F490985

General Info

Members Datasets Scaffolds Average Seq Length
1160 796 634 175

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1012796|Ga0006562J51391_10127963
Length 170
Sequence MSQTAPENRGSAVAIRTVVSLVVVALGVWALFHVNPADAYLWIKSLHVIAVIAWMAGMLYLPRLFVYHCAAKPGSETSETFKVMEKRLLRFIINPAMIVTWIAGLWMAWEIFGFQGGWLHAKLLLVVLMSGLHGYLAKSTRLFAEDRNMRSAKHWRIINEVPTILMVKPF

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
26 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
27 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
28 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
29 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
37 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
42 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
43 2519899620 Rhizobium sp. Pop5 Isolate Nodule
44 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
45 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
46 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
47 2534681786 Brucella suis 92/29 Isolate Unclassified
48 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
49 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
50 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
51 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
52 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
53 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
54 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
55 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
56 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
57 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
58 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
59 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
60 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
61 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
62 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
63 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
64 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
65 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
66 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
67 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
68 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
69 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
70 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
71 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
72 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
82 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
83 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
86 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
87 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
88 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
89 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
90 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
91 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
92 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
93 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
94 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
95 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
96 2643221557 Ensifer sp. Root558 Isolate Unclassified
97 2643221568 Rhizobium sp. Root564 Isolate Unclassified
98 2643221599 Rhizobium sp. Root708 Isolate Unclassified
99 2643221607 Rhizobium sp. Root73 Isolate Unclassified
100 2643221610 Ensifer sp. Root74 Isolate Unclassified
101 2643221618 Ensifer sp. Root231 Isolate Unclassified
102 2643221626 Ensifer sp. Root31 Isolate Unclassified
103 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
104 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
105 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
106 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
107 2643221655 Ensifer sp. Root1252 Isolate Unclassified
108 2643221659 Ensifer sp. Root127 Isolate Unclassified
109 2643221668 Ensifer sp. Root423 Isolate Unclassified
110 2643221675 Ensifer sp. Root1298 Isolate Unclassified
111 2643221680 Ensifer sp. Root1312 Isolate Unclassified
112 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
113 2643221688 Rhizobium sp. Root482 Isolate Unclassified
114 2643221693 Rhizobium sp. Root491 Isolate Unclassified
115 2643221698 Ensifer sp. Root142 Isolate Unclassified
116 2643221712 Ensifer sp. Root258 Isolate Unclassified
117 2643221718 Rhizobium sp. Root268 Isolate Unclassified
118 2643221719 Rhizobium sp. Root274 Isolate Unclassified
119 2643221723 Ensifer sp. Root278 Isolate Unclassified
120 2643221726 Ensifer sp. Root954 Isolate Unclassified
121 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
122 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
123 2718217927 Rhizobium sp. N324 Isolate Nodule
124 2718218009 Rhizobium sp. N561 Isolate Nodule
125 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
126 2718218363 Rhizobium sp. N113 Isolate Nodule
127 2718218365 Rhizobium sp. N731 Isolate Nodule
128 2718218366 Rhizobium sp. N621 Isolate Nodule
129 2718218423 Rhizobium sp. N941 Isolate Nodule
130 2721755514 Rhizobium sp. N6212 Isolate Nodule
131 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
132 2721755809 Rhizobium sp. N541 Isolate Nodule
133 2721755810 Rhizobium sp. N871 Isolate Nodule
134 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
135 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
136 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
137 2728369365 Rhizobium sp. N1341 Isolate Nodule
138 2728369397 Rhizobium sp. N1314 Isolate Nodule
139 2738541293 Rhizobium sp. GV031 Isolate Unclassified
140 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
141 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
142 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
143 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
144 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
145 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
146 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
147 2791355256 Rhizobium sp. M10 Isolate Nodule
148 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
149 2791355260 Rhizobium sp. L9 Isolate Nodule
150 2791355261 Rhizobium sp. J15 Isolate Nodule
151 2791355263 Rhizobium chutanense C5 Isolate Nodule
152 2791355264 Rhizobium sp. S9 Isolate Nodule
153 2791355265 Rhizobium sp. H4 Isolate Nodule
154 2791355266 Rhizobium sp. L43 Isolate Nodule
155 2791355267 Rhizobium sp. L18 Isolate Nodule
156 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
157 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
158 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
159 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
160 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
161 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
162 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
163 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
164 2802429633 Rhizobium anhuiense J3 Isolate Nodule
165 2802429634 Rhizobium anhuiense S10 Isolate Nodule
166 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
167 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
168 2802429637 Rhizobium anhuiense C15 Isolate Nodule
169 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
170 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
171 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
172 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
173 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
174 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
175 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
176 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
177 2838048938 Rhizobium pisi 27/80 Isolate Nodule
178 2838061910 Rhizobium phaseoli L15 Isolate Nodule
179 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
180 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
181 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
182 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
183 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
184 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
187 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
188 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
189 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
190 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
191 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
192 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
193 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
194 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
195 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
196 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
197 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
198 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
199 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
200 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
203 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
204 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
205 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
206 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
207 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
208 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
209 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
210 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
211 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
212 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
213 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
214 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
215 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
216 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
217 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
218 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
219 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
220 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
221 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
222 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
223 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
224 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
225 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
226 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
227 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
228 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
229 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
230 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
233 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
234 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
235 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
236 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
237 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
238 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
239 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
240 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
241 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
242 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
243 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
244 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
245 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
246 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
247 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
248 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
252 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
253 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
254 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
255 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
256 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
257 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
258 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
259 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
260 2844163670 Ensifer sp. 1H6 Isolate Unclassified
261 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
262 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
263 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
264 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
265 2854911287 Brucella lupini LUP21 Isolate Unclassified
266 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
267 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
268 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
269 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
270 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
271 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
272 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
273 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
274 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
275 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
276 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
277 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
278 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
279 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
280 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
281 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
282 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
283 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
284 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
285 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
286 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
287 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
288 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
289 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
290 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
291 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
292 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
293 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
294 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
295 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
296 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
297 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
298 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
299 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
300 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
301 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
302 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
303 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
304 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
305 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
306 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
307 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
308 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
309 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
310 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
311 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
312 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
313 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
314 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
315 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
316 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
317 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
318 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
319 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
320 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
321 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
322 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
323 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
324 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
325 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
326 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
327 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
328 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
329 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
330 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
331 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
332 2933599457 Rhizobium phaseoli M3 Isolate Nodule
333 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
334 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
335 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
336 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
337 2936381700 Rhizobium chutanense C16 Isolate Unclassified
338 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
339 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
340 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
341 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
342 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
343 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
344 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
345 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
346 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
347 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
348 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
349 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
350 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
