F490999

General Info

Members Datasets Scaffolds Average Seq Length
1160 356 2320 99

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0385645|Ga0496114_0385645_505_798
Length 97
Sequence MKGWSSAPFGDAVTQLMEKNHFTYRSLGERTGLSAGYLNHIVHGNRPIPDLEVVKRIASALGVVPEYFREMRVRAIAETLEAGPTSEIDRAYKKLVA

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
216 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
217 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
218 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
224 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 4.05
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 16.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0385645 3300048917 Bacteria 1241
2 ARSoilYngRDRAFT_c03869 3300000042 Unclassified 563
3 ARcpr5yngRDRAFT_c004304 3300000043 Bacteria 1352
4 ARSoilOldRDRAFT_c002253 3300000044 Bacteria 1717
5 ARCol0yngRDRAFT_1003723 3300000652 Unclassified 1112
6 JGI24744J21845_10065760 3300002077 Unclassified 662
7 JGI24033J26618_1022814 3300002155 Bacteria 811
8 JGI24751J29686_10023172 3300002459 Bacteria 1287
9 JGI25406J46586_10104778 3300003203 Unclassified 841
10 rootH2_10071422 3300003320 Unclassified 2602
11 rootL2_10040196 3300003322 Bacteria 2184
12 Ga0058860_11509346 3300004801 Bacteria 577
13 Ga0070658_10008374 3300005327 Bacteria 8314
14 Ga0070658_10551943 3300005327 Bacteria 997
15 Ga0070658_11358569 3300005327 Unclassified 617
16 Ga0070676_10266110 3300005328 Bacteria 1150
17 Ga0070676_10407999 3300005328 Bacteria 947
18 Ga0070683_100037857 3300005329 Bacteria 4417
19 Ga0070683_100102866 3300005329 Bacteria 2691
20 Ga0070683_100103528 3300005329 Bacteria 2683
21 Ga0070683_100130023 3300005329 Bacteria 2383
22 Ga0070683_100507894 3300005329 Bacteria 1152
23 Ga0070683_100525014 3300005329 Bacteria 1131
24 Ga0070683_101204746 3300005329 Unclassified 728
25 Ga0070670_100001301 3300005331 Bacteria 19889
26 Ga0070670_100125655 3300005331 Bacteria 2213
27 Ga0070670_100883783 3300005331 Bacteria 809
28 Ga0068869_100301087 3300005334 Bacteria 1295
29 Ga0068869_100750244 3300005334 Bacteria 836
30 Ga0070680_100020158 3300005336 Bacteria 5290
31 Ga0070680_100126947 3300005336 Bacteria 2131
32 Ga0070680_100333749 3300005336 Bacteria 1288
33 Ga0070680_100373401 3300005336 Bacteria 1214
34 Ga0070680_101573002 3300005336 Unclassified 569
35 Ga0070682_100103411 3300005337 Bacteria 1885
36 Ga0070682_100219665 3300005337 Bacteria 1352
37 Ga0070682_100543301 3300005337 Bacteria 908
38 Ga0068868_100120012 3300005338 Bacteria 2144
39 Ga0068868_100361933 3300005338 Bacteria 1245
40 Ga0068868_100772725 3300005338 Bacteria 865
41 Ga0070660_100016342 3300005339 Bacteria 5385
42 Ga0070660_100612089 3300005339 Bacteria 911
43 Ga0070660_100994314 3300005339 Bacteria 709
44 Ga0070660_101424199 3300005339 Bacteria 589
45 Ga0070660_101527020 3300005339 Bacteria 568
46 Ga0070689_100050025 3300005340 Bacteria 3228
47 Ga0070689_100235485 3300005340 Bacteria 1506
48 Ga0070689_101656022 3300005340 Bacteria 582
49 Ga0070691_10135354 3300005341 Bacteria 1251
50 Ga0070691_10179864 3300005341 Bacteria 1100
51 Ga0070687_100157581 3300005343 Bacteria 1339
52 Ga0070687_100585681 3300005343 Bacteria 764
53 Ga0070661_100229374 3300005344 Bacteria 1427
54 Ga0070661_100239943 3300005344 Bacteria 1395
55 Ga0070661_100300406 3300005344 Bacteria 1250
56 Ga0070661_101451515 3300005344 Unclassified 578
57 Ga0070692_10009786 3300005345 Bacteria 4339
58 Ga0070668_100321546 3300005347 Bacteria 1303
59 Ga0070668_100919385 3300005347 Bacteria 783
60 Ga0070669_100223550 3300005353 Bacteria 1489
61 Ga0070669_100407918 3300005353 Bacteria 1113
62 Ga0070669_101070545 3300005353 Bacteria 694
63 Ga0070669_101730012 3300005353 Unclassified 545
64 Ga0070675_100046193 3300005354 Bacteria 3565
65 Ga0070675_100200288 3300005354 Bacteria 1733
66 Ga0070675_100918025 3300005354 Bacteria 803
67 Ga0070674_100003504 3300005356 Bacteria 8811
68 Ga0070674_100036141 3300005356 Bacteria 3313
69 Ga0070674_100081411 3300005356 Bacteria 2314
70 Ga0070674_100156721 3300005356 Bacteria 1724
71 Ga0070674_100255346 3300005356 Bacteria 1379
72 Ga0070674_100781979 3300005356 Bacteria 823
73 Ga0070673_100068448 3300005364 Bacteria 2843
74 Ga0070673_101609535 3300005364 Unclassified 614
75 Ga0070688_100002904 3300005365 Bacteria 8740
76 Ga0070659_100351870 3300005366 Bacteria 1236
77 Ga0070659_100425065 3300005366 Bacteria 1124
78 Ga0070659_101190245 3300005366 Bacteria 674
79 Ga0070667_102333135 3300005367 Bacteria 504
80 Ga0070714_100331440 3300005435 Bacteria 1425
81 Ga0070701_10148499 3300005438 Bacteria 1347
82 Ga0070701_10418642 3300005438 Bacteria 853
83 Ga0070701_10481625 3300005438 Unclassified 802
84 Ga0070701_10518137 3300005438 Unclassified 777
85 Ga0070701_11036797 3300005438 Unclassified 574
86 Ga0070701_11123273 3300005438 Bacteria 554
87 Ga0070711_100683099 3300005439 Bacteria 863
88 Ga0070711_101161858 3300005439 Bacteria 667
89 Ga0070705_100802049 3300005440 Unclassified 749
90 Ga0070700_100533381 3300005441 Unclassified 909
91 Ga0070700_100761905 3300005441 Bacteria 776
92 Ga0070700_100830572 3300005441 Bacteria 747
93 Ga0070700_101356317 3300005441 Unclassified 599
94 Ga0070694_101390200 3300005444 Bacteria 592
95 Ga0070708_100474977 3300005445 Bacteria 1180
96 Ga0070663_100427979 3300005455 Bacteria 1087
97 Ga0070678_100041082 3300005456 Bacteria 3276
98 Ga0070678_100043835 3300005456 Bacteria 3190
99 Ga0070678_100317860 3300005456 Bacteria 1329
100 Ga0070678_101180906 3300005456 Unclassified 709
101 Ga0070662_100253411 3300005457 Bacteria 1416
102 Ga0070662_100295276 3300005457 Bacteria 1315
103 Ga0070681_10079765 3300005458 Bacteria 3229
104 Ga0070681_10303323 3300005458 Bacteria 1506
105 Ga0070681_10356085 3300005458 Bacteria 1374
106 Ga0070681_10943718 3300005458 Unclassified 782
107 Ga0068867_100089836 3300005459 Bacteria 2330
108 Ga0068867_100181897 3300005459 Bacteria 1672
109 Ga0068867_100441348 3300005459 Unclassified 1107
110 Ga0068867_100564383 3300005459 Bacteria 988
111 Ga0068867_101153566 3300005459 Unclassified 710
112 Ga0068867_101700904 3300005459 Bacteria 592
113 Ga0070685_10007193 3300005466 Bacteria 5688
114 Ga0070685_10183543 3300005466 Bacteria 1349
115 Ga0070685_10351105 3300005466 Bacteria 1008
116 Ga0070685_10394768 3300005466 Bacteria 957
117 Ga0070699_100104231 3300005518 Bacteria 2488
118 Ga0070699_102186667 3300005518 Bacteria 505
119 Ga0070679_100028843 3300005530 Bacteria 5474
120 Ga0070679_100068458 3300005530 Bacteria 3541
121 Ga0070679_100174876 3300005530 Bacteria 2119
122 Ga0070679_100320188 3300005530 Bacteria 1500
123 Ga0070684_100021957 3300005535 Bacteria 5317
124 Ga0070684_100027954 3300005535 Bacteria 4767
125 Ga0070684_100033420 3300005535 Bacteria 4391
126 Ga0070684_100068165 3300005535 Bacteria 3127
127 Ga0070684_100070931 3300005535 Bacteria 3066
128 Ga0070684_100089953 3300005535 Bacteria 2729
129 Ga0070684_100129098 3300005535 Bacteria 2279
130 Ga0070684_100134494 3300005535 Bacteria 2232
131 Ga0070684_100136570 3300005535 Bacteria 2215
132 Ga0070684_100593465 3300005535 Bacteria 1029
133 Ga0070684_100752755 3300005535 Bacteria 910
134 Ga0070684_101023050 3300005535 Bacteria 775
135 Ga0070684_101329322 3300005535 Bacteria 677
136 Ga0070697_100997591 3300005536 Bacteria 744
137 Ga0068853_100078651 3300005539 Bacteria 2883
138 Ga0068853_100098678 3300005539 Bacteria 2579
139 Ga0068853_100100648 3300005539 Bacteria 2555
140 Ga0070672_100509507 3300005543 Bacteria 1042
141 Ga0070672_100565938 3300005543 Bacteria 988
142 Ga0070672_100636693 3300005543 Bacteria 931
143 Ga0070672_101113242 3300005543 Bacteria 702
144 Ga0070672_101261169 3300005543 Unclassified 659
145 Ga0070686_100148829 3300005544 Bacteria 1638
146 Ga0070686_100200261 3300005544 Bacteria 1431
147 Ga0070686_100601243 3300005544 Bacteria 867
148 Ga0070695_100028444 3300005545 Bacteria 3469
149 Ga0070695_100335062 3300005545 Bacteria 1129
150 Ga0070696_100112797 3300005546 Bacteria 1960
151 Ga0070693_100048091 3300005547 Bacteria 2428
152 Ga0070693_100060007 3300005547 Bacteria 2207
153 Ga0070693_100122335 3300005547 Bacteria 1616
154 Ga0070693_100744495 3300005547 Bacteria 722
155 Ga0070693_100746455 3300005547 Bacteria 721
156 Ga0070693_100804718 3300005547 Bacteria 697
157 Ga0070665_100027593 3300005548 Bacteria 5718
158 Ga0070704_100040624 3300005549 Bacteria 3204
159 Ga0070704_100265538 3300005549 Unclassified 1416
160 Ga0068855_100034552 3300005563 Bacteria 6028
161 Ga0068855_100688794 3300005563 Bacteria 1095
162 Ga0068855_101221327 3300005563 Bacteria 781
163 Ga0070664_100061983 3300005564 Bacteria 3188
164 Ga0070664_100121618 3300005564 Bacteria 2286
165 Ga0070664_100308032 3300005564 Bacteria 1432
166 Ga0070664_100600117 3300005564 Bacteria 1021
167 Ga0070664_100625950 3300005564 Bacteria 999
168 Ga0070664_100728979 3300005564 Bacteria 924
169 Ga0070664_101464425 3300005564 Unclassified 646
170 Ga0070664_102125861 3300005564 Bacteria 533
171 Ga0070664_102134198 3300005564 Bacteria 532
172 Ga0068857_100052275 3300005577 Bacteria 3625
173 Ga0068857_100073839 3300005577 Bacteria 3039
174 Ga0068857_100154574 3300005577 Bacteria 2080
175 Ga0068857_100335696 3300005577 Bacteria 1398
176 Ga0068857_100352293 3300005577 Unclassified 1363
177 Ga0068857_100883461 3300005577 Unclassified 856
178 Ga0068857_101158083 3300005577 Bacteria 748
179 Ga0068854_100065623 3300005578 Bacteria 2639
180 Ga0068854_100083986 3300005578 Bacteria 2355
181 Ga0068854_100574823 3300005578 Unclassified 959
182 Ga0068856_100133345 3300005614 Bacteria 2489
183 Ga0070702_100086712 3300005615 Bacteria 1889
184 Ga0070702_100280009 3300005615 Bacteria 1145
185 Ga0070702_100354406 3300005615 Bacteria 1035
186 Ga0070702_100813596 3300005615 Bacteria 724
187 Ga0068852_100112286 3300005616 Bacteria 2480
188 Ga0068852_101153500 3300005616 Bacteria 795
189 Ga0068859_101792894 3300005617 Bacteria 678
190 Ga0068864_100125522 3300005618 Bacteria 2299
191 Ga0068864_101393888 3300005618 Bacteria 703
192 Ga0068864_102370575 3300005618 Bacteria 537
193 Ga0068866_10036005 3300005718 Bacteria 2422
194 Ga0068861_100308882 3300005719 Bacteria 1373
195 Ga0068861_100312646 3300005719 Bacteria 1365
196 Ga0068861_100859923 3300005719 Bacteria 856
197 Ga0068861_102154543 3300005719 Bacteria 558
198 Ga0068851_10358625 3300005834 Bacteria 850
199 Ga0068851_10499731 3300005834 Bacteria 729
200 Ga0068870_10000314 3300005840 Bacteria 18000
201 Ga0068870_10093905 3300005840 Bacteria 1683
202 Ga0068870_10359043 3300005840 Bacteria 937
203 Ga0068858_100521033 3300005842 Bacteria 1150
204 Ga0068858_101076723 3300005842 Bacteria 789
205 Ga0068860_100829038 3300005843 Bacteria 939
206 Ga0068860_101073424 3300005843 Bacteria 824
207 Ga0068862_100332626 3300005844 Bacteria 1405
