F490944
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1156 | 524 | 1140 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0314542|Ga0395905_0314542_288_896 |
| Length | 202 |
| Sequence | MQIVLVAQYTENDAVFFIVFPHEEARCWATRRIAMGLFTRDIKTMDDLFVHQLQDIYYAEKQLVKALPKMAEKANDNQLKQGFLGHLEQTKGHVTRLEQVFQMHGVTPKAVTCPAIDGIIEEADEVAGEVADKQVLDAALINAAQAAEHYEITRYGTLVTWAKRLGRNDCAAVLQKTLDEEKATDKKLTQLAESGINLKAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 5 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 6 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 7 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 8 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 9 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 10 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 11 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 12 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 13 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 14 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 23 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 24 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 25 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 112 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 128 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 132 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 133 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 134 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 158 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 174 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 181 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300023684 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 183 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 252 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 264 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 266 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 267 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 268 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 269 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 270 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 271 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 272 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 273 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 274 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 289 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 290 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 291 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 294 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 295 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 296 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 308 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 310 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 402 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 411 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 412 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 413 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 414 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 415 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 416 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 417 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 418 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 475 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 478 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 479 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 482 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 483 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 484 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 485 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 486 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 487 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 488 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 489 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 491 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 492 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 495 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 496 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 498 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 499 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 500 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 505 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 507 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 508 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 509 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 510 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 511 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 513 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 522 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 523 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 524 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.18 |
| Metatranscriptomes | 7.44 |
| Isolates | 1.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.09 |
| Nodule | 0.43 |
| Rhizoplane | 5.28 |
| Rhizosphere | 81.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3951670 | 2162886007 | Bacteria | 800 |
| 2 | JGI24746J21847_1021252 | 3300001977 | Bacteria | 907 |
| 3 | JGI24747J21853_1042903 | 3300001978 | Bacteria | 539 |
| 4 | JGI24740J21852_10024470 | 3300001979 | Bacteria | 2048 |
| 5 | JGI24739J22299_10007360 | 3300001989 | Bacteria | 4133 |
| 6 | JGI24737J22298_10008541 | 3300001990 | Bacteria | 3425 |
| 7 | JGI24737J22298_10126944 | 3300001990 | Bacteria | 753 |
| 8 | JGI24743J22301_10050615 | 3300001991 | Bacteria | 846 |
| 9 | JGI24735J21928_10013907 | 3300002067 | Bacteria | 2524 |
| 10 | JGI24750J21931_1036810 | 3300002070 | Bacteria | 734 |
| 11 | JGI24749J21850_1023924 | 3300002076 | Bacteria | 868 |
| 12 | JGI24744J21845_10067843 | 3300002077 | Bacteria | 651 |
| 13 | JGI24033J26618_1025586 | 3300002155 | Bacteria | 775 |
| 14 | JGI24034J26672_10035091 | 3300002239 | Bacteria | 828 |
| 15 | JGI24742J22300_10042532 | 3300002244 | Bacteria | 812 |
| 16 | JGI24742J22300_10059722 | 3300002244 | Bacteria | 699 |
| 17 | JGI24751J29686_10018533 | 3300002459 | Bacteria | 1440 |
| 18 | JGI25406J46586_10002904 | 3300003203 | Bacteria | 8083 |
| 19 | Ga0006777J48905_1012696 | 3300003308 | Bacteria | 553 |
| 20 | Ga0006777J48905_1040219 | 3300003308 | Bacteria | 567 |
| 21 | Ga0006777J48905_1058774 | 3300003308 | Bacteria | 953 |
| 22 | Ga0006781J51513_1035190 | 3300003568 | Bacteria | 587 |
| 23 | Ga0007410J51695_1043051 | 3300003574 | Bacteria | 586 |
| 24 | Ga0007409J51694_1088714 | 3300003575 | Bacteria | 562 |
| 25 | Ga0007429J51699_1021511 | 3300003579 | Bacteria | 651 |
| 26 | Ga0007429J51699_1059805 | 3300003579 | Bacteria | 589 |
| 27 | JGI25404J52841_10022797 | 3300003659 | Bacteria | 1352 |
| 28 | JGI25404J52841_10033517 | 3300003659 | Bacteria | 1094 |
| 29 | Ga0032354_1012960 | 3300003693 | Bacteria | 654 |
| 30 | Ga0032354_1047272 | 3300003693 | Bacteria | 546 |
| 31 | Ga0032354_1052366 | 3300003693 | Bacteria | 825 |
| 32 | Ga0006780_1021799 | 3300003735 | Bacteria | 605 |
| 33 | Ga0058863_11574013 | 3300004799 | Bacteria | 670 |
| 34 | Ga0058860_12115543 | 3300004801 | Bacteria | 611 |
| 35 | Ga0058860_12149836 | 3300004801 | Bacteria | 713 |
| 36 | Ga0065715_10500263 | 3300005293 | Bacteria | 780 |
| 37 | Ga0065707_10331906 | 3300005295 | Bacteria | 948 |
| 38 | Ga0070658_10122009 | 3300005327 | Bacteria | 2166 |
| 39 | Ga0070658_10719580 | 3300005327 | Bacteria | 867 |
| 40 | Ga0070676_10214685 | 3300005328 | Bacteria | 1268 |
| 41 | Ga0070683_100116918 | 3300005329 | Bacteria | 2518 |
| 42 | Ga0070683_100186787 | 3300005329 | Bacteria | 1967 |
| 43 | Ga0070690_100312075 | 3300005330 | Bacteria | 1131 |
| 44 | Ga0070670_100036037 | 3300005331 | Bacteria | 4258 |
| 45 | Ga0070670_100131914 | 3300005331 | Bacteria | 2158 |
| 46 | Ga0070670_101179141 | 3300005331 | Bacteria | 700 |
| 47 | Ga0068869_100143438 | 3300005334 | Bacteria | 1846 |
| 48 | Ga0068869_100177601 | 3300005334 | Bacteria | 1668 |
| 49 | Ga0068869_100313946 | 3300005334 | Bacteria | 1269 |
| 50 | Ga0070666_10091734 | 3300005335 | Bacteria | 2087 |
| 51 | Ga0070666_10316492 | 3300005335 | Bacteria | 1113 |
| 52 | Ga0070680_100013974 | 3300005336 | Bacteria | 6267 |
| 53 | Ga0070682_100068797 | 3300005337 | Bacteria | 2259 |