351 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
352 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
353 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
354 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
355 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
356 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
357 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
358 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
359 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
360 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
361 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
362 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
363 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
364 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
365 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
366 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
367 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
368 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
369 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
370 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
371 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
372 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
373 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
374 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
375 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
376 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
377 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
378 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
379 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
380 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
381 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
382 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
383 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
384 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
385 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
386 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
387 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
388 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
389 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
390 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
391 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
392 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
393 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
394 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
395 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
396 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
397 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
398 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
399 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
400 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
401 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
402 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
403 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
404 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
405 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
406 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
407 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
408 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
409 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
410 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
411 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
412 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
413 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
414 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
415 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
416 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
417 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
418 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
419 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
420 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
421 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
422 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
423 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
424 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
425 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
426 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
427 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
428 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
429 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
430 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
431 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
432 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
433 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
434 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
435 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
436 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
437 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
438 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
439 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
440 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
441 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
442 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
443 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
444 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
445 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
446 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
447 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
448 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
449 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
450 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
451 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
452 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
453 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
454 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
455 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
456 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
457 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
458 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
459 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
460 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
461 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
462 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
463 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
464 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
465 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
466 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
467 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
468 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
469 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
470 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
471 2996887358 Rhizobium sp. R711 Isolate Nodule
472 2996893221 Rhizobium sp. R635 Isolate Nodule
473 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
474 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
475 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
476 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
477 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
478 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
479 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
480 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
481 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
482 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
483 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
484 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
485 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
486 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
487 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
488 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
489 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
490 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
491 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
492 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
493 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
494 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
495 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
496 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
497 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
498 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
499 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
500 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
501 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
502 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
503 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
504 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
505 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
506 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
507 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
508 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
509 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
510 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
511 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
512 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
513 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
514 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
515 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
516 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
517 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
518 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
519 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
520 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
521 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
522 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
523 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
524 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
525 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
526 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
527 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
528 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
529 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
530 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
531 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
532 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
533 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
534 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
535 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
536 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
537 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
538 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
539 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
540 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
541 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
542 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
543 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
544 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
545 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
546 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
547 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
548 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
549 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
550 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
551 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
552 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
553 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
554 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
555 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
556 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
557 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
558 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
561 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
562 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
563 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
564 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
565 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
566 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
567 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
568 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
569 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
570 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
571 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
572 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
574 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
575 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
576 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
578 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
579 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
580 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
594 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
595 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
596 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
597 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
598 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
600 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
601 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
602 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
603 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
604 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
605 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
606 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
607 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
608 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
609 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
610 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
611 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
612 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
613 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
614 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
615 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
616 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
617 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
618 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
619 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
620 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
621 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
622 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
623 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
624 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
625 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
626 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
627 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
628 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
629 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
630 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
631 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
632 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
633 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
634 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
635 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
636 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
637 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
638 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
639 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
640 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
641 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
642 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
643 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
644 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
645 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
646 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
647 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
648 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
649 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
650 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
651 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
652 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
653 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
654 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
655 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
656 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
657 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
658 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
659 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
660 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
661 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
662 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
663 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
664 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