208 Ga0068862_100954823 3300005844 Unclassified 846
209 Ga0081455_10006933 3300005937 Bacteria 12048
210 Ga0081455_10022098 3300005937 Bacteria 5954
211 Ga0081455_10045327 3300005937 Bacteria 3827
212 Ga0081455_10147563 3300005937 Bacteria 1817
213 Ga0081455_10184313 3300005937 Bacteria 1578
214 Ga0081455_10259983 3300005937 Bacteria 1265
215 Ga0081455_10321337 3300005937 Unclassified 1102
216 Ga0081455_10331918 3300005937 Bacteria 1079
217 Ga0081455_10516061 3300005937 Unclassified 799
218 Ga0081455_10550496 3300005937 Bacteria 763
219 Ga0081455_10649104 3300005937 Unclassified 680
220 Ga0081538_10049846 3300005981 Bacteria 2536
221 Ga0081538_10128433 3300005981 Bacteria 1198
222 Ga0081539_10010651 3300005985 Bacteria 7422
223 Ga0081539_10158747 3300005985 Bacteria 1080
224 Ga0075365_10084679 3300006038 Bacteria 2152
225 Ga0075365_10306601 3300006038 Bacteria 1118
226 Ga0075364_10078387 3300006051 Bacteria 2182
227 Ga0075364_10493385 3300006051 Bacteria 837
228 Ga0075432_10112650 3300006058 Bacteria 1015
229 Ga0097621_100442884 3300006237 Unclassified 1169
230 Ga0097621_101201728 3300006237 Bacteria 714
231 Ga0068871_100122618 3300006358 Bacteria 2197
232 Ga0068871_101815974 3300006358 Bacteria 579
233 Ga0075428_100001303 3300006844 Bacteria 26471
234 Ga0075428_100034856 3300006844 Bacteria 5550
235 Ga0075428_100088862 3300006844 Bacteria 3370
236 Ga0075428_100099485 3300006844 Bacteria 3171
237 Ga0075428_100995469 3300006844 Bacteria 888
238 Ga0075430_100012393 3300006846 Bacteria 7253
239 Ga0075430_100033910 3300006846 Bacteria 4333
240 Ga0075430_100302656 3300006846 Bacteria 1322
241 Ga0075430_101802463 3300006846 Unclassified 502
242 Ga0075431_100002708 3300006847 Bacteria 17182
243 Ga0075431_100568439 3300006847 Bacteria 1120
244 Ga0075431_101106383 3300006847 Unclassified 757
245 Ga0075433_10123536 3300006852 Bacteria 2300
246 Ga0075433_10470356 3300006852 Unclassified 1107
247 Ga0075433_10485944 3300006852 Bacteria 1088
248 Ga0075433_10651745 3300006852 Unclassified 923
249 Ga0075433_10776089 3300006852 Bacteria 838
250 Ga0075434_100047520 3300006871 Bacteria 4259
251 Ga0075434_100423707 3300006871 Bacteria 1352
252 Ga0075434_101780842 3300006871 Bacteria 623
253 Ga0075434_101930691 3300006871 Bacteria 596
254 Ga0075429_100032058 3300006880 Bacteria 4568
255 Ga0075429_100049289 3300006880 Bacteria 3662
256 Ga0075429_100063378 3300006880 Bacteria 3220
257 Ga0075429_100067690 3300006880 Bacteria 3108
258 Ga0068865_100131240 3300006881 Bacteria 1877
259 Ga0068865_100184103 3300006881 Bacteria 1610
260 Ga0068865_100279574 3300006881 Bacteria 1328
261 Ga0068865_100428041 3300006881 Bacteria 1090
262 Ga0068865_100527831 3300006881 Bacteria 988
263 Ga0068865_100563172 3300006881 Bacteria 958
264 Ga0068865_101082435 3300006881 Bacteria 705
265 Ga0068865_101192904 3300006881 Bacteria 673
266 Ga0075436_100034374 3300006914 Bacteria 3496
267 Ga0075436_100186227 3300006914 Unclassified 1468
268 Ga0097620_101793142 3300006931 Bacteria 678
269 Ga0075435_100845124 3300007076 Bacteria 797
270 Ga0075435_101971977 3300007076 Bacteria 513
271 Ga0105240_10056968 3300009093 Bacteria 4887
272 Ga0105240_11267498 3300009093 Bacteria 778
273 Ga0111539_10003299 3300009094 Bacteria 21326
274 Ga0111539_10004030 3300009094 Bacteria 19288
275 Ga0111539_10006384 3300009094 Bacteria 15204
276 Ga0111539_10043904 3300009094 Bacteria 5357
277 Ga0111539_10143609 3300009094 Bacteria 2794
278 Ga0111539_10186756 3300009094 Bacteria 2420
279 Ga0111539_10571106 3300009094 Bacteria 1317
280 Ga0111539_10887431 3300009094 Bacteria 1037
281 Ga0111539_10896376 3300009094 Bacteria 1031
282 Ga0111539_10988800 3300009094 Bacteria 978
283 Ga0105245_10013227 3300009098 Bacteria 7191
284 Ga0105245_10015075 3300009098 Bacteria 6735
285 Ga0105245_10029446 3300009098 Bacteria 4851
286 Ga0105245_10134576 3300009098 Bacteria 2321
287 Ga0105245_10196789 3300009098 Bacteria 1934
288 Ga0105245_10375936 3300009098 Bacteria 1414
289 Ga0105245_11509357 3300009098 Bacteria 723
290 Ga0105245_12335388 3300009098 Unclassified 588
291 Ga0105247_11213972 3300009101 Bacteria 601
292 Ga0114129_10010739 3300009147 Bacteria 13052
293 Ga0114129_10044815 3300009147 Bacteria 6221
294 Ga0114129_10160423 3300009147 Bacteria 3072
295 Ga0114129_10363852 3300009147 Bacteria 1913
296 Ga0114129_10422564 3300009147 Bacteria 1753
297 Ga0114129_10952676 3300009147 Bacteria 1084
298 Ga0114129_11098605 3300009147 Unclassified 996
299 Ga0114129_11784119 3300009147 Bacteria 749
300 Ga0114129_11816537 3300009147 Bacteria 741
301 Ga0114129_11954222 3300009147 Unclassified 710
302 Ga0114129_12108078 3300009147 Unclassified 680
303 Ga0114129_12871667 3300009147 Bacteria 571
304 Ga0114129_13193677 3300009147 Bacteria 533
305 Ga0105243_10089998 3300009148 Bacteria 2525
306 Ga0105243_10103030 3300009148 Bacteria 2373
307 Ga0105243_10222820 3300009148 Unclassified 1668
308 Ga0105243_10354291 3300009148 Bacteria 1349
309 Ga0105243_10406725 3300009148 Bacteria 1266
310 Ga0105243_10733933 3300009148 Bacteria 966
311 Ga0105243_10734701 3300009148 Bacteria 966
312 Ga0105243_11501754 3300009148 Bacteria 697
313 Ga0105243_11640183 3300009148 Unclassified 671
314 Ga0105241_10748508 3300009174 Bacteria 896
315 Ga0105241_11927793 3300009174 Unclassified 580
316 Ga0105242_10052183 3300009176 Bacteria 3336
317 Ga0105242_10112254 3300009176 Bacteria 2326
318 Ga0105242_10178987 3300009176 Bacteria 1869
319 Ga0105242_10353535 3300009176 Bacteria 1358
320 Ga0105242_11664473 3300009176 Bacteria 673
321 Ga0105242_12713597 3300009176 Unclassified 545
322 Ga0105248_10076402 3300009177 Bacteria 3764
323 Ga0105248_11680983 3300009177 Bacteria 720
324 Ga0105249_10083457 3300009553 Bacteria 2974
325 Ga0105249_10100359 3300009553 Bacteria 2721
326 Ga0105249_10171797 3300009553 Bacteria 2103
327 Ga0105249_10271389 3300009553 Bacteria 1690
328 Ga0105249_11195266 3300009553 Bacteria 831
329 Ga0105249_12443964 3300009553 Bacteria 595
330 Ga0105249_13496306 3300009553 Bacteria 506
331 Ga0105239_10061175 3300010375 Bacteria 4132
332 Ga0105239_10088866 3300010375 Bacteria 3407
333 Ga0105239_10096392 3300010375 Bacteria 3268
334 Ga0105239_10154842 3300010375 Unclassified 2559
335 Ga0105239_13218489 3300010375 Bacteria 532
336 Ga0105246_10025997 3300011119 Bacteria 3818
337 Ga0105246_10139771 3300011119 Unclassified 1820
338 Ga0105246_10175203 3300011119 Unclassified 1646
339 Ga0105246_10333983 3300011119 Bacteria 1236
340 Ga0105246_10351532 3300011119 Bacteria 1208
341 Ga0105246_10365596 3300011119 Bacteria 1187
342 Ga0105246_10743007 3300011119 Bacteria 865
343 Ga0105246_10975591 3300011119 Bacteria 765
344 Ga0105246_11682063 3300011119 Unclassified 602
345 Ga0105246_12351164 3300011119 Bacteria 522
346 Ga0157342_1062535 3300012507 Bacteria 549
347 Ga0157373_10596717 3300013100 Bacteria 804
348 Ga0157373_10881182 3300013100 Bacteria 663
349 Ga0157371_10149916 3300013102 Bacteria 1663
350 Ga0157370_10033295 3300013104 Bacteria 5024
351 Ga0157370_10350013 3300013104 Bacteria 1362
352 Ga0157370_10573459 3300013104 Bacteria 1034
353 Ga0157374_10984962 3300013296 Bacteria 862
354 Ga0157374_11662497 3300013296 Unclassified 663
355 Ga0157374_12802303 3300013296 Bacteria 515
356 Ga0157378_10719185 3300013297 Unclassified 1019
357 Ga0157378_11717905 3300013297 Unclassified 675
358 Ga0163162_10334291 3300013306 Bacteria 1647
359 Ga0163162_10341744 3300013306 Bacteria 1629
360 Ga0163162_13319678 3300013306 Bacteria 515
361 Ga0157372_10172325 3300013307 Bacteria 2504
362 Ga0157375_10951958 3300013308 Bacteria 1000
363 Ga0157375_11413949 3300013308 Bacteria 820
364 Ga0157375_11506130 3300013308 Unclassified 794
365 Ga0157375_11548347 3300013308 Unclassified 783
366 Ga0157375_11686417 3300013308 Bacteria 750
367 Ga0163163_10196044 3300014325 Bacteria 2067
368 Ga0157380_10273875 3300014326 Bacteria 1540
369 Ga0157380_10307737 3300014326 Bacteria 1463
370 Ga0157380_11150343 3300014326 Unclassified 817
371 Ga0157380_12988236 3300014326 Bacteria 539
372 Ga0157377_10059463 3300014745 Bacteria 2178
373 Ga0157377_10064493 3300014745 Bacteria 2101
374 Ga0157377_10517929 3300014745 Bacteria 837
375 Ga0157377_11380409 3300014745 Unclassified 555
376 Ga0157379_10371995 3300014968 Bacteria 1310
377 Ga0157376_10532420 3300014969 Bacteria 1160
378 Ga0157376_10824899 3300014969 Unclassified 941
379 Ga0157376_11203027 3300014969 Bacteria 786
380 Ga0163161_10571931 3300017792 Bacteria 928
381 Ga0163161_11122300 3300017792 Bacteria 677
382 Ga0197907_10085909 3300020069 Unclassified 1532
383 Ga0206356_11077094 3300020070 Bacteria 2150
384 Ga0206356_11105661 3300020070 Bacteria 1986
385 Ga0206355_1025702 3300020076 Bacteria 634
386 Ga0206355_1160160 3300020076 Unclassified 624
387 Ga0206352_11172591 3300020078 Bacteria 1059
388 Ga0206350_10334532 3300020080 Bacteria 1256
389 Ga0206354_10793628 3300020081 Bacteria 3108
390 Ga0206354_11430998 3300020081 Bacteria 2789
391 Ga0206353_10828983 3300020082 Unclassified 825
392 Ga0206353_11822418 3300020082 Bacteria 780
393 Ga0206353_11909465 3300020082 Bacteria 4171
394 Ga0206353_11930517 3300020082 Bacteria 5513
395 Ga0154015_1632745 3300020610 Bacteria 656
396 Ga0224712_10129633 3300022467 Unclassified 1100
397 Ga0207682_10434040 3300025893 Bacteria 621
398 Ga0207642_10202870 3300025899 Bacteria 1096
399 Ga0207642_10449887 3300025899 Bacteria 780
400 Ga0207710_10647796 3300025900 Bacteria 553
401 Ga0207688_10001991 3300025901 Bacteria 10955
402 Ga0207688_10024376 3300025901 Bacteria 3317
403 Ga0207688_10091080 3300025901 Bacteria 1751
404 Ga0207688_10233448 3300025901 Bacteria 1111
405 Ga0207688_10627789 3300025901 Bacteria 678
406 Ga0207680_11144248 3300025903 Bacteria 556
407 Ga0207647_10264398 3300025904 Unclassified 984
408 Ga0207647_10460521 3300025904 Unclassified 712
409 Ga0207645_10040177 3300025907 Bacteria 2996
410 Ga0207645_10155157 3300025907 Bacteria 1496
411 Ga0207645_10259557 3300025907 Unclassified 1151
412 Ga0207645_10831474 3300025907 Bacteria 628
413 Ga0207643_10002509 3300025908 Bacteria 9923
414 Ga0207643_10008679 3300025908 Bacteria 5452
415 Ga0207643_10026604 3300025908 Bacteria 3203
416 Ga0207643_10085602 3300025908 Unclassified 1831
417 Ga0207643_10244095 3300025908 Bacteria 1105
418 Ga0207643_11105561 3300025908 Bacteria 511
419 Ga0207705_10111197 3300025909 Bacteria 2024
420 Ga0207705_10718579 3300025909 Unclassified 776
421 Ga0207705_11226465 3300025909 Unclassified 575
422 Ga0207684_11673760 3300025910 Bacteria 513
423 Ga0207654_10713073 3300025911 Bacteria 721
424 Ga0207707_10039946 3300025912 Bacteria 4099
425 Ga0207707_10076138 3300025912 Bacteria 2928
426 Ga0207707_10119502 3300025912 Bacteria 2303
427 Ga0207707_11274483 3300025912 Unclassified 592
428 Ga0207707_11558423 3300025912 Bacteria 522
429 Ga0207695_10529602 3300025913 Bacteria 1060