| 54 | Ga0070682_100095633 | 3300005337 | Bacteria | 1951 |
| 55 | Ga0070682_100479432 | 3300005337 | Bacteria | 959 |
| 56 | Ga0068868_100147810 | 3300005338 | Bacteria | 1933 |
| 57 | Ga0068868_100725833 | 3300005338 | Bacteria | 891 |
| 58 | Ga0068868_100968955 | 3300005338 | Bacteria | 776 |
| 59 | Ga0070660_100235492 | 3300005339 | Bacteria | 1490 |
| 60 | Ga0070660_100278994 | 3300005339 | Bacteria | 1367 |
| 61 | Ga0070660_100834516 | 3300005339 | Bacteria | 776 |
| 62 | Ga0070660_100857848 | 3300005339 | Bacteria | 765 |
| 63 | Ga0070689_100032271 | 3300005340 | Bacteria | 3982 |
| 64 | Ga0070691_10075852 | 3300005341 | Bacteria | 1638 |
| 65 | Ga0070687_100237656 | 3300005343 | Bacteria | 1125 |
| 66 | Ga0070661_100024323 | 3300005344 | Bacteria | 4344 |
| 67 | Ga0070661_100214230 | 3300005344 | Bacteria | 1475 |
| 68 | Ga0070661_100598004 | 3300005344 | Bacteria | 891 |
| 69 | Ga0070692_10548936 | 3300005345 | Bacteria | 757 |
| 70 | Ga0070668_100217633 | 3300005347 | Bacteria | 1574 |
| 71 | Ga0070668_100248629 | 3300005347 | Bacteria | 1475 |
| 72 | Ga0070668_100275195 | 3300005347 | Bacteria | 1404 |
| 73 | Ga0070669_100129738 | 3300005353 | Bacteria | 1932 |
| 74 | Ga0070669_100335643 | 3300005353 | Bacteria | 1224 |
| 75 | Ga0070671_100063284 | 3300005355 | Bacteria | 3080 |
| 76 | Ga0070671_100172520 | 3300005355 | Bacteria | 1829 |
| 77 | Ga0070671_101044787 | 3300005355 | Bacteria | 717 |
| 78 | Ga0070674_100068947 | 3300005356 | Bacteria | 2493 |
| 79 | Ga0070674_100654750 | 3300005356 | Bacteria | 893 |
| 80 | Ga0070673_100169492 | 3300005364 | Bacteria | 1862 |
| 81 | Ga0070673_100474346 | 3300005364 | Bacteria | 1128 |
| 82 | Ga0070673_100737795 | 3300005364 | Bacteria | 906 |
| 83 | Ga0070688_100130134 | 3300005365 | Bacteria | 1697 |
| 84 | Ga0070688_100199709 | 3300005365 | Bacteria | 1398 |
| 85 | Ga0070659_100044581 | 3300005366 | Bacteria | 3473 |
| 86 | Ga0070659_100123679 | 3300005366 | Bacteria | 2097 |
| 87 | Ga0070659_100224555 | 3300005366 | Bacteria | 1551 |
| 88 | Ga0070659_100299217 | 3300005366 | Bacteria | 1341 |
| 89 | Ga0070659_100666840 | 3300005366 | Bacteria | 898 |
| 90 | Ga0070659_101470739 | 3300005366 | Bacteria | 607 |
| 91 | Ga0070667_100042228 | 3300005367 | Bacteria | 3826 |
| 92 | Ga0070667_100291770 | 3300005367 | Bacteria | 1467 |
| 93 | Ga0070667_100461147 | 3300005367 | Bacteria | 1162 |
| 94 | Ga0070703_10168139 | 3300005406 | Bacteria | 838 |
| 95 | Ga0070703_10207770 | 3300005406 | Bacteria | 772 |
| 96 | Ga0070709_10001015 | 3300005434 | Bacteria | 15518 |
| 97 | Ga0070714_100008787 | 3300005435 | Bacteria | 7901 |
| 98 | Ga0070714_100160074 | 3300005435 | Bacteria | 2036 |
| 99 | Ga0070714_101523020 | 3300005435 | Bacteria | 653 |
| 100 | Ga0070713_100002311 | 3300005436 | Bacteria | 12409 |
| 101 | Ga0070713_100102531 | 3300005436 | Bacteria | 2482 |
| 102 | Ga0070713_100504541 | 3300005436 | Bacteria | 1142 |
| 103 | Ga0070710_10013948 | 3300005437 | Bacteria | 4035 |
| 104 | Ga0070710_10446128 | 3300005437 | Bacteria | 876 |
| 105 | Ga0070710_10557628 | 3300005437 | Bacteria | 792 |
| 106 | Ga0070701_10170254 | 3300005438 | Bacteria | 1268 |
| 107 | Ga0070701_10182050 | 3300005438 | Bacteria | 1231 |
| 108 | Ga0070711_100147022 | 3300005439 | Bacteria | 1773 |
| 109 | Ga0070711_100184808 | 3300005439 | Bacteria | 1598 |
| 110 | Ga0070705_100354370 | 3300005440 | Bacteria | 1071 |
| 111 | Ga0070705_100414755 | 3300005440 | Bacteria | 1001 |
| 112 | Ga0070700_100014021 | 3300005441 | Bacteria | 4518 |
| 113 | Ga0070700_100258660 | 3300005441 | Bacteria | 1252 |
| 114 | Ga0070700_100959397 | 3300005441 | Bacteria | 700 |
| 115 | Ga0070694_100085125 | 3300005444 | Bacteria | 2207 |
| 116 | Ga0070694_100153679 | 3300005444 | Bacteria | 1683 |
| 117 | Ga0070694_100299584 | 3300005444 | Bacteria | 1231 |
| 118 | Ga0070694_100502318 | 3300005444 | Bacteria | 965 |
| 119 | Ga0070663_100008060 | 3300005455 | Bacteria | 6460 |
| 120 | Ga0070663_100086075 | 3300005455 | Bacteria | 2320 |
| 121 | Ga0070663_100113623 | 3300005455 | Bacteria | 2038 |
| 122 | Ga0070663_100159559 | 3300005455 | Bacteria | 1735 |
| 123 | Ga0070663_100182877 | 3300005455 | Bacteria | 1627 |
| 124 | Ga0070663_100420146 | 3300005455 | Bacteria | 1096 |
| 125 | Ga0070663_100773989 | 3300005455 | Bacteria | 821 |
| 126 | Ga0070663_100809046 | 3300005455 | Bacteria | 804 |
| 127 | Ga0070678_100135175 | 3300005456 | Bacteria | 1965 |
| 128 | Ga0070678_100418545 | 3300005456 | Bacteria | 1167 |
| 129 | Ga0070678_100855993 | 3300005456 | Bacteria | 829 |
| 130 | Ga0070662_100054508 | 3300005457 | Bacteria | 2897 |
| 131 | Ga0070662_100057011 | 3300005457 | Bacteria | 2837 |
| 132 | Ga0070662_100084041 | 3300005457 | Bacteria | 2377 |
| 133 | Ga0070662_100230727 | 3300005457 | Bacteria | 1481 |
| 134 | Ga0070662_101063909 | 3300005457 | Bacteria | 694 |
| 135 | Ga0070681_10013083 | 3300005458 | Bacteria | 8240 |
| 136 | Ga0070681_10070681 | 3300005458 | Bacteria | 3455 |
| 137 | Ga0070685_10251199 | 3300005466 | Bacteria | 1172 |
| 138 | Ga0070698_100053016 | 3300005471 | Bacteria | 4124 |
| 139 | Ga0070679_100126829 | 3300005530 | Bacteria | 2534 |
| 140 | Ga0070679_100267934 | 3300005530 | Bacteria | 1662 |
| 141 | Ga0070679_100652430 | 3300005530 | Bacteria | 995 |
| 142 | Ga0070679_100754742 | 3300005530 | Bacteria | 916 |
| 143 | Ga0070684_100092938 | 3300005535 | Bacteria | 2685 |
| 144 | Ga0070684_100626745 | 3300005535 | Bacteria | 1000 |
| 145 | Ga0070697_100064835 | 3300005536 | Bacteria | 2984 |
| 146 | Ga0068853_100004957 | 3300005539 | Bacteria | 10372 |
| 147 | Ga0068853_100039011 | 3300005539 | Bacteria | 4049 |
| 148 | Ga0068853_100130476 | 3300005539 | Bacteria | 2249 |
| 149 | Ga0068853_100663727 | 3300005539 | Bacteria | 993 |
| 150 | Ga0068853_100767883 | 3300005539 | Bacteria | 922 |
| 151 | Ga0070672_100586816 | 3300005543 | Bacteria | 970 |
| 152 | Ga0070686_100050014 | 3300005544 | Bacteria | 2654 |
| 153 | Ga0070686_100404916 | 3300005544 | Bacteria | 1039 |
| 154 | Ga0070686_100665765 | 3300005544 | Bacteria | 827 |
| 155 | Ga0070695_100042844 | 3300005545 | Bacteria | 2875 |
| 156 | Ga0070695_100315310 | 3300005545 | Bacteria | 1160 |
| 157 | Ga0070696_100000971 | 3300005546 | Bacteria | 18578 |
| 158 | Ga0070696_100044480 | 3300005546 | Bacteria | 3075 |
| 159 | Ga0070696_100246081 | 3300005546 | Bacteria | 1350 |
| 160 | Ga0070693_100017592 | 3300005547 | Bacteria | 3719 |
| 161 | Ga0070693_100987912 | 3300005547 | Bacteria | 636 |
| 162 | Ga0070693_100988161 | 3300005547 | Bacteria | 636 |
| 163 | Ga0070665_100003902 | 3300005548 | Bacteria | 15759 |
| 164 | Ga0070665_100053521 | 3300005548 | Bacteria | 4048 |
| 165 | Ga0070665_100113980 | 3300005548 | Bacteria | 2706 |
| 166 | Ga0070665_100546810 | 3300005548 | Bacteria | 1170 |
| 167 | Ga0070665_100550745 | 3300005548 | Bacteria | 1166 |
| 168 | Ga0070665_100891149 | 3300005548 | Bacteria | 902 |
| 169 | Ga0070704_100181227 | 3300005549 | Bacteria | 1685 |
| 170 | Ga0070704_100238813 | 3300005549 | Bacteria | 1486 |
| 171 | Ga0068855_100075381 | 3300005563 | Bacteria | 3917 |
| 172 | Ga0068855_100110751 | 3300005563 | Bacteria | 3151 |
| 173 | Ga0068855_100227171 | 3300005563 | Bacteria | 2091 |
| 174 | Ga0068855_100272230 | 3300005563 | Bacteria | 1883 |
| 175 | Ga0068855_100337368 | 3300005563 | Bacteria | 1663 |
| 176 | Ga0070664_100351050 | 3300005564 | Bacteria | 1342 |
| 177 | Ga0070664_100481716 | 3300005564 | Bacteria | 1142 |
| 178 | Ga0068857_100020850 | 3300005577 | Bacteria | 5765 |
| 179 | Ga0068857_100334791 | 3300005577 | Bacteria | 1399 |
| 180 | Ga0068854_100006791 | 3300005578 | Bacteria | 7294 |
| 181 | Ga0068854_100006800 | 3300005578 | Bacteria | 7290 |
| 182 | Ga0068854_101698589 | 3300005578 | Bacteria | 577 |
| 183 | Ga0068854_101707607 | 3300005578 | Bacteria | 576 |
| 184 | Ga0068856_100000363 | 3300005614 | Bacteria | 49777 |
| 185 | Ga0068856_100028283 | 3300005614 | Bacteria | 5473 |
| 186 | Ga0068856_100154754 | 3300005614 | Bacteria | 2302 |
| 187 | Ga0068856_100411333 | 3300005614 | Bacteria | 1372 |
| 188 | Ga0070702_100003979 | 3300005615 | Bacteria | 6703 |
| 189 | Ga0070702_100104963 | 3300005615 | Bacteria | 1740 |
| 190 | Ga0068852_100005807 | 3300005616 | Bacteria | 8861 |
| 191 | Ga0068852_100391373 | 3300005616 | Bacteria | 1365 |
| 192 | Ga0068859_100117890 | 3300005617 | Bacteria | 2720 |
| 193 | Ga0068859_100224959 | 3300005617 | Bacteria | 1964 |