665 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
666 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
667 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
668 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
669 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
670 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
671 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
672 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
673 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
674 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
675 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
676 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
677 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
678 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
679 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
680 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
681 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
682 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
683 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
684 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
685 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
686 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
687 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
688 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
689 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
690 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
691 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
692 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
693 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
694 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
695 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
696 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
697 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
698 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
699 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
700 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
701 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
702 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
704 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
705 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
706 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
707 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
709 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
710 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
711 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
712 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
713 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
714 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
715 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
716 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
717 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
718 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
719 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
720 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
721 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
722 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
723 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
724 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
725 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
726 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
727 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
728 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
729 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
730 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
731 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
732 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
733 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
734 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
735 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
736 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
737 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
738 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
739 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
740 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
741 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
742 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
743 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
744 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
745 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
746 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
747 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
748 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
749 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
750 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
751 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
752 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
753 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
754 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
755 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
756 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
757 8005258706 Rhizobium sp. R693 Isolate Nodule
758 8005275841 Rhizobium sp. N4311 Isolate Nodule
759 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
760 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
761 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
762 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
763 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
764 8005321885 Rhizobium sp. R72 Isolate Nodule
765 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
766 8005382845 Rhizobium sp. R634 Isolate Nodule
767 8005395548 Rhizobium sp. R339 Isolate Nodule
768 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
769 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
770 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
771 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
772 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
773 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
774 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
775 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
776 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
777 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
778 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
779 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
780 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
781 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
782 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
783 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
784 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
785 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
786 8018176218 Rhizobium sp. N122 Isolate Nodule
787 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
788 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
789 8024501048 Rhizobium sp. H4 Isolate Nodule
790 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
791 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
792 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
793 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
794 8056382006 Rhizobium croatiense 13T Isolate Nodule
795 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
796 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.31
Metatranscriptomes 0.26
Isolates 45.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 21.64
Nodule 36.21
Rhizoplane 2.5
Rhizosphere 20.69
Stem 0
Stem Tuber 0
Unclassified 18.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008219 3300001979 Bacteria 4178
2 JGI25155J39150_1000018 3300002704 Bacteria 157606
3 JGI25156J39149_1000055 3300002705 Bacteria 87733
4 JGI25162J39368_1000601 3300002737 Bacteria 25918
5 JGI25162J39368_1000903 3300002737 Bacteria 19226
6 JGI25154J39366_1000069 3300002738 Bacteria 96438
7 JGI25158J39367_1000191 3300002739 Bacteria 14579
8 JGI25158J39367_1000951 3300002739 Bacteria 5346
9 JGI25157J39369_1000076 3300002741 Bacteria 87678
10 JGI25152J39213_1000169 3300002773 Bacteria 44325
11 JGI25152J39213_1000820 3300002773 Bacteria 15512
12 JGI25152J39213_1001739 3300002773 Bacteria 8902
13 JGI25152J39213_1004374 3300002773 Bacteria 4468
14 JGI25152J39213_1013219 3300002773 Bacteria 1729
15 JGI25152J39213_1018927 3300002773 Bacteria 1263
16 JGI25150J39212_1000018 3300002774 Bacteria 146535
17 JGI25150J39212_1002889 3300002774 Bacteria 4155
18 JGI25150J39212_1018607 3300002774 Bacteria 1102
19 JGI25159J45721_1000486 3300002987 Bacteria 18238
20 JGI25159J45721_1002910 3300002987 Bacteria 6247
21 JGI25151J46595_10000034 3300003187 Bacteria 192271
22 JGI25151J46595_10000879 3300003187 Bacteria 23723
23 JGI25151J46595_10003252 3300003187 Bacteria 9039
24 JGI25151J46595_10043649 3300003187 Bacteria 1602
25 JGI25151J46595_10054567 3300003187 Bacteria 1324
26 JGI25165J46597_1000974 3300003214 Bacteria 19236
27 JGI25165J46597_1001602 3300003214 Bacteria 10851
28 JGI25165J46597_1002402 3300003214 Bacteria 6170
29 JGI25153J46596_10000759 3300003215 Bacteria 19719
30 JGI25153J46596_10002149 3300003215 Bacteria 11526
31 JGI25153J46596_10025442 3300003215 Bacteria 2114
32 JGI25153J46596_10029546 3300003215 Bacteria 1879
33 rootL2_10083269 3300003322 Bacteria 2231
34 rootH1_10095635 3300003316 Bacteria 3608
35 rootH1_10095635 3300003323 Bacteria 2362
36 JGI25160J50197_1000051 3300003354 Bacteria 132923
37 JGI25160J50197_1000056 3300003354 Bacteria 119463
38 JGI25160J50197_1000317 3300003354 Bacteria 33502
39 JGI25160J50197_1008846 3300003354 Bacteria 3791
40 JGI25160J50197_1025547 3300003354 Bacteria 1650
41 JGI25161J50226_1000011 3300003374 Bacteria 210140
42 JGI25161J50226_1000214 3300003374 Bacteria 36702
43 JGI25161J50226_1000451 3300003374 Bacteria 19047
44 JGI25161J50226_1004227 3300003374 Bacteria 3052
45 Ga0006562J51391_1012796 3300003578 Bacteria 4245
46 Ga0055526_1005687 3300003771 Bacteria 7076
47 Ga0055526_1009954 3300003771 Bacteria 4493
48 Ga0055526_1010755 3300003771 Bacteria 4216
49 Ga0055526_1013485 3300003771 Bacteria 3451
50 Ga0055526_1017527 3300003771 Bacteria 2730
51 Ga0055526_1023958 3300003771 Bacteria 2017
52 Ga0055524_1000962 3300003775 Bacteria 18149
53 Ga0055524_1006628 3300003775 Bacteria 5007
54 Ga0055524_1018114 3300003775 Bacteria 2458
55 Ga0055524_1039657 3300003775 Bacteria 1213
56 Ga0055524_1049246 3300003775 Bacteria 973
57 Ga0055524_1049366 3300003775 Bacteria 971
58 Ga0055528_1010175 3300003790 Bacteria 3853
59 Ga0055528_1016302 3300003790 Bacteria 2635
60 Ga0055528_1020531 3300003790 Bacteria 2141
61 Ga0055528_1023092 3300003790 Bacteria 1911
62 Ga0055530_10025854 3300003791 Bacteria 1632
63 Ga0055540_1000597 3300003792 Bacteria 26126
64 Ga0055540_1008997 3300003792 Bacteria 3516
65 Ga0055540_1020440 3300003792 Bacteria 1750
66 Ga0055540_1043882 3300003792 Bacteria 952
67 Ga0055531_10001167 3300003794 Bacteria 20222
68 Ga0055531_10020645 3300003794 Bacteria 2595
69 Ga0058692_1014620 3300003856 Bacteria 1792
70 Ga0055543_1000041 3300004625 Bacteria 118501
71 Ga0055543_1000330 3300004625 Bacteria 32518
72 Ga0055543_1000383 3300004625 Bacteria 28950
73 Ga0055543_1006123 3300004625 Bacteria 2961
74 Ga0065165_1000155 3300005262 Bacteria 119501
75 Ga0065165_1000303 3300005262 Bacteria 82513
76 Ga0065165_1008432 3300005262 Bacteria 4823
77 Ga0070670_100000711 3300005331 Bacteria 25830
78 Ga0070668_100008156 3300005347 Bacteria 7779
79 Ga0070668_100107225 3300005347 Bacteria 2221
80 Ga0070668_100306582 3300005347 Bacteria 1333
81 Ga0070668_100432186 3300005347 Bacteria 1129
82 Ga0070669_100115122 3300005353 Bacteria 2045
83 Ga0070663_100509972 3300005455 Bacteria 1000
84 Ga0070665_100005296 3300005548 Bacteria 13322
85 Ga0070665_100039485 3300005548 Bacteria 4746
86 Ga0070665_100440710 3300005548 Bacteria 1312
87 Ga0068855_100103757 3300005563 Bacteria 3271
88 Ga0068854_100030834 3300005578 Bacteria 3722
89 Ga0068856_100502083 3300005614 Bacteria 1234
90 Ga0068852_100016523 3300005616 Bacteria 5760
91 Ga0068852_101020637 3300005616 Bacteria 846
92 Ga0068862_100188269 3300005844 Bacteria 1856
93 Ga0075365_10001383 3300006038 Bacteria 10915
94 Ga0075365_10064227 3300006038 Bacteria 2459
95 Ga0075365_10198007 3300006038 Bacteria 1407
96 Ga0075368_10000331 3300006042 Bacteria 13823
97 Ga0075368_10077585 3300006042 Bacteria 1349
98 Ga0075363_100020723 3300006048 Bacteria 3301
99 Ga0075363_100223553 3300006048 Bacteria 1079
100 Ga0075363_100292366 3300006048 Bacteria 944
101 Ga0075363_100309617 3300006048 Bacteria 917
102 Ga0075364_10000055 3300006051 Bacteria 41950
103 Ga0075364_10002563 3300006051 Bacteria 10184
104 Ga0075364_10151699 3300006051 Bacteria 1562
105 Ga0075364_10378509 3300006051 Bacteria 965
106 Ga0075362_10008613 3300006177 Bacteria 3912
107 Ga0075362_10051857 3300006177 Bacteria 1837
108 Ga0075367_10000616 3300006178 Bacteria 13639
109 Ga0075367_10035020 3300006178 Bacteria 2904
110 Ga0075367_10035857 3300006178 Bacteria 2873
111 Ga0075369_10000392 3300006186 Bacteria 13230
112 Ga0075369_10010550 3300006186 Bacteria 3615
113 Ga0075369_10062604 3300006186 Bacteria 1626
114 Ga0075366_10007979 3300006195 Bacteria 5862
115 Ga0075370_10002288 3300006353 Bacteria 8836
116 Ga0075370_10003473 3300006353 Bacteria 7510
117 Ga0075370_10401889 3300006353 Bacteria 822
118 Ga0079104_1000310 3300006946 Bacteria 61815
119 Ga0079104_1001973 3300006946 Bacteria 12061
120 Ga0099826_10000813 3300006948 Bacteria 16761
121 Ga0099826_10069443 3300006948 Bacteria 2245
122 Ga0099826_10160612 3300006948 Bacteria 1273
123 Ga0105251_10004120 3300009011 Bacteria 10148
124 Ga0105244_10101027 3300009036 Bacteria 1411
125 Ga0105250_10012077 3300009092 Bacteria 3576
126 Ga0105240_10000142 3300009093 Bacteria 146932
127 Ga0105247_10032017 3300009101 Bacteria 3193
128 Ga0105243_10062288 3300009148 Bacteria 2986
129 Ga0105243_10729429 3300009148 Bacteria 969
130 Ga0105248_10041973 3300009177 Bacteria 5129
131 Ga0105237_10009587 3300009545 Bacteria 10367
132 Ga0123341_1000071 3300009765 Bacteria 43545
133 Ga0123342_1006148 3300009766 Bacteria 16842
134 Ga0123342_1018750 3300009766 Bacteria 5434
135 Ga0105239_10070590 3300010375 Bacteria 3837
136 Ga0105239_10434691 3300010375 Bacteria 1488
137 Ga0105246_10118809 3300011119 Bacteria 1955
138 Ga0105246_10487897 3300011119 Bacteria 1044
139 Ga0105246_11727429 3300011119 Bacteria 596
140 Ga0157319_1018011 3300012497 Bacteria 658
141 Ga0157373_10013927 3300013100 Bacteria 5899
142 Ga0157371_10000071 3300013102 Bacteria 164088
143 Ga0157371_10031236 3300013102 Bacteria 3838
144 Ga0157370_10000079 3300013104 Bacteria 107305
145 Ga0157370_10002835 3300013104 Bacteria 20731
146 Ga0157370_10552230 3300013104 Bacteria 1056
147 Ga0157369_10121813 3300013105 Bacteria 2767
148 Ga0157369_10606682 3300013105 Bacteria 1130
149 Ga0171463_1004 3300013249 Bacteria 437207
150 Ga0157378_10477533 3300013297 Bacteria 1242
151 Ga0157372_10085199 3300013307 Bacteria 3584
152 Ga0182008_10180622 3300014497 Bacteria 1068
153 Ga0182007_10004127 3300015262 Bacteria 6662
154 Ga0182005_1003860 3300015265 Bacteria 4974
155 Ga0183362_10164 3300015683 Bacteria 1127
156 Ga0183363_1129 3300015690 Bacteria 19181
157 Ga0214544_1000079 3300021320 Bacteria 121742
158 Ga0214542_1000064 3300021321 Bacteria 127681
159 Ga0214543_1000063 3300021327 Bacteria 127694
160 Ga0228711_1000030 3300022739 Bacteria 94546
161 Ga0228710_1000002 3300022740 Bacteria 287279
162 Ga0209435_100031 3300025206 Bacteria 164115
163 Ga0209436_100013 3300025208 Bacteria 131492
164 Ga0209436_100428 3300025208 Bacteria 18888
165 Ga0209563_105689 3300025230 Bacteria 2227
166 Ga0209437_100179 3300025233 Bacteria 134210
167 Ga0209437_100181 3300025233 Bacteria 132953
168 Ga0209437_108423 3300025233 Bacteria 1648
169 Ga0207425_1000035 3300025245 Bacteria 225942
170 Ga0207425_1002490 3300025245 Bacteria 6467
171 Ga0207425_1014028 3300025245 Bacteria 1830
172 Ga0207425_1028298 3300025245 Bacteria 1137
173 Ga0207425_1033815 3300025245 Bacteria 1005
174 Ga0207425_1042326 3300025245 Bacteria 862
175 Ga0209646_1000102 3300025246 Bacteria 164115
176 Ga0209646_1008159 3300025246 Bacteria 1693
177 Ga0209026_1000096 3300025250 Bacteria 164115
178 Ga0209677_100353 3300025253 Bacteria 28643
179 Ga0209759_1000090 3300025256 Bacteria 164115
180 Ga0209759_1019437 3300025256 Bacteria 1611
181 Ga0209129_1000029 3300025258 Bacteria 401149
182 Ga0209129_1000050 3300025258 Bacteria 267408
183 Ga0209129_1000289 3300025258 Bacteria 48018
184 Ga0209129_1000826 3300025258 Bacteria 19503
185 Ga0209129_1001114 3300025258 Bacteria 15657
186 Ga0209129_1001662 3300025258 Bacteria 12035
187 Ga0209129_1002660 3300025258 Bacteria 8461
188 Ga0209233_1000185 3300025261 Bacteria 133788
189 Ga0209233_1000212 3300025261 Bacteria 110364
190 Ga0209233_1000263 3300025261 Bacteria 79293
191 Ga0209565_1014660 3300025263 Bacteria 1792
192 Ga0209455_1015460 3300025272 Bacteria 1676
193 Ga0209673_1000033 3300025273 Bacteria 335369
194 Ga0209673_1000050 3300025273 Bacteria 285287
195 Ga0209673_1000370 3300025273 Bacteria 81047
196 Ga0209673_1001321 3300025273 Bacteria 24961