430 Ga0207695_11101380 3300025913 Bacteria 674
431 Ga0207663_11002107 3300025916 Bacteria 670
432 Ga0207660_10051686 3300025917 Bacteria 2922
433 Ga0207660_10162583 3300025917 Bacteria 1723
434 Ga0207660_10227258 3300025917 Bacteria 1466
435 Ga0207660_10240319 3300025917 Bacteria 1426
436 Ga0207660_10463547 3300025917 Bacteria 1025
437 Ga0207662_10222222 3300025918 Bacteria 1230
438 Ga0207657_10000054 3300025919 Bacteria 106767
439 Ga0207657_10254646 3300025919 Bacteria 1398
440 Ga0207657_10705595 3300025919 Bacteria 783
441 Ga0207657_10759290 3300025919 Bacteria 751
442 Ga0207649_10085355 3300025920 Bacteria 2054
443 Ga0207649_10171418 3300025920 Bacteria 1512
444 Ga0207649_10291676 3300025920 Bacteria 1190
445 Ga0207649_10845844 3300025920 Bacteria 716
446 Ga0207649_10859341 3300025920 Unclassified 710
447 Ga0207649_10929413 3300025920 Unclassified 683
448 Ga0207652_10033046 3300025921 Bacteria 4354
449 Ga0207652_10074422 3300025921 Bacteria 2957
450 Ga0207652_10108706 3300025921 Bacteria 2457
451 Ga0207652_10704876 3300025921 Bacteria 900
452 Ga0207652_10989795 3300025921 Unclassified 739
453 Ga0207681_10714654 3300025923 Bacteria 834
454 Ga0207650_10007062 3300025925 Bacteria 7656
455 Ga0207650_10165300 3300025925 Bacteria 1756
456 Ga0207659_10155495 3300025926 Bacteria 1790
457 Ga0207659_10291846 3300025926 Bacteria 1336
458 Ga0207659_10813420 3300025926 Bacteria 803
459 Ga0207659_11295080 3300025926 Unclassified 626
460 Ga0207687_10012184 3300025927 Bacteria 5625
461 Ga0207687_10099918 3300025927 Bacteria 2133
462 Ga0207687_10204167 3300025927 Bacteria 1547
463 Ga0207687_10915436 3300025927 Bacteria 751
464 Ga0207687_11610264 3300025927 Unclassified 557
465 Ga0207664_10011249 3300025929 Bacteria 6349
466 Ga0207664_10567371 3300025929 Bacteria 1019
467 Ga0207690_10221492 3300025932 Bacteria 1448
468 Ga0207706_10063067 3300025933 Bacteria 3263
469 Ga0207706_10116957 3300025933 Bacteria 2345
470 Ga0207706_10561091 3300025933 Bacteria 982
471 Ga0207686_10549569 3300025934 Bacteria 903
472 Ga0207686_10555364 3300025934 Bacteria 898
473 Ga0207686_11623723 3300025934 Bacteria 534
474 Ga0207709_10067618 3300025935 Bacteria 2255
475 Ga0207709_10837245 3300025935 Unclassified 745
476 Ga0207709_10899644 3300025935 Bacteria 719
477 Ga0207670_10624877 3300025936 Bacteria 886
478 Ga0207670_11237922 3300025936 Unclassified 632
479 Ga0207669_10066597 3300025937 Bacteria 2240
480 Ga0207669_10104921 3300025937 Bacteria 1879
481 Ga0207669_10254974 3300025937 Bacteria 1309
482 Ga0207669_10344698 3300025937 Bacteria 1148
483 Ga0207669_10720788 3300025937 Bacteria 821
484 Ga0207669_11529408 3300025937 Bacteria 569
485 Ga0207704_10099604 3300025938 Bacteria 1934
486 Ga0207704_10162040 3300025938 Bacteria 1593
487 Ga0207704_10197928 3300025938 Bacteria 1468
488 Ga0207704_10354543 3300025938 Bacteria 1143
489 Ga0207704_10779764 3300025938 Bacteria 797
490 Ga0207691_10063570 3300025940 Bacteria 3347
491 Ga0207691_10465928 3300025940 Bacteria 1074
492 Ga0207691_10602484 3300025940 Unclassified 930
493 Ga0207691_10608664 3300025940 Bacteria 925
494 Ga0207689_10023381 3300025942 Bacteria 5188
495 Ga0207689_10027661 3300025942 Bacteria 4746
496 Ga0207689_10589648 3300025942 Bacteria 935
497 Ga0207689_10784014 3300025942 Bacteria 805
498 Ga0207661_10007306 3300025944 Bacteria 7858
499 Ga0207661_10039832 3300025944 Bacteria 3690
500 Ga0207661_10043058 3300025944 Bacteria 3562
501 Ga0207661_10064710 3300025944 Bacteria 2965
502 Ga0207661_10073776 3300025944 Bacteria 2796
503 Ga0207661_10100031 3300025944 Bacteria 2433
504 Ga0207661_10258994 3300025944 Bacteria 1549
505 Ga0207679_10091288 3300025945 Bacteria 2357
506 Ga0207679_10250932 3300025945 Unclassified 1504
507 Ga0207679_10514052 3300025945 Bacteria 1070
508 Ga0207679_10622403 3300025945 Bacteria 974
509 Ga0207679_10680872 3300025945 Bacteria 932
510 Ga0207679_10915438 3300025945 Bacteria 802
511 Ga0207679_12085320 3300025945 Bacteria 515
512 Ga0207667_10015039 3300025949 Bacteria 8802
513 Ga0207667_11136832 3300025949 Bacteria 763
514 Ga0207667_11659602 3300025949 Unclassified 607
515 Ga0207667_12096909 3300025949 Bacteria 524
516 Ga0207712_10083469 3300025961 Bacteria 2332
517 Ga0207712_10103665 3300025961 Bacteria 2120
518 Ga0207712_10250607 3300025961 Bacteria 1431
519 Ga0207712_11704001 3300025961 Unclassified 565
520 Ga0207668_10077833 3300025972 Bacteria 2393
521 Ga0207668_10207128 3300025972 Unclassified 1566
522 Ga0207668_11060362 3300025972 Bacteria 726
523 Ga0207640_10108593 3300025981 Bacteria 1961
524 Ga0207640_10857812 3300025981 Bacteria 790
525 Ga0207677_10144452 3300026023 Bacteria 1826
526 Ga0207677_10294225 3300026023 Bacteria 1339
527 Ga0207677_10554268 3300026023 Bacteria 1002
528 Ga0207677_10630911 3300026023 Bacteria 944
529 Ga0207677_11252898 3300026023 Bacteria 680
530 Ga0207703_11063014 3300026035 Bacteria 777
531 Ga0207639_10225586 3300026041 Unclassified 1621
532 Ga0207639_10277708 3300026041 Bacteria 1472
533 Ga0207639_11065630 3300026041 Unclassified 758
534 Ga0207639_11572892 3300026041 Unclassified 617
535 Ga0207678_10157709 3300026067 Bacteria 1938
536 Ga0207678_11757252 3300026067 Bacteria 544
537 Ga0207678_11809559 3300026067 Unclassified 534
538 Ga0207708_10058798 3300026075 Bacteria 2933
539 Ga0207708_10389622 3300026075 Bacteria 1150
540 Ga0207708_11088043 3300026075 Bacteria 697
541 Ga0207702_10460933 3300026078 Bacteria 1234
542 Ga0207702_12068355 3300026078 Bacteria 559
543 Ga0207641_10801404 3300026088 Bacteria 932
544 Ga0207648_10069046 3300026089 Bacteria 3079
545 Ga0207648_10129248 3300026089 Bacteria 2223
546 Ga0207648_10213047 3300026089 Bacteria 1715
547 Ga0207648_10290811 3300026089 Bacteria 1463
548 Ga0207648_10387792 3300026089 Unclassified 1264
549 Ga0207648_10833752 3300026089 Bacteria 859
550 Ga0207648_11499738 3300026089 Bacteria 634
551 Ga0207676_10598686 3300026095 Bacteria 1058
552 Ga0207676_10778309 3300026095 Bacteria 932
553 Ga0207676_11581384 3300026095 Bacteria 653
554 Ga0207674_10002093 3300026116 Bacteria 25273
555 Ga0207674_10018243 3300026116 Bacteria 7632
556 Ga0207674_10059218 3300026116 Bacteria 3876
557 Ga0207674_10145617 3300026116 Bacteria 2327
558 Ga0207674_10151009 3300026116 Unclassified 2280
559 Ga0207674_10446753 3300026116 Bacteria 1250
560 Ga0207675_100105767 3300026118 Bacteria 2653
561 Ga0207675_100110180 3300026118 Bacteria 2597
562 Ga0207675_100401490 3300026118 Bacteria 1351
563 Ga0207683_10015569 3300026121 Bacteria 6473
564 Ga0207683_10041072 3300026121 Bacteria 4037
565 Ga0207683_10271837 3300026121 Bacteria 1548
566 Ga0207683_10420899 3300026121 Bacteria 1230
567 Ga0207683_10905603 3300026121 Bacteria 819
568 Ga0207683_11071811 3300026121 Bacteria 748
569 Ga0207683_11126103 3300026121 Bacteria 728
570 Ga0207698_10056700 3300026142 Bacteria 3026
571 Ga0207698_10095721 3300026142 Bacteria 2445
572 Ga0207428_10000401 3300027907 Bacteria 53789
573 Ga0207428_10009137 3300027907 Bacteria 8907
574 Ga0207428_10050027 3300027907 Bacteria 3345
575 Ga0207428_10109876 3300027907 Bacteria 2123
576 Ga0207428_10306901 3300027907 Bacteria 1174
577 Ga0207428_10389957 3300027907 Bacteria 1021
578 Ga0268266_12155903 3300028379 Unclassified 530
579 Ga0268265_10545035 3300028380 Unclassified 1100
580 Ga0268265_11832194 3300028380 Bacteria 613
581 Ga0268264_11166965 3300028381 Bacteria 779
582 Ga0307408_100133628 3300031548 Bacteria 1938
583 Ga0307405_10050448 3300031731 Bacteria 2577
584 Ga0307405_10050941 3300031731 Bacteria 2567
585 Ga0307413_10074386 3300031824 Bacteria 2151
586 Ga0307410_10012458 3300031852 Bacteria 4920
587 Ga0307410_10088032 3300031852 Bacteria 2198
588 Ga0307410_10376759 3300031852 Bacteria 1141
589 Ga0307410_11037767 3300031852 Bacteria 708
590 Ga0307406_10068566 3300031901 Bacteria 2316
591 Ga0307406_10078186 3300031901 Bacteria 2191
592 Ga0307406_11778989 3300031901 Bacteria 547
593 Ga0307407_10001948 3300031903 Bacteria 7819
594 Ga0307407_11153674 3300031903 Bacteria 604
595 Ga0307412_10049701 3300031911 Bacteria 2764
596 Ga0307409_100024427 3300031995 Bacteria 4215
597 Ga0307409_100028580 3300031995 Bacteria 3975
598 Ga0307409_101857677 3300031995 Bacteria 632
599 Ga0307416_100006216 3300032002 Bacteria 7452
600 Ga0307416_100064904 3300032002 Bacteria 2997
601 Ga0307416_100186337 3300032002 Bacteria 1951
602 Ga0307416_100763763 3300032002 Bacteria 1060
603 Ga0307414_10169396 3300032004 Bacteria 1744
604 Ga0307414_10331474 3300032004 Bacteria 1299
605 Ga0307414_10534154 3300032004 Bacteria 1043
606 Ga0307411_10036924 3300032005 Bacteria 3067
607 Ga0307415_100000048 3300032126 Bacteria 51694
608 Ga0307415_100090281 3300032126 Bacteria 2215
609 Ga0373946_0390442 3300035171 Bacteria 701
610 Ga0373962_0212986 3300035242 Bacteria 658
611 Ga0373962_0290574 3300035242 Bacteria 577
612 Ga0373931_0911970 3300035691 Bacteria 591
613 Ga0373931_1179277 3300035691 Unclassified 524
614 Ga0395899_0001267 3300037312 Bacteria 21969
615 Ga0395899_0007849 3300037312 Bacteria 8223
616 Ga0395899_0109697 3300037312 Bacteria 1985
617 Ga0395899_0370342 3300037312 Bacteria 954
618 Ga0395900_0002886 3300037418 Bacteria 18717
619 Ga0395900_0027313 3300037418 Bacteria 5845
620 Ga0395900_0034837 3300037418 Bacteria 5186
621 Ga0395900_0060391 3300037418 Bacteria 3901
622 Ga0395900_0065948 3300037418 Bacteria 3720
623 Ga0395900_0066781 3300037418 Unclassified 3696
624 Ga0395900_0233297 3300037418 Bacteria 1849
625 Ga0395900_0338229 3300037418 Bacteria 1481
626 Ga0395898_0001276 3300037466 Bacteria 37111
627 Ga0395898_0038785 3300037466 Bacteria 4719
628 Ga0395898_0076090 3300037466 Bacteria 3241
629 Ga0395898_0121509 3300037466 Bacteria 2502
630 Ga0395898_0290795 3300037466 Bacteria 1559
631 Ga0395898_0434028 3300037466 Bacteria 1251
632 Ga0395898_0478993 3300037466 Bacteria 1184
633 Ga0395898_1623705 3300037466 Bacteria 570
634 Ga0395905_0001281 3300037471 Bacteria 31019
635 Ga0395905_0018402 3300037471 Bacteria 6630
636 Ga0395905_0064515 3300037471 Bacteria 3427
637 Ga0395905_0323752 3300037471 Unclassified 1431
638 Ga0395905_0647610 3300037471 Bacteria 958
639 Ga0395905_0648832 3300037471 Bacteria 957
640 Ga0395905_0781437 3300037471 Unclassified 858
641 Ga0395905_1375500 3300037471 Bacteria 610
642 Ga0395901_0001957 3300038443 Bacteria 21190
643 Ga0395901_0020142 3300038443 Bacteria 6826
644 Ga0395901_0135873 3300038443 Bacteria 2584
645 Ga0395901_0191483 3300038443 Bacteria 2145
646 Ga0395901_0263620 3300038443 Bacteria 1793
647 Ga0395901_0336015 3300038443 Unclassified 1561
648 Ga0395901_0796873 3300038443 Bacteria 934
649 Ga0395901_0819152 3300038443 Unclassified 918
650 Ga0439439_0060092 3300041406 Bacteria 1008
651 Ga0451807_1804249 3300041486 Bacteria 559
652 Ga0451839_0318159 3300041496 Unclassified 533