| 194 | Ga0068864_100064661 | 3300005618 | Bacteria | 3173 |
| 195 | Ga0068864_100109309 | 3300005618 | Bacteria | 2461 |
| 196 | Ga0068864_101347514 | 3300005618 | Bacteria | 715 |
| 197 | Ga0068866_10418506 | 3300005718 | Bacteria | 869 |
| 198 | Ga0068861_100028388 | 3300005719 | Bacteria | 4082 |
| 199 | Ga0068861_100101152 | 3300005719 | Bacteria | 2292 |
| 200 | Ga0068861_100152343 | 3300005719 | Bacteria | 1898 |
| 201 | Ga0068851_10009198 | 3300005834 | Bacteria | 4587 |
| 202 | Ga0068851_10034585 | 3300005834 | Bacteria | 2523 |
| 203 | Ga0068851_10147229 | 3300005834 | Bacteria | 1285 |
| 204 | Ga0068870_10049659 | 3300005840 | Bacteria | 2214 |
| 205 | Ga0068863_100020353 | 3300005841 | Bacteria | 6344 |
| 206 | Ga0068858_100249886 | 3300005842 | Bacteria | 1684 |
| 207 | Ga0068858_100482037 | 3300005842 | Bacteria | 1197 |
| 208 | Ga0068858_101021531 | 3300005842 | Bacteria | 810 |
| 209 | Ga0068860_100061571 | 3300005843 | Bacteria | 3565 |
| 210 | Ga0068860_100067286 | 3300005843 | Bacteria | 3404 |
| 211 | Ga0068860_101207093 | 3300005843 | Bacteria | 777 |
| 212 | Ga0068862_100131627 | 3300005844 | Bacteria | 2213 |
| 213 | Ga0068862_100889847 | 3300005844 | Bacteria | 875 |
| 214 | Ga0081455_10000633 | 3300005937 | Bacteria | 45582 |
| 215 | Ga0081455_10045282 | 3300005937 | Bacteria | 3829 |
| 216 | Ga0081540_1001350 | 3300005983 | Bacteria | 21352 |
| 217 | Ga0081540_1005948 | 3300005983 | Bacteria | 9003 |
| 218 | Ga0081540_1013070 | 3300005983 | Bacteria | 5422 |
| 219 | Ga0081540_1023275 | 3300005983 | Bacteria | 3629 |
| 220 | Ga0081539_10000864 | 3300005985 | Bacteria | 58047 |
| 221 | Ga0081539_10064473 | 3300005985 | Bacteria | 1993 |
| 222 | Ga0070717_10008605 | 3300006028 | Bacteria | 7627 |
| 223 | Ga0070717_10207693 | 3300006028 | Bacteria | 1718 |
| 224 | Ga0070717_10349425 | 3300006028 | Bacteria | 1322 |
| 225 | Ga0075365_10007938 | 3300006038 | Bacteria | 5983 |
| 226 | Ga0075365_10142814 | 3300006038 | Bacteria | 1662 |
| 227 | Ga0075365_10262762 | 3300006038 | Bacteria | 1214 |
| 228 | Ga0075365_10600407 | 3300006038 | Bacteria | 778 |
| 229 | Ga0075368_10022861 | 3300006042 | Bacteria | 2383 |
| 230 | Ga0075363_100001181 | 3300006048 | Bacteria | 9618 |
| 231 | Ga0075364_10025549 | 3300006051 | Bacteria | 3760 |
| 232 | Ga0075364_10136743 | 3300006051 | Bacteria | 1647 |
| 233 | Ga0075364_10194511 | 3300006051 | Bacteria | 1374 |
| 234 | Ga0070716_100019318 | 3300006173 | Bacteria | 3560 |
| 235 | Ga0070712_100006584 | 3300006175 | Bacteria | 7215 |
| 236 | Ga0075362_10020047 | 3300006177 | Bacteria | 2790 |
| 237 | Ga0075362_10227062 | 3300006177 | Bacteria | 914 |
| 238 | Ga0075362_10246177 | 3300006177 | Bacteria | 879 |
| 239 | Ga0075367_10001700 | 3300006178 | Bacteria | 9620 |
| 240 | Ga0075367_10017229 | 3300006178 | Bacteria | 3962 |
| 241 | Ga0075367_10065669 | 3300006178 | Bacteria | 2173 |
| 242 | Ga0075367_10249851 | 3300006178 | Bacteria | 1112 |
| 243 | Ga0075369_10091556 | 3300006186 | Bacteria | 1357 |
| 244 | Ga0075369_10245394 | 3300006186 | Bacteria | 831 |
| 245 | Ga0075366_10845597 | 3300006195 | Bacteria | 569 |
| 246 | Ga0097621_100026518 | 3300006237 | Bacteria | 4546 |
| 247 | Ga0097621_100074213 | 3300006237 | Bacteria | 2817 |
| 248 | Ga0097621_100316295 | 3300006237 | Bacteria | 1382 |
| 249 | Ga0075370_10020128 | 3300006353 | Bacteria | 3643 |
| 250 | Ga0075370_10028239 | 3300006353 | Bacteria | 3118 |
| 251 | Ga0068871_100035821 | 3300006358 | Bacteria | 3946 |
| 252 | Ga0068871_100104255 | 3300006358 | Bacteria | 2379 |
| 253 | Ga0075428_100070086 | 3300006844 | Bacteria | 3833 |
| 254 | Ga0075430_100109997 | 3300006846 | Bacteria | 2298 |
| 255 | Ga0075430_100917106 | 3300006846 | Bacteria | 722 |
| 256 | Ga0075431_100465897 | 3300006847 | Bacteria | 1258 |
| 257 | Ga0075433_10809127 | 3300006852 | Bacteria | 819 |
| 258 | Ga0075433_10833840 | 3300006852 | Bacteria | 805 |
| 259 | Ga0075434_100044641 | 3300006871 | Bacteria | 4396 |
| 260 | Ga0075434_100125713 | 3300006871 | Bacteria | 2581 |
| 261 | Ga0075434_100510301 | 3300006871 | Bacteria | 1223 |
| 262 | Ga0068865_100001775 | 3300006881 | Bacteria | 12654 |
| 263 | Ga0075436_100005858 | 3300006914 | Bacteria | 8445 |
| 264 | Ga0075436_100692290 | 3300006914 | Unclassified | 755 |
| 265 | Ga0075436_101191223 | 3300006914 | Bacteria | 575 |
| 266 | Ga0097620_100117884 | 3300006931 | Bacteria | 2720 |
| 267 | Ga0097620_100224948 | 3300006931 | Bacteria | 1964 |
| 268 | Ga0075435_100073638 | 3300007076 | Bacteria | 2793 |
| 269 | Ga0075435_100111808 | 3300007076 | Bacteria | 2272 |
| 270 | Ga0075435_100468897 | 3300007076 | Bacteria | 1087 |
| 271 | Ga0099794_10381339 | 3300007265 | Bacteria | 735 |
| 272 | Ga0099795_10021043 | 3300007788 | Bacteria | 2134 |
| 273 | Ga0099795_10030236 | 3300007788 | Bacteria | 1857 |
| 274 | Ga0099795_10048728 | 3300007788 | Bacteria | 1535 |
| 275 | Ga0105251_10097573 | 3300009011 | Bacteria | 1345 |
| 276 | Ga0105251_10313106 | 3300009011 | Bacteria | 713 |
| 277 | Ga0105244_10088248 | 3300009036 | Bacteria | 1528 |
| 278 | Ga0105250_10030865 | 3300009092 | Bacteria | 2154 |
| 279 | Ga0105250_10046623 | 3300009092 | Bacteria | 1738 |
| 280 | Ga0105240_10016715 | 3300009093 | Bacteria | 9924 |
| 281 | Ga0105240_10030730 | 3300009093 | Bacteria | 6976 |
| 282 | Ga0105240_10196998 | 3300009093 | Bacteria | 2364 |
| 283 | Ga0105240_12090505 | 3300009093 | Bacteria | 588 |
| 284 | Ga0111539_10315761 | 3300009094 | Bacteria | 1818 |
| 285 | Ga0111539_10663958 | 3300009094 | Bacteria | 1214 |
| 286 | Ga0105245_10312564 | 3300009098 | Bacteria | 1545 |
| 287 | Ga0105245_10359871 | 3300009098 | Bacteria | 1444 |
| 288 | Ga0105245_10530627 | 3300009098 | Bacteria | 1197 |
| 289 | Ga0105245_10791723 | 3300009098 | Bacteria | 986 |
| 290 | Ga0105245_10968353 | 3300009098 | Bacteria | 894 |
| 291 | Ga0105247_10095694 | 3300009101 | Bacteria | 1891 |
| 292 | Ga0114129_10037544 | 3300009147 | Bacteria | 6839 |
| 293 | Ga0114129_10784305 | 3300009147 | Bacteria | 1217 |
| 294 | Ga0105243_10076785 | 3300009148 | Bacteria | 2715 |
| 295 | Ga0105243_10319515 | 3300009148 | Bacteria | 1414 |
| 296 | Ga0105243_10501399 | 3300009148 | Bacteria | 1150 |
| 297 | Ga0105241_10066421 | 3300009174 | Bacteria | 2789 |
| 298 | Ga0105241_10070808 | 3300009174 | Bacteria | 2706 |
| 299 | Ga0105241_10406303 | 3300009174 | Bacteria | 1196 |
| 300 | Ga0105241_10493630 | 3300009174 | Bacteria | 1090 |
| 301 | Ga0105242_10022368 | 3300009176 | Bacteria | 4970 |
| 302 | Ga0105242_10322965 | 3300009176 | Bacteria | 1416 |
| 303 | Ga0105248_10061998 | 3300009177 | Bacteria | 4199 |
| 304 | Ga0105248_10272244 | 3300009177 | Bacteria | 1907 |
| 305 | Ga0105237_10040252 | 3300009545 | Bacteria | 4714 |
| 306 | Ga0105237_10176281 | 3300009545 | Bacteria | 2138 |
| 307 | Ga0105237_10317584 | 3300009545 | Bacteria | 1561 |
| 308 | Ga0105237_10396831 | 3300009545 | Bacteria | 1384 |
| 309 | Ga0105238_10012175 | 3300009551 | Bacteria | 8671 |
| 310 | Ga0105238_10035982 | 3300009551 | Bacteria | 5033 |
| 311 | Ga0105238_10049838 | 3300009551 | Bacteria | 4216 |
| 312 | Ga0105238_10102283 | 3300009551 | Bacteria | 2847 |
| 313 | Ga0105238_10264456 | 3300009551 | Bacteria | 1700 |
| 314 | Ga0105238_10347316 | 3300009551 | Bacteria | 1472 |
| 315 | Ga0105249_10074945 | 3300009553 | Bacteria | 3133 |
| 316 | Ga0105249_10092015 | 3300009553 | Bacteria | 2839 |
| 317 | Ga0105249_10133651 | 3300009553 | Bacteria | 2371 |
| 318 | Ga0099796_10061656 | 3300010159 | Bacteria | 1331 |
| 319 | Ga0105239_10091468 | 3300010375 | Bacteria | 3357 |
| 320 | Ga0105239_10152572 | 3300010375 | Bacteria | 2578 |
| 321 | Ga0105239_10153070 | 3300010375 | Bacteria | 2574 |
| 322 | Ga0105239_10428627 | 3300010375 | Bacteria | 1499 |
| 323 | Ga0105239_10560225 | 3300010375 | Bacteria | 1302 |
| 324 | Ga0105239_10644628 | 3300010375 | Bacteria | 1210 |
| 325 | Ga0105239_11920494 | 3300010375 | Bacteria | 687 |
| 326 | Ga0105246_10095430 | 3300011119 | Bacteria | 2153 |
| 327 | Ga0105246_10547708 | 3300011119 | Bacteria | 991 |
| 328 | Ga0105246_10581741 | 3300011119 | Bacteria | 964 |
| 329 | Ga0157344_1004409 | 3300012476 | Bacteria | 837 |
| 330 | Ga0157326_1003126 | 3300012513 | Bacteria | 1751 |
| 331 | Ga0157373_10585099 | 3300013100 | Bacteria | 812 |
| 332 | Ga0157373_10730117 | 3300013100 | Bacteria | 727 |
| 333 | Ga0157370_10158045 | 3300013104 | Bacteria | 2109 |