197 Ga0209673_1001329 3300025273 Bacteria 24789
198 Ga0209673_1001845 3300025273 Bacteria 17300
199 Ga0209673_1004386 3300025273 Bacteria 7591
200 Ga0209673_1024489 3300025273 Bacteria 2026
201 Ga0209673_1080572 3300025273 Bacteria 747
202 Ga0209130_1000009 3300025284 Bacteria 498952
203 Ga0209130_1000058 3300025284 Bacteria 210250
204 Ga0209130_1000133 3300025284 Bacteria 119561
205 Ga0209130_1004684 3300025284 Bacteria 5070
206 Ga0209130_1009828 3300025284 Bacteria 2686
207 Ga0209130_1021959 3300025284 Bacteria 1431
208 Ga0209676_1012855 3300025292 Bacteria 3253
209 Ga0209025_1000042 3300025294 Bacteria 370577
210 Ga0209025_1000132 3300025294 Bacteria 197432
211 Ga0209025_1000536 3300025294 Bacteria 71932
212 Ga0209025_1000815 3300025294 Bacteria 50019
213 Ga0209025_1001644 3300025294 Bacteria 27573
214 Ga0209025_1008730 3300025294 Bacteria 7219
215 Ga0209025_1015126 3300025294 Bacteria 4679
216 Ga0209025_1017618 3300025294 Bacteria 4107
217 Ga0209025_1043997 3300025294 Bacteria 1873
218 Ga0209564_1000193 3300025295 Bacteria 141731
219 Ga0209564_1000227 3300025295 Bacteria 125497
220 Ga0209564_1000284 3300025295 Bacteria 102684
221 Ga0209564_1001108 3300025295 Bacteria 31835
222 Ga0209564_1004168 3300025295 Bacteria 9034
223 Ga0209564_1009154 3300025295 Bacteria 4761
224 Ga0209564_1028940 3300025295 Bacteria 1756
225 Ga0209758_1000299 3300025297 Bacteria 97367
226 Ga0209758_1000406 3300025297 Bacteria 73962
227 Ga0209758_1000864 3300025297 Bacteria 41937
228 Ga0209758_1001221 3300025297 Bacteria 32261
229 Ga0209758_1001412 3300025297 Bacteria 28454
230 Ga0209758_1001462 3300025297 Bacteria 27731
231 Ga0209758_1003168 3300025297 Bacteria 15434
232 Ga0209758_1012764 3300025297 Bacteria 4657
233 Ga0209758_1041997 3300025297 Bacteria 1701
234 Ga0209050_1004678 3300025298 Bacteria 9092
235 Ga0209050_1004888 3300025298 Bacteria 8778
236 Ga0209050_1017307 3300025298 Bacteria 2884
237 Ga0209256_1000286 3300025299 Bacteria 88880
238 Ga0209256_1001479 3300025299 Bacteria 24043
239 Ga0209256_1001610 3300025299 Bacteria 22074
240 Ga0209256_1001820 3300025299 Bacteria 19999
241 Ga0209256_1005684 3300025299 Bacteria 7012
242 Ga0209256_1006504 3300025299 Bacteria 6147
243 Ga0209256_1017619 3300025299 Bacteria 2361
244 Ga0209256_1020044 3300025299 Bacteria 2103
245 Ga0207426_1000131 3300025302 Bacteria 210250
246 Ga0207426_1000214 3300025302 Bacteria 137296
247 Ga0207426_1000248 3300025302 Bacteria 119561
248 Ga0207426_1000450 3300025302 Bacteria 65777
249 Ga0207426_1000682 3300025302 Bacteria 40955
250 Ga0209051_1000118 3300025303 Bacteria 149426
251 Ga0209051_1000547 3300025303 Bacteria 45743
252 Ga0209051_1001039 3300025303 Bacteria 26259
253 Ga0209051_1004006 3300025303 Bacteria 9339
254 Ga0209051_1019149 3300025303 Bacteria 2999
255 Ga0209051_1021614 3300025303 Bacteria 2731
256 Ga0209051_1032327 3300025303 Bacteria 1998
257 Ga0209051_1033630 3300025303 Bacteria 1935
258 Ga0209257_1002918 3300025304 Bacteria 15767
259 Ga0209257_1006107 3300025304 Bacteria 7995
260 Ga0209257_1014729 3300025304 Bacteria 3328
261 Ga0209257_1032028 3300025304 Bacteria 1672
262 Ga0207710_10131335 3300025900 Bacteria 1203
263 Ga0207680_10266370 3300025903 Bacteria 1187
264 Ga0207647_10063583 3300025904 Bacteria 2244
265 Ga0207695_10000234 3300025913 Bacteria 146987
266 Ga0207671_10000234 3300025914 Bacteria 83448
267 Ga0207681_10185327 3300025923 Bacteria 1588
268 Ga0207650_10003285 3300025925 Bacteria 11136
269 Ga0207644_10050498 3300025931 Bacteria 2981
270 Ga0207667_10078699 3300025949 Bacteria 3417
271 Ga0207668_10060123 3300025972 Bacteria 2666
272 Ga0207678_10072706 3300026067 Bacteria 2946
273 Ga0207702_10056535 3300026078 Bacteria 3332
274 Ga0207702_10326585 3300026078 Bacteria 1462
275 Ga0207698_10025061 3300026142 Bacteria 4196
276 Ga0209281_1000028 3300027111 Bacteria 440027
277 Ga0209281_1000030 3300027111 Bacteria 425931
278 Ga0209281_1000144 3300027111 Bacteria 172471
279 Ga0209371_1001411 3300027312 Bacteria 16466
280 Ga0209282_1000004 3300027666 Bacteria 425931
281 Ga0209282_1000695 3300027666 Bacteria 16757
282 Ga0209813_10045426 3300027866 Bacteria 1353
283 Ga0268266_10017319 3300028379 Bacteria 6150
284 Ga0268266_10049742 3300028379 Bacteria 3595
285 Ga0268266_10088034 3300028379 Bacteria 2718
286 Ga0307515_10012908 3300028794 Bacteria 15667
287 Ga0307515_10069879 3300028794 Bacteria 4790
288 Ga0268256_1001490 3300030500 Bacteria 13902
289 Ga0268256_1006162 3300030500 Bacteria 4517
290 Ga0316181_1189592 3300030744 Bacteria 1764
291 Ga0307513_10583171 3300031456 Bacteria 828
292 Ga0307408_100028873 3300031548 Bacteria 3837
293 Ga0307408_100073764 3300031548 Bacteria 2530
294 Ga0307406_10004352 3300031901 Bacteria 7707
295 Ga0307406_10096826 3300031901 Bacteria 2000
296 Ga0307412_10000412 3300031911 Bacteria 26116
297 Ga0307412_10155397 3300031911 Bacteria 1693
298 Ga0307412_10764681 3300031911 Bacteria 835
299 Ga0315914_1000001 3300031967 Bacteria 416633
300 Ga0307409_100101363 3300031995 Bacteria 2389
301 Ga0307416_100576121 3300032002 Bacteria 1202
302 Ga0307414_10153173 3300032004 Bacteria 1821
303 Ga0307510_10295522 3300033180 Bacteria 1084
304 Ga0315913_1000022 3300033430 Bacteria 94546
305 Ga0315915_1000002 3300033464 Bacteria 425854
306 Ga0439436_0002644 3300041404 Bacteria 5400
307 Ga0439438_012733 3300041405 Bacteria 2566
308 Ga0439439_0031627 3300041406 Bacteria 1350
309 Ga0439466_0089780 3300041411 Bacteria 964
310 Ga0439465_0021382 3300041413 Bacteria 2028
311 Ga0439465_0021386 3300041413 Bacteria 2028
312 Ga0439465_0047034 3300041413 Bacteria 1405
313 Ga0439465_0260925 3300041413 Bacteria 642
314 Ga0451787_200251 3300041441 Bacteria 1828
315 Ga0451833_0683899 3300041491 Bacteria 788
316 Ga0451837_0098499 3300041494 Bacteria 2060
317 Ga0451845_0156427 3300041501 Bacteria 1631
318 Ga0451846_59670 3300041502 Bacteria 1528
319 Ga0451847_0888963 3300041503 Bacteria 1142
320 Ga0451849_1200051 3300041505 Bacteria 1196
321 Ga0451851_0539026 3300041507 Bacteria 1847
322 Ga0451855_1436254 3300041511 Bacteria 858
323 Ga0439449_0008658 3300042007 Bacteria 3862
324 Ga0439449_0047436 3300042007 Bacteria 1591
325 Ga0439449_0054121 3300042007 Bacteria 1483
326 Ga0439449_0118555 3300042007 Bacteria 982
327 Ga0439462_0035578 3300042015 Bacteria 1324
328 Ga0439462_0066838 3300042015 Bacteria 975
329 Ga0450894_028395 3300042131 Bacteria 774
330 Ga0450906_003057 3300042145 Bacteria 3626
331 Ga0450909_018620 3300042185 Bacteria 1032
332 Ga0439434_0063586 3300042435 Bacteria 1156
333 Ga0466970_0001843 3300044765 Bacteria 10241
334 Ga0466957_0100894 3300044842 Bacteria 1819
335 Ga0451576_0379481 3300045051 Bacteria 1482
336 Ga0495638_0000110 3300046460 Bacteria 131410
337 Ga0495638_0018330 3300046460 Bacteria 4650
338 Ga0495651_0255648 3300046462 Bacteria 1194
339 Ga0495650_0070595 3300046471 Bacteria 1371
340 Ga0495605_0005548 3300046474 Bacteria 7337
341 Ga0495605_0007620 3300046474 Bacteria 6138
342 Ga0495662_0002722 3300046476 Bacteria 8931
343 Ga0495585_0028682 3300046492 Bacteria 3173
344 Ga0495585_0057536 3300046492 Bacteria 2145
345 Ga0495585_0062483 3300046492 Bacteria 2046
346 Ga0495596_0146851 3300046500 Bacteria 916
347 Ga0495607_0009351 3300046501 Bacteria 6637
348 Ga0495607_0089810 3300046501 Bacteria 1667
349 Ga0495583_0009155 3300046506 Bacteria 5951
350 Ga0495583_0027839 3300046506 Bacteria 2785
351 Ga0495606_0001343 3300046507 Bacteria 33471
352 Ga0495610_0000363 3300046512 Bacteria 47378
353 Ga0495610_0028182 3300046512 Bacteria 2973
354 Ga0495616_0037833 3300046513 Bacteria 2480
355 Ga0495620_0038973 3300046515 Bacteria 2105
356 Ga0495620_0090655 3300046515 Bacteria 1227
357 Ga0495631_0019274 3300046518 Bacteria 3200
358 Ga0495632_0038705 3300046519 Bacteria 2413
359 Ga0495632_0401716 3300046519 Bacteria 598
360 Ga0495643_0008699 3300046522 Bacteria 6403
361 Ga0495643_0031872 3300046522 Bacteria 2930
362 Ga0495644_0329723 3300046523 Bacteria 599
363 Ga0495648_0059177 3300046524 Bacteria 2287
364 Ga0495648_0113237 3300046524 Bacteria 1472
365 Ga0495648_0214502 3300046524 Bacteria 954
366 Ga0495652_0262856 3300046529 Bacteria 1273
367 Ga0495654_0000143 3300046530 Bacteria 74495
368 Ga0495622_0023390 3300046557 Bacteria 2880
369 Ga0495633_0010330 3300046558 Bacteria 5103
370 Ga0495633_0058082 3300046558 Bacteria 1816
371 Ga0495633_0110702 3300046558 Bacteria 1273
372 Ga0495668_0017818 3300046616 Bacteria 4115
373 Ga0495668_0156898 3300046616 Bacteria 1246
374 Ga0495668_0329142 3300046616 Bacteria 838
375 Ga0495611_0014969 3300046648 Bacteria 3315
376 Ga0495625_0013089 3300046660 Bacteria 6683
377 Ga0495625_0023025 3300046660 Bacteria 4764
378 Ga0495625_0053893 3300046660 Bacteria 2874
379 Ga0495625_0248065 3300046660 Bacteria 1156
380 Ga0495625_0290690 3300046660 Bacteria 1049
381 Ga0495661_0084273 3300046665 Bacteria 1825
382 Ga0495661_0177524 3300046665 Bacteria 1131
383 Ga0495588_0359925 3300046674 Bacteria 764
384 Ga0495657_0096683 3300046675 Bacteria 1887
385 Ga0495624_0119154 3300046690 Bacteria 1621
386 Ga0495671_0022537 3300046692 Bacteria 3299
387 Ga0495671_0099466 3300046692 Bacteria 1422
388 Ga0495649_0109551 3300046694 Bacteria 1465
389 Ga0495600_0131244 3300046809 Bacteria 1628
390 Ga0495660_0008098 3300046810 Bacteria 6173
391 Ga0495660_0034931 3300046810 Bacteria 2811
392 Ga0495604_0026659 3300047317 Bacteria 4599
393 Ga0495636_0072915 3300047318 Bacteria 1468
394 Ga0495636_0096439 3300047318 Bacteria 1289
395 Ga0495683_0364772 3300047323 Bacteria 607
396 Ga0495687_050654 3300047443 Bacteria 1768
397 Ga0495687_057994 3300047443 Bacteria 1608
398 Ga0495681_0039594 3300047470 Bacteria 2300
399 Ga0495686_0001162 3300047472 Bacteria 30927
400 Ga0495686_0002138 3300047472 Bacteria 19314
401 Ga0495686_0012296 3300047472 Bacteria 5994
402 Ga0495686_0030443 3300047472 Bacteria 3504
403 Ga0495686_0072590 3300047472 Bacteria 2116
404 Ga0495686_0097709 3300047472 Bacteria 1775
405 Ga0495686_0153621 3300047472 Bacteria 1350
406 Ga0495686_0162224 3300047472 Bacteria 1305
407 Ga0495615_0063006 3300048090 Bacteria 983
408 Ga0495615_0120596 3300048090 Bacteria 758
409 Ga0496100_0507011 3300048903 Bacteria 930
410 Ga0496100_1186344 3300048903 Bacteria 602
411 Ga0496101_0150338 3300048904 Bacteria 1781
412 Ga0496101_0155654 3300048904 Bacteria 1750
413 Ga0496101_0178948 3300048904 Bacteria 1632
414 Ga0496102_0006022 3300048905 Bacteria 10327
415 Ga0496102_0041154 3300048905 Bacteria 4183
416 Ga0496103_0070260 3300048906 Bacteria 2190
417 Ga0496103_0091095 3300048906 Bacteria 1924
418 Ga0496104_0023303 3300048907 Bacteria 5691
419 Ga0496104_0309275 3300048907 Bacteria 1493
420 Ga0496105_0022420 3300048908 Bacteria 5114
421 Ga0496106_0095281 3300048909 Bacteria 2302
422 Ga0496107_0147598 3300048910 Bacteria 1739
423 Ga0496108_0198734 3300048911 Bacteria 1740
424 Ga0496110_0026155 3300048913 Bacteria 4991
425 Ga0496111_0000529 3300048914 Bacteria 19781
426 Ga0496111_0049930 3300048914 Bacteria 3016
427 Ga0496113_0024324 3300048916 Bacteria 4303
428 Ga0496113_0102060 3300048916 Bacteria 2224
429 Ga0496116_0000057 3300048919 Bacteria 281652
430 Ga0496116_0002951 3300048919 Bacteria 17324
431 Ga0496116_0004307 3300048919 Bacteria 13619
432 Ga0496116_0030549 3300048919 Bacteria 3867
433 Ga0496116_0049132 3300048919 Bacteria 2824
434 Ga0496116_0053282 3300048919 Bacteria 2673
435 Ga0496116_0086110 3300048919 Bacteria 1929
436 Ga0496116_0091172 3300048919 Bacteria 1852
437 Ga0496116_0096696 3300048919 Bacteria 1778
438 Ga0496116_0150070 3300048919 Bacteria 1296
439 Ga0496117_0000031 3300048920 Bacteria 381048
440 Ga0496117_0004374 3300048920 Bacteria 15663
441 Ga0496117_0005859 3300048920 Bacteria 12714
442 Ga0496117_0006996 3300048920 Bacteria 11181
443 Ga0496117_0010245 3300048920 Bacteria 8588
444 Ga0496117_0051336 3300048920 Bacteria 2916
445 Ga0496117_0123121 3300048920 Bacteria 1589
446 Ga0496117_0197772 3300048920 Bacteria 1138
447 Ga0496117_0289550 3300048920 Bacteria 873
448 Ga0496117_0387798 3300048920 Bacteria 709
449 Ga0496118_0000208 3300048921 Bacteria 102645
450 Ga0496118_0008237 3300048921 Bacteria 10813
451 Ga0496118_0008792 3300048921 Bacteria 10353
452 Ga0496118_0026435 3300048921 Bacteria 4946
453 Ga0496118_0026767 3300048921 Bacteria 4903
454 Ga0496118_0027135 3300048921 Bacteria 4854
455 Ga0496118_0327999 3300048921 Bacteria 827
456 Ga0496119_0008844 3300048922 Bacteria 8758
457 Ga0496119_0008902 3300048922 Bacteria 8729
458 Ga0496119_0015539 3300048922 Bacteria 5850
459 Ga0496119_0026061 3300048922 Bacteria 4064
460 Ga0496119_0032107 3300048922 Bacteria 3505
461 Ga0496119_0070713 3300048922 Bacteria 2046
462 Ga0496119_0086697 3300048922 Bacteria 1788
463 Ga0496119_0119430 3300048922 Bacteria 1451
464 Ga0496119_0120155 3300048922 Bacteria 1446
465 Ga0496119_0184720 3300048922 Bacteria 1091
466 Ga0496120_0000387 3300048923 Bacteria 71224
467 Ga0496120_0016894 3300048923 Bacteria 4750
468 Ga0496120_0056066 3300048923 Bacteria 2226
469 Ga0496120_0230012 3300048923 Bacteria 881
470 Ga0496121_0000034 3300048924 Bacteria 377095
471 Ga0496121_0000660 3300048924 Bacteria 64425
472 Ga0496121_0003956 3300048924 Bacteria 20474
473 Ga0496121_0006665 3300048924 Bacteria 14205
474 Ga0496121_0011216 3300048924 Bacteria 9985
475 Ga0496121_0067785 3300048924 Bacteria 2890
476 Ga0496121_0124164 3300048924 Bacteria 1944
477 Ga0496121_0149267 3300048924 Bacteria 1722
478 Ga0496121_0185447 3300048924 Bacteria 1497
479 Ga0496121_0225027 3300048924 Bacteria 1318
480 Ga0496122_0000023 3300048925 Bacteria 381035
481 Ga0496122_0000308 3300048925 Bacteria 107960
482 Ga0496122_0009867 3300048925 Bacteria 9953
483 Ga0496122_0015251 3300048925 Bacteria 7354
484 Ga0496122_0015840 3300048925 Bacteria 7180
485 Ga0496122_0019377 3300048925 Bacteria 6218
486 Ga0496122_0020473 3300048925 Bacteria 5975
487 Ga0496122_0023049 3300048925 Bacteria 5509
488 Ga0496122_0041403 3300048925 Bacteria 3642
489 Ga0496122_0069645 3300048925 Bacteria 2518
490 Ga0496122_0108993 3300048925 Bacteria 1824
491 Ga0496122_0149017 3300048925 Bacteria 1448
492 Ga0496122_0163330 3300048925 Bacteria 1354
493 Ga0496122_0237697 3300048925 Bacteria 1030
494 Ga0496122_0280647 3300048925 Bacteria 910
495 Ga0496122_0383985 3300048925 Bacteria 719
496 Ga0496123_0000027 3300048926 Bacteria 306773
497 Ga0496123_0000066 3300048926 Bacteria 210327
498 Ga0496123_0004280 3300048926 Bacteria 15189
499 Ga0496123_0005944 3300048926 Bacteria 12020
500 Ga0496123_0018773 3300048926 Bacteria 5481
501 Ga0496123_0031587 3300048926 Bacteria 3850
502 Ga0496123_0033424 3300048926 Bacteria 3701
503 Ga0496123_0051392 3300048926 Bacteria 2745
504 Ga0496123_0059994 3300048926 Bacteria 2455
505 Ga0496123_0071116 3300048926 Bacteria 2172
506 Ga0496123_0098834 3300048926 Bacteria 1705
507 Ga0496123_0116877 3300048926 Bacteria 1510
508 Ga0496123_0206756 3300048926 Bacteria 1001
509 Ga0496124_0000294 3300048927 Bacteria 93153
510 Ga0496124_0001215 3300048927 Bacteria 39879
511 Ga0496124_0003574 3300048927 Bacteria 18903
512 Ga0496124_0011810 3300048927 Bacteria 8701
513 Ga0496124_0018416 3300048927 Bacteria 6539
514 Ga0496124_0018926 3300048927 Bacteria 6429
515 Ga0496124_0019169 3300048927 Bacteria 6381
516 Ga0496124_0027404 3300048927 Bacteria 5114
517 Ga0496124_0031109 3300048927 Bacteria 4728
518 Ga0496124_0036348 3300048927 Bacteria 4297
519 Ga0496124_0116297 3300048927 Bacteria 2144
520 Ga0496124_0196710 3300048927 Bacteria 1537
521 Ga0496124_0219698 3300048927 Bacteria 1430
522 Ga0496124_0228190 3300048927 Bacteria 1394
523 Ga0496124_0228472 3300048927 Bacteria 1393
524 Ga0496124_0382986 3300048927 Bacteria 983
525 Ga0496125_0000030 3300048928 Bacteria 375023
526 Ga0496125_0000288 3300048928 Bacteria 99681
527 Ga0496125_0004702 3300048928 Bacteria 15559
528 Ga0496125_0005090 3300048928 Bacteria 14802
529 Ga0496125_0038337 3300048928 Bacteria 4149
530 Ga0496125_0040784 3300048928 Bacteria 3978
531 Ga0496125_0071783 3300048928 Bacteria 2702
532 Ga0496125_0162917 3300048928 Bacteria 1512
533 Ga0496125_0228186 3300048928 Bacteria 1193
534 Ga0496125_0252960 3300048928 Bacteria 1110
535 Ga0496125_0447862 3300048928 Bacteria 740
536 Ga0496126_0000115 3300048929 Bacteria 188546
537 Ga0496126_0000258 3300048929 Bacteria 113843
538 Ga0496126_0024648 3300048929 Bacteria 5804
539 Ga0496126_0098924 3300048929 Bacteria 2555
540 Ga0496126_0100054 3300048929 Bacteria 2538
541 Ga0496126_0137324 3300048929 Bacteria 2107
542 Ga0496126_0145376 3300048929 Bacteria 2037
543 Ga0496126_0150808 3300048929 Bacteria 1993
544 Ga0496126_0557761 3300048929 Bacteria 908
545 Ga0496126_0673755 3300048929 Bacteria 806
546 Ga0495678_027905 3300049459 Bacteria 2389
547 Ga0495678_028870 3300049459 Bacteria 2335
548 Ga0495678_073003 3300049459 Bacteria 1252
549 Ga0495682_0078250 3300049460 Bacteria 1190
550 Ga0501031_0040846 3300049568 Bacteria 3028
551 Ga0501032_0250325 3300049569 Bacteria 1150
552 Ga0501032_0362992 3300049569 Bacteria 932
553 Ga0501033_0012136 3300049570 Bacteria 6577
554 Ga0501033_0180827 3300049570 Bacteria 1512
555 Ga0501034_0308918 3300049571 Bacteria 1516
556 Ga0501038_0250154 3300049574 Bacteria 1404
557 Ga0501043_0262873 3300049579 Bacteria 1326
558 Ga0501048_0000691 3300049582 Bacteria 24520
559 Ga0501073_0102474 3300049589 Bacteria 1988