653 Ga0451845_0926056 3300041501 Bacteria 719
654 Ga0451849_0021204 3300041505 Bacteria 1047
655 Ga0451853_3202839 3300041512 Bacteria 2507
656 Ga0439448_0106769 3300042005 Unclassified 954
657 Ga0439448_0222463 3300042005 Bacteria 664
658 Ga0439448_0366107 3300042005 Unclassified 515
659 Ga0439456_036207 3300042013 Bacteria 1064
660 Ga0439463_086856 3300042016 Unclassified 805
661 Ga0439463_121816 3300042016 Bacteria 674
662 Ga0450920_064267 3300042122 Bacteria 743
663 Ga0450920_068154 3300042122 Unclassified 723
664 Ga0450923_054348 3300042125 Unclassified 865
665 Ga0450903_066322 3300042138 Bacteria 522
666 Ga0450906_048518 3300042145 Bacteria 749
667 Ga0439446_0090789 3300042156 Bacteria 956
668 Ga0439458_0050149 3300042157 Bacteria 1029
669 Ga0439458_0086793 3300042157 Bacteria 802
670 Ga0439434_0027687 3300042435 Bacteria 1714
671 Ga0439460_0169385 3300042461 Unclassified 735
672 Ga0450916_087189 3300042530 Unclassified 539
673 Ga0450918_005450 3300042531 Bacteria 2288
674 Ga0450918_064542 3300042531 Bacteria 680
675 Ga0451577_0518193 3300042876 Bacteria 1083
676 Ga0466972_0517172 3300044658 Bacteria 562
677 Ga0466965_0573514 3300044683 Bacteria 639
678 Ga0466965_0821123 3300044683 Bacteria 539
679 Ga0466966_0367792 3300044684 Bacteria 864
680 Ga0466963_0041023 3300044694 Bacteria 3034
681 Ga0466963_0196061 3300044694 Bacteria 1412
682 Ga0466968_0097698 3300044735 Bacteria 1308
683 Ga0466957_0218230 3300044842 Unclassified 1258
684 Ga0466960_0020509 3300044901 Bacteria 2928
685 Ga0451576_0207388 3300045051 Unclassified 2046
686 Ga0466967_0063451 3300045976 Bacteria 3283
687 Ga0495617_085647 3300046452 Bacteria 1031
688 Ga0495627_054819 3300046453 Unclassified 1191
689 Ga0495592_0680571 3300046454 Bacteria 620
690 Ga0495603_0013529 3300046455 Bacteria 4935
691 Ga0495603_0046215 3300046455 Bacteria 2595
692 Ga0495590_0112501 3300046457 Bacteria 972
693 Ga0495590_0140363 3300046457 Archaea 872
694 Ga0495641_0098171 3300046461 Bacteria 1307
695 Ga0495582_0028288 3300046473 Bacteria 3076
696 Ga0495605_0100506 3300046474 Bacteria 1330
697 Ga0495605_0168527 3300046474 Bacteria 968
698 Ga0495584_0286789 3300046491 Bacteria 836
699 Ga0495585_0102558 3300046492 Unclassified 1529
700 Ga0495585_0228463 3300046492 Bacteria 936
701 Ga0495596_0071797 3300046500 Bacteria 1344
702 Ga0495596_0083222 3300046500 Bacteria 1242
703 Ga0495596_0101511 3300046500 Unclassified 1117
704 Ga0495596_0154386 3300046500 Bacteria 892
705 Ga0495583_0108090 3300046506 Unclassified 1181
706 Ga0495616_0289418 3300046513 Bacteria 694
707 Ga0495620_0090038 3300046515 Unclassified 1232
708 Ga0495620_0250784 3300046515 Unclassified 675
709 Ga0495631_0110522 3300046518 Bacteria 1182
710 Ga0495632_0373764 3300046519 Bacteria 625
711 Ga0495637_0129783 3300046520 Bacteria 963
712 Ga0495637_0133482 3300046520 Unclassified 946
713 Ga0495643_0333014 3300046522 Bacteria 684
714 Ga0495644_0046431 3300046523 Bacteria 1632
715 Ga0495644_0229737 3300046523 Bacteria 718
716 Ga0495644_0390616 3300046523 Bacteria 550
717 Ga0495663_0004676 3300046525 Bacteria 3835
718 Ga0495663_0040106 3300046525 Unclassified 1420
719 Ga0495663_0149605 3300046525 Bacteria 796
720 Ga0495663_0233650 3300046525 Archaea 649
721 Ga0495642_0430060 3300046528 Unclassified 583
722 Ga0495652_0312872 3300046529 Bacteria 1137
723 Ga0495654_0308257 3300046530 Unclassified 645
724 Ga0495665_0194446 3300046531 Bacteria 1052
725 Ga0495587_0642715 3300046536 Bacteria 583
726 Ga0495598_0012933 3300046537 Bacteria 2059
727 Ga0495598_0407442 3300046537 Bacteria 532
728 Ga0495598_0440279 3300046537 Unclassified 515
729 Ga0495609_0144655 3300046538 Bacteria 1013
730 Ga0495609_0453173 3300046538 Unclassified 509
731 Ga0495621_0074773 3300046539 Unclassified 1254
732 Ga0495621_0155546 3300046539 Bacteria 902
733 Ga0495621_0378071 3300046539 Bacteria 598
734 Ga0495597_0300703 3300046542 Unclassified 622
735 Ga0495597_0318428 3300046542 Bacteria 601
736 Ga0495597_0334741 3300046542 Bacteria 583
737 Ga0495633_0297989 3300046558 Unclassified 733
738 Ga0495656_0137860 3300046615 Unclassified 1167
739 Ga0495656_0242782 3300046615 Bacteria 907
740 Ga0495656_0406429 3300046615 Bacteria 713
741 Ga0495656_0421376 3300046615 Unclassified 700
742 Ga0495668_0378630 3300046616 Unclassified 777
743 Ga0495611_0049281 3300046648 Unclassified 1895
744 Ga0495611_0152182 3300046648 Bacteria 1080
745 Ga0495659_0048780 3300046664 Unclassified 1535
746 Ga0495659_0161064 3300046664 Bacteria 906
747 Ga0495659_0184467 3300046664 Bacteria 851
748 Ga0495661_0308516 3300046665 Bacteria 790
749 Ga0495588_0024053 3300046674 Bacteria 3023
750 Ga0495588_0093632 3300046674 Bacteria 1575
751 Ga0495588_0724431 3300046674 Unclassified 520
752 Ga0495599_0791774 3300046678 Bacteria 542
753 Ga0495669_0273298 3300046684 Bacteria 812
754 Ga0495613_0330815 3300046689 Bacteria 1050
755 Ga0495670_0065142 3300046691 Unclassified 1836
756 Ga0495670_0105833 3300046691 Bacteria 1453
757 Ga0495670_0480464 3300046691 Bacteria 674
758 Ga0495670_0715252 3300046691 Unclassified 546
759 Ga0495671_0374451 3300046692 Unclassified 682
760 Ga0495649_0280587 3300046694 Unclassified 851
761 Ga0495589_0079726 3300046794 Unclassified 1593
762 Ga0495589_0081993 3300046794 Bacteria 1569
763 Ga0495589_0186200 3300046794 Unclassified 983
764 Ga0495589_0248661 3300046794 Bacteria 831
765 Ga0495589_0311574 3300046794 Bacteria 728
766 Ga0495600_0793625 3300046809 Bacteria 564
767 Ga0495660_0079438 3300046810 Bacteria 1723
768 Ga0495581_0283482 3300047315 Bacteria 968
769 Ga0495581_0812960 3300047315 Unclassified 536
770 Ga0495604_0630258 3300047317 Unclassified 685
771 Ga0495636_0154959 3300047318 Bacteria 1030
772 Ga0495676_0023919 3300047321 Bacteria 5294
773 Ga0495680_0303581 3300047322 Unclassified 1120
774 Ga0495683_0370665 3300047323 Bacteria 601
775 Ga0495677_0080032 3300047445 Bacteria 1224
776 Ga0495677_0252653 3300047445 Bacteria 689
777 Ga0495679_074607 3300047446 Bacteria 971
778 Ga0495679_194794 3300047446 Unclassified 534
779 Ga0495673_0267120 3300047469 Unclassified 621
780 Ga0495681_0212711 3300047470 Bacteria 779
781 Ga0495615_0031877 3300048090 Unclassified 1267
782 Ga0495626_0054070 3300048091 Bacteria 1845
783 Ga0495626_0108280 3300048091 Unclassified 1206
784 Ga0496101_0280678 3300048904 Bacteria 1302
785 Ga0496101_1096919 3300048904 Bacteria 625
786 Ga0496102_0028791 3300048905 Bacteria 4966
787 Ga0496102_0423380 3300048905 Bacteria 1251
788 Ga0496102_1732351 3300048905 Bacteria 542
789 Ga0496103_0106691 3300048906 Bacteria 1777
790 Ga0496103_0449432 3300048906 Bacteria 827
791 Ga0496104_0727418 3300048907 Bacteria 900
792 Ga0496104_0860734 3300048907 Bacteria 812
793 Ga0496105_0878004 3300048908 Unclassified 677
794 Ga0496105_0969202 3300048908 Unclassified 638
795 Ga0496106_0120703 3300048909 Bacteria 2049
796 Ga0496106_0175479 3300048909 Bacteria 1700
797 Ga0496106_0482540 3300048909 Bacteria 996
798 Ga0496107_0542351 3300048910 Bacteria 862
799 Ga0496107_0752435 3300048910 Bacteria 715
800 Ga0496108_0040312 3300048911 Bacteria 3892
801 Ga0496108_0068710 3300048911 Bacteria 2989
802 Ga0496108_0299078 3300048911 Bacteria 1402
803 Ga0496108_1068807 3300048911 Unclassified 687
804 Ga0496109_0022743 3300048912 Bacteria 5554
805 Ga0496109_0060318 3300048912 Bacteria 3466
806 Ga0496109_0127383 3300048912 Bacteria 2374
807 Ga0496109_0277844 3300048912 Bacteria 1578
808 Ga0496109_0337591 3300048912 Bacteria 1423
809 Ga0496109_1564420 3300048912 Unclassified 594
810 Ga0496110_0001407 3300048913 Bacteria 17382
811 Ga0496110_0127487 3300048913 Bacteria 2296
812 Ga0496110_0230115 3300048913 Bacteria 1686
813 Ga0496110_0287119 3300048913 Bacteria 1498
814 Ga0496110_0304871 3300048913 Bacteria 1451
815 Ga0496111_0000429 3300048914 Bacteria 21251
816 Ga0496111_0021603 3300048914 Bacteria 4497
817 Ga0496111_0295934 3300048914 Bacteria 1200
818 Ga0496111_0300145 3300048914 Bacteria 1191
819 Ga0496111_1336123 3300048914 Unclassified 504
820 Ga0496112_0133792 3300048915 Bacteria 2450
821 Ga0496112_0175855 3300048915 Bacteria 2106
822 Ga0496113_0090032 3300048916 Bacteria 2363
823 Ga0496113_0119174 3300048916 Bacteria 2062
824 Ga0496113_0350260 3300048916 Bacteria 1185
825 Ga0496113_1092764 3300048916 Unclassified 626
826 Ga0496113_1141349 3300048916 Unclassified 610
827 Ga0496114_1307762 3300048917 Bacteria 612
828 Ga0496115_1456003 3300048918 Unclassified 503
829 Ga0501031_0017526 3300049568 Bacteria 4655
830 Ga0501031_0091998 3300049568 Bacteria 1979
831 Ga0501031_0303888 3300049568 Unclassified 1034
832 Ga0501032_0024682 3300049569 Bacteria 4148
833 Ga0501032_0184612 3300049569 Bacteria 1365
834 Ga0501032_0225685 3300049569 Bacteria 1218
835 Ga0501032_0240974 3300049569 Bacteria 1175
836 Ga0501033_0020457 3300049570 Bacteria 4999
837 Ga0501033_0085797 3300049570 Bacteria 2305
838 Ga0501033_0277089 3300049570 Bacteria 1185
839 Ga0501033_0709822 3300049570 Bacteria 684
840 Ga0501034_0235388 3300049571 Bacteria 1779
841 Ga0501034_0458509 3300049571 Bacteria 1192
842 Ga0501034_0943534 3300049571 Bacteria 749
843 Ga0501036_0010942 3300049572 Bacteria 7500
844 Ga0501036_0061610 3300049572 Bacteria 3178
845 Ga0501036_0099059 3300049572 Bacteria 2465
846 Ga0501036_0145794 3300049572 Bacteria 1997
847 Ga0501036_0395671 3300049572 Bacteria 1153
848 Ga0501036_0471274 3300049572 Bacteria 1045
849 Ga0501036_0881109 3300049572 Unclassified 735
850 Ga0501037_0224497 3300049573 Bacteria 1320
851 Ga0501037_0305204 3300049573 Bacteria 1104
852 Ga0501037_0435921 3300049573 Bacteria 895
853 Ga0501037_1148808 3300049573 Unclassified 502
854 Ga0501038_0022437 3300049574 Bacteria 5656
855 Ga0501038_0027917 3300049574 Bacteria 5016
856 Ga0501038_0334649 3300049574 Bacteria 1182
857 Ga0501038_0424149 3300049574 Bacteria 1026
858 Ga0501038_1326751 3300049574 Bacteria 519
859 Ga0501039_0002212 3300049575 Bacteria 14387
860 Ga0501039_0032683 3300049575 Bacteria 4012
861 Ga0501039_0095908 3300049575 Bacteria 2312
862 Ga0501039_0243431 3300049575 Bacteria 1414
863 Ga0501039_0254316 3300049575 Bacteria 1381
864 Ga0501039_0902689 3300049575 Bacteria 688
865 Ga0501040_0004806 3300049576 Bacteria 8754
866 Ga0501040_0026839 3300049576 Bacteria 3875
867 Ga0501040_0037267 3300049576 Bacteria 3303
868 Ga0501040_0077947 3300049576 Bacteria 2293
869 Ga0501040_0139227 3300049576 Bacteria 1709
870 Ga0501040_0181381 3300049576 Bacteria 1493
871 Ga0501040_0476048 3300049576 Bacteria 899
872 Ga0501040_0480602 3300049576 Bacteria 895
873 Ga0501040_0750421 3300049576 Bacteria 706
874 Ga0501040_1068370 3300049576 Bacteria 585
875 Ga0501041_0005164 3300049577 Bacteria 7618
876 Ga0501041_0019292 3300049577 Bacteria 4071
877 Ga0501041_0049701 3300049577 Bacteria 2554
878 Ga0501041_0084776 3300049577 Bacteria 1953
879 Ga0501041_0188418 3300049577 Bacteria 1292