| 334 | Ga0157370_10538178 | 3300013104 | Bacteria | 1071 |
| 335 | Ga0157370_10810914 | 3300013104 | Bacteria | 851 |
| 336 | Ga0157374_10510630 | 3300013296 | Bacteria | 1207 |
| 337 | Ga0157378_10074128 | 3300013297 | Bacteria | 3062 |
| 338 | Ga0157378_10077086 | 3300013297 | Bacteria | 3005 |
| 339 | Ga0157378_10367816 | 3300013297 | Bacteria | 1409 |
| 340 | Ga0157378_10661797 | 3300013297 | Bacteria | 1061 |
| 341 | Ga0163162_10010007 | 3300013306 | Bacteria | 9221 |
| 342 | Ga0163162_10321503 | 3300013306 | Bacteria | 1680 |
| 343 | Ga0163162_10394122 | 3300013306 | Bacteria | 1517 |
| 344 | Ga0157372_10218610 | 3300013307 | Bacteria | 2208 |
| 345 | Ga0157372_10855203 | 3300013307 | Bacteria | 1056 |
| 346 | Ga0157375_10724238 | 3300013308 | Bacteria | 1147 |
| 347 | Ga0163163_10064503 | 3300014325 | Bacteria | 3634 |
| 348 | Ga0163163_10075022 | 3300014325 | Bacteria | 3375 |
| 349 | Ga0163163_11988878 | 3300014325 | Bacteria | 641 |
| 350 | Ga0157380_10186461 | 3300014326 | Bacteria | 1827 |
| 351 | Ga0157380_10215780 | 3300014326 | Bacteria | 1713 |
| 352 | Ga0157380_10426265 | 3300014326 | Bacteria | 1267 |
| 353 | Ga0157380_12527629 | 3300014326 | Bacteria | 579 |
| 354 | Ga0157377_10048477 | 3300014745 | Bacteria | 2383 |
| 355 | Ga0157376_10188927 | 3300014969 | Bacteria | 1888 |
| 356 | Ga0157376_10267523 | 3300014969 | Bacteria | 1604 |
| 357 | Ga0157376_11224350 | 3300014969 | Bacteria | 779 |
| 358 | Ga0163161_10112438 | 3300017792 | Bacteria | 2037 |
| 359 | Ga0197907_10889824 | 3300020069 | Bacteria | 574 |
| 360 | Ga0197907_11053528 | 3300020069 | Bacteria | 633 |
| 361 | Ga0197907_11501374 | 3300020069 | Unclassified | 664 |
| 362 | Ga0206356_10247621 | 3300020070 | Bacteria | 626 |
| 363 | Ga0206356_10594276 | 3300020070 | Bacteria | 568 |
| 364 | Ga0206356_11474439 | 3300020070 | Bacteria | 620 |
| 365 | Ga0206356_11572529 | 3300020070 | Bacteria | 629 |
| 366 | Ga0206356_11733153 | 3300020070 | Bacteria | 582 |
| 367 | Ga0206356_11743097 | 3300020070 | Bacteria | 581 |
| 368 | Ga0206356_11836906 | 3300020070 | Bacteria | 1183 |
| 369 | Ga0206349_1020691 | 3300020075 | Bacteria | 556 |
| 370 | Ga0206349_1186858 | 3300020075 | Bacteria | 588 |
| 371 | Ga0206349_1197767 | 3300020075 | Bacteria | 550 |
| 372 | Ga0206349_1262994 | 3300020075 | Bacteria | 882 |
| 373 | Ga0206349_1463205 | 3300020075 | Bacteria | 572 |
| 374 | Ga0206349_1946070 | 3300020075 | Bacteria | 691 |
| 375 | Ga0206355_1093692 | 3300020076 | Bacteria | 615 |
| 376 | Ga0206355_1113466 | 3300020076 | Bacteria | 587 |
| 377 | Ga0206355_1164344 | 3300020076 | Unclassified | 1069 |
| 378 | Ga0206355_1358260 | 3300020076 | Bacteria | 668 |
| 379 | Ga0206355_1367435 | 3300020076 | Bacteria | 586 |
| 380 | Ga0206351_10032476 | 3300020077 | Bacteria | 639 |
| 381 | Ga0206351_10751612 | 3300020077 | Bacteria | 609 |
| 382 | Ga0206352_10138666 | 3300020078 | Bacteria | 618 |
| 383 | Ga0206350_10122239 | 3300020080 | Bacteria | 592 |
| 384 | Ga0206350_10365195 | 3300020080 | Bacteria | 665 |
| 385 | Ga0206350_10388215 | 3300020080 | Bacteria | 633 |
| 386 | Ga0206350_10511773 | 3300020080 | Bacteria | 590 |
| 387 | Ga0206350_10646272 | 3300020080 | Bacteria | 632 |
| 388 | Ga0206350_10677610 | 3300020080 | Bacteria | 719 |
| 389 | Ga0206350_10924274 | 3300020080 | Bacteria | 634 |
| 390 | Ga0206350_11081022 | 3300020080 | Bacteria | 674 |
| 391 | Ga0206350_11355059 | 3300020080 | Bacteria | 567 |
| 392 | Ga0206354_10089617 | 3300020081 | Bacteria | 1824 |
| 393 | Ga0206354_11086759 | 3300020081 | Bacteria | 708 |
| 394 | Ga0206354_11428798 | 3300020081 | Bacteria | 589 |
| 395 | Ga0206353_10116796 | 3300020082 | Bacteria | 1490 |
| 396 | Ga0206353_10362445 | 3300020082 | Bacteria | 902 |
| 397 | Ga0206353_10411745 | 3300020082 | Bacteria | 651 |
| 398 | Ga0206353_10504062 | 3300020082 | Bacteria | 579 |
| 399 | Ga0206353_10883923 | 3300020082 | Bacteria | 855 |
| 400 | Ga0206353_11374616 | 3300020082 | Bacteria | 681 |
| 401 | Ga0206353_11504878 | 3300020082 | Bacteria | 604 |
| 402 | Ga0206353_11657362 | 3300020082 | Bacteria | 592 |
| 403 | Ga0154015_1321397 | 3300020610 | Bacteria | 725 |
| 404 | Ga0224712_10182083 | 3300022467 | Bacteria | 947 |
| 405 | Ga0224712_10278123 | 3300022467 | Bacteria | 778 |
| 406 | Ga0224712_10295154 | 3300022467 | Bacteria | 757 |
| 407 | Ga0224712_10304103 | 3300022467 | Bacteria | 746 |
| 408 | Ga0224712_10305207 | 3300022467 | Bacteria | 745 |
| 409 | Ga0224712_10448592 | 3300022467 | Bacteria | 619 |
| 410 | Ga0224712_10488207 | 3300022467 | Bacteria | 594 |
| 411 | Ga0224712_10494070 | 3300022467 | Bacteria | 591 |
| 412 | Ga0224712_10511958 | 3300022467 | Bacteria | 581 |
| 413 | Ga0247551_102201 | 3300023552 | Bacteria | 703 |
| 414 | Ga0247523_112525 | 3300023684 | Bacteria | 697 |
| 415 | Ga0209455_1002093 | 3300025272 | Bacteria | 7978 |
| 416 | Ga0209758_1008352 | 3300025297 | Bacteria | 6736 |
| 417 | Ga0207426_1075567 | 3300025302 | Bacteria | 927 |
| 418 | Ga0207656_10126512 | 3300025321 | Bacteria | 1194 |
| 419 | Ga0207656_10163908 | 3300025321 | Bacteria | 1059 |
| 420 | Ga0207713_1073333 | 3300025735 | Bacteria | 1256 |
| 421 | Ga0207653_10007478 | 3300025885 | Bacteria | 3405 |
| 422 | Ga0207653_10039302 | 3300025885 | Bacteria | 1549 |
| 423 | Ga0207692_10027517 | 3300025898 | Bacteria | 2679 |
| 424 | Ga0207642_10081749 | 3300025899 | Bacteria | 1571 |
| 425 | Ga0207642_10230011 | 3300025899 | Bacteria | 1041 |
| 426 | Ga0207710_10011489 | 3300025900 | Bacteria | 3728 |
| 427 | Ga0207688_10000896 | 3300025901 | Bacteria | 15032 |
| 428 | Ga0207680_10009686 | 3300025903 | Bacteria | 4791 |
| 429 | Ga0207680_10601969 | 3300025903 | Bacteria | 786 |
| 430 | Ga0207647_10005519 | 3300025904 | Bacteria | 9261 |
| 431 | Ga0207647_10086076 | 3300025904 | Bacteria | 1879 |
| 432 | Ga0207647_10091272 | 3300025904 | Bacteria | 1816 |
| 433 | Ga0207699_10000463 | 3300025906 | Bacteria | 20679 |
| 434 | Ga0207699_10107996 | 3300025906 | Bacteria | 1779 |
| 435 | Ga0207645_10005784 | 3300025907 | Bacteria | 8919 |
| 436 | Ga0207645_10227158 | 3300025907 | Bacteria | 1231 |
| 437 | Ga0207645_10336316 | 3300025907 | Bacteria | 1009 |
| 438 | Ga0207643_10005864 | 3300025908 | Bacteria | 6561 |
| 439 | Ga0207705_10109530 | 3300025909 | Bacteria | 2039 |
| 440 | Ga0207705_10177512 | 3300025909 | Bacteria | 1606 |
| 441 | Ga0207705_10690578 | 3300025909 | Bacteria | 793 |
| 442 | Ga0207684_11024328 | 3300025910 | Bacteria | 690 |
| 443 | Ga0207654_10002142 | 3300025911 | Bacteria | 10111 |
| 444 | Ga0207654_10126759 | 3300025911 | Bacteria | 1611 |
| 445 | Ga0207654_10156278 | 3300025911 | Bacteria | 1469 |
| 446 | Ga0207654_10550951 | 3300025911 | Bacteria | 819 |
| 447 | Ga0207707_10014498 | 3300025912 | Bacteria | 6863 |
| 448 | Ga0207707_10024561 | 3300025912 | Bacteria | 5275 |
| 449 | Ga0207695_10015064 | 3300025913 | Bacteria | 9121 |
| 450 | Ga0207695_10056580 | 3300025913 | Bacteria | 4080 |
| 451 | Ga0207671_10008930 | 3300025914 | Bacteria | 8436 |
| 452 | Ga0207671_10073879 | 3300025914 | Bacteria | 2548 |
| 453 | Ga0207671_10170843 | 3300025914 | Bacteria | 1688 |
| 454 | Ga0207671_10223604 | 3300025914 | Bacteria | 1475 |
| 455 | Ga0207671_10716188 | 3300025914 | Bacteria | 796 |
| 456 | Ga0207671_10968571 | 3300025914 | Bacteria | 671 |
| 457 | Ga0207693_10000640 | 3300025915 | Bacteria | 31338 |
| 458 | Ga0207693_10037124 | 3300025915 | Bacteria | 3840 |
| 459 | Ga0207693_10070055 | 3300025915 | Bacteria | 2744 |
| 460 | Ga0207663_10373124 | 3300025916 | Bacteria | 1085 |
| 461 | Ga0207663_11025368 | 3300025916 | Bacteria | 662 |
| 462 | Ga0207662_10006236 | 3300025918 | Bacteria | 6419 |
| 463 | Ga0207657_10006779 | 3300025919 | Bacteria | 11827 |
| 464 | Ga0207657_10042348 | 3300025919 | Bacteria | 4018 |
| 465 | Ga0207657_10386797 | 3300025919 | Bacteria | 1101 |
| 466 | Ga0207649_10037057 | 3300025920 | Bacteria | 2943 |
| 467 | Ga0207649_10073668 | 3300025920 | Bacteria | 2188 |
| 468 | Ga0207652_10014385 | 3300025921 | Bacteria | 6411 |
| 469 | Ga0207652_10227920 | 3300025921 | Bacteria | 1679 |
| 470 | Ga0207694_10000275 | 3300025924 | Bacteria | 48774 |
| 471 | Ga0207694_10128284 | 3300025924 | Bacteria | 2031 |
| 472 | Ga0207694_10151091 | 3300025924 | Bacteria | 1871 |
| 473 | Ga0207650_10179565 | 3300025925 | Bacteria | 1686 |
| 474 | Ga0207659_10524947 | 3300025926 | Bacteria | 1004 |
| 475 | Ga0207659_10779263 | 3300025926 | Bacteria | 821 |