560 Ga0501238_021171 3300049671 Bacteria 920
561 Ga0501241_014536 3300049758 Bacteria 1430
562 Ga0501035_0002574 3300049822 Bacteria 17734
563 Ga0501035_0292156 3300049822 Bacteria 1375
564 Ga0501044_0306524 3300049823 Bacteria 1515
565 nmdc:mga03683_14113_c1 3300050489 Bacteria 2952
566 nmdc:mga03n38_185089_c1 3300050490 Bacteria 1069
567 nmdc:mga03n38_41352_c1 3300050490 Bacteria 2009
568 nmdc:mga03n38_77720_c1 3300050490 Bacteria 1552
569 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
570 nmdc:mga00v17_303560_c1 3300050491 Bacteria 1037
571 nmdc:mga00v17_38122_c1 3300050491 Bacteria 2873
572 nmdc:mga00v17_431_c1 3300050491 Bacteria 23635
573 nmdc:mga00v17_532523_c1 3300050491 Bacteria 760
574 nmdc:mga0yw44_199669_c1 3300050492 Bacteria 1321
575 nmdc:mga0yw44_266127_c1 3300050492 Bacteria 1143
576 nmdc:mga0yw44_28130_c1 3300050492 Bacteria 3231
577 nmdc:mga0yw44_71493_c1 3300050492 Bacteria 2154
578 nmdc:mga0k408_6544_c1 3300050493 Bacteria 6205
579 nmdc:mga06z11_105349_c1 3300050494 Bacteria 1554
580 nmdc:mga06z11_314527_c1 3300050494 Bacteria 933
581 nmdc:mga06z11_31619_c1 3300050494 Bacteria 2574
582 nmdc:mga04h51_2783_c1 3300050495 Bacteria 4173
583 nmdc:mga04h51_320408_c1 3300050495 Bacteria 635
584 nmdc:mga04h51_62452_c1 3300050495 Bacteria 1280
585 nmdc:mga07m45_337836_c1 3300050496 Bacteria 875
586 nmdc:mga07m45_56391_c1 3300050496 Bacteria 2221
587 nmdc:mga0sz30_17657_c1 3300050516 Bacteria 2848
588 nmdc:mga0sz30_259983_c1 3300050516 Bacteria 773
589 nmdc:mga0sz30_2785_c1 3300050516 Bacteria 6238
590 nmdc:mga0sz30_34013_c1 3300050516 Bacteria 1213
591 nmdc:mga0sz30_735_c1 3300050516 Bacteria 11987
592 Ga0495601_0108667 3300053077 Bacteria 1795
593 Ga0495619_0020945 3300053085 Bacteria 4170
594 Ga0500578_0287531 3300053086 Bacteria 978
595 Ga0500651_0188730 3300053093 Bacteria 1221
596 Ga0500650_0255796 3300053098 Bacteria 784
597 Ga0500556_0081629 3300053104 Bacteria 1223
598 Ga0500557_063612 3300053105 Bacteria 1201
599 Ga0500560_001162 3300053107 Bacteria 4359
600 Ga0500560_010415 3300053107 Bacteria 2327
601 Ga0500572_025438 3300053111 Bacteria 1605
602 Ga0500572_128560 3300053111 Bacteria 822
603 Ga0500608_185677 3300053122 Bacteria 875
604 Ga0500618_000701 3300053125 Bacteria 19679
605 Ga0500618_007154 3300053125 Bacteria 3209
606 Ga0500618_034724 3300053125 Bacteria 1172
607 Ga0500658_0001061 3300053134 Bacteria 11260
608 Ga0500658_0080982 3300053134 Bacteria 1388
609 Ga0500561_0004664 3300053137 Bacteria 2491
610 Ga0500568_0000247 3300053139 Bacteria 45994
611 Ga0500568_0005405 3300053139 Bacteria 6604
612 Ga0500577_0009281 3300053142 Bacteria 2849
613 Ga0500588_0148512 3300053146 Bacteria 846
614 Ga0500590_000271 3300053148 Bacteria 16202
615 Ga0500604_0001019 3300053151 Bacteria 7827
616 Ga0500604_0033925 3300053151 Bacteria 1512
617 Ga0500616_0000448 3300053153 Bacteria 53998
618 Ga0500616_0002118 3300053153 Bacteria 17230
619 Ga0500616_0016144 3300053153 Bacteria 4257
620 Ga0500622_0000169 3300053156 Bacteria 70224
621 Ga0500622_0000441 3300053156 Bacteria 39445
622 Ga0500622_0045920 3300053156 Bacteria 2260
623 Ga0500624_004757 3300053157 Bacteria 1795
624 Ga0500627_0065278 3300053158 Bacteria 1606
625 Ga0500627_0140944 3300053158 Bacteria 1089
626 Ga0500633_0000081 3300053160 Bacteria 14125
627 Ga0500634_0000956 3300053161 Bacteria 10406
628 Ga0500634_0162178 3300053161 Bacteria 1030
629 Ga0500636_0007591 3300053177 Bacteria 6274
630 Ga0500636_0104142 3300053177 Bacteria 1610
631 Ga0500636_0211987 3300053177 Bacteria 1016
632 Ga0587072_001339 3300059643 Bacteria 3009
633 Ga0501082_0198695 3300060353 Bacteria 1744
634 Ga0466962_0074087 3300061719 Bacteria 1627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10764681 Ga0307412_107646812 153
2 3300049671 Ga0501238_021171 Ga0501238_021171_39_584 153
3 3300049758 Ga0501241_014536 Ga0501241_014536_128_673 153
4 3300006051 Ga0075364_10151699 Ga0075364_101516992 156
5 3300048924 Ga0496121_0000660 Ga0496121_0000660_737_1282 156
6 3300049568 Ga0501031_0040846 Ga0501031_0040846_1207_1746 156
7 3300006051 Ga0075364_10000055 Ga0075364_100000558 157
8 3300046530 Ga0495654_0000143 Ga0495654_0000143_55968_56567 157
9 3300049571 Ga0501034_0308918 Ga0501034_0308918_404_943 157
10 3300049574 Ga0501038_0250154 Ga0501038_0250154_324_863 157
11 3300049579 Ga0501043_0262873 Ga0501043_0262873_253_792 157
12 3300049822 Ga0501035_0292156 Ga0501035_0292156_766_1305 157
13 3300049823 Ga0501044_0306524 Ga0501044_0306524_571_1110 157
14 3300050491 nmdc:mga00v17_431_c1 nmdc:mga00v17_431_c1_7338_7883 157
15 3300049582 Ga0501048_0000691 Ga0501048_0000691_10255_10782 158
16 3300025230 Ga0209563_105689 Ga0209563_1056892 163
17 3300031901 Ga0307406_10096826 Ga0307406_100968262 163
18 3300046460 Ga0495638_0018330 Ga0495638_0018330_1679_2176 165
19 3300046660 Ga0495625_0290690 Ga0495625_0290690_424_969 165
20 3300047472 Ga0495686_0012296 Ga0495686_0012296_4350_4895 165
21 3300049570 Ga0501033_0012136 Ga0501033_0012136_478_1005 165
22 3300049822 Ga0501035_0002574 Ga0501035_0002574_507_1034 165
23 3300053125 Ga0500618_000701 Ga0500618_000701_17947_18492 165
24 3300048906 Ga0496103_0070260 Ga0496103_0070260_451_1008 166
25 3300003792 Ga0055540_1000597 Ga0055540_100059713 167
26 3300009765 Ga0123341_1000071 Ga0123341_100007137 167
27 3300009766 Ga0123342_1018750 Ga0123342_10187502 167
28 3300012497 Ga0157319_1018011 Ga0157319_10180111 167
29 3300025303 Ga0209051_1000118 Ga0209051_100011814 167
30 3300050494 nmdc:mga06z11_314527_c1 nmdc:mga06z11_314527_c1_229_765 167
31 3300053142 Ga0500577_0009281 Ga0500577_0009281_1657_2190 167
32 3300053156 Ga0500622_0000441 Ga0500622_0000441_15015_15548 167
33 3300002773 JGI25152J39213_1001739 JGI25152J39213_10017392 168
34 3300002773 JGI25152J39213_1013219 JGI25152J39213_10132192 168
35 3300002774 JGI25150J39212_1002889 JGI25150J39212_10028894 168
36 3300003187 JGI25151J46595_10000879 JGI25151J46595_1000087918 168
37 3300003187 JGI25151J46595_10043649 JGI25151J46595_100436492 168
38 3300003215 JGI25153J46596_10000759 JGI25153J46596_1000075914 168
39 3300003215 JGI25153J46596_10025442 JGI25153J46596_100254423 168
40 3300003354 JGI25160J50197_1000317 JGI25160J50197_100031722 168
41 3300003374 JGI25161J50226_1004227 JGI25161J50226_10042272 168
42 3300003771 Ga0055526_1010755 Ga0055526_10107553 168
43 3300003771 Ga0055526_1023958 Ga0055526_10239582 168
44 3300003775 Ga0055524_1018114 Ga0055524_10181142 168
45 3300003790 Ga0055528_1016302 Ga0055528_10163022 168
46 3300003790 Ga0055528_1020531 Ga0055528_10205313 168
47 3300003792 Ga0055540_1043882 Ga0055540_10438822 168
48 3300004625 Ga0055543_1006123 Ga0055543_10061232 168
49 3300005262 Ga0065165_1008432 Ga0065165_10084323 168
50 3300005455 Ga0070663_100509972 Ga0070663_1005099722 168
51 3300006038 Ga0075365_10064227 Ga0075365_100642272 168
52 3300006042 Ga0075368_10077585 Ga0075368_100775852 168
53 3300006048 Ga0075363_100223553 Ga0075363_1002235532 168
54 3300006048 Ga0075363_100309617 Ga0075363_1003096172 168
55 3300006178 Ga0075367_10035857 Ga0075367_100358571 168
56 3300006195 Ga0075366_10007979 Ga0075366_100079796 168
57 3300006353 Ga0075370_10003473 Ga0075370_100034732 168
58 3300011119 Ga0105246_11727429 Ga0105246_117274291 168
59 3300025245 Ga0207425_1002490 Ga0207425_10024904 168
60 3300025246 Ga0209646_1008159 Ga0209646_10081592 168
61 3300025258 Ga0209129_1000050 Ga0209129_100005061 168
62 3300025258 Ga0209129_1000289 Ga0209129_100028940 168
63 3300025263 Ga0209565_1014660 Ga0209565_10146602 168
64 3300025273 Ga0209673_1000033 Ga0209673_100003359 168
65 3300025273 Ga0209673_1000370 Ga0209673_100037015 168
66 3300025284 Ga0209130_1004684 Ga0209130_10046842 168
67 3300025284 Ga0209130_1009828 Ga0209130_10098282 168
68 3300025294 Ga0209025_1000815 Ga0209025_100081518 168
69 3300025294 Ga0209025_1001644 Ga0209025_100164428 168
70 3300025294 Ga0209025_1017618 Ga0209025_10176183 168
71 3300025295 Ga0209564_1001108 Ga0209564_10011083 168
72 3300025295 Ga0209564_1009154 Ga0209564_10091544 168
73 3300025297 Ga0209758_1001221 Ga0209758_10012214 168
74 3300025297 Ga0209758_1012764 Ga0209758_10127644 168
75 3300025299 Ga0209256_1001479 Ga0209256_100147920 168
76 3300025299 Ga0209256_1005684 Ga0209256_10056843 168
77 3300025302 Ga0207426_1000214 Ga0207426_100021462 168
78 3300025303 Ga0209051_1001039 Ga0209051_100103919 168
79 3300025303 Ga0209051_1033630 Ga0209051_10336302 168
80 3300028794 Ga0307515_10012908 Ga0307515_100129088 168
81 3300031456 Ga0307513_10583171 Ga0307513_105831712 168
82 3300041404 Ga0439436_0002644 Ga0439436_0002644_4041_4580 168
83 3300041441 Ga0451787_200251 Ga0451787_200251_535_1071 168
84 3300041494 Ga0451837_0098499 Ga0451837_0098499_24_560 168
85 3300041502 Ga0451846_59670 Ga0451846_59670_45_581 168
86 3300045051 Ga0451576_0379481 Ga0451576_0379481_866_1402 168
87 3300046474 Ga0495605_0005548 Ga0495605_0005548_1564_2100 168
88 3300046492 Ga0495585_0057536 Ga0495585_0057536_1515_2051 168
89 3300046500 Ga0495596_0146851 Ga0495596_0146851_17_553 168
90 3300046501 Ga0495607_0009351 Ga0495607_0009351_2977_3513 168
91 3300046512 Ga0495610_0000363 Ga0495610_0000363_15037_15573 168
92 3300046512 Ga0495610_0028182 Ga0495610_0028182_1669_2205 168
93 3300046515 Ga0495620_0090655 Ga0495620_0090655_674_1210 168
94 3300046519 Ga0495632_0401716 Ga0495632_0401716_43_579 168
95 3300046522 Ga0495643_0008699 Ga0495643_0008699_4354_4890 168
96 3300046524 Ga0495648_0059177 Ga0495648_0059177_1071_1607 168
97 3300046558 Ga0495633_0010330 Ga0495633_0010330_4047_4583 168
98 3300046616 Ga0495668_0156898 Ga0495668_0156898_421_957 168
99 3300046616 Ga0495668_0329142 Ga0495668_0329142_87_623 168
100 3300046660 Ga0495625_0053893 Ga0495625_0053893_144_680 168
101 3300046660 Ga0495625_0248065 Ga0495625_0248065_143_679 168
102 3300046665 Ga0495661_0084273 Ga0495661_0084273_922_1458 168
103 3300046692 Ga0495671_0099466 Ga0495671_0099466_433_969 168
104 3300046810 Ga0495660_0008098 Ga0495660_0008098_5128_5664 168
105 3300047318 Ga0495636_0096439 Ga0495636_0096439_181_717 168
106 3300047323 Ga0495683_0364772 Ga0495683_0364772_49_585 168
107 3300047472 Ga0495686_0002138 Ga0495686_0002138_13187_13723 168
108 3300047472 Ga0495686_0030443 Ga0495686_0030443_188_724 168
109 3300048090 Ga0495615_0120596 Ga0495615_0120596_95_631 168
110 3300049459 Ga0495678_027905 Ga0495678_027905_1223_1759 168
111 3300049459 Ga0495678_073003 Ga0495678_073003_295_831 168
112 3300049589 Ga0501073_0102474 Ga0501073_0102474_660_1196 168
113 3300050489 nmdc:mga03683_14113_c1 nmdc:mga03683_14113_c1_1640_2176 168
114 3300050490 nmdc:mga03n38_77720_c1 nmdc:mga03n38_77720_c1_522_1058 168
115 3300050492 nmdc:mga0yw44_28130_c1 nmdc:mga0yw44_28130_c1_2047_2583 168
116 3300050493 nmdc:mga0k408_6544_c1 nmdc:mga0k408_6544_c1_3306_3842 168
117 3300050494 nmdc:mga06z11_31619_c1 nmdc:mga06z11_31619_c1_1493_2029 168
118 3300050495 nmdc:mga04h51_62452_c1 nmdc:mga04h51_62452_c1_541_1077 168
119 3300050496 nmdc:mga07m45_56391_c1 nmdc:mga07m45_56391_c1_345_881 168
120 3300053086 Ga0500578_0287531 Ga0500578_0287531_305_841 168
121 3300053093 Ga0500651_0188730 Ga0500651_0188730_250_786 168
122 3300053111 Ga0500572_128560 Ga0500572_128560_90_626 168
123 3300053125 Ga0500618_007154 Ga0500618_007154_2169_2705 168
124 3300053134 Ga0500658_0001061 Ga0500658_0001061_2535_3071 168
125 3300053158 Ga0500627_0065278 Ga0500627_0065278_137_673 168
126 3300003187 JGI25151J46595_10003252 JGI25151J46595_100032527 169
127 3300006946 Ga0079104_1001973 Ga0079104_10019735 169
128 3300006948 Ga0099826_10160612 Ga0099826_101606122 169
129 3300009148 Ga0105243_10729429 Ga0105243_107294292 169
130 3300022739 Ga0228711_1000030 Ga0228711_100003012 169
131 3300022740 Ga0228710_1000002 Ga0228710_1000002186 169
132 3300025245 Ga0207425_1014028 Ga0207425_10140282 169
133 3300025258 Ga0209129_1001114 Ga0209129_10011143 169
134 3300025273 Ga0209673_1001845 Ga0209673_100184515 169
135 3300025294 Ga0209025_1000042 Ga0209025_100004288 169
136 3300025297 Ga0209758_1001462 Ga0209758_100146221 169
137 3300025298 Ga0209050_1004678 Ga0209050_10046788 169
138 3300025304 Ga0209257_1002918 Ga0209257_10029183 169
139 3300027111 Ga0209281_1000030 Ga0209281_100003072 169
140 3300027666 Ga0209282_1000004 Ga0209282_100000472 169
141 3300031967 Ga0315914_1000001 Ga0315914_1000001310 169
142 3300033430 Ga0315913_1000022 Ga0315913_100002212 169
143 3300033464 Ga0315915_1000002 Ga0315915_100000273 169
144 3300041411 Ga0439466_0089780 Ga0439466_0089780_85_624 169
145 3300041413 Ga0439465_0260925 Ga0439465_0260925_85_624 169
146 3300041491 Ga0451833_0683899 Ga0451833_0683899_36_575 169
147 3300041501 Ga0451845_0156427 Ga0451845_0156427_36_575 169
148 3300041503 Ga0451847_0888963 Ga0451847_0888963_573_1112 169
149 3300041507 Ga0451851_0539026 Ga0451851_0539026_872_1411 169
150 3300041511 Ga0451855_1436254 Ga0451855_1436254_36_575 169
151 3300042007 Ga0439449_0054121 Ga0439449_0054121_122_661 169
152 3300044765 Ga0466970_0001843 Ga0466970_0001843_5294_5851 169
153 3300049569 Ga0501032_0362992 Ga0501032_0362992_335_874 169
154 3300049570 Ga0501033_0180827 Ga0501033_0180827_569_1108 169
155 3300061719 Ga0466962_0074087 Ga0466962_0074087_575_1132 169
156 3300002739 JGI25158J39367_1000191 JGI25158J39367_100019110 170
157 3300002773 JGI25152J39213_1004374 JGI25152J39213_10043741 170
158 3300002773 JGI25152J39213_1018927 JGI25152J39213_10189272 170
159 3300002774 JGI25150J39212_1018607 JGI25150J39212_10186072 170
160 3300002987 JGI25159J45721_1002910 JGI25159J45721_10029107 170
161 3300003187 JGI25151J46595_10054567 JGI25151J46595_100545672 170
162 3300003215 JGI25153J46596_10029546 JGI25153J46596_100295462 170
163 3300003354 JGI25160J50197_1025547 JGI25160J50197_10255472 170
164 3300003374 JGI25161J50226_1000214 JGI25161J50226_100021410 170
165 3300003578 Ga0006562J51391_1012796 Ga0006562J51391_10127963 170
166 3300003771 Ga0055526_1009954 Ga0055526_10099542 170
167 3300003771 Ga0055526_1013485 Ga0055526_10134853 170
168 3300003775 Ga0055524_1006628 Ga0055524_10066282 170
169 3300003790 Ga0055528_1023092 Ga0055528_10230922 170
170 3300003792 Ga0055540_1020440 Ga0055540_10204402 170
171 3300004625 Ga0055543_1000330 Ga0055543_100033017 170
172 3300005347 Ga0070668_100432186 Ga0070668_1004321862 170
173 3300005548 Ga0070665_100440710 Ga0070665_1004407101 170
174 3300005616 Ga0068852_101020637 Ga0068852_1010206372 170
175 3300006051 Ga0075364_10002563 Ga0075364_1000256310 170
176 3300021320 Ga0214544_1000079 Ga0214544_100007964 170
177 3300021321 Ga0214542_1000064 Ga0214542_100006469 170
178 3300021327 Ga0214543_1000063 Ga0214543_100006343 170
179 3300025208 Ga0209436_100013 Ga0209436_10001361 170
180 3300025245 Ga0207425_1028298 Ga0207425_10282982 170
181 3300025258 Ga0209129_1001662 Ga0209129_10016622 170
182 3300025258 Ga0209129_1002660 Ga0209129_10026601 170
183 3300025273 Ga0209673_1000050 Ga0209673_1000050200 170
184 3300025273 Ga0209673_1001321 Ga0209673_10013214 170
185 3300025273 Ga0209673_1004386 Ga0209673_10043867 170
186 3300025273 Ga0209673_1080572 Ga0209673_10805721 170
187 3300025284 Ga0209130_1000009 Ga0209130_100000962 170
188 3300025294 Ga0209025_1015126 Ga0209025_10151264 170
189 3300025295 Ga0209564_1000227 Ga0209564_100022766 170
190 3300025295 Ga0209564_1000284 Ga0209564_10002842 170
191 3300025297 Ga0209758_1000864 Ga0209758_100086418 170
192 3300025297 Ga0209758_1001412 Ga0209758_100141218 170
193 3300025297 Ga0209758_1003168 Ga0209758_10031686 170
194 3300025299 Ga0209256_1001610 Ga0209256_100161014 170
195 3300025299 Ga0209256_1006504 Ga0209256_10065044 170
196 3300025302 Ga0207426_1000450 Ga0207426_10004502 170
197 3300025303 Ga0209051_1021614 Ga0209051_10216142 170
198 3300025303 Ga0209051_1032327 Ga0209051_10323272 170
199 3300025304 Ga0209257_1032028 Ga0209257_10320282 170
200 3300027866 Ga0209813_10045426 Ga0209813_100454262 170
201 3300028379 Ga0268266_10088034 Ga0268266_100880342 170
202 3300041406 Ga0439439_0031627 Ga0439439_0031627_565_1107 170
203 3300041413 Ga0439465_0021386 Ga0439465_0021386_563_1099 170
204 3300041413 Ga0439465_0047034 Ga0439465_0047034_362_904 170
205 3300041505 Ga0451849_1200051 Ga0451849_1200051_238_774 170
206 3300042007 Ga0439449_0047436 Ga0439449_0047436_892_1434 170
207 3300042015 Ga0439462_0066838 Ga0439462_0066838_180_722 170
208 3300046460 Ga0495638_0000110 Ga0495638_0000110_69655_70239 170
209 3300047472 Ga0495686_0162224 Ga0495686_0162224_700_1236 170
210 3300048919 Ga0496116_0086110 Ga0496116_0086110_866_1402 170
211 3300048919 Ga0496116_0091172 Ga0496116_0091172_103_645 170
212 3300048920 Ga0496117_0006996 Ga0496117_0006996_9957_10496 170
213 3300048920 Ga0496117_0010245 Ga0496117_0010245_5911_6453 170
214 3300048921 Ga0496118_0008237 Ga0496118_0008237_696_1232 170
215 3300048922 Ga0496119_0008844 Ga0496119_0008844_3754_4290 170
216 3300048922 Ga0496119_0070713 Ga0496119_0070713_1214_1753 170
217 3300048922 Ga0496119_0119430 Ga0496119_0119430_153_695 170
218 3300048924 Ga0496121_0000034 Ga0496121_0000034_60800_61342 170
219 3300048925 Ga0496122_0000308 Ga0496122_0000308_68275_68814 170
220 3300048925 Ga0496122_0237697 Ga0496122_0237697_129_665 170
221 3300048925 Ga0496122_0280647 Ga0496122_0280647_79_621 170
222 3300048925 Ga0496122_0383985 Ga0496122_0383985_21_557 170