880 Ga0501041_0286064 3300049577 Bacteria 1038
881 Ga0501041_0485140 3300049577 Bacteria 786
882 Ga0501042_0018108 3300049578 Bacteria 4872
883 Ga0501042_0026164 3300049578 Bacteria 4102
884 Ga0501042_0165086 3300049578 Unclassified 1598
885 Ga0501042_0175223 3300049578 Bacteria 1547
886 Ga0501042_0279120 3300049578 Bacteria 1206
887 Ga0501042_0538576 3300049578 Bacteria 848
888 Ga0501042_0612707 3300049578 Bacteria 791
889 Ga0501043_0068028 3300049579 Bacteria 2796
890 Ga0501043_0216553 3300049579 Bacteria 1483
891 Ga0501043_0292045 3300049579 Bacteria 1248
892 Ga0501046_0012761 3300049580 Bacteria 7146
893 Ga0501046_0078450 3300049580 Bacteria 2554
894 Ga0501046_0100480 3300049580 Bacteria 2220
895 Ga0501047_0251004 3300049581 Bacteria 1618
896 Ga0501048_0006302 3300049582 Bacteria 9022
897 Ga0501048_0042274 3300049582 Bacteria 3263
898 Ga0501048_0142440 3300049582 Bacteria 1695
899 Ga0501048_0169398 3300049582 Bacteria 1547
900 Ga0501048_0871857 3300049582 Bacteria 647
901 Ga0501048_0976338 3300049582 Bacteria 609
902 Ga0501048_1114084 3300049582 Bacteria 568
903 Ga0501067_0019768 3300049583 Bacteria 3728
904 Ga0501067_0033431 3300049583 Bacteria 2853
905 Ga0501067_0034302 3300049583 Bacteria 2816
906 Ga0501067_0052225 3300049583 Bacteria 2265
907 Ga0501067_0074138 3300049583 Bacteria 1886
908 Ga0501067_0124915 3300049583 Bacteria 1432
909 Ga0501067_0638256 3300049583 Unclassified 598
910 Ga0501067_0655592 3300049583 Bacteria 589
911 Ga0501068_0008679 3300049584 Bacteria 5667
912 Ga0501068_0013162 3300049584 Bacteria 4703
913 Ga0501068_0030506 3300049584 Bacteria 3198
914 Ga0501068_0043231 3300049584 Bacteria 2710
915 Ga0501068_0080912 3300049584 Unclassified 1993
916 Ga0501068_0124228 3300049584 Bacteria 1611
917 Ga0501068_0138056 3300049584 Bacteria 1527
918 Ga0501068_0152299 3300049584 Bacteria 1454
919 Ga0501068_0536747 3300049584 Bacteria 760
920 Ga0501068_0799758 3300049584 Unclassified 618
921 Ga0501068_1067745 3300049584 Bacteria 534
922 Ga0501069_0007796 3300049585 Bacteria 5622
923 Ga0501069_0022300 3300049585 Bacteria 3443
924 Ga0501069_0040981 3300049585 Bacteria 2558
925 Ga0501069_0046889 3300049585 Bacteria 2398
926 Ga0501069_0149432 3300049585 Bacteria 1342
927 Ga0501069_0169046 3300049585 Bacteria 1261
928 Ga0501069_0703316 3300049585 Unclassified 610
929 Ga0501069_0867439 3300049585 Unclassified 548
930 Ga0501070_0020654 3300049586 Bacteria 5524
931 Ga0501070_0048989 3300049586 Bacteria 3508
932 Ga0501070_0176336 3300049586 Bacteria 1760
933 Ga0501070_0412799 3300049586 Bacteria 1091
934 Ga0501070_0645325 3300049586 Bacteria 841
935 Ga0501070_0936911 3300049586 Bacteria 674
936 Ga0501071_0018405 3300049587 Bacteria 4835
937 Ga0501071_0024160 3300049587 Bacteria 4249
938 Ga0501071_0028681 3300049587 Bacteria 3924
939 Ga0501071_0047047 3300049587 Bacteria 3099
940 Ga0501071_0211396 3300049587 Bacteria 1459
941 Ga0501071_0234140 3300049587 Unclassified 1384
942 Ga0501071_0280880 3300049587 Bacteria 1260
943 Ga0501071_0326348 3300049587 Bacteria 1166
944 Ga0501071_0364117 3300049587 Bacteria 1101
945 Ga0501071_0397214 3300049587 Bacteria 1052
946 Ga0501071_0397854 3300049587 Bacteria 1051
947 Ga0501071_0463586 3300049587 Bacteria 970
948 Ga0501071_0565713 3300049587 Bacteria 873
949 Ga0501071_0654296 3300049587 Bacteria 808
950 Ga0501071_0677326 3300049587 Bacteria 794
951 Ga0501071_1267531 3300049587 Unclassified 569
952 Ga0501071_1271416 3300049587 Unclassified 568
953 Ga0501072_0033625 3300049588 Bacteria 4018
954 Ga0501072_0042269 3300049588 Bacteria 3580
955 Ga0501072_0224443 3300049588 Bacteria 1497
956 Ga0501072_0281226 3300049588 Bacteria 1323
957 Ga0501072_0357610 3300049588 Unclassified 1159
958 Ga0501072_0413755 3300049588 Unclassified 1069
959 Ga0501072_0417534 3300049588 Bacteria 1064
960 Ga0501072_0439181 3300049588 Bacteria 1034
961 Ga0501072_0456171 3300049588 Bacteria 1012
962 Ga0501072_0656734 3300049588 Bacteria 825
963 Ga0501072_0846546 3300049588 Bacteria 715
964 Ga0501072_0998220 3300049588 Bacteria 652
965 Ga0501072_1206708 3300049588 Unclassified 587
966 Ga0501073_0107039 3300049589 Bacteria 1940
967 Ga0501073_0147229 3300049589 Bacteria 1632
968 Ga0501074_0006126 3300049590 Bacteria 8687
969 Ga0501074_0013466 3300049590 Bacteria 5947
970 Ga0501074_0104953 3300049590 Bacteria 2023
971 Ga0501074_0162554 3300049590 Bacteria 1595
972 Ga0501074_0210731 3300049590 Bacteria 1384
973 Ga0501074_0507914 3300049590 Bacteria 854
974 Ga0501074_0928348 3300049590 Bacteria 612
975 Ga0501074_1079707 3300049590 Unclassified 564
976 Ga0501075_0003679 3300049591 Bacteria 10284
977 Ga0501075_0013849 3300049591 Bacteria 5767
978 Ga0501075_0115636 3300049591 Bacteria 2039
979 Ga0501075_0243998 3300049591 Bacteria 1369
980 Ga0501075_0262271 3300049591 Bacteria 1317
981 Ga0501075_0534090 3300049591 Bacteria 895
982 Ga0501075_0707745 3300049591 Unclassified 767
983 Ga0501075_0936112 3300049591 Unclassified 658
984 Ga0501075_1197469 3300049591 Unclassified 576
985 Ga0501076_0008472 3300049592 Bacteria 7536
986 Ga0501076_0015191 3300049592 Bacteria 5816
987 Ga0501076_0016399 3300049592 Bacteria 5617
988 Ga0501076_0016982 3300049592 Bacteria 5525
989 Ga0501076_0100138 3300049592 Bacteria 2335
990 Ga0501076_0132771 3300049592 Bacteria 2020
991 Ga0501076_0146069 3300049592 Bacteria 1923
992 Ga0501076_0157680 3300049592 Unclassified 1848
993 Ga0501076_0159606 3300049592 Bacteria 1837
994 Ga0501076_0219158 3300049592 Bacteria 1555
995 Ga0501076_0244055 3300049592 Bacteria 1469
996 Ga0501076_0329809 3300049592 Bacteria 1252
997 Ga0501076_0427588 3300049592 Bacteria 1090
998 Ga0501076_0456519 3300049592 Unclassified 1052
999 Ga0501076_0665851 3300049592 Unclassified 859
1000 Ga0501077_0022574 3300049593 Bacteria 3986
1001 Ga0501077_0041065 3300049593 Bacteria 2946
1002 Ga0501077_0318572 3300049593 Bacteria 991
1003 Ga0501077_0348603 3300049593 Bacteria 945
1004 Ga0501077_0774112 3300049593 Bacteria 617
1005 Ga0501227_161066 3300049665 Bacteria 624
1006 Ga0501079_0006082 3300049741 Bacteria 9046
1007 Ga0501079_0022587 3300049741 Bacteria 4825
1008 Ga0501079_0154836 3300049741 Bacteria 1786
1009 Ga0501079_0160189 3300049741 Bacteria 1755
1010 Ga0501079_0238403 3300049741 Bacteria 1421
1011 Ga0501079_0273204 3300049741 Bacteria 1321
1012 Ga0501079_0457698 3300049741 Bacteria 1002
1013 Ga0501079_0484261 3300049741 Unclassified 972
1014 Ga0501079_0980480 3300049741 Bacteria 666
1015 Ga0501079_1100036 3300049741 Bacteria 626
1016 Ga0501079_1336632 3300049741 Bacteria 564
1017 Ga0501080_0002972 3300049742 Bacteria 14917
1018 Ga0501080_0035360 3300049742 Bacteria 4662
1019 Ga0501080_0156880 3300049742 Bacteria 2102
1020 Ga0501080_0308322 3300049742 Bacteria 1435
1021 Ga0501080_0520091 3300049742 Bacteria 1062
1022 Ga0501080_0911245 3300049742 Bacteria 766
1023 Ga0501080_0932329 3300049742 Bacteria 756
1024 Ga0501080_1770544 3300049742 Bacteria 520
1025 Ga0501081_0016817 3300049743 Bacteria 4835
1026 Ga0501081_0030270 3300049743 Bacteria 3663
1027 Ga0501081_0067384 3300049743 Bacteria 2491
1028 Ga0501081_0082457 3300049743 Bacteria 2253
1029 Ga0501081_0083996 3300049743 Bacteria 2233
1030 Ga0501081_0172817 3300049743 Bacteria 1560
1031 Ga0501081_0388053 3300049743 Bacteria 1033
1032 Ga0501081_0446074 3300049743 Unclassified 961
1033 Ga0501081_0965591 3300049743 Bacteria 643
1034 Ga0501081_1035808 3300049743 Bacteria 620
1035 Ga0501081_1373756 3300049743 Bacteria 536
1036 Ga0501083_0021679 3300049744 Bacteria 4462
1037 Ga0501083_0033656 3300049744 Bacteria 3508
1038 Ga0501083_0438702 3300049744 Bacteria 850
1039 Ga0501083_0594524 3300049744 Bacteria 720
1040 Ga0501083_0796336 3300049744 Bacteria 615
1041 Ga0501083_0947818 3300049744 Bacteria 560
1042 Ga0501035_0027926 3300049822 Bacteria 5155
1043 Ga0501035_0045420 3300049822 Bacteria 3952
1044 Ga0501035_0163984 3300049822 Bacteria 1923
1045 Ga0501035_0556547 3300049822 Bacteria 939
1046 Ga0501035_1039394 3300049822 Unclassified 642
1047 Ga0501044_0080565 3300049823 Bacteria 3298
1048 Ga0501044_0210408 3300049823 Bacteria 1899
1049 Ga0501045_0007918 3300049824 Bacteria 7400
1050 Ga0501045_0009197 3300049824 Bacteria 6904
1051 Ga0501045_0071952 3300049824 Bacteria 2545
1052 Ga0501045_0087248 3300049824 Bacteria 2303
1053 Ga0501045_0797633 3300049824 Bacteria 695
1054 Ga0501045_0981993 3300049824 Unclassified 619
1055 Ga0501045_1211452 3300049824 Bacteria 551
1056 Ga0501212_023168 3300049851 Bacteria 972
1057 nmdc:mga00v17_223732_c1 3300050491 Bacteria 1219
1058 nmdc:mga0yw44_35698_c1 3300050492 Bacteria 2924
1059 nmdc:mga0yw44_87545_c1 3300050492 Unclassified 1963
1060 nmdc:mga05p37_1383058_c1 3300050507 Unclassified 710
1061 nmdc:mga05p37_1515997_c1 3300050507 Bacteria 666
1062 nmdc:mga05p37_1775211_c1 3300050507 Unclassified 597
1063 nmdc:mga05p37_19483_c1 3300050507 Bacteria 8206
1064 nmdc:mga05p37_215759_c1 3300050507 Bacteria 2318
1065 nmdc:mga05p37_24671_c1 3300050507 Bacteria 7309
1066 nmdc:mga05p37_399062_c1 3300050507 Bacteria 1606
1067 nmdc:mga05p37_442608_c1 3300050507 Bacteria 1507
1068 nmdc:mga05p37_5798_c1 3300050507 Bacteria 14515
1069 nmdc:mga09592_36637_c1 3300050508 Bacteria 4109
1070 nmdc:mga09592_37133_c1 3300050508 Bacteria 4085
1071 nmdc:mga09592_420676_c1 3300050508 Bacteria 1154
1072 nmdc:mga09592_65927_c1 3300050508 Bacteria 3068
1073 nmdc:mga0qj67_103939_c1 3300050509 Bacteria 2291
1074 nmdc:mga0qj67_121664_c1 3300050509 Bacteria 2112
1075 nmdc:mga0qj67_1333152_c1 3300050509 Unclassified 555
1076 nmdc:mga0qj67_492082_c1 3300050509 Bacteria 986
1077 nmdc:mga06r32_1446085_c1 3300050510 Unclassified 628
1078 nmdc:mga06r32_317855_c1 3300050510 Bacteria 1542
1079 nmdc:mga06r32_51565_c1 3300050510 Bacteria 3938
1080 nmdc:mga06r32_735327_c1 3300050510 Bacteria 950
1081 nmdc:mga08y16_1002010_c1 3300050511 Unclassified 815
1082 nmdc:mga08y16_221056_c1 3300050511 Bacteria 1961
1083 nmdc:mga08y16_272307_c1 3300050511 Bacteria 1747
1084 nmdc:mga08y16_37087_c1 3300050511 Bacteria 5119
1085 nmdc:mga08y16_556171_c1 3300050511 Bacteria 1161
1086 nmdc:mga08y16_685307_c1 3300050511 Bacteria 1026
1087 nmdc:mga08y16_685895_c1 3300050511 Bacteria 1026
1088 nmdc:mga0n895_1293621_c1 3300050512 Unclassified 700
1089 nmdc:mga0n895_1549327_c1 3300050512 Unclassified 628
1090 nmdc:mga0n895_357403_c1 3300050512 Bacteria 1479
1091 nmdc:mga0n895_594457_c1 3300050512 Bacteria 1109
1092 nmdc:mga0n895_69227_c1 3300050512 Bacteria 3496
1093 nmdc:mga0rr50_107620_c1 3300050513 Bacteria 2201
1094 nmdc:mga0rr50_172342_c2 3300050513 Unclassified 1331
1095 nmdc:mga08x19_1118743_c1 3300050514 Unclassified 559
1096 nmdc:mga08x19_1154895_c1 3300050514 Unclassified 549
1097 nmdc:mga08x19_149941_c1 3300050514 Unclassified 1578
1098 nmdc:mga08x19_303502_c1 3300050514 Bacteria 1109