| 476 | Ga0207687_10074887 | 3300025927 | Bacteria | 2428 |
| 477 | Ga0207687_10300546 | 3300025927 | Bacteria | 1293 |
| 478 | Ga0207700_10135523 | 3300025928 | Bacteria | 2016 |
| 479 | Ga0207700_10981429 | 3300025928 | Bacteria | 756 |
| 480 | Ga0207664_10163043 | 3300025929 | Bacteria | 1902 |
| 481 | Ga0207664_10332650 | 3300025929 | Bacteria | 1342 |
| 482 | Ga0207664_11066688 | 3300025929 | Bacteria | 723 |
| 483 | Ga0207644_10026008 | 3300025931 | Bacteria | 4028 |
| 484 | Ga0207644_10065213 | 3300025931 | Bacteria | 2648 |
| 485 | Ga0207644_10746250 | 3300025931 | Bacteria | 817 |
| 486 | Ga0207690_10099075 | 3300025932 | Bacteria | 2077 |
| 487 | Ga0207690_10224525 | 3300025932 | Bacteria | 1439 |
| 488 | Ga0207706_10007357 | 3300025933 | Bacteria | 10175 |
| 489 | Ga0207706_10059285 | 3300025933 | Bacteria | 3371 |
| 490 | Ga0207706_10067153 | 3300025933 | Bacteria | 3155 |
| 491 | Ga0207706_10186103 | 3300025933 | Bacteria | 1823 |
| 492 | Ga0207706_10482924 | 3300025933 | Bacteria | 1070 |
| 493 | Ga0207686_10074963 | 3300025934 | Bacteria | 2188 |
| 494 | Ga0207686_10247460 | 3300025934 | Bacteria | 1301 |
| 495 | Ga0207709_10139546 | 3300025935 | Bacteria | 1664 |
| 496 | Ga0207709_10560673 | 3300025935 | Bacteria | 900 |
| 497 | Ga0207709_10569188 | 3300025935 | Bacteria | 893 |
| 498 | Ga0207670_10186147 | 3300025936 | Bacteria | 1567 |
| 499 | Ga0207670_10228092 | 3300025936 | Bacteria | 1429 |
| 500 | Ga0207669_10529931 | 3300025937 | Bacteria | 947 |
| 501 | Ga0207669_10983171 | 3300025937 | Bacteria | 708 |
| 502 | Ga0207704_10004344 | 3300025938 | Bacteria | 6482 |
| 503 | Ga0207665_10001240 | 3300025939 | Bacteria | 17200 |
| 504 | Ga0207691_10016710 | 3300025940 | Bacteria | 6968 |
| 505 | Ga0207691_10037607 | 3300025940 | Bacteria | 4481 |
| 506 | Ga0207711_10028906 | 3300025941 | Bacteria | 4670 |
| 507 | Ga0207711_10030859 | 3300025941 | Bacteria | 4521 |
| 508 | Ga0207711_10815829 | 3300025941 | Bacteria | 869 |
| 509 | Ga0207689_10002364 | 3300025942 | Bacteria | 17614 |
| 510 | Ga0207689_10424621 | 3300025942 | Bacteria | 1109 |
| 511 | Ga0207689_10572682 | 3300025942 | Unclassified | 949 |
| 512 | Ga0207661_10055213 | 3300025944 | Bacteria | 3185 |
| 513 | Ga0207661_10127093 | 3300025944 | Bacteria | 2178 |
| 514 | Ga0207661_10968211 | 3300025944 | Bacteria | 784 |
| 515 | Ga0207679_11108163 | 3300025945 | Unclassified | 726 |
| 516 | Ga0207667_10061756 | 3300025949 | Bacteria | 3920 |
| 517 | Ga0207651_10357019 | 3300025960 | Bacteria | 1232 |
| 518 | Ga0207651_10421006 | 3300025960 | Bacteria | 1140 |
| 519 | Ga0207651_10782063 | 3300025960 | Bacteria | 845 |
| 520 | Ga0207712_10434904 | 3300025961 | Bacteria | 1110 |
| 521 | Ga0207668_10023778 | 3300025972 | Bacteria | 3944 |
| 522 | Ga0207668_10125228 | 3300025972 | Bacteria | 1953 |
| 523 | Ga0207668_10281391 | 3300025972 | Bacteria | 1364 |
| 524 | Ga0207640_10062060 | 3300025981 | Bacteria | 2478 |
| 525 | Ga0207640_10148236 | 3300025981 | Bacteria | 1720 |
| 526 | Ga0207658_10028993 | 3300025986 | Bacteria | 3903 |
| 527 | Ga0207658_10134836 | 3300025986 | Bacteria | 1989 |
| 528 | Ga0207677_11102657 | 3300026023 | Bacteria | 724 |
| 529 | Ga0207703_10205828 | 3300026035 | Bacteria | 1751 |
| 530 | Ga0207703_10351960 | 3300026035 | Bacteria | 1356 |
| 531 | Ga0207703_10393125 | 3300026035 | Bacteria | 1285 |
| 532 | Ga0207639_10056687 | 3300026041 | Bacteria | 3004 |
| 533 | Ga0207639_10126168 | 3300026041 | Bacteria | 2111 |
| 534 | Ga0207678_10013706 | 3300026067 | Bacteria | 7122 |
| 535 | Ga0207678_10043711 | 3300026067 | Bacteria | 3876 |
| 536 | Ga0207678_10047593 | 3300026067 | Bacteria | 3708 |
| 537 | Ga0207678_10094228 | 3300026067 | Bacteria | 2558 |
| 538 | Ga0207678_10143127 | 3300026067 | Bacteria | 2041 |
| 539 | Ga0207678_10368890 | 3300026067 | Bacteria | 1240 |
| 540 | Ga0207678_10396695 | 3300026067 | Bacteria | 1194 |
| 541 | Ga0207678_10459519 | 3300026067 | Bacteria | 1107 |
| 542 | Ga0207678_11083551 | 3300026067 | Bacteria | 709 |
| 543 | Ga0207708_10001706 | 3300026075 | Bacteria | 16253 |
| 544 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 545 | Ga0207702_10000261 | 3300026078 | Bacteria | 61023 |
| 546 | Ga0207702_10018370 | 3300026078 | Bacteria | 5785 |
| 547 | Ga0207702_10122685 | 3300026078 | Bacteria | 2328 |
| 548 | Ga0207702_10189685 | 3300026078 | Bacteria | 1898 |
| 549 | Ga0207641_10152237 | 3300026088 | Bacteria | 2095 |
| 550 | Ga0207641_11075545 | 3300026088 | Unclassified | 802 |
| 551 | Ga0207648_10001075 | 3300026089 | Bacteria | 30605 |
| 552 | Ga0207648_10918263 | 3300026089 | Bacteria | 818 |
| 553 | Ga0207676_10144444 | 3300026095 | Bacteria | 2041 |
| 554 | Ga0207676_10557049 | 3300026095 | Bacteria | 1096 |
| 555 | Ga0207676_11575435 | 3300026095 | Bacteria | 654 |
| 556 | Ga0207674_10010326 | 3300026116 | Bacteria | 10586 |
| 557 | Ga0207674_10011498 | 3300026116 | Bacteria | 9941 |
| 558 | Ga0207674_10095357 | 3300026116 | Bacteria | 2961 |
| 559 | Ga0207675_100019330 | 3300026118 | Bacteria | 6356 |
| 560 | Ga0207675_100075468 | 3300026118 | Bacteria | 3156 |
| 561 | Ga0207675_100078028 | 3300026118 | Bacteria | 3103 |
| 562 | Ga0207675_100459020 | 3300026118 | Bacteria | 1263 |
| 563 | Ga0207683_10005431 | 3300026121 | Bacteria | 10918 |
| 564 | Ga0207683_10231562 | 3300026121 | Bacteria | 1685 |
| 565 | Ga0207683_10529706 | 3300026121 | Bacteria | 1089 |
| 566 | Ga0207683_11079303 | 3300026121 | Bacteria | 745 |
| 567 | Ga0207698_10502536 | 3300026142 | Bacteria | 1180 |
| 568 | Ga0207698_10726318 | 3300026142 | Bacteria | 990 |
| 569 | Ga0207698_10935451 | 3300026142 | Bacteria | 875 |
| 570 | Ga0209588_1076492 | 3300027671 | Bacteria | 1082 |
| 571 | Ga0209813_10075398 | 3300027866 | Bacteria | 1105 |
| 572 | Ga0207428_10039794 | 3300027907 | Bacteria | 3817 |
| 573 | Ga0207428_10557741 | 3300027907 | Bacteria | 828 |
| 574 | Ga0268266_10061845 | 3300028379 | Bacteria | 3229 |
| 575 | Ga0268266_10089000 | 3300028379 | Bacteria | 2702 |
| 576 | Ga0268266_10091874 | 3300028379 | Bacteria | 2662 |
| 577 | Ga0268266_10270862 | 3300028379 | Bacteria | 1576 |
| 578 | Ga0268266_10615691 | 3300028379 | Bacteria | 1043 |
| 579 | Ga0268266_10757559 | 3300028379 | Bacteria | 937 |
| 580 | Ga0268265_10054641 | 3300028380 | Bacteria | 3031 |
| 581 | Ga0268265_10220268 | 3300028380 | Bacteria | 1660 |
| 582 | Ga0268265_10227273 | 3300028380 | Bacteria | 1637 |
| 583 | Ga0268264_10328562 | 3300028381 | Bacteria | 1448 |
| 584 | Ga0268264_10424356 | 3300028381 | Bacteria | 1283 |
| 585 | Ga0268264_10583177 | 3300028381 | Bacteria | 1100 |
| 586 | Ga0307515_10163003 | 3300028794 | Bacteria | 2263 |
| 587 | Ga0307515_10419659 | 3300028794 | Bacteria | 959 |
| 588 | Ga0265766_1015316 | 3300030863 | Bacteria | 591 |
| 589 | Ga0265328_10244845 | 3300031239 | Bacteria | 686 |
| 590 | Ga0265325_10001626 | 3300031241 | Bacteria | 15661 |
| 591 | Ga0265325_10011302 | 3300031241 | Bacteria | 5130 |
| 592 | Ga0265339_10005018 | 3300031249 | Bacteria | 8901 |
| 593 | Ga0307513_10154734 | 3300031456 | Bacteria | 2195 |
| 594 | Ga0307513_10445618 | 3300031456 | Bacteria | 1020 |
| 595 | Ga0307509_10508846 | 3300031507 | Bacteria | 887 |
| 596 | Ga0307509_10577547 | 3300031507 | Bacteria | 799 |
| 597 | Ga0307408_100421690 | 3300031548 | Bacteria | 1151 |
| 598 | Ga0307408_100536846 | 3300031548 | Bacteria | 1030 |
| 599 | Ga0310117_124297 | 3300031592 | Bacteria | 597 |
| 600 | Ga0265313_10004507 | 3300031595 | Bacteria | 10658 |
| 601 | Ga0265313_10030909 | 3300031595 | Bacteria | 2750 |
| 602 | Ga0265313_10054763 | 3300031595 | Bacteria | 1893 |
| 603 | Ga0307508_10146318 | 3300031616 | Bacteria | 1967 |
| 604 | Ga0265342_10059304 | 3300031712 | Bacteria | 2261 |
| 605 | Ga0316043_127489 | 3300031828 | Bacteria | 583 |
| 606 | Ga0307406_10316115 | 3300031901 | Bacteria | 1206 |
| 607 | Ga0307416_100168750 | 3300032002 | Bacteria | 2034 |
| 608 | Ga0307415_100036591 | 3300032126 | Bacteria | 3218 |
| 609 | Ga0307507_10213161 | 3300033179 | Bacteria | 1313 |
| 610 | Ga0307510_10062648 | 3300033180 | Bacteria | 3798 |
| 611 | Ga0307510_10440666 | 3300033180 | Bacteria | 744 |
| 612 | Ga0373948_0008489 | 3300034817 | Bacteria | 1750 |
| 613 | Ga0373958_0001587 | 3300034819 | Bacteria | 3078 |
| 614 | Ga0373926_0005541 | 3300035083 | Bacteria | 4164 |
| 615 | Ga0373934_0054317 | 3300035086 | Bacteria | 1590 |
| 616 | Ga0373944_0000364 | 3300035089 | Bacteria | 10277 |
