc:mga05p37_1515997_c1 | |||
| 2222 | nmdc:mga05p37_1775211_c1 | |||
| 2223 | nmdc:mga05p37_19483_c1 | |||
| 2224 | nmdc:mga05p37_215759_c1 | |||
| 2225 | nmdc:mga05p37_24671_c1 | |||
| 2226 | nmdc:mga05p37_399062_c1 | |||
| 2227 | nmdc:mga05p37_442608_c1 | |||
| 2228 | nmdc:mga05p37_5798_c1 | |||
| 2229 | nmdc:mga09592_36637_c1 | |||
| 2230 | nmdc:mga09592_37133_c1 | |||
| 2231 | nmdc:mga09592_420676_c1 | |||
| 2232 | nmdc:mga09592_65927_c1 | |||
| 2233 | nmdc:mga0qj67_103939_c1 | |||
| 2234 | nmdc:mga0qj67_121664_c1 | |||
| 2235 | nmdc:mga0qj67_1333152_c1 | |||
| 2236 | nmdc:mga0qj67_492082_c1 | |||
| 2237 | nmdc:mga06r32_1446085_c1 | |||
| 2238 | nmdc:mga06r32_317855_c1 | |||
| 2239 | nmdc:mga06r32_51565_c1 | |||
| 2240 | nmdc:mga06r32_735327_c1 | |||
| 2241 | nmdc:mga08y16_1002010_c1 | |||
| 2242 | nmdc:mga08y16_221056_c1 | |||
| 2243 | nmdc:mga08y16_272307_c1 | |||
| 2244 | nmdc:mga08y16_37087_c1 | |||
| 2245 | nmdc:mga08y16_556171_c1 | |||
| 2246 | nmdc:mga08y16_685307_c1 | |||
| 2247 | nmdc:mga08y16_685895_c1 | |||
| 2248 | nmdc:mga0n895_1293621_c1 | |||
| 2249 | nmdc:mga0n895_1549327_c1 | |||
| 2250 | nmdc:mga0n895_357403_c1 | |||
| 2251 | nmdc:mga0n895_594457_c1 | |||
| 2252 | nmdc:mga0n895_69227_c1 | |||
| 2253 | nmdc:mga0rr50_107620_c1 | |||
| 2254 | nmdc:mga0rr50_172342_c2 | |||
| 2255 | nmdc:mga08x19_1118743_c1 | |||
| 2256 | nmdc:mga08x19_1154895_c1 | |||
| 2257 | nmdc:mga08x19_149941_c1 | |||
| 2258 | nmdc:mga08x19_303502_c1 | |||
| 2259 | nmdc:mga08x19_41118_c1 | |||
| 2260 | nmdc:mga08x19_54456_c1 | |||
| 2261 | nmdc:mga0a205_216054_c1 | |||
| 2262 | nmdc:mga0a205_257589_c1 | |||
| 2263 | nmdc:mga0a205_4243_c1 | |||
| 2264 | nmdc:mga0a205_704131_c1 | |||
| 2265 | nmdc:mga0a205_716096_c1 | |||
| 2266 | Ga0495601_0529968 | |||
| 2267 | Ga0495655_0043766 | |||
| 2268 | Ga0495655_0055670 | |||
| 2269 | Ga0495655_0159155 | |||
| 2270 | Ga0501084_0009849 | |||
| 2271 | Ga0501084_0015159 | |||
| 2272 | Ga0501084_0035388 | |||
| 2273 | Ga0501084_0052553 | |||
| 2274 | Ga0501084_0113678 | |||
| 2275 | Ga0501084_0120403 | |||
| 2276 | Ga0501084_0243077 | |||
| 2277 | Ga0501084_0356317 | |||
| 2278 | Ga0501084_0358930 | |||
| 2279 | Ga0501084_0447723 | |||
| 2280 | Ga0501084_0564612 | |||
| 2281 | Ga0501084_0577369 | |||
| 2282 | Ga0501084_0646050 | |||
| 2283 | Ga0501084_0880093 | |||
| 2284 | Ga0501084_1023443 | |||
| 2285 | Ga0501084_1032644 | |||
| 2286 | Ga0501082_0002353 | |||
| 2287 | Ga0501082_0044473 | |||
| 2288 | Ga0501082_0054855 | |||
| 2289 | Ga0501082_0175257 | |||
| 2290 | Ga0501082_0176791 | |||
| 2291 | Ga0501082_0183806 | |||
| 2292 | Ga0501082_0219797 | |||
| 2293 | Ga0501082_0232665 | |||
| 2294 | Ga0501082_0238964 | |||
| 2295 | Ga0501082_0310428 | |||
| 2296 | Ga0501082_0333275 | |||
| 2297 | Ga0501082_0385491 | |||
| 2298 | Ga0501082_0856855 | |||
| 2299 | Ga0501082_0999306 | |||
| 2300 | Ga0501082_1001569 | |||
| 2301 | Ga0501082_1224263 | |||
| 2302 | Ga0501082_1238717 | |||
| 2303 | Ga0501082_1834074 | |||
| 2304 | Ga0530510_0029888 | |||
| 2305 | Ga0530510_0042376 | |||
| 2306 | Ga0530510_0150317 | |||
| 2307 | Ga0530510_0169347 | |||
| 2308 | Ga0530510_0184121 | |||
| 2309 | Ga0530510_0205172 | |||
| 2310 | Ga0530510_0205550 | |||
| 2311 | Ga0530510_0267187 | |||
| 2312 | Ga0530510_0317083 | |||
| 2313 | Ga0530510_0390892 | |||
| 2314 | Ga0530510_0487394 | |||
| 2315 | Ga0530510_0497253 | |||
| 2316 | Ga0530510_0515465 | |||
| 2317 | Ga0530510_0883189 | |||
| 2318 | Ga0530510_1211853 | |||
| 2319 | Ga0530510_1505255 | |||
| 2320 | Ga0530510_1540627 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9439 | 14 | 71 |
| 1y7y-assembly1.cif.gz_A | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.9383 | 14 | 71 |
| 1adr-assembly1.cif.gz_A | determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor | 0.9328 | 9 | 71 |
| 3f52-assembly1.cif.gz_E | crystal structure of the clp gene regulator clgr from c. glutamicum | 0.9317 | 14 | 68 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9302 | 14 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qq6B00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9467 | 14 | 71 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9439 | 14 | 71 | 1.10.260.40 |
| 1y7yA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9383 | 14 | 71 | 1.10.260.40 |
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9328 | 9 | 71 | 1.10.260.40 |
| 3f52E00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9317 | 14 | 68 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1DEX6-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9766 | 14 | 69 |
GO:0003677
|
| AF-A0A1S8NBT8-F1-model_v4 | Helix-turn-helix domain protein | 0.9572 | 11 | 71 |
GO:0003677
|
| AF-A0A535F9L4-F1-model_v4 | D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) | 0.9556 | 12 | 69 |
GO:0003677
GO:0004617 GO:0006564 GO:0051287 |
| AF-A0A661V0H1-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9553 | 11 | 71 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A133XPF9-F1-model_v4 | DNA-binding helix-turn-helix protein | 0.9547 | 11 | 68 |
GO:0003677
|