1099 nmdc:mga08x19_41118_c1 3300050514 Bacteria 2944
1100 nmdc:mga08x19_54456_c1 3300050514 Bacteria 2575
1101 nmdc:mga0a205_216054_c1 3300050515 Bacteria 1804
1102 nmdc:mga0a205_257589_c1 3300050515 Unclassified 1623
1103 nmdc:mga0a205_4243_c1 3300050515 Bacteria 12854
1104 nmdc:mga0a205_704131_c1 3300050515 Bacteria 860
1105 nmdc:mga0a205_716096_c1 3300050515 Unclassified 850
1106 Ga0495601_0529968 3300053077 Bacteria 759
1107 Ga0495655_0043766 3300053083 Bacteria 1155
1108 Ga0495655_0055670 3300053083 Unclassified 1062
1109 Ga0495655_0159155 3300053083 Bacteria 715
1110 Ga0501084_0009849 3300054114 Bacteria 7898
1111 Ga0501084_0015159 3300054114 Bacteria 6391
1112 Ga0501084_0035388 3300054114 Bacteria 4174
1113 Ga0501084_0052553 3300054114 Bacteria 3409
1114 Ga0501084_0113678 3300054114 Bacteria 2276
1115 Ga0501084_0120403 3300054114 Bacteria 2207
1116 Ga0501084_0243077 3300054114 Bacteria 1519
1117 Ga0501084_0356317 3300054114 Bacteria 1236
1118 Ga0501084_0358930 3300054114 Bacteria 1231
1119 Ga0501084_0447723 3300054114 Unclassified 1092
1120 Ga0501084_0564612 3300054114 Bacteria 961
1121 Ga0501084_0577369 3300054114 Unclassified 950
1122 Ga0501084_0646050 3300054114 Bacteria 893
1123 Ga0501084_0880093 3300054114 Bacteria 753
1124 Ga0501084_1023443 3300054114 Bacteria 694
1125 Ga0501084_1032644 3300054114 Bacteria 691
1126 Ga0501082_0002353 3300060353 Bacteria 16550
1127 Ga0501082_0044473 3300060353 Bacteria 3830
1128 Ga0501082_0054855 3300060353 Bacteria 3435
1129 Ga0501082_0175257 3300060353 Bacteria 1864
1130 Ga0501082_0176791 3300060353 Bacteria 1856
1131 Ga0501082_0183806 3300060353 Bacteria 1819
1132 Ga0501082_0219797 3300060353 Bacteria 1653
1133 Ga0501082_0232665 3300060353 Unclassified 1604
1134 Ga0501082_0238964 3300060353 Bacteria 1581
1135 Ga0501082_0310428 3300060353 Bacteria 1373
1136 Ga0501082_0333275 3300060353 Unclassified 1322
1137 Ga0501082_0385491 3300060353 Bacteria 1223
1138 Ga0501082_0856855 3300060353 Bacteria 795
1139 Ga0501082_0999306 3300060353 Bacteria 731
1140 Ga0501082_1001569 3300060353 Bacteria 731
1141 Ga0501082_1224263 3300060353 Bacteria 656
1142 Ga0501082_1238717 3300060353 Bacteria 652
1143 Ga0501082_1834074 3300060353 Bacteria 529
1144 Ga0530510_0029888 3300061734 Bacteria 3912
1145 Ga0530510_0042376 3300061734 Bacteria 3289
1146 Ga0530510_0150317 3300061734 Bacteria 1719
1147 Ga0530510_0169347 3300061734 Bacteria 1618
1148 Ga0530510_0184121 3300061734 Bacteria 1549
1149 Ga0530510_0205172 3300061734 Bacteria 1465
1150 Ga0530510_0205550 3300061734 Bacteria 1463
1151 Ga0530510_0267187 3300061734 Bacteria 1276
1152 Ga0530510_0317083 3300061734 Unclassified 1168
1153 Ga0530510_0390892 3300061734 Bacteria 1047
1154 Ga0530510_0487394 3300061734 Bacteria 934
1155 Ga0530510_0497253 3300061734 Unclassified 924
1156 Ga0530510_0515465 3300061734 Bacteria 907
1157 Ga0530510_0883189 3300061734 Unclassified 683
1158 Ga0530510_1211853 3300061734 Bacteria 579
1159 Ga0530510_1505255 3300061734 Bacteria 517
1160 Ga0530510_1540627 3300061734 Bacteria 510
1161 Ga0496114_0385645
1162 ARSoilYngRDRAFT_c03869
1163 ARcpr5yngRDRAFT_c004304
1164 ARSoilOldRDRAFT_c002253
1165 ARCol0yngRDRAFT_1003723
1166 JGI24744J21845_10065760
1167 JGI24033J26618_1022814
1168 JGI24751J29686_10023172
1169 JGI25406J46586_10104778
1170 rootH2_10071422
1171 rootL2_10040196
1172 Ga0058860_11509346
1173 Ga0070658_10008374
1174 Ga0070658_10551943
1175 Ga0070658_11358569
1176 Ga0070676_10266110
1177 Ga0070676_10407999
1178 Ga0070683_100037857
1179 Ga0070683_100102866
1180 Ga0070683_100103528
1181 Ga0070683_100130023
1182 Ga0070683_100507894
1183 Ga0070683_100525014
1184 Ga0070683_101204746
1185 Ga0070670_100001301
1186 Ga0070670_100125655
1187 Ga0070670_100883783
1188 Ga0068869_100301087
1189 Ga0068869_100750244
1190 Ga0070680_100020158
1191 Ga0070680_100126947
1192 Ga0070680_100333749
1193 Ga0070680_100373401
1194 Ga0070680_101573002
1195 Ga0070682_100103411
1196 Ga0070682_100219665
1197 Ga0070682_100543301
1198 Ga0068868_100120012
1199 Ga0068868_100361933
1200 Ga0068868_100772725
1201 Ga0070660_100016342
1202 Ga0070660_100612089
1203 Ga0070660_100994314
1204 Ga0070660_101424199
1205 Ga0070660_101527020
1206 Ga0070689_100050025
1207 Ga0070689_100235485
1208 Ga0070689_101656022
1209 Ga0070691_10135354
1210 Ga0070691_10179864
1211 Ga0070687_100157581
1212 Ga0070687_100585681
1213 Ga0070661_100229374
1214 Ga0070661_100239943
1215 Ga0070661_100300406
1216 Ga0070661_101451515
1217 Ga0070692_10009786
1218 Ga0070668_100321546
1219 Ga0070668_100919385
1220 Ga0070669_100223550
1221 Ga0070669_100407918
1222 Ga0070669_101070545
1223 Ga0070669_101730012
1224 Ga0070675_100046193
1225 Ga0070675_100200288
1226 Ga0070675_100918025
1227 Ga0070674_100003504
1228 Ga0070674_100036141
1229 Ga0070674_100081411
1230 Ga0070674_100156721
1231 Ga0070674_100255346
1232 Ga0070674_100781979
1233 Ga0070673_100068448
1234 Ga0070673_101609535
1235 Ga0070688_100002904
1236 Ga0070659_100351870
1237 Ga0070659_100425065
1238 Ga0070659_101190245
1239 Ga0070667_102333135
1240 Ga0070714_100331440
1241 Ga0070701_10148499
1242 Ga0070701_10418642
1243 Ga0070701_10481625
1244 Ga0070701_10518137
1245 Ga0070701_11036797
1246 Ga0070701_11123273
1247 Ga0070711_100683099
1248 Ga0070711_101161858
1249 Ga0070705_100802049
1250 Ga0070700_100533381
1251 Ga0070700_100761905
1252 Ga0070700_100830572
1253 Ga0070700_101356317
1254 Ga0070694_101390200
1255 Ga0070708_100474977
1256 Ga0070663_100427979
1257 Ga0070678_100041082
1258 Ga0070678_100043835
1259 Ga0070678_100317860
1260 Ga0070678_101180906
1261 Ga0070662_100253411
1262 Ga0070662_100295276
1263 Ga0070681_10079765
1264 Ga0070681_10303323
1265 Ga0070681_10356085
1266 Ga0070681_10943718
1267 Ga0068867_100089836
1268 Ga0068867_100181897
1269 Ga0068867_100441348
1270 Ga0068867_100564383
1271 Ga0068867_101153566
1272 Ga0068867_101700904
1273 Ga0070685_10007193
1274 Ga0070685_10183543
1275 Ga0070685_10351105
1276 Ga0070685_10394768
1277 Ga0070699_100104231
1278 Ga0070699_102186667
1279 Ga0070679_100028843
1280 Ga0070679_100068458
1281 Ga0070679_100174876
1282 Ga0070679_100320188
1283 Ga0070684_100021957
1284 Ga0070684_100027954
1285 Ga0070684_100033420
1286 Ga0070684_100068165
1287 Ga0070684_100070931
1288 Ga0070684_100089953
1289 Ga0070684_100129098
1290 Ga0070684_100134494
1291 Ga0070684_100136570
1292 Ga0070684_100593465
1293 Ga0070684_100752755
1294 Ga0070684_101023050
1295 Ga0070684_101329322
1296 Ga0070697_100997591
1297 Ga0068853_100078651
1298 Ga0068853_100098678
1299 Ga0068853_100100648
1300 Ga0070672_100509507
1301 Ga0070672_100565938
1302 Ga0070672_100636693
1303 Ga0070672_101113242
1304 Ga0070672_101261169
1305 Ga0070686_100148829
1306 Ga0070686_100200261
1307 Ga0070686_100601243
1308 Ga0070695_100028444
1309 Ga0070695_100335062
1310 Ga0070696_100112797
1311 Ga0070693_100048091
1312 Ga0070693_100060007
1313 Ga0070693_100122335
1314 Ga0070693_100744495
1315 Ga0070693_100746455
1316 Ga0070693_100804718
1317 Ga0070665_100027593
1318 Ga0070704_100040624
1319 Ga0070704_100265538
1320 Ga0068855_100034552
1321 Ga0068855_100688794
1322 Ga0068855_101221327
1323 Ga0070664_100061983
1324 Ga0070664_100121618
1325 Ga0070664_100308032
1326 Ga0070664_100600117
1327 Ga0070664_100625950
1328 Ga0070664_100728979
1329 Ga0070664_101464425
1330 Ga0070664_102125861
1331 Ga0070664_102134198
1332 Ga0068857_100052275
1333 Ga0068857_100073839
1334 Ga0068857_100154574
1335 Ga0068857_100335696
1336 Ga0068857_100352293
1337 Ga0068857_100883461
1338 Ga0068857_101158083
1339 Ga0068854_100065623
1340 Ga0068854_100083986
1341 Ga0068854_100574823
1342 Ga0068856_100133345
1343 Ga0070702_100086712
1344 Ga0070702_100280009
1345 Ga0070702_100354406
1346 Ga0070702_100813596
1347 Ga0068852_100112286
1348 Ga0068852_101153500
1349 Ga0068859_101792894
1350 Ga0068864_100125522
1351 Ga0068864_101393888
1352 Ga0068864_102370575
1353 Ga0068866_10036005
1354 Ga0068861_100308882
1355 Ga0068861_100312646
1356 Ga0068861_100859923
1357 Ga0068861_102154543
1358 Ga0068851_10358625
1359 Ga0068851_10499731
1360 Ga0068870_10000314
1361 Ga0068870_10093905
1362 Ga0068870_10359043
1363 Ga0068858_100521033
1364 Ga0068858_101076723
1365 Ga0068860_100829038
1366 Ga0068860_101073424
1367 Ga0068862_100332626
1368 Ga0068862_100954823
1369 Ga0081455_10006933
1370 Ga0081455_10022098
1371 Ga0081455_10045327
1372 Ga0081455_10147563
1373 Ga0081455_10184313
1374 Ga0081455_10259983
1375 Ga0081455_10321337
1376 Ga0081455_10331918
1377 Ga0081455_10516061
1378 Ga0081455_10550496
1379 Ga0081455_10649104
1380 Ga0081538_10049846
1381 Ga0081538_10128433
1382 Ga0081539_10010651
1383 Ga0081539_10158747
1384 Ga0075365_10084679
1385 Ga0075365_10306601
1386 Ga0075364_10078387
1387 Ga0075364_10493385
1388 Ga0075432_10112650
1389 Ga0097621_100442884
1390 Ga0097621_101201728
1391 Ga0068871_100122618
1392 Ga0068871_101815974
1393 Ga0075428_100001303
1394 Ga0075428_100034856
1395 Ga0075428_100088862
1396 Ga0075428_100099485
1397 Ga0075428_100995469
1398 Ga0075430_100012393
1399 Ga0075430_100033910
1400 Ga0075430_100302656
1401 Ga0075430_101802463
1402 Ga0075431_100002708
1403 Ga0075431_100568439
1404 Ga0075431_101106383
1405 Ga0075433_10123536
1406 Ga0075433_10470356
1407 Ga0075433_10485944
1408 Ga0075433_10651745
1409 Ga0075433_10776089
1410 Ga0075434_100047520
1411 Ga0075434_100423707
1412 Ga0075434_101780842
1413 Ga0075434_101930691
1414 Ga0075429_100032058
1415 Ga0075429_100049289
1416 Ga0075429_100063378
1417 Ga0075429_100067690
1418 Ga0068865_100131240
1419 Ga0068865_100184103
1420 Ga0068865_100279574
1421 Ga0068865_100428041
1422 Ga0068865_100527831
1423 Ga0068865_100563172
1424 Ga0068865_101082435
1425 Ga0068865_101192904
1426 Ga0075436_100034374
1427 Ga0075436_100186227
1428 Ga0097620_101793142
1429 Ga0075435_100845124
1430 Ga0075435_101971977
1431 Ga0105240_10056968
1432 Ga0105240_11267498
1433 Ga0111539_10003299
1434 Ga0111539_10004030
1435 Ga0111539_10006384
1436 Ga0111539_10043904
1437 Ga0111539_10143609
1438 Ga0111539_10186756
1439 Ga0111539_10571106
1440 Ga0111539_10887431
1441 Ga0111539_10896376
1442 Ga0111539_10988800
1443 Ga0105245_10013227
1444 Ga0105245_10015075
1445 Ga0105245_10029446
1446 Ga0105245_10134576
1447 Ga0105245_10196789
1448 Ga0105245_10375936
1449 Ga0105245_11509357
1450 Ga0105245_12335388
1451 Ga0105247_11213972
1452 Ga0114129_10010739
1453 Ga0114129_10044815
1454 Ga0114129_10160423
1455 Ga0114129_10363852
1456 Ga0114129_10422564
1457 Ga0114129_10952676
1458 Ga0114129_11098605
1459 Ga0114129_11784119
1460 Ga0114129_11816537
1461 Ga0114129_11954222
1462 Ga0114129_12108078
1463 Ga0114129_12871667
1464 Ga0114129_13193677
1465 Ga0105243_10089998
1466 Ga0105243_10103030
1467 Ga0105243_10222820
1468 Ga0105243_10354291
1469 Ga0105243_10406725
1470 Ga0105243_10733933
1471 Ga0105243_10734701
1472 Ga0105243_11501754