| 617 | Ga0373944_0010085 | 3300035089 | Bacteria | 2569 |
| 618 | Ga0373944_0097139 | 3300035089 | Unclassified | 991 |
| 619 | Ga0373949_0021242 | 3300035090 | Bacteria | 1491 |
| 620 | Ga0373951_0023092 | 3300035091 | Bacteria | 1435 |
| 621 | Ga0373951_0112944 | 3300035091 | Bacteria | 733 |
| 622 | Ga0373923_0005611 | 3300035111 | Bacteria | 4272 |
| 623 | Ga0373923_0009594 | 3300035111 | Bacteria | 3499 |
| 624 | Ga0373923_0183843 | 3300035111 | Bacteria | 961 |
| 625 | Ga0373936_0008721 | 3300035113 | Bacteria | 3819 |
| 626 | Ga0373936_0081898 | 3300035113 | Bacteria | 1344 |
| 627 | Ga0373939_0133078 | 3300035114 | Unclassified | 889 |
| 628 | Ga0373939_0327484 | 3300035114 | Bacteria | 618 |
| 629 | Ga0373941_0013347 | 3300035115 | Bacteria | 2170 |
| 630 | Ga0373945_0000604 | 3300035116 | Bacteria | 10308 |
| 631 | Ga0373945_0013010 | 3300035116 | Unclassified | 2772 |
| 632 | Ga0373945_0066848 | 3300035116 | Bacteria | 1352 |
| 633 | Ga0373953_0031765 | 3300035117 | Bacteria | 2055 |
| 634 | Ga0373953_0038873 | 3300035117 | Bacteria | 1884 |
| 635 | Ga0373954_0011230 | 3300035118 | Bacteria | 3965 |
| 636 | Ga0373954_0048759 | 3300035118 | Bacteria | 1984 |
| 637 | Ga0373956_0084357 | 3300035119 | Bacteria | 1460 |
| 638 | Ga0373956_0381736 | 3300035119 | Bacteria | 672 |
| 639 | Ga0373957_0003340 | 3300035120 | Bacteria | 4729 |
| 640 | Ga0373957_0062844 | 3300035120 | Bacteria | 1441 |
| 641 | Ga0373943_0006934 | 3300035170 | Bacteria | 5082 |
| 642 | Ga0373943_0031393 | 3300035170 | Bacteria | 2520 |
| 643 | Ga0373946_0029874 | 3300035171 | Bacteria | 2172 |
| 644 | Ga0373946_0033120 | 3300035171 | Bacteria | 2078 |
| 645 | Ga0373955_0002404 | 3300035172 | Bacteria | 8159 |
| 646 | Ga0373955_0007268 | 3300035172 | Bacteria | 5084 |
| 647 | Ga0373955_0114546 | 3300035172 | Bacteria | 1562 |
| 648 | Ga0373961_0002416 | 3300035241 | Bacteria | 4853 |
| 649 | Ga0373962_0112365 | 3300035242 | Unclassified | 861 |
| 650 | Ga0373924_0006081 | 3300035410 | Bacteria | 4311 |
| 651 | Ga0373924_0006172 | 3300035410 | Bacteria | 4284 |
| 652 | Ga0373931_0096660 | 3300035691 | Bacteria | 1655 |
| 653 | Ga0373931_0199953 | 3300035691 | Bacteria | 1193 |
| 654 | Ga0373935_0013235 | 3300035692 | Bacteria | 4976 |
| 655 | Ga0373935_0399675 | 3300035692 | Bacteria | 987 |
| 656 | Ga0373935_0465733 | 3300035692 | Bacteria | 914 |
| 657 | Ga0373935_0800384 | 3300035692 | Bacteria | 696 |
| 658 | Ga0373927_0001118 | 3300035695 | Bacteria | 20382 |
| 659 | Ga0373927_0011708 | 3300035695 | Bacteria | 5839 |
| 660 | Ga0373927_0014273 | 3300035695 | Bacteria | 5264 |
| 661 | Ga0373933_0011886 | 3300035724 | Bacteria | 4806 |
| 662 | Ga0373933_0088546 | 3300035724 | Bacteria | 1907 |
| 663 | Ga0373947_0000372 | 3300035725 | Bacteria | 25344 |
| 664 | Ga0373947_0017773 | 3300035725 | Bacteria | 4090 |
| 665 | Ga0373947_0026529 | 3300035725 | Bacteria | 3387 |
| 666 | Ga0373937_0030143 | 3300036401 | Bacteria | 4914 |
| 667 | Ga0373937_0101470 | 3300036401 | Bacteria | 2671 |
| 668 | Ga0373937_0106945 | 3300036401 | Bacteria | 2600 |
| 669 | Ga0373937_0114684 | 3300036401 | Bacteria | 2508 |
| 670 | Ga0373937_0995412 | 3300036401 | Bacteria | 787 |
| 671 | Ga0310109_046298 | 3300036534 | Bacteria | 563 |
| 672 | Ga0373925_0006079 | 3300037068 | Bacteria | 8931 |
| 673 | Ga0373925_0035309 | 3300037068 | Bacteria | 3687 |
| 674 | Ga0373925_0043061 | 3300037068 | Bacteria | 3350 |
| 675 | Ga0373925_0263159 | 3300037068 | Bacteria | 1386 |
| 676 | Ga0373925_0268518 | 3300037068 | Bacteria | 1372 |
| 677 | Ga0395905_0217267 | 3300037471 | Bacteria | 1790 |
| 678 | Ga0395905_0314542 | 3300037471 | Bacteria | 1455 |
| 679 | Ga0436360_0599366 | 3300039438 | Bacteria | 2885 |
| 680 | Ga0436360_0645480 | 3300039438 | Bacteria | 1322 |
| 681 | Ga0436363_1293311 | 3300039450 | Bacteria | 6055 |
| 682 | Ga0436362_1029460 | 3300039453 | Bacteria | 3668 |
| 683 | Ga0439461_0128559 | 3300041410 | Bacteria | 639 |
| 684 | Ga0451802_0955069 | 3300041460 | Bacteria | 661 |
| 685 | Ga0451833_1205776 | 3300041491 | Bacteria | 606 |
| 686 | Ga0451853_3246118 | 3300041512 | Bacteria | 687 |
| 687 | Ga0466966_0005575 | 3300044684 | Bacteria | 8277 |
| 688 | Ga0466966_0252929 | 3300044684 | Bacteria | 1061 |
| 689 | Ga0466963_0038531 | 3300044694 | Bacteria | 3126 |
| 690 | Ga0466963_0955214 | 3300044694 | Bacteria | 604 |
| 691 | Ga0466968_0005113 | 3300044735 | Bacteria | 4908 |
| 692 | Ga0466959_0010598 | 3300045049 | Bacteria | 6598 |
| 693 | Ga0466959_0329301 | 3300045049 | Bacteria | 1043 |
| 694 | Ga0466959_0444672 | 3300045049 | Bacteria | 879 |
| 695 | Ga0466967_0021546 | 3300045976 | Bacteria | 5240 |
| 696 | Ga0495627_103522 | 3300046453 | Bacteria | 811 |
| 697 | Ga0495592_0001055 | 3300046454 | Bacteria | 19077 |
| 698 | Ga0495592_0010832 | 3300046454 | Bacteria | 6878 |
| 699 | Ga0495603_0014865 | 3300046455 | Bacteria | 4709 |
| 700 | Ga0495603_0024400 | 3300046455 | Bacteria | 3657 |
| 701 | Ga0495603_0026152 | 3300046455 | Bacteria | 3526 |
| 702 | Ga0495603_0223293 | 3300046455 | Bacteria | 1087 |
| 703 | Ga0495590_0030522 | 3300046457 | Bacteria | 1888 |
| 704 | Ga0495629_0003357 | 3300046459 | Bacteria | 12088 |
| 705 | Ga0495629_0019076 | 3300046459 | Bacteria | 4903 |
| 706 | Ga0495629_0112714 | 3300046459 | Bacteria | 1896 |
| 707 | Ga0495629_0177175 | 3300046459 | Bacteria | 1478 |
| 708 | Ga0495638_0105696 | 3300046460 | Bacteria | 1677 |
| 709 | Ga0495638_0127089 | 3300046460 | Bacteria | 1501 |
| 710 | Ga0495641_0012702 | 3300046461 | Bacteria | 4688 |
| 711 | Ga0495651_0009559 | 3300046462 | Bacteria | 7449 |
| 712 | Ga0495651_0039188 | 3300046462 | Bacteria | 3690 |
| 713 | Ga0495651_0055997 | 3300046462 | Bacteria | 3029 |
| 714 | Ga0495651_0099648 | 3300046462 | Bacteria | 2166 |
| 715 | Ga0495653_0008585 | 3300046463 | Bacteria | 8375 |
| 716 | Ga0495653_0017321 | 3300046463 | Bacteria | 5860 |
| 717 | Ga0495653_0267673 | 3300046463 | Bacteria | 1127 |
| 718 | Ga0495580_0013690 | 3300046472 | Bacteria | 6180 |
| 719 | Ga0495580_0222805 | 3300046472 | Bacteria | 1296 |
| 720 | Ga0495582_0011471 | 3300046473 | Bacteria | 4882 |
| 721 | Ga0495582_0031598 | 3300046473 | Bacteria | 2910 |
| 722 | Ga0495639_0004110 | 3300046475 | Bacteria | 6235 |
| 723 | Ga0495662_0003064 | 3300046476 | Bacteria | 8427 |
| 724 | Ga0495662_0362007 | 3300046476 | Bacteria | 713 |
| 725 | Ga0495664_0008779 | 3300046477 | Bacteria | 5647 |
| 726 | Ga0495664_0269855 | 3300046477 | Bacteria | 1028 |
| 727 | Ga0495584_0034642 | 3300046491 | Bacteria | 2553 |
| 728 | Ga0495585_0056846 | 3300046492 | Bacteria | 2160 |
| 729 | Ga0495594_0005321 | 3300046499 | Bacteria | 6610 |
| 730 | Ga0495594_0143479 | 3300046499 | Bacteria | 1355 |
| 731 | Ga0495607_0044310 | 3300046501 | Bacteria | 2624 |
| 732 | Ga0495607_0455181 | 3300046501 | Bacteria | 574 |
| 733 | Ga0495583_0042395 | 3300046506 | Bacteria | 2126 |
| 734 | Ga0495606_0055888 | 3300046507 | Bacteria | 2550 |
| 735 | Ga0495608_0033105 | 3300046511 | Bacteria | 3495 |
| 736 | Ga0495610_0044346 | 3300046512 | Bacteria | 2207 |
| 737 | Ga0495616_0035528 | 3300046513 | Bacteria | 2578 |
| 738 | Ga0495616_0113607 | 3300046513 | Bacteria | 1256 |
| 739 | Ga0495616_0312848 | 3300046513 | Bacteria | 661 |
| 740 | Ga0495618_0002517 | 3300046514 | Bacteria | 11741 |
| 741 | Ga0495618_0045723 | 3300046514 | Bacteria | 2762 |
| 742 | Ga0495618_0722148 | 3300046514 | Bacteria | 585 |
| 743 | Ga0495628_0087042 | 3300046516 | Bacteria | 2422 |
| 744 | Ga0495628_0087330 | 3300046516 | Bacteria | 2418 |
| 745 | Ga0495628_0348576 | 3300046516 | Bacteria | 1089 |
| 746 | Ga0495630_0017717 | 3300046517 | Bacteria | 5222 |
| 747 | Ga0495630_0025849 | 3300046517 | Bacteria | 4343 |
| 748 | Ga0495631_0109239 | 3300046518 | Bacteria | 1189 |
| 749 | Ga0495631_0199360 | 3300046518 | Bacteria | 856 |
| 750 | Ga0495632_0021367 | 3300046519 | Bacteria | 3489 |
| 751 | Ga0495637_0033862 | 3300046520 | Bacteria | 2241 |
| 752 | Ga0495643_0206760 | 3300046522 | Bacteria | 939 |
| 753 | Ga0495644_0002732 | 3300046523 | Bacteria | 7000 |
| 754 | Ga0495663_0046978 | 3300046525 | Bacteria | 1328 |
| 755 | Ga0495666_0006077 | 3300046526 | Bacteria | 6079 |
| 756 | Ga0495666_0020392 | 3300046526 | Bacteria | 3285 |
| 757 | Ga0495666_0152763 | 3300046526 | Bacteria | 1073 |
| 758 | Ga0495652_0108337 | 3300046529 | Bacteria | 2239 |
| 759 | Ga0495652_0145992 | 3300046529 | Bacteria | 1854 |