223 3300048926 Ga0496123_0000066 Ga0496123_0000066_68042_68581 170
224 3300048926 Ga0496123_0033424 Ga0496123_0033424_2742_3278 170
225 3300048927 Ga0496124_0011810 Ga0496124_0011810_5793_6335 170
226 3300048927 Ga0496124_0382986 Ga0496124_0382986_321_857 170
227 3300048928 Ga0496125_0000030 Ga0496125_0000030_313597_314139 170
228 3300048928 Ga0496125_0000288 Ga0496125_0000288_74074_74613 170
229 3300048929 Ga0496126_0150808 Ga0496126_0150808_1149_1685 170
230 3300048929 Ga0496126_0673755 Ga0496126_0673755_240_782 170
231 3300049569 Ga0501032_0250325 Ga0501032_0250325_166_702 170
232 3300050491 nmdc:mga00v17_38122_c1 nmdc:mga00v17_38122_c1_717_1259 170
233 3300053098 Ga0500650_0255796 Ga0500650_0255796_11_583 170
234 3300053139 Ga0500568_0000247 Ga0500568_0000247_27559_28143 170
235 3300053153 Ga0500616_0002118 Ga0500616_0002118_1090_1674 170
236 3300053156 Ga0500622_0045920 Ga0500622_0045920_1615_2151 170
237 3300053158 Ga0500627_0140944 Ga0500627_0140944_227_799 170
238 3300053161 Ga0500634_0000956 Ga0500634_0000956_1149_1694 170
239 3300060353 Ga0501082_0198695 Ga0501082_0198695_652_1188 170
240 3300002739 JGI25158J39367_1000951 JGI25158J39367_10009512 171
241 3300003214 JGI25165J46597_1002402 JGI25165J46597_10024023 171
242 3300003354 JGI25160J50197_1000056 JGI25160J50197_100005672 171
243 3300003374 JGI25161J50226_1000451 JGI25161J50226_10004518 171
244 3300003771 Ga0055526_1005687 Ga0055526_10056873 171
245 3300003775 Ga0055524_1000962 Ga0055524_100096211 171
246 3300003775 Ga0055524_1039657 Ga0055524_10396572 171
247 3300003791 Ga0055530_10025854 Ga0055530_100258542 171
248 3300003794 Ga0055531_10020645 Ga0055531_100206452 171
249 3300004625 Ga0055543_1000383 Ga0055543_100038325 171
250 3300005262 Ga0065165_1000155 Ga0065165_100015573 171
251 3300005347 Ga0070668_100107225 Ga0070668_1001072252 171
252 3300005548 Ga0070665_100039485 Ga0070665_1000394852 171
253 3300005563 Ga0068855_100103757 Ga0068855_1001037573 171
254 3300005578 Ga0068854_100030834 Ga0068854_1000308344 171
255 3300005614 Ga0068856_100502083 Ga0068856_1005020831 171
256 3300005616 Ga0068852_100016523 Ga0068852_1000165234 171
257 3300006038 Ga0075365_10198007 Ga0075365_101980072 171
258 3300006186 Ga0075369_10062604 Ga0075369_100626042 171
259 3300009093 Ga0105240_10000142 Ga0105240_1000014276 171
260 3300009545 Ga0105237_10009587 Ga0105237_100095875 171
261 3300010375 Ga0105239_10070590 Ga0105239_100705902 171
262 3300013102 Ga0157371_10031236 Ga0157371_100312363 171
263 3300013104 Ga0157370_10002835 Ga0157370_1000283519 171
264 3300013105 Ga0157369_10121813 Ga0157369_101218132 171
265 3300013297 Ga0157378_10477533 Ga0157378_104775332 171
266 3300013307 Ga0157372_10085199 Ga0157372_100851994 171
267 3300014497 Ga0182008_10180622 Ga0182008_101806222 171
268 3300015262 Ga0182007_10004127 Ga0182007_100041273 171
269 3300015265 Ga0182005_1003860 Ga0182005_10038603 171
270 3300015683 Ga0183362_10164 Ga0183362_101641 171
271 3300015690 Ga0183363_1129 Ga0183363_112915 171
272 3300025208 Ga0209436_100428 Ga0209436_10042813 171
273 3300025233 Ga0209437_108423 Ga0209437_1084232 171
274 3300025245 Ga0207425_1042326 Ga0207425_10423261 171
275 3300025253 Ga0209677_100353 Ga0209677_10035320 171
276 3300025261 Ga0209233_1000263 Ga0209233_100026326 171
277 3300025284 Ga0209130_1000133 Ga0209130_100013372 171
278 3300025294 Ga0209025_1000536 Ga0209025_100053632 171
279 3300025294 Ga0209025_1043997 Ga0209025_10439972 171
280 3300025295 Ga0209564_1000193 Ga0209564_100019382 171
281 3300025298 Ga0209050_1004888 Ga0209050_10048888 171
282 3300025299 Ga0209256_1000286 Ga0209256_100028610 171
283 3300025299 Ga0209256_1001820 Ga0209256_100182015 171
284 3300025302 Ga0207426_1000248 Ga0207426_100024872 171
285 3300025303 Ga0209051_1019149 Ga0209051_10191493 171
286 3300025304 Ga0209257_1014729 Ga0209257_10147292 171
287 3300025913 Ga0207695_10000234 Ga0207695_1000023477 171
288 3300025914 Ga0207671_10000234 Ga0207671_1000023411 171
289 3300025949 Ga0207667_10078699 Ga0207667_100786993 171
290 3300025972 Ga0207668_10060123 Ga0207668_100601233 171
291 3300026078 Ga0207702_10326585 Ga0207702_103265852 171
292 3300026142 Ga0207698_10025061 Ga0207698_100250612 171
293 3300028379 Ga0268266_10017319 Ga0268266_100173196 171
294 3300046506 Ga0495583_0027839 Ga0495583_0027839_1756_2292 171
295 3300047318 Ga0495636_0072915 Ga0495636_0072915_874_1446 171
296 3300048905 Ga0496102_0006022 Ga0496102_0006022_1516_2073 171
297 3300048916 Ga0496113_0102060 Ga0496113_0102060_1112_1669 171
298 3300048919 Ga0496116_0000057 Ga0496116_0000057_59008_59553 171
299 3300048919 Ga0496116_0096696 Ga0496116_0096696_943_1479 171
300 3300048919 Ga0496116_0150070 Ga0496116_0150070_665_1222 171
301 3300048920 Ga0496117_0004374 Ga0496117_0004374_12881_13438 171
302 3300048920 Ga0496117_0123121 Ga0496117_0123121_567_1112 171
303 3300048921 Ga0496118_0026435 Ga0496118_0026435_2271_2816 171
304 3300048921 Ga0496118_0026767 Ga0496118_0026767_3542_4078 171
305 3300048921 Ga0496118_0027135 Ga0496118_0027135_2782_3339 171
306 3300048922 Ga0496119_0032107 Ga0496119_0032107_1516_2073 171
307 3300048922 Ga0496119_0184720 Ga0496119_0184720_283_828 171
308 3300048923 Ga0496120_0016894 Ga0496120_0016894_75_632 171
309 3300048924 Ga0496121_0003956 Ga0496121_0003956_11339_11896 171
310 3300048925 Ga0496122_0015251 Ga0496122_0015251_5282_5839 171
311 3300048925 Ga0496122_0149017 Ga0496122_0149017_43_588 171
312 3300048925 Ga0496122_0163330 Ga0496122_0163330_97_633 171
313 3300048926 Ga0496123_0005944 Ga0496123_0005944_8139_8696 171
314 3300048926 Ga0496123_0059994 Ga0496123_0059994_654_1190 171
315 3300048926 Ga0496123_0116877 Ga0496123_0116877_406_951 171
316 3300048927 Ga0496124_0018416 Ga0496124_0018416_1638_2195 171
317 3300048927 Ga0496124_0018926 Ga0496124_0018926_5284_5823 171
318 3300048927 Ga0496124_0116297 Ga0496124_0116297_759_1295 171
319 3300048928 Ga0496125_0005090 Ga0496125_0005090_3447_3983 171
320 3300048928 Ga0496125_0071783 Ga0496125_0071783_1551_2108 171
321 3300048928 Ga0496125_0162917 Ga0496125_0162917_515_1054 171
322 3300048929 Ga0496126_0000115 Ga0496126_0000115_59093_59638 171
323 3300048929 Ga0496126_0000258 Ga0496126_0000258_67271_67810 171
324 3300048929 Ga0496126_0098924 Ga0496126_0098924_709_1266 171
325 3300048929 Ga0496126_0100054 Ga0496126_0100054_618_1157 171
326 3300048929 Ga0496126_0137324 Ga0496126_0137324_1113_1670 171
327 3300050492 nmdc:mga0yw44_266127_c1 nmdc:mga0yw44_266127_c1_171_716 171
328 3300050516 nmdc:mga0sz30_34013_c1 nmdc:mga0sz30_34013_c1_193_729 171
329 3300053134 Ga0500658_0080982 Ga0500658_0080982_404_940 171
330 3300053139 Ga0500568_0005405 Ga0500568_0005405_720_1256 171
331 3300053151 Ga0500604_0001019 Ga0500604_0001019_4106_4642 171
332 3300053156 Ga0500622_0000169 Ga0500622_0000169_34804_35340 171
333 3300053160 Ga0500633_0000081 Ga0500633_0000081_10581_11117 171
334 3300053177 Ga0500636_0007591 Ga0500636_0007591_5290_5835 171
335 iso_pu_bacteria 3002141150 3002141752 171
336 3300006051 Ga0075364_10378509 Ga0075364_103785091 172
337 3300006178 Ga0075367_10035020 Ga0075367_100350203 172
338 3300006186 Ga0075369_10000392 Ga0075369_100003928 172
339 3300006353 Ga0075370_10401889 Ga0075370_104018892 172
340 3300013249 Ga0171463_1004 Ga0171463_1004321 172
341 3300030744 Ga0316181_1189592 Ga0316181_11895922 172
342 3300031995 Ga0307409_100101363 Ga0307409_1001013632 172
343 3300041405 Ga0439438_012733 Ga0439438_012733_589_1131 172
344 3300046522 Ga0495643_0031872 Ga0495643_0031872_1479_2015 172
345 3300050491 nmdc:mga00v17_303560_c1 nmdc:mga00v17_303560_c1_261_806 172
346 3300050516 nmdc:mga0sz30_2785_c1 nmdc:mga0sz30_2785_c1_1845_2390 172
347 3300053122 Ga0500608_185677 Ga0500608_185677_185_730 172
348 3300003856 Ga0058692_1014620 Ga0058692_10146201 173
349 3300005347 Ga0070668_100306582 Ga0070668_1003065822 173
350 3300005353 Ga0070669_100115122 Ga0070669_1001151221 173
351 3300005548 Ga0070665_100005296 Ga0070665_10000529614 173
352 3300006042 Ga0075368_10000331 Ga0075368_100003313 173
353 3300006048 Ga0075363_100020723 Ga0075363_1000207232 173
354 3300006177 Ga0075362_10008613 Ga0075362_100086133 173
355 3300006948 Ga0099826_10000813 Ga0099826_100008139 173
356 3300006948 Ga0099826_10069443 Ga0099826_100694432 173
357 3300009148 Ga0105243_10062288 Ga0105243_100622883 173
358 3300011119 Ga0105246_10487897 Ga0105246_104878971 173
359 3300013100 Ga0157373_10013927 Ga0157373_100139273 173
360 3300013102 Ga0157371_10000071 Ga0157371_1000007197 173
361 3300013104 Ga0157370_10000079 Ga0157370_1000007945 173
362 3300025923 Ga0207681_10185327 Ga0207681_101853272 173
363 3300027312 Ga0209371_1001411 Ga0209371_10014117 173
364 3300027666 Ga0209282_1000695 Ga0209282_100069511 173
365 3300028379 Ga0268266_10049742 Ga0268266_100497423 173
366 3300030500 Ga0268256_1001490 Ga0268256_100149011 173
367 3300046558 Ga0495633_0058082 Ga0495633_0058082_388_933 173
368 3300046558 Ga0495633_0110702 Ga0495633_0110702_19_564 173
369 3300046692 Ga0495671_0022537 Ga0495671_0022537_2002_2547 173
370 3300047472 Ga0495686_0072590 Ga0495686_0072590_1399_1938 173
371 3300048919 Ga0496116_0049132 Ga0496116_0049132_825_1370 173
372 3300048920 Ga0496117_0000031 Ga0496117_0000031_322359_322904 173
373 3300048920 Ga0496117_0051336 Ga0496117_0051336_1939_2484 173
374 3300048921 Ga0496118_0000208 Ga0496118_0000208_66760_67305 173
375 3300048922 Ga0496119_0086697 Ga0496119_0086697_562_1107 173
376 3300048923 Ga0496120_0000387 Ga0496120_0000387_50930_51475 173
377 3300048924 Ga0496121_0185447 Ga0496121_0185447_297_842 173
378 3300048925 Ga0496122_0000023 Ga0496122_0000023_322347_322892 173
379 3300048926 Ga0496123_0000027 Ga0496123_0000027_58144_58689 173
380 3300048927 Ga0496124_0000294 Ga0496124_0000294_34635_35180 173
381 3300048927 Ga0496124_0036348 Ga0496124_0036348_2128_2673 173
382 3300048928 Ga0496125_0040784 Ga0496125_0040784_2522_3067 173
383 3300048928 Ga0496125_0447862 Ga0496125_0447862_136_681 173
384 3300050490 nmdc:mga03n38_41352_c1 nmdc:mga03n38_41352_c1_1219_1764 173
385 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_70430_70975 173
386 3300050492 nmdc:mga0yw44_199669_c1 nmdc:mga0yw44_199669_c1_37_582 173
387 3300050495 nmdc:mga04h51_2783_c1 nmdc:mga04h51_2783_c1_2345_2890 173
388 3300050516 nmdc:mga0sz30_735_c1 nmdc:mga0sz30_735_c1_5519_6064 173
389 3300053107 Ga0500560_001162 Ga0500560_001162_2842_3387 173
390 3300053107 Ga0500560_010415 Ga0500560_010415_217_762 173
391 3300053111 Ga0500572_025438 Ga0500572_025438_454_999 173
392 3300053137 Ga0500561_0004664 Ga0500561_0004664_464_1009 173
393 3300053157 Ga0500624_004757 Ga0500624_004757_147_692 173
394 3300053161 Ga0500634_0162178 Ga0500634_0162178_372_917 173
395 3300053177 Ga0500636_0211987 Ga0500636_0211987_69_614 173
396 3300059643 Ga0587072_001339 Ga0587072_001339_1948_2493 173
397 3300002987 JGI25159J45721_1000486 JGI25159J45721_100048614 174
398 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005161 174
399 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011133 174
400 3300004625 Ga0055543_1000041 Ga0055543_100004144 174
401 3300005262 Ga0065165_1000303 Ga0065165_100030313 174
402 3300025284 Ga0209130_1000058 Ga0209130_100005861 174
403 3300025302 Ga0207426_1000131 Ga0207426_100013161 174
404 3300046694 Ga0495649_0109551 Ga0495649_0109551_711_1265 174
405 3300048907 Ga0496104_0309275 Ga0496104_0309275_589_1134 174
406 3300048922 Ga0496119_0026061 Ga0496119_0026061_768_1313 174
407 3300048923 Ga0496120_0056066 Ga0496120_0056066_292_846 174
408 3300048924 Ga0496121_0067785 Ga0496121_0067785_2215_2769 174
409 3300053148 Ga0500590_000271 Ga0500590_000271_4939_5478 174
410 iso_pu_bacteria 2509276021 2509389229 174
411 iso_pu_bacteria 2509276033 2509444792 174
412 iso_pu_bacteria 2510065019 2510135426 174
413 iso_pu_bacteria 2510917028 2511185222 174
414 iso_pu_bacteria 2510917030 2511194250 174
415 iso_pu_bacteria 2513237084 2513572875 174
416 iso_pu_bacteria 2513237085 2513580408 174
417 iso_pu_bacteria 2513237088 2513597843 174
418 iso_pu_bacteria 2513237093 2513634910 174
419 iso_pu_bacteria 2513237103 2513711529 174
420 iso_pu_bacteria 2513237138 2513865122 174
421 iso_pu_bacteria 2515075009 2515114598 174
422 iso_pu_bacteria 2515154113 2515634982 174
423 iso_pu_bacteria 2515154114 2515644454 174
424 iso_pu_bacteria 2515154116 2515660969 174
425 iso_pu_bacteria 2516653077 2517038241 174
426 iso_pu_bacteria 2516653085 2517078519 174
427 iso_pu_bacteria 2517093000 2517097258 174
428 iso_pu_bacteria 2517287029 2517408353 174
429 iso_pu_bacteria 2529292951 2530647176 174
430 iso_pu_bacteria 2534681786 2535485509 174
431 iso_pu_bacteria 2534681796 2535519219 174
432 iso_pu_bacteria 2582581294 2585201545 174
433 iso_pu_bacteria 2582581298 2585224114 174
434 iso_pu_bacteria 2582581299 2585231866 174
435 iso_pu_bacteria 2582581304 2585257168 174
436 iso_pu_bacteria 2582581867 2585399946 174
437 iso_pu_bacteria 2585427528 2585542999 174
438 iso_pu_bacteria 2585427529 2585549814 174
439 iso_pu_bacteria 2585427590 2585821035 174
440 iso_pu_bacteria 2585427593 2585839232 174
441 iso_pu_bacteria 2585427594 2585845068 174
442 iso_pu_bacteria 2643221599 2644002650 174
443 iso_pu_bacteria 2643221634 2644194643 174
444 iso_pu_bacteria 2643221643 2644240308 174
445 iso_pu_bacteria 2718217927 2719387857 174
446 iso_pu_bacteria 2718218365 2721160651 174
447 iso_pu_bacteria 2718218423 2721401490 174
448 iso_pu_bacteria 2721755809 2724040304 174
449 iso_pu_bacteria 2724679232 2725945788 174
450 iso_pu_bacteria 2728369397 2730300283 174
451 iso_pu_bacteria 2738541293 2738801017 174
452 iso_pu_bacteria 2738541333 2739037694 174
453 iso_pu_bacteria 2791355259 2793317954 174
454 iso_pu_bacteria 2791355261 2793329613 174
455 iso_pu_bacteria 2791355264 2793346773 174
456 iso_pu_bacteria 2791355266 2793359199 174
457 iso_pu_bacteria 2791355267 2793366077 174
458 iso_pu_bacteria 2802429633 2806047761 174
459 iso_pu_bacteria 2802429634 2806055337 174
460 iso_pu_bacteria 2802429635 2806062218 174
461 iso_pu_bacteria 2802429636 2806070023 174
462 iso_pu_bacteria 2802429637 2806076677 174
463 iso_pu_bacteria 2838035591 2838042007 174
464 iso_pu_bacteria 2838042994 2838046763 174
465 iso_pu_bacteria 2838661181 2838668142 174
466 iso_pu_bacteria 2838680041 2838683701 174
467 iso_pu_bacteria 2838694306 2838698229 174
468 iso_pu_bacteria 2838707686 2838711344 174
469 iso_pu_bacteria 2841864319 2841867578 174
470 iso_pu_bacteria 2842077413 2842081145 174
471 iso_pu_bacteria 2842118031 2842122078 174
472 iso_pu_bacteria 2842217011 2842221964 174
473 iso_pu_bacteria 2842237096 2842241092 174
474 iso_pu_bacteria 2842291075 2842294802 174
475 iso_pu_bacteria 2842341865 2842346877 174
476 iso_pu_bacteria 2842363717 2842366092 174
477 iso_pu_bacteria 2842370503 2842375180 174
478 iso_pu_bacteria 2842377471 2842381200 174
479 iso_pu_bacteria 2842384541 2842388271 174
480 iso_pu_bacteria 2854911287 2854913707 174
481 iso_pu_bacteria 2857516855 2857519767 174
482 iso_pu_bacteria 2919100787 2919107950 174
483 iso_pu_bacteria 2920760137 2920760210 174
484 iso_pu_bacteria 2923556063 2923559964 174
485 iso_pu_bacteria 2935894831 2935898117 174
486 iso_pu_bacteria 2936367885 2936370085 174
487 iso_pu_bacteria 2936375103 2936379261 174
488 iso_pu_bacteria 2996887358 2996890464 174
489 iso_pu_bacteria 3005409236 3005415967 174
490 iso_pu_bacteria 3005445848 3005449851 174
491 iso_pu_bacteria 3005452660 3005456142 174
492 iso_pu_bacteria 8005258706 8005262651 174
493 iso_pu_bacteria 8005275841 8005282615 174
494 iso_pu_bacteria 8005301065 8005306131 174
495 iso_pu_bacteria 8005321885 8005324991 174
496 iso_pu_bacteria 8005376324 8005381385 174
497 iso_pu_bacteria 8005460587 8005465293 174
498 iso_pu_bacteria 8005542996 8005546876 174
499 iso_pu_bacteria 8005556819 8005561358 174
500 iso_pu_bacteria 8005563573 8005565980 174
501 iso_pu_bacteria 8005688590 8005694172 174
502 iso_pu_bacteria 8018163183 8018164905 174
503 iso_pu_bacteria 8018176218 8018177655 174
504 iso_pu_bacteria 8024479707 8024484555 174
505 iso_pu_bacteria 8057874678 8057879474 174
506 iso_pu_bacteria 2510461069 2510839194 175
507 iso_pu_bacteria 2512047086 2512534742 175
508 iso_pu_bacteria 2513237144 2513912908 175
509 iso_pu_bacteria 2513237146 2513929501 175
510 iso_pu_bacteria 2513237159 2514001714 175
511 iso_pu_bacteria 2558860983 2561468556 175
512 iso_pu_bacteria 2582581283 2585166499 175
513 iso_pu_bacteria 2582581306 2585267180 175
514 iso_pu_bacteria 2582581865 2585388231 175
515 iso_pu_bacteria 2599185170 2599419957 175
516 iso_pu_bacteria 2599185352 2600193980 175
517 iso_pu_bacteria 2617270742 2617382331 175
518 iso_pu_bacteria 2643221557 2643807934 175
519 iso_pu_bacteria 2643221607 2644052447 175
520 iso_pu_bacteria 2643221610 2644068875 175
521 iso_pu_bacteria 2643221618 2644105756 175
522 iso_pu_bacteria 2643221626 2644146360 175
523 iso_pu_bacteria 2643221636 2644201170 175
524 iso_pu_bacteria 2643221655 2644310369 175
525 iso_pu_bacteria 2643221659 2644334846 175
526 iso_pu_bacteria 2643221668 2644378399 175
527 iso_pu_bacteria 2643221675 2644419946 175
528 iso_pu_bacteria 2643221680 2644453302 175
529 iso_pu_bacteria 2643221686 2644484725 175
530 iso_pu_bacteria 2643221688 2644492552 175