1473 Ga0105243_11640183
1474 Ga0105241_10748508
1475 Ga0105241_11927793
1476 Ga0105242_10052183
1477 Ga0105242_10112254
1478 Ga0105242_10178987
1479 Ga0105242_10353535
1480 Ga0105242_11664473
1481 Ga0105242_12713597
1482 Ga0105248_10076402
1483 Ga0105248_11680983
1484 Ga0105249_10083457
1485 Ga0105249_10100359
1486 Ga0105249_10171797
1487 Ga0105249_10271389
1488 Ga0105249_11195266
1489 Ga0105249_12443964
1490 Ga0105249_13496306
1491 Ga0105239_10061175
1492 Ga0105239_10088866
1493 Ga0105239_10096392
1494 Ga0105239_10154842
1495 Ga0105239_13218489
1496 Ga0105246_10025997
1497 Ga0105246_10139771
1498 Ga0105246_10175203
1499 Ga0105246_10333983
1500 Ga0105246_10351532
1501 Ga0105246_10365596
1502 Ga0105246_10743007
1503 Ga0105246_10975591
1504 Ga0105246_11682063
1505 Ga0105246_12351164
1506 Ga0157342_1062535
1507 Ga0157373_10596717
1508 Ga0157373_10881182
1509 Ga0157371_10149916
1510 Ga0157370_10033295
1511 Ga0157370_10350013
1512 Ga0157370_10573459
1513 Ga0157374_10984962
1514 Ga0157374_11662497
1515 Ga0157374_12802303
1516 Ga0157378_10719185
1517 Ga0157378_11717905
1518 Ga0163162_10334291
1519 Ga0163162_10341744
1520 Ga0163162_13319678
1521 Ga0157372_10172325
1522 Ga0157375_10951958
1523 Ga0157375_11413949
1524 Ga0157375_11506130
1525 Ga0157375_11548347
1526 Ga0157375_11686417
1527 Ga0163163_10196044
1528 Ga0157380_10273875
1529 Ga0157380_10307737
1530 Ga0157380_11150343
1531 Ga0157380_12988236
1532 Ga0157377_10059463
1533 Ga0157377_10064493
1534 Ga0157377_10517929
1535 Ga0157377_11380409
1536 Ga0157379_10371995
1537 Ga0157376_10532420
1538 Ga0157376_10824899
1539 Ga0157376_11203027
1540 Ga0163161_10571931
1541 Ga0163161_11122300
1542 Ga0197907_10085909
1543 Ga0206356_11077094
1544 Ga0206356_11105661
1545 Ga0206355_1025702
1546 Ga0206355_1160160
1547 Ga0206352_11172591
1548 Ga0206350_10334532
1549 Ga0206354_10793628
1550 Ga0206354_11430998
1551 Ga0206353_10828983
1552 Ga0206353_11822418
1553 Ga0206353_11909465
1554 Ga0206353_11930517
1555 Ga0154015_1632745
1556 Ga0224712_10129633
1557 Ga0207682_10434040
1558 Ga0207642_10202870
1559 Ga0207642_10449887
1560 Ga0207710_10647796
1561 Ga0207688_10001991
1562 Ga0207688_10024376
1563 Ga0207688_10091080
1564 Ga0207688_10233448
1565 Ga0207688_10627789
1566 Ga0207680_11144248
1567 Ga0207647_10264398
1568 Ga0207647_10460521
1569 Ga0207645_10040177
1570 Ga0207645_10155157
1571 Ga0207645_10259557
1572 Ga0207645_10831474
1573 Ga0207643_10002509
1574 Ga0207643_10008679
1575 Ga0207643_10026604
1576 Ga0207643_10085602
1577 Ga0207643_10244095
1578 Ga0207643_11105561
1579 Ga0207705_10111197
1580 Ga0207705_10718579
1581 Ga0207705_11226465
1582 Ga0207684_11673760
1583 Ga0207654_10713073
1584 Ga0207707_10039946
1585 Ga0207707_10076138
1586 Ga0207707_10119502
1587 Ga0207707_11274483
1588 Ga0207707_11558423
1589 Ga0207695_10529602
1590 Ga0207695_11101380
1591 Ga0207663_11002107
1592 Ga0207660_10051686
1593 Ga0207660_10162583
1594 Ga0207660_10227258
1595 Ga0207660_10240319
1596 Ga0207660_10463547
1597 Ga0207662_10222222
1598 Ga0207657_10000054
1599 Ga0207657_10254646
1600 Ga0207657_10705595
1601 Ga0207657_10759290
1602 Ga0207649_10085355
1603 Ga0207649_10171418
1604 Ga0207649_10291676
1605 Ga0207649_10845844
1606 Ga0207649_10859341
1607 Ga0207649_10929413
1608 Ga0207652_10033046
1609 Ga0207652_10074422
1610 Ga0207652_10108706
1611 Ga0207652_10704876
1612 Ga0207652_10989795
1613 Ga0207681_10714654
1614 Ga0207650_10007062
1615 Ga0207650_10165300
1616 Ga0207659_10155495
1617 Ga0207659_10291846
1618 Ga0207659_10813420
1619 Ga0207659_11295080
1620 Ga0207687_10012184
1621 Ga0207687_10099918
1622 Ga0207687_10204167
1623 Ga0207687_10915436
1624 Ga0207687_11610264
1625 Ga0207664_10011249
1626 Ga0207664_10567371
1627 Ga0207690_10221492
1628 Ga0207706_10063067
1629 Ga0207706_10116957
1630 Ga0207706_10561091
1631 Ga0207686_10549569
1632 Ga0207686_10555364
1633 Ga0207686_11623723
1634 Ga0207709_10067618
1635 Ga0207709_10837245
1636 Ga0207709_10899644
1637 Ga0207670_10624877
1638 Ga0207670_11237922
1639 Ga0207669_10066597
1640 Ga0207669_10104921
1641 Ga0207669_10254974
1642 Ga0207669_10344698
1643 Ga0207669_10720788
1644 Ga0207669_11529408
1645 Ga0207704_10099604
1646 Ga0207704_10162040
1647 Ga0207704_10197928
1648 Ga0207704_10354543
1649 Ga0207704_10779764
1650 Ga0207691_10063570
1651 Ga0207691_10465928
1652 Ga0207691_10602484
1653 Ga0207691_10608664
1654 Ga0207689_10023381
1655 Ga0207689_10027661
1656 Ga0207689_10589648
1657 Ga0207689_10784014
1658 Ga0207661_10007306
1659 Ga0207661_10039832
1660 Ga0207661_10043058
1661 Ga0207661_10064710
1662 Ga0207661_10073776
1663 Ga0207661_10100031
1664 Ga0207661_10258994
1665 Ga0207679_10091288
1666 Ga0207679_10250932
1667 Ga0207679_10514052
1668 Ga0207679_10622403
1669 Ga0207679_10680872
1670 Ga0207679_10915438
1671 Ga0207679_12085320
1672 Ga0207667_10015039
1673 Ga0207667_11136832
1674 Ga0207667_11659602
1675 Ga0207667_12096909
1676 Ga0207712_10083469
1677 Ga0207712_10103665
1678 Ga0207712_10250607
1679 Ga0207712_11704001
1680 Ga0207668_10077833
1681 Ga0207668_10207128
1682 Ga0207668_11060362
1683 Ga0207640_10108593
1684 Ga0207640_10857812
1685 Ga0207677_10144452
1686 Ga0207677_10294225
1687 Ga0207677_10554268
1688 Ga0207677_10630911
1689 Ga0207677_11252898
1690 Ga0207703_11063014
1691 Ga0207639_10225586
1692 Ga0207639_10277708
1693 Ga0207639_11065630
1694 Ga0207639_11572892
1695 Ga0207678_10157709
1696 Ga0207678_11757252
1697 Ga0207678_11809559
1698 Ga0207708_10058798
1699 Ga0207708_10389622
1700 Ga0207708_11088043
1701 Ga0207702_10460933
1702 Ga0207702_12068355
1703 Ga0207641_10801404
1704 Ga0207648_10069046
1705 Ga0207648_10129248
1706 Ga0207648_10213047
1707 Ga0207648_10290811
1708 Ga0207648_10387792
1709 Ga0207648_10833752
1710 Ga0207648_11499738
1711 Ga0207676_10598686
1712 Ga0207676_10778309
1713 Ga0207676_11581384
1714 Ga0207674_10002093
1715 Ga0207674_10018243
1716 Ga0207674_10059218
1717 Ga0207674_10145617
1718 Ga0207674_10151009
1719 Ga0207674_10446753
1720 Ga0207675_100105767
1721 Ga0207675_100110180
1722 Ga0207675_100401490
1723 Ga0207683_10015569
1724 Ga0207683_10041072
1725 Ga0207683_10271837
1726 Ga0207683_10420899
1727 Ga0207683_10905603
1728 Ga0207683_11071811
1729 Ga0207683_11126103
1730 Ga0207698_10056700
1731 Ga0207698_10095721
1732 Ga0207428_10000401
1733 Ga0207428_10009137
1734 Ga0207428_10050027
1735 Ga0207428_10109876
1736 Ga0207428_10306901
1737 Ga0207428_10389957
1738 Ga0268266_12155903
1739 Ga0268265_10545035
1740 Ga0268265_11832194
1741 Ga0268264_11166965
1742 Ga0307408_100133628
1743 Ga0307405_10050448
1744 Ga0307405_10050941
1745 Ga0307413_10074386
1746 Ga0307410_10012458
1747 Ga0307410_10088032
1748 Ga0307410_10376759
1749 Ga0307410_11037767
1750 Ga0307406_10068566
1751 Ga0307406_10078186
1752 Ga0307406_11778989
1753 Ga0307407_10001948
1754 Ga0307407_11153674
1755 Ga0307412_10049701
1756 Ga0307409_100024427
1757 Ga0307409_100028580
1758 Ga0307409_101857677
1759 Ga0307416_100006216
1760 Ga0307416_100064904
1761 Ga0307416_100186337
1762 Ga0307416_100763763
1763 Ga0307414_10169396
1764 Ga0307414_10331474
1765 Ga0307414_10534154
1766 Ga0307411_10036924
1767 Ga0307415_100000048
1768 Ga0307415_100090281
1769 Ga0373946_0390442
1770 Ga0373962_0212986
1771 Ga0373962_0290574
1772 Ga0373931_0911970
1773 Ga0373931_1179277
1774 Ga0395899_0001267
1775 Ga0395899_0007849
1776 Ga0395899_0109697
1777 Ga0395899_0370342
1778 Ga0395900_0002886
1779 Ga0395900_0027313
1780 Ga0395900_0034837
1781 Ga0395900_0060391
1782 Ga0395900_0065948
1783 Ga0395900_0066781
1784 Ga0395900_0233297
1785 Ga0395900_0338229
1786 Ga0395898_0001276
1787 Ga0395898_0038785
1788 Ga0395898_0076090
1789 Ga0395898_0121509
1790 Ga0395898_0290795
1791 Ga0395898_0434028
1792 Ga0395898_0478993
1793 Ga0395898_1623705
1794 Ga0395905_0001281
1795 Ga0395905_0018402
1796 Ga0395905_0064515
1797 Ga0395905_0323752
1798 Ga0395905_0647610
1799 Ga0395905_0648832
1800 Ga0395905_0781437
1801 Ga0395905_1375500
1802 Ga0395901_0001957
1803 Ga0395901_0020142
1804 Ga0395901_0135873
1805 Ga0395901_0191483
1806 Ga0395901_0263620
1807 Ga0395901_0336015
1808 Ga0395901_0796873
1809 Ga0395901_0819152
1810 Ga0439439_0060092
1811 Ga0451807_1804249
1812 Ga0451839_0318159
1813 Ga0451845_0926056
1814 Ga0451849_0021204
1815 Ga0451853_3202839
1816 Ga0439448_0106769
1817 Ga0439448_0222463
1818 Ga0439448_0366107
1819 Ga0439456_036207
1820 Ga0439463_086856
1821 Ga0439463_121816
1822 Ga0450920_064267
1823 Ga0450920_068154
1824 Ga0450923_054348
1825 Ga0450903_066322
1826 Ga0450906_048518
1827 Ga0439446_0090789
1828 Ga0439458_0050149
1829 Ga0439458_0086793
1830 Ga0439434_0027687
1831 Ga0439460_0169385
1832 Ga0450916_087189
1833 Ga0450918_005450
1834 Ga0450918_064542
1835 Ga0451577_0518193
1836 Ga0466972_0517172
1837 Ga0466965_0573514
1838 Ga0466965_0821123
1839 Ga0466966_0367792
1840 Ga0466963_0041023
1841 Ga0466963_0196061
1842 Ga0466968_0097698
1843 Ga0466957_0218230
1844 Ga0466960_0020509
1845 Ga0451576_0207388
1846 Ga0466967_0063451
1847 Ga0495617_085647
1848 Ga0495627_054819
1849 Ga0495592_0680571
1850 Ga0495603_0013529
1851 Ga0495603_0046215
1852 Ga0495590_0112501
1853 Ga0495590_0140363
1854 Ga0495641_0098171
1855 Ga0495582_0028288
1856 Ga0495605_0100506
1857 Ga0495605_0168527
1858 Ga0495584_0286789
1859 Ga0495585_0102558
1860 Ga0495585_0228463
1861 Ga0495596_0071797
1862 Ga0495596_0083222
1863 Ga0495596_0101511
1864 Ga0495596_0154386
1865 Ga0495583_0108090
1866 Ga0495616_0289418
1867 Ga0495620_0090038
1868 Ga0495620_0250784
1869 Ga0495631_0110522
1870 Ga0495632_0373764
1871 Ga0495637_0129783
1872 Ga0495637_0133482
1873 Ga0495643_0333014
1874 Ga0495644_0046431
1875 Ga0495644_0229737
1876 Ga0495644_0390616
1877 Ga0495663_0004676
1878 Ga0495663_0040106
1879 Ga0495663_0149605
1880 Ga0495663_0233650
1881 Ga0495642_0430060
1882 Ga0495652_0312872
1883 Ga0495654_0308257
1884 Ga0495665_0194446
1885 Ga0495587_0642715
1886 Ga0495598_0012933
1887 Ga0495598_0407442
1888 Ga0495598_0440279
1889 Ga0495609_0144655
1890 Ga0495609_0453173
1891 Ga0495621_0074773
1892 Ga0495621_0155546
1893 Ga0495621_0378071
1894 Ga0495597_0300703
1895 Ga0495597_0318428
1896 Ga0495597_0334741
1897 Ga0495633_0297989
1898 Ga0495656_0137860
1899 Ga0495656_0242782
1900 Ga0495656_0406429
1901 Ga0495656_0421376
1902 Ga0495668_0378630
1903 Ga0495611_0049281
1904 Ga0495611_0152182
1905 Ga0495659_0048780
1906 Ga0495659_0161064
1907 Ga0495659_0184467
1908 Ga0495661_0308516
1909 Ga0495588_0024053
1910 Ga0495588_0093632
1911 Ga0495588_0724431
1912 Ga0495599_0791774
1913 Ga0495669_0273298
1914 Ga0495613_0330815
1915 Ga0495670_0065142
1916 Ga0495670_0105833
1917 Ga0495670_0480464
1918 Ga0495670_0715252
1919 Ga0495671_0374451
1920 Ga0495649_0280587
1921 Ga0495589_0079726
1922 Ga0495589_0081993
1923 Ga0495589_0186200
1924 Ga0495589_0248661
1925 Ga0495589_0311574
1926 Ga0495600_0793625
1927 Ga0495660_0079438