| 760 | Ga0495665_0032754 | 3300046531 | Bacteria | 2780 |
| 761 | Ga0495640_0006867 | 3300046533 | Bacteria | 8966 |
| 762 | Ga0495640_0051277 | 3300046533 | Bacteria | 2836 |
| 763 | Ga0495640_0183560 | 3300046533 | Bacteria | 1332 |
| 764 | Ga0495586_0087335 | 3300046535 | Bacteria | 1719 |
| 765 | Ga0495586_0230257 | 3300046535 | Bacteria | 1054 |
| 766 | Ga0495587_0026482 | 3300046536 | Bacteria | 3536 |
| 767 | Ga0495587_0051328 | 3300046536 | Bacteria | 2438 |
| 768 | Ga0495598_0058368 | 3300046537 | Bacteria | 1183 |
| 769 | Ga0495598_0067460 | 3300046537 | Bacteria | 1119 |
| 770 | Ga0495609_0033203 | 3300046538 | Bacteria | 2343 |
| 771 | Ga0495621_0013532 | 3300046539 | Bacteria | 2566 |
| 772 | Ga0495597_0092747 | 3300046542 | Bacteria | 1280 |
| 773 | Ga0495622_0006399 | 3300046557 | Bacteria | 5467 |
| 774 | Ga0495633_0009880 | 3300046558 | Bacteria | 5241 |
| 775 | Ga0495633_0018095 | 3300046558 | Bacteria | 3584 |
| 776 | Ga0495667_0008737 | 3300046559 | Bacteria | 6882 |
| 777 | Ga0495667_0020910 | 3300046559 | Bacteria | 4416 |
| 778 | Ga0495667_0078258 | 3300046559 | Bacteria | 2150 |
| 779 | Ga0495667_0106403 | 3300046559 | Bacteria | 1813 |
| 780 | Ga0495656_0000064 | 3300046615 | Bacteria | 48582 |
| 781 | Ga0495656_0046515 | 3300046615 | Bacteria | 1836 |
| 782 | Ga0495656_0048334 | 3300046615 | Bacteria | 1807 |
| 783 | Ga0495668_0025416 | 3300046616 | Bacteria | 3364 |
| 784 | Ga0495634_0026538 | 3300046642 | Bacteria | 4041 |
| 785 | Ga0495634_0047460 | 3300046642 | Bacteria | 2893 |
| 786 | Ga0495611_0105572 | 3300046648 | Bacteria | 1310 |
| 787 | Ga0495611_0124745 | 3300046648 | Bacteria | 1201 |
| 788 | Ga0495611_0226481 | 3300046648 | Bacteria | 869 |
| 789 | Ga0495625_0006076 | 3300046660 | Bacteria | 10838 |
| 790 | Ga0495625_0047212 | 3300046660 | Bacteria | 3105 |
| 791 | Ga0495625_0658367 | 3300046660 | Bacteria | 623 |
| 792 | Ga0495635_0008796 | 3300046663 | Bacteria | 7049 |
| 793 | Ga0495635_0037890 | 3300046663 | Bacteria | 3338 |
| 794 | Ga0495635_0122079 | 3300046663 | Bacteria | 1776 |
| 795 | Ga0495659_0208813 | 3300046664 | Bacteria | 803 |
| 796 | Ga0495661_0036088 | 3300046665 | Bacteria | 3097 |
| 797 | Ga0495661_0150914 | 3300046665 | Bacteria | 1255 |
| 798 | Ga0495661_0225380 | 3300046665 | Bacteria | 969 |
| 799 | Ga0495588_0011011 | 3300046674 | Bacteria | 4231 |
| 800 | Ga0495588_0018681 | 3300046674 | Bacteria | 3384 |
| 801 | Ga0495657_0047604 | 3300046675 | Bacteria | 2897 |
| 802 | Ga0495657_0106638 | 3300046675 | Bacteria | 1779 |
| 803 | Ga0495657_0202029 | 3300046675 | Bacteria | 1211 |
| 804 | Ga0495657_0509451 | 3300046675 | Bacteria | 701 |
| 805 | Ga0495599_0021867 | 3300046678 | Bacteria | 3993 |
| 806 | Ga0495599_0043307 | 3300046678 | Bacteria | 2824 |
| 807 | Ga0495623_0036443 | 3300046679 | Bacteria | 3150 |
| 808 | Ga0495623_0248643 | 3300046679 | Bacteria | 1001 |
| 809 | Ga0495646_0003336 | 3300046680 | Bacteria | 9986 |
| 810 | Ga0495647_0015713 | 3300046681 | Bacteria | 2657 |
| 811 | Ga0495647_0017786 | 3300046681 | Bacteria | 2520 |
| 812 | Ga0495658_0001834 | 3300046683 | Bacteria | 10873 |
| 813 | Ga0495658_0010431 | 3300046683 | Bacteria | 4648 |
| 814 | Ga0495658_0311236 | 3300046683 | Bacteria | 997 |
| 815 | Ga0495658_0444063 | 3300046683 | Bacteria | 828 |
| 816 | Ga0495669_0241913 | 3300046684 | Bacteria | 866 |
| 817 | Ga0495669_0266358 | 3300046684 | Bacteria | 823 |
| 818 | Ga0495613_0033299 | 3300046689 | Bacteria | 3829 |
| 819 | Ga0495613_0102619 | 3300046689 | Bacteria | 2065 |
| 820 | Ga0495613_0182144 | 3300046689 | Bacteria | 1487 |
| 821 | Ga0495613_0819128 | 3300046689 | Bacteria | 607 |
| 822 | Ga0495624_0005807 | 3300046690 | Bacteria | 8837 |
| 823 | Ga0495624_0045904 | 3300046690 | Bacteria | 2779 |
| 824 | Ga0495670_0090641 | 3300046691 | Bacteria | 1564 |
| 825 | Ga0495671_0013849 | 3300046692 | Bacteria | 4351 |
| 826 | Ga0495589_0247988 | 3300046794 | Bacteria | 832 |
| 827 | Ga0495600_0000716 | 3300046809 | Bacteria | 17441 |
| 828 | Ga0495600_0001994 | 3300046809 | Bacteria | 11472 |
| 829 | Ga0495600_0181124 | 3300046809 | Bacteria | 1358 |
| 830 | Ga0495660_0128889 | 3300046810 | Bacteria | 1271 |
| 831 | Ga0495660_0343500 | 3300046810 | Bacteria | 665 |
| 832 | Ga0495581_0020045 | 3300047315 | Bacteria | 3882 |
| 833 | Ga0495581_0072896 | 3300047315 | Bacteria | 1987 |
| 834 | Ga0495581_0073317 | 3300047315 | Bacteria | 1981 |
| 835 | Ga0495604_0025973 | 3300047317 | Bacteria | 4665 |
| 836 | Ga0495604_0039798 | 3300047317 | Bacteria | 3693 |
| 837 | Ga0495604_0054739 | 3300047317 | Bacteria | 3077 |
| 838 | Ga0495636_0095471 | 3300047318 | Bacteria | 1295 |
| 839 | Ga0495674_0088487 | 3300047319 | Bacteria | 2648 |
| 840 | Ga0495674_0345361 | 3300047319 | Bacteria | 1209 |
| 841 | Ga0495672_0079076 | 3300047320 | Bacteria | 1837 |
| 842 | Ga0495676_0030061 | 3300047321 | Bacteria | 4617 |
| 843 | Ga0495676_0050140 | 3300047321 | Bacteria | 3350 |
| 844 | Ga0495676_0052812 | 3300047321 | Bacteria | 3242 |
| 845 | Ga0495676_0346310 | 3300047321 | Unclassified | 994 |
| 846 | Ga0495680_0011117 | 3300047322 | Bacteria | 7991 |
| 847 | Ga0495680_0014218 | 3300047322 | Bacteria | 6903 |
| 848 | Ga0495680_0045137 | 3300047322 | Bacteria | 3481 |
| 849 | Ga0495680_0301870 | 3300047322 | Bacteria | 1124 |
| 850 | Ga0495675_0104372 | 3300047444 | Bacteria | 1771 |
| 851 | Ga0495675_0154536 | 3300047444 | Bacteria | 1416 |
| 852 | Ga0495673_0035535 | 3300047469 | Bacteria | 2295 |
| 853 | Ga0495684_0003050 | 3300047471 | Bacteria | 13176 |
| 854 | Ga0495684_0006284 | 3300047471 | Bacteria | 9233 |
| 855 | Ga0495684_0022194 | 3300047471 | Bacteria | 4886 |
| 856 | Ga0495684_0220457 | 3300047471 | Bacteria | 1391 |
| 857 | Ga0495684_0324079 | 3300047471 | Bacteria | 1101 |
| 858 | Ga0495684_0332537 | 3300047471 | Bacteria | 1083 |
| 859 | Ga0495686_0017077 | 3300047472 | Bacteria | 4900 |
| 860 | Ga0495686_0223799 | 3300047472 | Bacteria | 1069 |
| 861 | Ga0495593_0003538 | 3300047673 | Bacteria | 9347 |
| 862 | Ga0495593_0003546 | 3300047673 | Bacteria | 9336 |
| 863 | Ga0495593_0007526 | 3300047673 | Bacteria | 6367 |
| 864 | Ga0495593_0029887 | 3300047673 | Bacteria | 2985 |
| 865 | Ga0495593_0093302 | 3300047673 | Bacteria | 1549 |
| 866 | Ga0495602_0086153 | 3300048088 | Bacteria | 2623 |
| 867 | Ga0495602_0094544 | 3300048088 | Bacteria | 2469 |
| 868 | Ga0495602_0215159 | 3300048088 | Bacteria | 1455 |
| 869 | Ga0495602_0237050 | 3300048088 | Bacteria | 1367 |
| 870 | Ga0495602_0271223 | 3300048088 | Bacteria | 1254 |
| 871 | Ga0495602_0561486 | 3300048088 | Bacteria | 790 |
| 872 | Ga0495614_0012122 | 3300048089 | Bacteria | 3786 |
| 873 | Ga0495626_0086193 | 3300048091 | Bacteria | 1388 |
| 874 | Ga0495626_0260181 | 3300048091 | Bacteria | 694 |
| 875 | Ga0496100_0007837 | 3300048903 | Bacteria | 5926 |
| 876 | Ga0496100_0100720 | 3300048903 | Bacteria | 1990 |
| 877 | Ga0496101_0138194 | 3300048904 | Bacteria | 1855 |
| 878 | Ga0496101_0266194 | 3300048904 | Bacteria | 1338 |
| 879 | Ga0496101_0401158 | 3300048904 | Bacteria | 1080 |
| 880 | Ga0496102_0032922 | 3300048905 | Bacteria | 4658 |
| 881 | Ga0496102_0041408 | 3300048905 | Bacteria | 4171 |
| 882 | Ga0496102_0061565 | 3300048905 | Bacteria | 3435 |
| 883 | Ga0496102_0123500 | 3300048905 | Bacteria | 2419 |
| 884 | Ga0496102_0131901 | 3300048905 | Bacteria | 2339 |
| 885 | Ga0496102_0362100 | 3300048905 | Bacteria | 1365 |
| 886 | Ga0496103_0071414 | 3300048906 | Bacteria | 2172 |
| 887 | Ga0496103_0097141 | 3300048906 | Bacteria | 1862 |
| 888 | Ga0496103_0381642 | 3300048906 | Bacteria | 905 |
| 889 | Ga0496104_0008842 | 3300048907 | Bacteria | 8953 |
| 890 | Ga0496104_0219238 | 3300048907 | Bacteria | 1815 |
| 891 | Ga0496104_0926033 | 3300048907 | Bacteria | 776 |
| 892 | Ga0496105_0162145 | 3300048908 | Bacteria | 1835 |
| 893 | Ga0496105_0502104 | 3300048908 | Bacteria | 952 |
| 894 | Ga0496105_0585446 | 3300048908 | Unclassified | 867 |
| 895 | Ga0496106_0029877 | 3300048909 | Bacteria | 4062 |
| 896 | Ga0496106_0041002 | 3300048909 | Bacteria | 3468 |
| 897 | Ga0496106_0097958 | 3300048909 | Bacteria | 2271 |
| 898 | Ga0496107_0138809 | 3300048910 | Bacteria | 1796 |
| 899 | Ga0496107_0473597 | 3300048910 | Bacteria | 929 |
| 900 | Ga0496107_1142889 | 3300048910 | Bacteria | 561 |
| 901 | Ga0496108_0005621 | 3300048911 | Bacteria | 10146 |
| 902 | Ga0496108_0181363 | 3300048911 | Bacteria | 1823 |