531 iso_pu_bacteria 2643221698 2644544960 175
532 iso_pu_bacteria 2643221712 2644615390 175
533 iso_pu_bacteria 2643221723 2644675101 175
534 iso_pu_bacteria 2643221726 2644688671 175
535 iso_pu_bacteria 2690316117 2692319832 175
536 iso_pu_bacteria 2791355091 2792621801 175
537 iso_pu_bacteria 2791355092 2792628942 175
538 iso_pu_bacteria 2791355094 2792640082 175
539 iso_pu_bacteria 2838074704 2838078056 175
540 iso_pu_bacteria 2842521101 2842527063 175
541 iso_pu_bacteria 2844163670 2844168160 175
542 iso_pu_bacteria 2847417321 2847420944 175
543 iso_pu_bacteria 2848992105 2848995775 175
544 iso_pu_bacteria 2855872281 2855873639 175
545 iso_pu_bacteria 2891373044 2891377786 175
546 iso_pu_bacteria 2896384573 2896390081 175
547 iso_pu_bacteria 2920822456 2920826063 175
548 iso_pu_bacteria 2933016740 2933017809 175
549 iso_pu_bacteria 2989349275 2989355079 175
550 iso_pu_bacteria 2989771324 2989771764 175
551 iso_pu_bacteria 3003930520 3003931147 175
552 iso_pu_bacteria 643692032 643827532 175
553 iso_pu_bacteria 8005658619 8005660969 175
554 iso_pu_bacteria 8054558443 8054559968 175
555 3300048914 Ga0496111_0000529 Ga0496111_0000529_10816_11361 176
556 3300048925 Ga0496122_0108993 Ga0496122_0108993_889_1434 176
557 3300048926 Ga0496123_0018773 Ga0496123_0018773_1396_1941 176
558 3300048927 Ga0496124_0001215 Ga0496124_0001215_33522_34067 176
559 3300050490 nmdc:mga03n38_185089_c1 nmdc:mga03n38_185089_c1_425_970 176
560 iso_pu_bacteria 2508501122 2509108856 176
561 iso_pu_bacteria 2510065057 2510305827 176
562 iso_pu_bacteria 2511231052 2511498593 176
563 iso_pu_bacteria 2512875026 2512973446 176
564 iso_pu_bacteria 2513237086 2513586359 176
565 iso_pu_bacteria 2513237089 2513602037 176
566 iso_pu_bacteria 2513237091 2513615826 176
567 iso_pu_bacteria 2513237140 2513885392 176
568 iso_pu_bacteria 2513237143 2513904661 176
569 iso_pu_bacteria 2513237156 2513983491 176
570 iso_pu_bacteria 2513237160 2514003364 176
571 iso_pu_bacteria 2513237162 2514023177 176
572 iso_pu_bacteria 2515154107 2515612427 176
573 iso_pu_bacteria 2515154134 2515741781 176
574 iso_pu_bacteria 2516653046 2516894870 176
575 iso_pu_bacteria 2517487022 2517571551 176
576 iso_pu_bacteria 2519899620 2520379802 176
577 iso_pu_bacteria 2524023207 2524450313 176
578 iso_pu_bacteria 2551306084 2551678464 176
579 iso_pu_bacteria 2551306085 2551685179 176
580 iso_pu_bacteria 2551306086 2551694007 176
581 iso_pu_bacteria 2551306087 2551704505 176
582 iso_pu_bacteria 2551306089 2551710803 176
583 iso_pu_bacteria 2551306090 2551717201 176
584 iso_pu_bacteria 2551306090 2551718199 176
585 iso_pu_bacteria 2551306090 2551720990 176
586 iso_pu_bacteria 2551306091 2551724601 176
587 iso_pu_bacteria 2551306092 2551734495 176
588 iso_pu_bacteria 2551306093 2551740728 176
589 iso_pu_bacteria 2585427526 2585529182 176
590 iso_pu_bacteria 2599185236 2599722643 176
591 iso_pu_bacteria 2615840624 2616297542 176
592 iso_pu_bacteria 2643221637 2644209671 176
593 iso_pu_bacteria 2643221718 2644653199 176
594 iso_pu_bacteria 2718218009 2719733854 176
595 iso_pu_bacteria 2718218199 2720493897 176
596 iso_pu_bacteria 2718218363 2721149249 176
597 iso_pu_bacteria 2718218366 2721166062 176
598 iso_pu_bacteria 2721755514 2722842232 176
599 iso_pu_bacteria 2721755556 2723028796 176
600 iso_pu_bacteria 2721755810 2724046610 176
601 iso_pu_bacteria 2721755823 2724112177 176
602 iso_pu_bacteria 2728369352 2730109732 176
603 iso_pu_bacteria 2728369365 2730166372 176
604 iso_pu_bacteria 2765235942 2766064077 176
605 iso_pu_bacteria 2791355256 2793295456 176
606 iso_pu_bacteria 2791355260 2793324570 176
607 iso_pu_bacteria 2791355263 2793339003 176
608 iso_pu_bacteria 2791355265 2793356789 176
609 iso_pu_bacteria 2802428858 2802717083 176
610 iso_pu_bacteria 2802428859 2802724929 176
611 iso_pu_bacteria 2802428860 2802729679 176
612 iso_pu_bacteria 2802428861 2802737025 176
613 iso_pu_bacteria 2802428862 2802743430 176
614 iso_pu_bacteria 2802428863 2802749444 176
615 iso_pu_bacteria 2802429605 2805930916 176
616 iso_pu_bacteria 2802429606 2805936765 176
617 iso_pu_bacteria 2838016132 2838018149 176
618 iso_pu_bacteria 2838022645 2838023829 176
619 iso_pu_bacteria 2838048938 2838050992 176
620 iso_pu_bacteria 2838061910 2838062758 176
621 iso_pu_bacteria 2838068647 2838072303 176
622 iso_pu_bacteria 2838668709 2838674236 176
623 iso_pu_bacteria 2838686498 2838693352 176
624 iso_pu_bacteria 2838701080 2838706639 176
625 iso_pu_bacteria 2838729681 2838735346 176
626 iso_pu_bacteria 2838742623 2838748105 176
627 iso_pu_bacteria 2841851746 2841857418 176
628 iso_pu_bacteria 2842110456 2842116603 176
629 iso_pu_bacteria 2842146304 2842148968 176
630 iso_pu_bacteria 2842156927 2842162407 176
631 iso_pu_bacteria 2842163707 2842166892 176
632 iso_pu_bacteria 2842180545 2842186047 176
633 iso_pu_bacteria 2842192696 2842194711 176
634 iso_pu_bacteria 2842198810 2842201184 176
635 iso_pu_bacteria 2842205361 2842207590 176
636 iso_pu_bacteria 2842229732 2842235506 176
637 iso_pu_bacteria 2842243621 2842249211 176
638 iso_pu_bacteria 2842250916 2842256430 176
639 iso_pu_bacteria 2842257432 2842263166 176
640 iso_pu_bacteria 2842264693 2842269269 176
641 iso_pu_bacteria 2842271015 2842277820 176
642 iso_pu_bacteria 2842278818 2842280699 176
643 iso_pu_bacteria 2842285085 2842290355 176
644 iso_pu_bacteria 2842304105 2842305637 176
645 iso_pu_bacteria 2842311132 2842311595 176
646 iso_pu_bacteria 2842317721 2842323655 176
647 iso_pu_bacteria 2842395702 2842395761 176
648 iso_pu_bacteria 2842402390 2842408189 176
649 iso_pu_bacteria 2842409023 2842414951 176
650 iso_pu_bacteria 2842415677 2842421540 176
651 iso_pu_bacteria 2842422224 2842425935 176
652 iso_pu_bacteria 2842428310 2842433447 176
653 iso_pu_bacteria 2842434925 2842439498 176
654 iso_pu_bacteria 2842441272 2842446194 176
655 iso_pu_bacteria 2842447887 2842448567 176
656 iso_pu_bacteria 2842462802 2842467696 176
657 iso_pu_bacteria 2842469257 2842474340 176
658 iso_pu_bacteria 2842482326 2842485288 176
659 iso_pu_bacteria 2842489311 2842491347 176
660 iso_pu_bacteria 2842495871 2842501918 176
661 iso_pu_bacteria 2844454524 2844456799 176
662 iso_pu_bacteria 2855825444 2855827504 176
663 iso_pu_bacteria 2855839649 2855842879 176
664 iso_pu_bacteria 2858800743 2858803557 176
665 iso_pu_bacteria 2913295892 2913300291 176
666 iso_pu_bacteria 2915980308 2915981708 176
667 iso_pu_bacteria 2915986958 2915991915 176
668 iso_pu_bacteria 2915993759 2915999562 176
669 iso_pu_bacteria 2916000859 2916004470 176
670 iso_pu_bacteria 2916007675 2916013446 176
671 iso_pu_bacteria 2916014648 2916019870 176
672 iso_pu_bacteria 2916021584 2916023936 176
673 iso_pu_bacteria 2916028427 2916031861 176
674 iso_pu_bacteria 2916035215 2916040502 176
675 iso_pu_bacteria 2916041962 2916043435 176
676 iso_pu_bacteria 2916048683 2916050640 176
677 iso_pu_bacteria 2916055098 2916058696 176
678 iso_pu_bacteria 2916061851 2916066479 176
679 iso_pu_bacteria 2916068649 2916074693 176
680 iso_pu_bacteria 2916076590 2916082578 176
681 iso_pu_bacteria 2921201388 2921205063 176
682 iso_pu_bacteria 2921208531 2921212025 176
683 iso_pu_bacteria 2921237296 2921240351 176
684 iso_pu_bacteria 2921244191 2921245626 176
685 iso_pu_bacteria 2921250672 2921252797 176
686 iso_pu_bacteria 2921257292 2921260436 176
687 iso_pu_bacteria 2921263974 2921267520 176
688 iso_pu_bacteria 2921282425 2921287327 176
689 iso_pu_bacteria 2921289301 2921293985 176
690 iso_pu_bacteria 2921296804 2921302348 176
691 iso_pu_bacteria 2924144063 2924144814 176
692 iso_pu_bacteria 2924150972 2924157665 176
693 iso_pu_bacteria 2924158325 2924158777 176
694 iso_pu_bacteria 2924165586 2924168521 176
695 iso_pu_bacteria 2924172951 2924175803 176
696 iso_pu_bacteria 2924179722 2924183462 176
697 iso_pu_bacteria 2924186466 2924190209 176
698 iso_pu_bacteria 2924193448 2924193480 176
699 iso_pu_bacteria 2924200457 2924201451 176
700 iso_pu_bacteria 2924207177 2924207795 176
701 iso_pu_bacteria 2924214083 2924214885 176
702 iso_pu_bacteria 2924221636 2924227138 176
703 iso_pu_bacteria 2924228884 2924234031 176
704 iso_pu_bacteria 2929138655 2929142007 176
705 iso_pu_bacteria 2933570622 2933572144 176
706 iso_pu_bacteria 2933586486 2933592791 176
707 iso_pu_bacteria 2933599457 2933602845 176
708 iso_pu_bacteria 2935901341 2935903441 176
709 iso_pu_bacteria 2936381700 2936381762 176
710 iso_pu_bacteria 2936996657 2936997441 176
711 iso_pu_bacteria 2937002841 2937004095 176
712 iso_pu_bacteria 2937009748 2937010368 176
713 iso_pu_bacteria 2937016420 2937020640 176
714 iso_pu_bacteria 2937023124 2937023171 176
715 iso_pu_bacteria 2937029754 2937031720 176
716 iso_pu_bacteria 2937036028 2937037787 176
717 iso_pu_bacteria 2937042894 2937043161 176
718 iso_pu_bacteria 2937049772 2937055211 176
719 iso_pu_bacteria 2937056579 2937059368 176
720 iso_pu_bacteria 2937063883 2937070504 176
721 iso_pu_bacteria 2937071275 2937076112 176
722 iso_pu_bacteria 2937078374 2937081495 176
723 iso_pu_bacteria 2937084907 2937090873 176
724 iso_pu_bacteria 2937091812 2937093351 176
725 iso_pu_bacteria 2937098957 2937104322 176
726 iso_pu_bacteria 2937106411 2937113249 176
727 iso_pu_bacteria 2937113482 2937114249 176
728 iso_pu_bacteria 2937119839 2937120247 176
729 iso_pu_bacteria 2937126314 2937129772 176
730 iso_pu_bacteria 2957375807 2957376787 176
731 iso_pu_bacteria 2957382221 2957384916 176
732 iso_pu_bacteria 2957388812 2957395191 176
733 iso_pu_bacteria 2957395598 2957399714 176
734 iso_pu_bacteria 2957402308 2957405542 176
735 iso_pu_bacteria 2957408893 2957411707 176
736 iso_pu_bacteria 2957415311 2957417464 176
737 iso_pu_bacteria 2957422303 2957422371 176
738 iso_pu_bacteria 2957430029 2957430085 176
739 iso_pu_bacteria 2957437181 2957441675 176
740 iso_pu_bacteria 2957443900 2957447644 176
741 iso_pu_bacteria 2957450854 2957454672 176
742 iso_pu_bacteria 2957457609 2957461005 176
743 iso_pu_bacteria 2957464669 2957466502 176
744 iso_pu_bacteria 2957471148 2957475388 176
745 iso_pu_bacteria 2957478035 2957481446 176
746 iso_pu_bacteria 2957484790 2957489078 176
747 iso_pu_bacteria 2957491536 2957494428 176
748 iso_pu_bacteria 2957498199 2957505167 176
749 iso_pu_bacteria 2957505466 2957508273 176
750 iso_pu_bacteria 2960584000 2960589440 176
751 iso_pu_bacteria 2960591022 2960592805 176
752 iso_pu_bacteria 2960597568 2960597892 176
753 iso_pu_bacteria 2960603979 2960607484 176
754 iso_pu_bacteria 2960610863 2960613672 176
755 iso_pu_bacteria 2960617483 2960619086 176
756 iso_pu_bacteria 2960624210 2960629067 176
757 iso_pu_bacteria 2960631154 2960634202 176
758 iso_pu_bacteria 2960637947 2960643578 176
759 iso_pu_bacteria 2960645483 2960650711 176
760 iso_pu_bacteria 2960652885 2960655919 176
761 iso_pu_bacteria 2960660292 2960663975 176
762 iso_pu_bacteria 2960667422 2960673294 176
763 iso_pu_bacteria 2960674078 2960674877 176
764 iso_pu_bacteria 2960680706 2960681730 176
765 iso_pu_bacteria 2960687367 2960689330 176
766 iso_pu_bacteria 2960693952 2960700656 176
767 iso_pu_bacteria 2964607997 2964608220 176
768 iso_pu_bacteria 2964615318 2964621664 176
769 iso_pu_bacteria 2964621998 2964625836 176
770 iso_pu_bacteria 2964628898 2964629539 176
771 iso_pu_bacteria 2964636051 2964639228 176
772 iso_pu_bacteria 2964643177 2964643603 176
773 iso_pu_bacteria 2964649959 2964655207 176
774 iso_pu_bacteria 2964656573 2964659984 176
775 iso_pu_bacteria 2964663802 2964669405 176
776 iso_pu_bacteria 2964670856 2964676861 176
777 iso_pu_bacteria 2964678106 2964681674 176
778 iso_pu_bacteria 2964685014 2964687458 176
779 iso_pu_bacteria 2964691889 2964695147 176
780 iso_pu_bacteria 2964698721 2964699165 176
781 iso_pu_bacteria 2964705432 2964711198 176
782 iso_pu_bacteria 2964712639 2964712654 176
783 iso_pu_bacteria 2964719344 2964719775 176
784 iso_pu_bacteria 2967664464 2967668263 176
785 iso_pu_bacteria 2967671571 2967675612 176
786 iso_pu_bacteria 2967678726 2967681253 176
787 iso_pu_bacteria 2967686174 2967692422 176
788 iso_pu_bacteria 2967693043 2967699404 176
789 iso_pu_bacteria 2967699805 2967704818 176
790 iso_pu_bacteria 2967706974 2967713020 176
791 iso_pu_bacteria 2967714385 2967721201 176
792 iso_pu_bacteria 2967721400 2967724957 176
793 iso_pu_bacteria 2967728569 2967731837 176
794 iso_pu_bacteria 2967735183 2967738468 176
795 iso_pu_bacteria 2967742019 2967745465 176
796 iso_pu_bacteria 2967748971 2967752611 176
797 iso_pu_bacteria 2967755722 2967757752 176
798 iso_pu_bacteria 2967762386 2967765791 176
799 iso_pu_bacteria 2967769361 2967770341 176
800 iso_pu_bacteria 2967775926 2967780510 176
801 iso_pu_bacteria 2970019648 2970021994 176
802 iso_pu_bacteria 2970026789 2970028673 176
803 iso_pu_bacteria 2970033650 2970038978 176
804 iso_pu_bacteria 2970040964 2970046604 176
805 iso_pu_bacteria 2970047711 2970049619 176
806 iso_pu_bacteria 2970054988 2970058831 176
807 iso_pu_bacteria 2970061556 2970066755 176
808 iso_pu_bacteria 2970068827 2970071179 176
809 iso_pu_bacteria 2970076120 2970076713 176
810 iso_pu_bacteria 2970082768 2970086754 176
811 iso_pu_bacteria 2970088815 2970092738 176
812 iso_pu_bacteria 2970095765 2970101176 176
813 iso_pu_bacteria 2970102677 2970104606 176
814 iso_pu_bacteria 2970109326 2970113932 176
815 iso_pu_bacteria 2970116247 2970118379 176
816 iso_pu_bacteria 2970122695 2970124501 176
817 iso_pu_bacteria 2970129317 2970133517 176
818 iso_pu_bacteria 2970136068 2970140888 176
819 iso_pu_bacteria 2970143518 2970147340 176
820 iso_pu_bacteria 2970149975 2970155846 176
821 iso_pu_bacteria 2970156795 2970161189 176
822 iso_pu_bacteria 2970164137 2970170750 176
823 iso_pu_bacteria 2970170962 2970174083 176
824 iso_pu_bacteria 2970177841 2970182113 176
825 iso_pu_bacteria 2970184632 2970189134 176
826 iso_pu_bacteria 2970191845 2970197908 176
827 iso_pu_bacteria 2977516862 2977520213 176
828 iso_pu_bacteria 2977523885 2977527402 176
829 iso_pu_bacteria 2977530762 2977531205 176
830 iso_pu_bacteria 2977537788 2977544465 176
831 iso_pu_bacteria 2977544691 2977547144 176
832 iso_pu_bacteria 2977551784 2977558007 176
833 iso_pu_bacteria 2977558990 2977564718 176
834 iso_pu_bacteria 2977565890 2977571317 176
835 iso_pu_bacteria 2977572785 2977577251 176
836 iso_pu_bacteria 2977579622 2977583338 176
837 iso_pu_bacteria 2996893221 2996896204 176
838 iso_pu_bacteria 639633055 639650618 176
839 iso_pu_bacteria 648276728 648737313 176
840 iso_pu_bacteria 8003992118 8003995460 176
841 iso_pu_bacteria 8003999396 8004003219 176
842 iso_pu_bacteria 8005282627 8005286570 176
843 iso_pu_bacteria 8005289223 8005291992 176
844 iso_pu_bacteria 8005307578 8005309705 176
845 iso_pu_bacteria 8005382845 8005387595 176
846 iso_pu_bacteria 8005395548 8005398431 176
847 iso_pu_bacteria 8005430974 8005431968 176
848 iso_pu_bacteria 8005497431 8005497871 176
849 iso_pu_bacteria 8005570704 8005572029 176
850 iso_pu_bacteria 8005619151 8005623605 176
851 iso_pu_bacteria 8005626139 8005630834 176
852 iso_pu_bacteria 8005668836 8005669277 176
853 iso_pu_bacteria 8005695170 8005695818 176
854 iso_pu_bacteria 8018127388 8018128663 176
855 iso_pu_bacteria 8023680758 8023686736 176
856 iso_pu_bacteria 8024501048 8024504028 176
857 iso_pu_bacteria 8056375014 8056380589 176
858 iso_pu_bacteria 8056382006 8056383351 176
859 iso_pu_bacteria 2510917026 2511168433 177
860 iso_pu_bacteria 2554235003 2554248995 177
861 iso_pu_bacteria 2558860242 2559296083 177
862 iso_pu_bacteria 2582581308 2585279625 177
863 iso_pu_bacteria 2582581315 2585327462 177
864 iso_pu_bacteria 2582581316 2585333999 177
865 iso_pu_bacteria 2585427527 2585535704 177
866 iso_pu_bacteria 2585427530 2585551082 177
867 iso_pu_bacteria 2599185210 2599603124 177
868 iso_pu_bacteria 2600255279 2601610971 177
869 iso_pu_bacteria 2600255308 2601747745 177
870 iso_pu_bacteria 2615840626 2616306412 177
871 iso_pu_bacteria 2615840698 2616551100 177
872 iso_pu_bacteria 2643221568 2643854817 177
873 iso_pu_bacteria 2643221693 2644521661 177
874 iso_pu_bacteria 2667528174 2671116021 177
875 iso_pu_bacteria 2775507049 2776915666 177
876 iso_pu_bacteria 2775507266 2778179224 177
877 iso_pu_bacteria 2818991448 2819611980 177
878 iso_pu_bacteria 2818991453 2819638480 177
879 iso_pu_bacteria 2838029111 2838034127 177
880 iso_pu_bacteria 2838675328 2838678536 177
881 iso_pu_bacteria 2838714209 2838718376 177
882 iso_pu_bacteria 2838719591 2838722832 177
883 iso_pu_bacteria 2838724970 2838728442 177
884 iso_pu_bacteria 2841846520 2841850388 177
885 iso_pu_bacteria 2841859092 2841863359 177
886 iso_pu_bacteria 2842124991 2842129102 177
887 iso_pu_bacteria 2842130223 2842133429 177
888 iso_pu_bacteria 2842152218 2842155660 177
889 iso_pu_bacteria 2842170452 2842174382 177
890 iso_pu_bacteria 2842175837 2842179043 177
891 iso_pu_bacteria 2842187318 2842190800 177
892 iso_pu_bacteria 2842211629 2842214876 177
893 iso_pu_bacteria 2842224351 2842227597 177
894 iso_pu_bacteria 2842475841 2842480905 177
895 iso_pu_bacteria 2842502639 2842507484 177
896 iso_pu_bacteria 2842509118 2842514684 177
897 iso_pu_bacteria 2842515876 2842519904 177
898 iso_pu_bacteria 2899792073 2899794813 177
899 iso_pu_bacteria 2899845264 2899849434 177
900 iso_pu_bacteria 2919114240 2919118367 177
901 iso_pu_bacteria 2919166419 2919170453 177