1928 Ga0495581_0283482
1929 Ga0495581_0812960
1930 Ga0495604_0630258
1931 Ga0495636_0154959
1932 Ga0495676_0023919
1933 Ga0495680_0303581
1934 Ga0495683_0370665
1935 Ga0495677_0080032
1936 Ga0495677_0252653
1937 Ga0495679_074607
1938 Ga0495679_194794
1939 Ga0495673_0267120
1940 Ga0495681_0212711
1941 Ga0495615_0031877
1942 Ga0495626_0054070
1943 Ga0495626_0108280
1944 Ga0496101_0280678
1945 Ga0496101_1096919
1946 Ga0496102_0028791
1947 Ga0496102_0423380
1948 Ga0496102_1732351
1949 Ga0496103_0106691
1950 Ga0496103_0449432
1951 Ga0496104_0727418
1952 Ga0496104_0860734
1953 Ga0496105_0878004
1954 Ga0496105_0969202
1955 Ga0496106_0120703
1956 Ga0496106_0175479
1957 Ga0496106_0482540
1958 Ga0496107_0542351
1959 Ga0496107_0752435
1960 Ga0496108_0040312
1961 Ga0496108_0068710
1962 Ga0496108_0299078
1963 Ga0496108_1068807
1964 Ga0496109_0022743
1965 Ga0496109_0060318
1966 Ga0496109_0127383
1967 Ga0496109_0277844
1968 Ga0496109_0337591
1969 Ga0496109_1564420
1970 Ga0496110_0001407
1971 Ga0496110_0127487
1972 Ga0496110_0230115
1973 Ga0496110_0287119
1974 Ga0496110_0304871
1975 Ga0496111_0000429
1976 Ga0496111_0021603
1977 Ga0496111_0295934
1978 Ga0496111_0300145
1979 Ga0496111_1336123
1980 Ga0496112_0133792
1981 Ga0496112_0175855
1982 Ga0496113_0090032
1983 Ga0496113_0119174
1984 Ga0496113_0350260
1985 Ga0496113_1092764
1986 Ga0496113_1141349
1987 Ga0496114_1307762
1988 Ga0496115_1456003
1989 Ga0501031_0017526
1990 Ga0501031_0091998
1991 Ga0501031_0303888
1992 Ga0501032_0024682
1993 Ga0501032_0184612
1994 Ga0501032_0225685
1995 Ga0501032_0240974
1996 Ga0501033_0020457
1997 Ga0501033_0085797
1998 Ga0501033_0277089
1999 Ga0501033_0709822
2000 Ga0501034_0235388
2001 Ga0501034_0458509
2002 Ga0501034_0943534
2003 Ga0501036_0010942
2004 Ga0501036_0061610
2005 Ga0501036_0099059
2006 Ga0501036_0145794
2007 Ga0501036_0395671
2008 Ga0501036_0471274
2009 Ga0501036_0881109
2010 Ga0501037_0224497
2011 Ga0501037_0305204
2012 Ga0501037_0435921
2013 Ga0501037_1148808
2014 Ga0501038_0022437
2015 Ga0501038_0027917
2016 Ga0501038_0334649
2017 Ga0501038_0424149
2018 Ga0501038_1326751
2019 Ga0501039_0002212
2020 Ga0501039_0032683
2021 Ga0501039_0095908
2022 Ga0501039_0243431
2023 Ga0501039_0254316
2024 Ga0501039_0902689
2025 Ga0501040_0004806
2026 Ga0501040_0026839
2027 Ga0501040_0037267
2028 Ga0501040_0077947
2029 Ga0501040_0139227
2030 Ga0501040_0181381
2031 Ga0501040_0476048
2032 Ga0501040_0480602
2033 Ga0501040_0750421
2034 Ga0501040_1068370
2035 Ga0501041_0005164
2036 Ga0501041_0019292
2037 Ga0501041_0049701
2038 Ga0501041_0084776
2039 Ga0501041_0188418
2040 Ga0501041_0286064
2041 Ga0501041_0485140
2042 Ga0501042_0018108
2043 Ga0501042_0026164
2044 Ga0501042_0165086
2045 Ga0501042_0175223
2046 Ga0501042_0279120
2047 Ga0501042_0538576
2048 Ga0501042_0612707
2049 Ga0501043_0068028
2050 Ga0501043_0216553
2051 Ga0501043_0292045
2052 Ga0501046_0012761
2053 Ga0501046_0078450
2054 Ga0501046_0100480
2055 Ga0501047_0251004
2056 Ga0501048_0006302
2057 Ga0501048_0042274
2058 Ga0501048_0142440
2059 Ga0501048_0169398
2060 Ga0501048_0871857
2061 Ga0501048_0976338
2062 Ga0501048_1114084
2063 Ga0501067_0019768
2064 Ga0501067_0033431
2065 Ga0501067_0034302
2066 Ga0501067_0052225
2067 Ga0501067_0074138
2068 Ga0501067_0124915
2069 Ga0501067_0638256
2070 Ga0501067_0655592
2071 Ga0501068_0008679
2072 Ga0501068_0013162
2073 Ga0501068_0030506
2074 Ga0501068_0043231
2075 Ga0501068_0080912
2076 Ga0501068_0124228
2077 Ga0501068_0138056
2078 Ga0501068_0152299
2079 Ga0501068_0536747
2080 Ga0501068_0799758
2081 Ga0501068_1067745
2082 Ga0501069_0007796
2083 Ga0501069_0022300
2084 Ga0501069_0040981
2085 Ga0501069_0046889
2086 Ga0501069_0149432
2087 Ga0501069_0169046
2088 Ga0501069_0703316
2089 Ga0501069_0867439
2090 Ga0501070_0020654
2091 Ga0501070_0048989
2092 Ga0501070_0176336
2093 Ga0501070_0412799
2094 Ga0501070_0645325
2095 Ga0501070_0936911
2096 Ga0501071_0018405
2097 Ga0501071_0024160
2098 Ga0501071_0028681
2099 Ga0501071_0047047
2100 Ga0501071_0211396
2101 Ga0501071_0234140
2102 Ga0501071_0280880
2103 Ga0501071_0326348
2104 Ga0501071_0364117
2105 Ga0501071_0397214
2106 Ga0501071_0397854
2107 Ga0501071_0463586
2108 Ga0501071_0565713
2109 Ga0501071_0654296
2110 Ga0501071_0677326
2111 Ga0501071_1267531
2112 Ga0501071_1271416
2113 Ga0501072_0033625
2114 Ga0501072_0042269
2115 Ga0501072_0224443
2116 Ga0501072_0281226
2117 Ga0501072_0357610
2118 Ga0501072_0413755
2119 Ga0501072_0417534
2120 Ga0501072_0439181
2121 Ga0501072_0456171
2122 Ga0501072_0656734
2123 Ga0501072_0846546
2124 Ga0501072_0998220
2125 Ga0501072_1206708
2126 Ga0501073_0107039
2127 Ga0501073_0147229
2128 Ga0501074_0006126
2129 Ga0501074_0013466
2130 Ga0501074_0104953
2131 Ga0501074_0162554
2132 Ga0501074_0210731
2133 Ga0501074_0507914
2134 Ga0501074_0928348
2135 Ga0501074_1079707
2136 Ga0501075_0003679
2137 Ga0501075_0013849
2138 Ga0501075_0115636
2139 Ga0501075_0243998
2140 Ga0501075_0262271
2141 Ga0501075_0534090
2142 Ga0501075_0707745
2143 Ga0501075_0936112
2144 Ga0501075_1197469
2145 Ga0501076_0008472
2146 Ga0501076_0015191
2147 Ga0501076_0016399
2148 Ga0501076_0016982
2149 Ga0501076_0100138
2150 Ga0501076_0132771
2151 Ga0501076_0146069
2152 Ga0501076_0157680
2153 Ga0501076_0159606
2154 Ga0501076_0219158
2155 Ga0501076_0244055
2156 Ga0501076_0329809
2157 Ga0501076_0427588
2158 Ga0501076_0456519
2159 Ga0501076_0665851
2160 Ga0501077_0022574
2161 Ga0501077_0041065
2162 Ga0501077_0318572
2163 Ga0501077_0348603
2164 Ga0501077_0774112
2165 Ga0501227_161066
2166 Ga0501079_0006082
2167 Ga0501079_0022587
2168 Ga0501079_0154836
2169 Ga0501079_0160189
2170 Ga0501079_0238403
2171 Ga0501079_0273204
2172 Ga0501079_0457698
2173 Ga0501079_0484261
2174 Ga0501079_0980480
2175 Ga0501079_1100036
2176 Ga0501079_1336632
2177 Ga0501080_0002972
2178 Ga0501080_0035360
2179 Ga0501080_0156880
2180 Ga0501080_0308322
2181 Ga0501080_0520091
2182 Ga0501080_0911245
2183 Ga0501080_0932329
2184 Ga0501080_1770544
2185 Ga0501081_0016817
2186 Ga0501081_0030270
2187 Ga0501081_0067384
2188 Ga0501081_0082457
2189 Ga0501081_0083996
2190 Ga0501081_0172817
2191 Ga0501081_0388053
2192 Ga0501081_0446074
2193 Ga0501081_0965591
2194 Ga0501081_1035808
2195 Ga0501081_1373756
2196 Ga0501083_0021679
2197 Ga0501083_0033656
2198 Ga0501083_0438702
2199 Ga0501083_0594524
2200 Ga0501083_0796336
2201 Ga0501083_0947818
2202 Ga0501035_0027926
2203 Ga0501035_0045420
2204 Ga0501035_0163984
2205 Ga0501035_0556547
2206 Ga0501035_1039394
2207 Ga0501044_0080565
2208 Ga0501044_0210408
2209 Ga0501045_0007918
2210 Ga0501045_0009197
2211 Ga0501045_0071952
2212 Ga0501045_0087248
2213 Ga0501045_0797633
2214 Ga0501045_0981993
2215 Ga0501045_1211452
2216 Ga0501212_023168
2217 nmdc:mga00v17_223732_c1
2218 nmdc:mga0yw44_35698_c1
2219 nmdc:mga0yw44_87545_c1
2220 nmdc:mga05p37_1383058_c1
2221 nmdc:mga05p37_1515997_c1
2222 nmdc:mga05p37_1775211_c1
2223 nmdc:mga05p37_19483_c1
2224 nmdc:mga05p37_215759_c1
2225 nmdc:mga05p37_24671_c1
2226 nmdc:mga05p37_399062_c1
2227 nmdc:mga05p37_442608_c1
2228 nmdc:mga05p37_5798_c1
2229 nmdc:mga09592_36637_c1
2230 nmdc:mga09592_37133_c1
2231 nmdc:mga09592_420676_c1
2232 nmdc:mga09592_65927_c1
2233 nmdc:mga0qj67_103939_c1
2234 nmdc:mga0qj67_121664_c1
2235 nmdc:mga0qj67_1333152_c1
2236 nmdc:mga0qj67_492082_c1
2237 nmdc:mga06r32_1446085_c1
2238 nmdc:mga06r32_317855_c1
2239 nmdc:mga06r32_51565_c1
2240 nmdc:mga06r32_735327_c1
2241 nmdc:mga08y16_1002010_c1
2242 nmdc:mga08y16_221056_c1
2243 nmdc:mga08y16_272307_c1
2244 nmdc:mga08y16_37087_c1
2245 nmdc:mga08y16_556171_c1
2246 nmdc:mga08y16_685307_c1
2247 nmdc:mga08y16_685895_c1
2248 nmdc:mga0n895_1293621_c1
2249 nmdc:mga0n895_1549327_c1
2250 nmdc:mga0n895_357403_c1
2251 nmdc:mga0n895_594457_c1
2252 nmdc:mga0n895_69227_c1
2253 nmdc:mga0rr50_107620_c1
2254 nmdc:mga0rr50_172342_c2
2255 nmdc:mga08x19_1118743_c1
2256 nmdc:mga08x19_1154895_c1
2257 nmdc:mga08x19_149941_c1
2258 nmdc:mga08x19_303502_c1
2259 nmdc:mga08x19_41118_c1
2260 nmdc:mga08x19_54456_c1
2261 nmdc:mga0a205_216054_c1
2262 nmdc:mga0a205_257589_c1
2263 nmdc:mga0a205_4243_c1
2264 nmdc:mga0a205_704131_c1
2265 nmdc:mga0a205_716096_c1
2266 Ga0495601_0529968
2267 Ga0495655_0043766
2268 Ga0495655_0055670
2269 Ga0495655_0159155
2270 Ga0501084_0009849
2271 Ga0501084_0015159
2272 Ga0501084_0035388
2273 Ga0501084_0052553
2274 Ga0501084_0113678
2275 Ga0501084_0120403
2276 Ga0501084_0243077
2277 Ga0501084_0356317
2278 Ga0501084_0358930
2279 Ga0501084_0447723
2280 Ga0501084_0564612
2281 Ga0501084_0577369
2282 Ga0501084_0646050
2283 Ga0501084_0880093
2284 Ga0501084_1023443
2285 Ga0501084_1032644
2286 Ga0501082_0002353
2287 Ga0501082_0044473
2288 Ga0501082_0054855
2289 Ga0501082_0175257
2290 Ga0501082_0176791
2291 Ga0501082_0183806
2292 Ga0501082_0219797
2293 Ga0501082_0232665
2294 Ga0501082_0238964
2295 Ga0501082_0310428
2296 Ga0501082_0333275
2297 Ga0501082_0385491
2298 Ga0501082_0856855
2299 Ga0501082_0999306
2300 Ga0501082_1001569
2301 Ga0501082_1224263
2302 Ga0501082_1238717
2303 Ga0501082_1834074
2304 Ga0530510_0029888
2305 Ga0530510_0042376
2306 Ga0530510_0150317
2307 Ga0530510_0169347
2308 Ga0530510_0184121
2309 Ga0530510_0205172
2310 Ga0530510_0205550
2311 Ga0530510_0267187
2312 Ga0530510_0317083
2313 Ga0530510_0390892
2314 Ga0530510_0487394
2315 Ga0530510_0497253
2316 Ga0530510_0515465
2317 Ga0530510_0883189
2318 Ga0530510_1211853
2319 Ga0530510_1505255
2320 Ga0530510_1540627

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

13

66

0.95

PF01381

HTH_3

Helix-turn-helix

13

68

0.93

PF13560

HTH_31

Helix-turn-helix domain

8

71

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9439 14 71
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.9383 14 71
1adr-assembly1.cif.gz_A determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor 0.9328 9 71
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9317 14 68
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9302 14 69
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9467 14 71 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9439 14 71 1.10.260.40
1y7yA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9383 14 71 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9328 9 71 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9317 14 68 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3C1DEX6-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9766 14 69 GO:0003677
AF-A0A1S8NBT8-F1-model_v4 Helix-turn-helix domain protein 0.9572 11 71 GO:0003677
AF-A0A535F9L4-F1-model_v4 D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95) 0.9556 12 69 GO:0003677
GO:0004617
GO:0006564
GO:0051287
AF-A0A661V0H1-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9553 11 71 GO:0003677
GO:0003700
GO:0005829
AF-A0A133XPF9-F1-model_v4 DNA-binding helix-turn-helix protein 0.9547 11 68 GO:0003677

Map