902 iso_pu_bacteria 2919171160 2919176878 177
903 iso_pu_bacteria 2919408235 2919411461 177
904 iso_pu_bacteria 2926754445 2926754896 177
905 iso_pu_bacteria 2926760298 2926762061 177
906 iso_pu_bacteria 2933006813 2933010494 177
907 iso_pu_bacteria 2933011516 2933015834 177
908 iso_pu_bacteria 2933594066 2933597428 177
909 iso_pu_bacteria 2978969890 2978972751 177
910 iso_pu_bacteria 2979089926 2979092670 177
911 iso_pu_bacteria 2979095461 2979099939 177
912 iso_pu_bacteria 2984587000 2984591003 177
913 iso_pu_bacteria 3005416602 3005416881 177
914 iso_pu_bacteria 650716007 650741299 177
915 iso_pu_bacteria 8003570095 8003573639 177
916 iso_pu_bacteria 8005314921 8005315915 177
917 iso_pu_bacteria 8005484373 8005487002 177
918 iso_pu_bacteria 8005645114 8005645199 177
919 iso_pu_bacteria 8005682033 8005687355 177
920 iso_pu_bacteria 8054460903 8054463891 177
921 3300002773 JGI25152J39213_1000169 JGI25152J39213_100016922 178
922 3300002773 JGI25152J39213_1000820 JGI25152J39213_100082012 178
923 3300002774 JGI25150J39212_1000018 JGI25150J39212_100001853 178
924 3300003187 JGI25151J46595_10000034 JGI25151J46595_10000034125 178
925 3300003215 JGI25153J46596_10002149 JGI25153J46596_100021499 178
926 3300003354 JGI25160J50197_1008846 JGI25160J50197_10088462 178
927 3300003771 Ga0055526_1017527 Ga0055526_10175273 178
928 3300003775 Ga0055524_1049246 Ga0055524_10492462 178
929 3300003775 Ga0055524_1049366 Ga0055524_10493661 178
930 3300003790 Ga0055528_1010175 Ga0055528_10101754 178
931 3300003792 Ga0055540_1008997 Ga0055540_10089975 178
932 3300003794 Ga0055531_10001167 Ga0055531_100011673 178
933 3300005347 Ga0070668_100008156 Ga0070668_1000081565 178
934 3300005844 Ga0068862_100188269 Ga0068862_1001882692 178
935 3300006038 Ga0075365_10001383 Ga0075365_100013839 178
936 3300006048 Ga0075363_100292366 Ga0075363_1002923662 178
937 3300006177 Ga0075362_10051857 Ga0075362_100518572 178
938 3300006178 Ga0075367_10000616 Ga0075367_1000061615 178
939 3300006186 Ga0075369_10010550 Ga0075369_100105505 178
940 3300006946 Ga0079104_1000310 Ga0079104_100031026 178
941 3300009011 Ga0105251_10004120 Ga0105251_100041204 178
942 3300009092 Ga0105250_10012077 Ga0105250_100120772 178
943 3300009101 Ga0105247_10032017 Ga0105247_100320173 178
944 3300009177 Ga0105248_10041973 Ga0105248_100419734 178
945 3300009766 Ga0123342_1006148 Ga0123342_10061482 178
946 3300010375 Ga0105239_10434691 Ga0105239_104346912 178
947 3300011119 Ga0105246_10118809 Ga0105246_101188092 178
948 3300013104 Ga0157370_10552230 Ga0157370_105522302 178
949 3300025245 Ga0207425_1000035 Ga0207425_1000035148 178
950 3300025245 Ga0207425_1033815 Ga0207425_10338152 178
951 3300025258 Ga0209129_1000029 Ga0209129_1000029148 178
952 3300025258 Ga0209129_1000826 Ga0209129_100082612 178
953 3300025273 Ga0209673_1001329 Ga0209673_100132929 178
954 3300025273 Ga0209673_1024489 Ga0209673_10244891 178
955 3300025284 Ga0209130_1021959 Ga0209130_10219592 178
956 3300025292 Ga0209676_1012855 Ga0209676_10128552 178
957 3300025294 Ga0209025_1000132 Ga0209025_100013258 178
958 3300025294 Ga0209025_1008730 Ga0209025_10087304 178
959 3300025295 Ga0209564_1004168 Ga0209564_10041688 178
960 3300025295 Ga0209564_1028940 Ga0209564_10289401 178
961 3300025297 Ga0209758_1000299 Ga0209758_100029937 178
962 3300025297 Ga0209758_1000406 Ga0209758_100040649 178
963 3300025297 Ga0209758_1041997 Ga0209758_10419971 178
964 3300025298 Ga0209050_1017307 Ga0209050_10173073 178
965 3300025299 Ga0209256_1017619 Ga0209256_10176192 178
966 3300025299 Ga0209256_1020044 Ga0209256_10200441 178
967 3300025302 Ga0207426_1000682 Ga0207426_100068224 178
968 3300025303 Ga0209051_1000547 Ga0209051_10005472 178
969 3300025303 Ga0209051_1004006 Ga0209051_10040067 178
970 3300025304 Ga0209257_1006107 Ga0209257_10061072 178
971 3300025900 Ga0207710_10131335 Ga0207710_101313352 178
972 3300025903 Ga0207680_10266370 Ga0207680_102663702 178
973 3300025904 Ga0207647_10063583 Ga0207647_100635832 178
974 3300025931 Ga0207644_10050498 Ga0207644_100504982 178
975 3300026067 Ga0207678_10072706 Ga0207678_100727062 178
976 3300027111 Ga0209281_1000028 Ga0209281_1000028245 178
977 3300031901 Ga0307406_10004352 Ga0307406_100043526 178
978 3300031911 Ga0307412_10000412 Ga0307412_1000041213 178
979 3300046492 Ga0495585_0028682 Ga0495585_0028682_1256_1792 178
980 3300046506 Ga0495583_0009155 Ga0495583_0009155_5261_5797 178
981 3300046515 Ga0495620_0038973 Ga0495620_0038973_1259_1795 178
982 3300046523 Ga0495644_0329723 Ga0495644_0329723_41_577 178
983 3300046524 Ga0495648_0214502 Ga0495648_0214502_259_795 178
984 3300046665 Ga0495661_0177524 Ga0495661_0177524_474_1010 178
985 3300046674 Ga0495588_0359925 Ga0495588_0359925_193_729 178
986 3300047443 Ga0495687_057994 Ga0495687_057994_433_969 178
987 3300047470 Ga0495681_0039594 Ga0495681_0039594_1154_1690 178
988 3300048090 Ga0495615_0063006 Ga0495615_0063006_334_870 178
989 3300048903 Ga0496100_0507011 Ga0496100_0507011_299_835 178
990 3300048904 Ga0496101_0150338 Ga0496101_0150338_172_708 178
991 3300048904 Ga0496101_0155654 Ga0496101_0155654_1145_1681 178
992 3300048904 Ga0496101_0178948 Ga0496101_0178948_835_1371 178
993 3300048905 Ga0496102_0041154 Ga0496102_0041154_993_1529 178
994 3300048906 Ga0496103_0091095 Ga0496103_0091095_1136_1672 178
995 3300048907 Ga0496104_0023303 Ga0496104_0023303_1096_1632 178
996 3300048908 Ga0496105_0022420 Ga0496105_0022420_4340_4876 178
997 3300048909 Ga0496106_0095281 Ga0496106_0095281_296_832 178
998 3300048910 Ga0496107_0147598 Ga0496107_0147598_936_1472 178
999 3300048911 Ga0496108_0198734 Ga0496108_0198734_565_1101 178
1000 3300048913 Ga0496110_0026155 Ga0496110_0026155_4193_4729 178
1001 3300048914 Ga0496111_0049930 Ga0496111_0049930_237_773 178
1002 3300048916 Ga0496113_0024324 Ga0496113_0024324_416_952 178
1003 3300048919 Ga0496116_0002951 Ga0496116_0002951_5587_6123 178
1004 3300048919 Ga0496116_0004307 Ga0496116_0004307_902_1438 178
1005 3300048919 Ga0496116_0030549 Ga0496116_0030549_902_1438 178
1006 3300048919 Ga0496116_0053282 Ga0496116_0053282_300_836 178
1007 3300048920 Ga0496117_0005859 Ga0496117_0005859_11079_11615 178
1008 3300048920 Ga0496117_0197772 Ga0496117_0197772_193_729 178
1009 3300048921 Ga0496118_0008792 Ga0496118_0008792_9178_9714 178
1010 3300048921 Ga0496118_0327999 Ga0496118_0327999_24_560 178
1011 3300048922 Ga0496119_0015539 Ga0496119_0015539_5056_5592 178
1012 3300048922 Ga0496119_0120155 Ga0496119_0120155_607_1143 178
1013 3300048923 Ga0496120_0230012 Ga0496120_0230012_44_580 178
1014 3300048924 Ga0496121_0006665 Ga0496121_0006665_8300_8836 178
1015 3300048924 Ga0496121_0011216 Ga0496121_0011216_1153_1689 178
1016 3300048924 Ga0496121_0124164 Ga0496121_0124164_237_773 178
1017 3300048924 Ga0496121_0149267 Ga0496121_0149267_68_604 178
1018 3300048924 Ga0496121_0225027 Ga0496121_0225027_383_931 178
1019 3300048925 Ga0496122_0009867 Ga0496122_0009867_9302_9838 178
1020 3300048925 Ga0496122_0015840 Ga0496122_0015840_1152_1688 178
1021 3300048925 Ga0496122_0019377 Ga0496122_0019377_5335_5871 178
1022 3300048925 Ga0496122_0041403 Ga0496122_0041403_2873_3409 178
1023 3300048926 Ga0496123_0004280 Ga0496123_0004280_6375_6911 178
1024 3300048926 Ga0496123_0051392 Ga0496123_0051392_494_1030 178
1025 3300048926 Ga0496123_0071116 Ga0496123_0071116_1003_1539 178
1026 3300048926 Ga0496123_0098834 Ga0496123_0098834_17_553 178
1027 3300048926 Ga0496123_0206756 Ga0496123_0206756_17_553 178
1028 3300048927 Ga0496124_0003574 Ga0496124_0003574_17215_17751 178
1029 3300048927 Ga0496124_0019169 Ga0496124_0019169_5567_6103 178
1030 3300048927 Ga0496124_0027404 Ga0496124_0027404_1834_2370 178
1031 3300048927 Ga0496124_0031109 Ga0496124_0031109_3075_3611 178
1032 3300048927 Ga0496124_0196710 Ga0496124_0196710_838_1374 178
1033 3300048927 Ga0496124_0219698 Ga0496124_0219698_145_681 178
1034 3300048927 Ga0496124_0228190 Ga0496124_0228190_285_821 178
1035 3300048928 Ga0496125_0004702 Ga0496125_0004702_9340_9876 178
1036 3300048928 Ga0496125_0038337 Ga0496125_0038337_300_836 178
1037 3300048929 Ga0496126_0024648 Ga0496126_0024648_303_839 178
1038 3300048929 Ga0496126_0145376 Ga0496126_0145376_599_1135 178
1039 3300049460 Ga0495682_0078250 Ga0495682_0078250_245_781 178
1040 3300050491 nmdc:mga00v17_532523_c1 nmdc:mga00v17_532523_c1_123_659 178
1041 3300050492 nmdc:mga0yw44_71493_c1 nmdc:mga0yw44_71493_c1_1443_1979 178
1042 3300050494 nmdc:mga06z11_105349_c1 nmdc:mga06z11_105349_c1_953_1489 178
1043 3300050496 nmdc:mga07m45_337836_c1 nmdc:mga07m45_337836_c1_247_783 178
1044 3300050516 nmdc:mga0sz30_17657_c1 nmdc:mga0sz30_17657_c1_476_1012 178
1045 3300050516 nmdc:mga0sz30_259983_c1 nmdc:mga0sz30_259983_c1_181_717 178
1046 3300053105 Ga0500557_063612 Ga0500557_063612_449_985 178
1047 3300053153 Ga0500616_0000448 Ga0500616_0000448_18413_18958 178
1048 3300053153 Ga0500616_0016144 Ga0500616_0016144_3696_4232 178
1049 iso_pu_bacteria 2821123053 2821129202 178
1050 iso_pu_bacteria 2838736955 2838742219 178
1051 iso_pu_bacteria 2841840854 2841846075 178
1052 iso_pu_bacteria 2842140634 2842145779 178
1053 iso_pu_bacteria 2857531043 2857536143 178
1054 3300009036 Ga0105244_10101027 Ga0105244_101010272 179
1055 3300028794 Ga0307515_10069879 Ga0307515_100698793 179
1056 3300031548 Ga0307408_100028873 Ga0307408_1000288732 179
1057 3300031911 Ga0307412_10155397 Ga0307412_101553971 179
1058 3300032004 Ga0307414_10153173 Ga0307414_101531732 179
1059 3300033180 Ga0307510_10295522 Ga0307510_102955222 179
1060 3300041413 Ga0439465_0021382 Ga0439465_0021382_608_1147 179
1061 3300042007 Ga0439449_0118555 Ga0439449_0118555_52_591 179
1062 3300042015 Ga0439462_0035578 Ga0439462_0035578_35_574 179
1063 3300042131 Ga0450894_028395 Ga0450894_028395_212_751 179
1064 3300042145 Ga0450906_003057 Ga0450906_003057_1919_2458 179
1065 3300042185 Ga0450909_018620 Ga0450909_018620_68_607 179
1066 3300042435 Ga0439434_0063586 Ga0439434_0063586_582_1121 179
1067 3300046462 Ga0495651_0255648 Ga0495651_0255648_185_724 179
1068 3300046471 Ga0495650_0070595 Ga0495650_0070595_161_700 179
1069 3300046476 Ga0495662_0002722 Ga0495662_0002722_8371_8910 179
1070 3300046507 Ga0495606_0001343 Ga0495606_0001343_2965_3504 179
1071 3300046524 Ga0495648_0113237 Ga0495648_0113237_686_1225 179
1072 3300046529 Ga0495652_0262856 Ga0495652_0262856_398_937 179
1073 3300046557 Ga0495622_0023390 Ga0495622_0023390_1377_1916 179
1074 3300046660 Ga0495625_0013089 Ga0495625_0013089_883_1422 179
1075 3300046690 Ga0495624_0119154 Ga0495624_0119154_895_1434 179
1076 3300046809 Ga0495600_0131244 Ga0495600_0131244_293_832 179
1077 3300047317 Ga0495604_0026659 Ga0495604_0026659_604_1143 179
1078 3300047472 Ga0495686_0097709 Ga0495686_0097709_178_717 179
1079 3300047472 Ga0495686_0153621 Ga0495686_0153621_186_725 179
1080 3300048903 Ga0496100_1186344 Ga0496100_1186344_33_572 179
1081 3300048920 Ga0496117_0289550 Ga0496117_0289550_303_842 179
1082 3300048925 Ga0496122_0069645 Ga0496122_0069645_37_576 179
1083 3300048928 Ga0496125_0228186 Ga0496125_0228186_556_1095 179
1084 3300048929 Ga0496126_0557761 Ga0496126_0557761_194_751 179
1085 3300053077 Ga0495601_0108667 Ga0495601_0108667_180_719 179
1086 3300053085 Ga0495619_0020945 Ga0495619_0020945_3274_3813 179
1087 3300053151 Ga0500604_0033925 Ga0500604_0033925_501_1040 179
1088 3300053177 Ga0500636_0104142 Ga0500636_0104142_858_1397 179
1089 3300027111 Ga0209281_1000144 Ga0209281_100014432 180
1090 3300031548 Ga0307408_100073764 Ga0307408_1000737642 180
1091 3300032002 Ga0307416_100576121 Ga0307416_1005761212 180
1092 3300042007 Ga0439449_0008658 Ga0439449_0008658_150_692 180
1093 3300046474 Ga0495605_0007620 Ga0495605_0007620_2122_2706 180
1094 3300046492 Ga0495585_0062483 Ga0495585_0062483_1068_1640 180
1095 3300046501 Ga0495607_0089810 Ga0495607_0089810_398_982 180
1096 3300046513 Ga0495616_0037833 Ga0495616_0037833_381_965 180
1097 3300046518 Ga0495631_0019274 Ga0495631_0019274_289_873 180
1098 3300046519 Ga0495632_0038705 Ga0495632_0038705_1563_2135 180
1099 3300046616 Ga0495668_0017818 Ga0495668_0017818_2941_3525 180
1100 3300046648 Ga0495611_0014969 Ga0495611_0014969_963_1535 180
1101 3300046660 Ga0495625_0023025 Ga0495625_0023025_1663_2247 180
1102 3300046810 Ga0495660_0034931 Ga0495660_0034931_1897_2469 180
1103 3300047472 Ga0495686_0001162 Ga0495686_0001162_15659_16201 180
1104 3300049459 Ga0495678_028870 Ga0495678_028870_154_726 180
1105 3300053104 Ga0500556_0081629 Ga0500556_0081629_445_1029 180
1106 3300053146 Ga0500588_0148512 Ga0500588_0148512_235_819 180
1107 iso_pu_bacteria 2510917022 2511135840 180
1108 iso_pu_bacteria 2524023209 2524461190 180
1109 iso_pu_bacteria 2582581307 2585272070 180
1110 iso_pu_bacteria 2585427531 2585563385 180
1111 iso_pu_bacteria 2585427608 2585897194 180
1112 iso_pu_bacteria 2585427609 2585909108 180
1113 iso_pu_bacteria 2585428125 2587984522 180
1114 iso_pu_bacteria 2599185156 2599335744 180
1115 iso_pu_bacteria 2643221719 2644657911 180
1116 iso_pu_bacteria 2842298080 2842302634 180
1117 iso_pu_bacteria 2842357229 2842358864 180
1118 iso_pu_bacteria 2842922631 2842926468 180
1119 iso_pu_bacteria 2852387548 2852392111 180
1120 iso_pu_bacteria 8046767195 8046768365 180
1121 iso_pu_bacteria 8057575449 8057581966 180
1122 3300001979 JGI24740J21852_10008219 JGI24740J21852_100082193 181
1123 3300002704 JGI25155J39150_1000018 JGI25155J39150_100001883 181
1124 3300002705 JGI25156J39149_1000055 JGI25156J39149_100005558 181
1125 3300002737 JGI25162J39368_1000601 JGI25162J39368_100060130 181
1126 3300002737 JGI25162J39368_1000903 JGI25162J39368_10009031 181
1127 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006942 181
1128 3300002741 JGI25157J39369_1000076 JGI25157J39369_100007658 181
1129 3300003214 JGI25165J46597_1000974 JGI25165J46597_10009741 181
1130 3300003214 JGI25165J46597_1001602 JGI25165J46597_10016021 181
1131 3300003322 rootL2_10083269 rootL2_100832692 181
1132 3300003323 rootH1_10095635 rootH1_100956353 181
1133 3300005331 Ga0070670_100000711 Ga0070670_10000071117 181
1134 3300006353 Ga0075370_10002288 Ga0075370_1000228810 181
1135 3300013105 Ga0157369_10606682 Ga0157369_106066822 181
1136 3300025206 Ga0209435_100031 Ga0209435_10003185 181
1137 3300025233 Ga0209437_100179 Ga0209437_10017964 181
1138 3300025233 Ga0209437_100181 Ga0209437_10018162 181
1139 3300025246 Ga0209646_1000102 Ga0209646_100010285 181
1140 3300025250 Ga0209026_1000096 Ga0209026_100009685 181
1141 3300025256 Ga0209759_1000090 Ga0209759_100009085 181
1142 3300025256 Ga0209759_1019437 Ga0209759_10194372 181
1143 3300025261 Ga0209233_1000185 Ga0209233_100018563 181
1144 3300025261 Ga0209233_1000212 Ga0209233_100021262 181
1145 3300025272 Ga0209455_1015460 Ga0209455_10154603 181
1146 3300025925 Ga0207650_10003285 Ga0207650_100032859 181
1147 3300026078 Ga0207702_10056535 Ga0207702_100565354 181
1148 3300030500 Ga0268256_1006162 Ga0268256_10061623 181
1149 3300044842 Ga0466957_0100894 Ga0466957_0100894_1146_1703 181
1150 3300046675 Ga0495657_0096683 Ga0495657_0096683_218_802 181
1151 3300047443 Ga0495687_050654 Ga0495687_050654_985_1539 181
1152 3300048920 Ga0496117_0387798 Ga0496117_0387798_130_687 181
1153 3300048922 Ga0496119_0008902 Ga0496119_0008902_6453_7010 181
1154 3300048925 Ga0496122_0020473 Ga0496122_0020473_2253_2810 181
1155 3300048925 Ga0496122_0023049 Ga0496122_0023049_2645_3190 181
1156 3300048926 Ga0496123_0031587 Ga0496123_0031587_22_579 181
1157 3300048927 Ga0496124_0228472 Ga0496124_0228472_399_956 181
1158 3300048928 Ga0496125_0252960 Ga0496125_0252960_332_889 181
1159 3300050495 nmdc:mga04h51_320408_c1 nmdc:mga04h51_320408_c1_10_555 181
1160 3300053125 Ga0500618_034724 Ga0500618_034724_59_616 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

36

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.657 45 174
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6333 45 174
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6235 63 174
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.5748 45 170
4e18-assembly1.cif.gz_A alpha-e-catenin is an autoinhibited molecule that co-activates vinculin 0.5697 49 174
ID Description Score Start End Superfamily
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7179 45 178 1.20.120.550
af_Q5JMS0_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7117 49 149 1.20.58.90
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6874 45 178 1.20.120.550
af_Q5JMS0_2_105_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6536 49 149 1.20.58.90
af_K7MEX1_94_281_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6115 40 174 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A1E1V102-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9978 44 180 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A4R6H5X9-F1-model_v4 deleted 0.9967 42 180
AF-A0A4R3E9V4-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9953 41 180 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A371WMR5-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9924 42 180 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A258ST49-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9923 41 180 GO:0005886
GO:0006782
GO:0046872
GO:0070818

Feature Viewer

pLDDT pTM Quality
89.79 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map