| 903 | Ga0496109_0076356 | 3300048912 | Bacteria | 3081 |
| 904 | Ga0496109_0315076 | 3300048912 | Bacteria | 1476 |
| 905 | Ga0496109_0328581 | 3300048912 | Bacteria | 1443 |
| 906 | Ga0496110_0065588 | 3300048913 | Bacteria | 3210 |
| 907 | Ga0496110_0320163 | 3300048913 | Bacteria | 1413 |
| 908 | Ga0496110_0384154 | 3300048913 | Bacteria | 1279 |
| 909 | Ga0496110_0430367 | 3300048913 | Bacteria | 1203 |
| 910 | Ga0496110_0453250 | 3300048913 | Bacteria | 1169 |
| 911 | Ga0496111_0048697 | 3300048914 | Bacteria | 3053 |
| 912 | Ga0496111_0219840 | 3300048914 | Bacteria | 1411 |
| 913 | Ga0496111_0454743 | 3300048914 | Unclassified | 944 |
| 914 | Ga0496112_0006027 | 3300048915 | Bacteria | 10582 |
| 915 | Ga0496112_0331113 | 3300048915 | Bacteria | 1466 |
| 916 | Ga0496112_0406145 | 3300048915 | Bacteria | 1301 |
| 917 | Ga0496112_0776215 | 3300048915 | Bacteria | 884 |
| 918 | Ga0496113_0030783 | 3300048916 | Bacteria | 3887 |
| 919 | Ga0496113_0130337 | 3300048916 | Bacteria | 1973 |
| 920 | Ga0496113_0149706 | 3300048916 | Bacteria | 1840 |
| 921 | Ga0496113_0163115 | 3300048916 | Bacteria | 1762 |
| 922 | Ga0496114_0060904 | 3300048917 | Bacteria | 3155 |
| 923 | Ga0496114_0152579 | 3300048917 | Bacteria | 2004 |
| 924 | Ga0496114_0208628 | 3300048917 | Bacteria | 1713 |
| 925 | Ga0496114_0307910 | 3300048917 | Bacteria | 1399 |
| 926 | Ga0496114_0333238 | 3300048917 | Bacteria | 1341 |
| 927 | Ga0496115_0033633 | 3300048918 | Bacteria | 4048 |
| 928 | Ga0496115_0046778 | 3300048918 | Bacteria | 3459 |
| 929 | Ga0496115_0121803 | 3300048918 | Bacteria | 2147 |
| 930 | Ga0496115_0214364 | 3300048918 | Bacteria | 1590 |
| 931 | Ga0496115_0215701 | 3300048918 | Bacteria | 1584 |
| 932 | Ga0496115_0231623 | 3300048918 | Bacteria | 1523 |
| 933 | Ga0496115_0353296 | 3300048918 | Bacteria | 1198 |
| 934 | Ga0496116_0349539 | 3300048919 | Bacteria | 678 |
| 935 | Ga0496117_0202176 | 3300048920 | Bacteria | 1121 |
| 936 | Ga0496118_0059696 | 3300048921 | Bacteria | 2837 |
| 937 | Ga0496118_0116918 | 3300048921 | Bacteria | 1751 |
| 938 | Ga0496118_0224777 | 3300048921 | Bacteria | 1089 |
| 939 | Ga0496120_0080935 | 3300048923 | Bacteria | 1759 |
| 940 | Ga0496120_0131365 | 3300048923 | Bacteria | 1282 |
| 941 | Ga0496121_0000300 | 3300048924 | Bacteria | 102506 |
| 942 | Ga0496121_0026815 | 3300048924 | Bacteria | 5413 |
| 943 | Ga0496121_0027734 | 3300048924 | Bacteria | 5293 |
| 944 | Ga0496121_0041567 | 3300048924 | Bacteria | 4016 |
| 945 | Ga0496121_0074274 | 3300048924 | Bacteria | 2720 |
| 946 | Ga0496121_0179884 | 3300048924 | Bacteria | 1527 |
| 947 | Ga0496121_0279163 | 3300048924 | Bacteria | 1144 |
| 948 | Ga0496121_0592625 | 3300048924 | Bacteria | 685 |
| 949 | Ga0496121_0597692 | 3300048924 | Bacteria | 681 |
| 950 | Ga0496122_0010659 | 3300048925 | Bacteria | 9438 |
| 951 | Ga0496122_0082401 | 3300048925 | Bacteria | 2234 |
| 952 | Ga0496122_0246162 | 3300048925 | Bacteria | 1004 |
| 953 | Ga0496123_0072978 | 3300048926 | Bacteria | 2132 |
| 954 | Ga0496123_0073217 | 3300048926 | Bacteria | 2126 |
| 955 | Ga0496123_0181476 | 3300048926 | Bacteria | 1099 |
| 956 | Ga0496124_0215824 | 3300048927 | Bacteria | 1447 |
| 957 | Ga0496124_0305892 | 3300048927 | Bacteria | 1146 |
| 958 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 959 | Ga0496125_0057601 | 3300048928 | Bacteria | 3145 |
| 960 | Ga0496126_0008064 | 3300048929 | Bacteria | 11410 |
| 961 | Ga0496126_0008100 | 3300048929 | Bacteria | 11382 |
| 962 | Ga0496126_0031081 | 3300048929 | Bacteria | 5049 |
| 963 | Ga0496126_0099390 | 3300048929 | Bacteria | 2548 |
| 964 | Ga0496126_0133791 | 3300048929 | Bacteria | 2140 |
| 965 | Ga0496126_0139126 | 3300048929 | Bacteria | 2092 |
| 966 | Ga0496126_0174394 | 3300048929 | Bacteria | 1830 |
| 967 | Ga0496126_0254741 | 3300048929 | Bacteria | 1461 |
| 968 | Ga0501031_0502400 | 3300049568 | Bacteria | 782 |
| 969 | Ga0501032_0001391 | 3300049569 | Bacteria | 19212 |
| 970 | Ga0501033_0000304 | 3300049570 | Bacteria | 46485 |
| 971 | Ga0501033_0257829 | 3300049570 | Bacteria | 1235 |
| 972 | Ga0501034_0028770 | 3300049571 | Bacteria | 5654 |
| 973 | Ga0501034_0061482 | 3300049571 | Bacteria | 3771 |
| 974 | Ga0501036_0093458 | 3300049572 | Bacteria | 2541 |
| 975 | Ga0501036_0117424 | 3300049572 | Bacteria | 2247 |
| 976 | Ga0501037_0000154 | 3300049573 | Bacteria | 64077 |
| 977 | Ga0501037_0202150 | 3300049573 | Bacteria | 1404 |
| 978 | Ga0501037_0322494 | 3300049573 | Bacteria | 1069 |
| 979 | Ga0501038_0465060 | 3300049574 | Bacteria | 971 |
| 980 | Ga0501038_0951447 | 3300049574 | Bacteria | 632 |
| 981 | Ga0501039_0190507 | 3300049575 | Bacteria | 1613 |
| 982 | Ga0501041_0009638 | 3300049577 | Bacteria | 5694 |
| 983 | Ga0501041_0433754 | 3300049577 | Bacteria | 834 |
| 984 | Ga0501042_0027891 | 3300049578 | Bacteria | 3973 |
| 985 | Ga0501043_0000007 | 3300049579 | Bacteria | 224595 |
| 986 | Ga0501043_0337856 | 3300049579 | Bacteria | 1146 |
| 987 | Ga0501047_0000740 | 3300049581 | Bacteria | 34045 |
| 988 | Ga0501047_0036680 | 3300049581 | Bacteria | 4739 |
| 989 | Ga0501047_0124460 | 3300049581 | Bacteria | 2459 |
| 990 | Ga0501047_0462930 | 3300049581 | Bacteria | 1097 |
| 991 | Ga0501048_0048949 | 3300049582 | Bacteria | 3014 |
| 992 | Ga0501067_0027605 | 3300049583 | Bacteria | 3146 |
| 993 | Ga0501067_0159701 | 3300049583 | Bacteria | 1255 |
| 994 | Ga0501067_0197413 | 3300049583 | Bacteria | 1121 |
| 995 | Ga0501067_0650151 | 3300049583 | Bacteria | 592 |
| 996 | Ga0501068_0180196 | 3300049584 | Bacteria | 1336 |
| 997 | Ga0501068_0342319 | 3300049584 | Bacteria | 960 |
| 998 | Ga0501069_0000027 | 3300049585 | Bacteria | 106217 |
| 999 | Ga0501069_0019796 | 3300049585 | Bacteria | 3641 |
| 1000 | Ga0501069_0061284 | 3300049585 | Bacteria | 2100 |
| 1001 | Ga0501069_0299895 | 3300049585 | Bacteria | 942 |
| 1002 | Ga0501070_0000160 | 3300049586 | Bacteria | 61662 |
| 1003 | Ga0501070_0000457 | 3300049586 | Bacteria | 37005 |
| 1004 | Ga0501070_0039896 | 3300049586 | Bacteria | 3915 |
| 1005 | Ga0501070_0064803 | 3300049586 | Bacteria | 3025 |
| 1006 | Ga0501070_0067828 | 3300049586 | Bacteria | 2954 |
| 1007 | Ga0501071_0006794 | 3300049587 | Bacteria | 7452 |
| 1008 | Ga0501071_0462787 | 3300049587 | Bacteria | 971 |
| 1009 | Ga0501071_0745146 | 3300049587 | Bacteria | 755 |
| 1010 | Ga0501072_1048843 | 3300049588 | Bacteria | 635 |
| 1011 | Ga0501073_0017148 | 3300049589 | Bacteria | 5245 |
| 1012 | Ga0501073_0027588 | 3300049589 | Bacteria | 4060 |
| 1013 | Ga0501074_0000066 | 3300049590 | Bacteria | 50258 |
| 1014 | Ga0501074_0025835 | 3300049590 | Bacteria | 4261 |
| 1015 | Ga0501074_0037426 | 3300049590 | Bacteria | 3517 |
| 1016 | Ga0501074_0781597 | 3300049590 | Bacteria | 673 |
| 1017 | Ga0501075_0029046 | 3300049591 | Bacteria | 4087 |
| 1018 | Ga0501076_0011562 | 3300049592 | Bacteria | 6582 |
| 1019 | Ga0501077_0022301 | 3300049593 | Bacteria | 4010 |
| 1020 | Ga0501079_0387449 | 3300049741 | Bacteria | 1096 |
| 1021 | Ga0501080_0000667 | 3300049742 | Bacteria | 27300 |
| 1022 | Ga0501080_0002747 | 3300049742 | Bacteria | 15450 |
| 1023 | Ga0501080_0053345 | 3300049742 | Bacteria | 3763 |
| 1024 | Ga0501081_0218907 | 3300049743 | Bacteria | 1384 |
| 1025 | Ga0501083_0000012 | 3300049744 | Bacteria | 178668 |
| 1026 | Ga0501083_0053745 | 3300049744 | Bacteria | 2704 |
| 1027 | Ga0501083_0284373 | 3300049744 | Bacteria | 1076 |
| 1028 | Ga0501035_0000073 | 3300049822 | Bacteria | 122603 |
| 1029 | Ga0501035_0000806 | 3300049822 | Bacteria | 33416 |
| 1030 | Ga0501035_0004991 | 3300049822 | Bacteria | 12570 |
| 1031 | Ga0501035_0012174 | 3300049822 | Bacteria | 7956 |
| 1032 | Ga0501044_0000118 | 3300049823 | Bacteria | 95218 |
| 1033 | Ga0501044_0063285 | 3300049823 | Bacteria | 3780 |
| 1034 | Ga0501044_0084403 | 3300049823 | Bacteria | 3210 |
| 1035 | Ga0501044_0101385 | 3300049823 | Bacteria | 2896 |
| 1036 | Ga0501045_0008186 | 3300049824 | Bacteria | 7281 |
| 1037 | nmdc:mga03n38_1260_c1 | 3300050490 | Bacteria | 7117 |
| 1038 | nmdc:mga03n38_313483_c1 | 3300050490 | Bacteria | 845 |
| 1039 | nmdc:mga00v17_36886_c1 | 3300050491 | Bacteria | 2916 |
| 1040 | nmdc:mga00v17_505748_c1 | 3300050491 | Bacteria | 783 |
| 1041 | nmdc:mga0yw44_42149_c1 | 3300050492 | Bacteria | 2721 |
| 1042 | nmdc:mga0k408_92180_c1 | 3300050493 | Bacteria | 1780 |
| 1043 | nmdc:mga06z11_105767_c1 | 3300050494 | Bacteria | 1551 |
| 1044 | nmdc:mga06z11_185807_c1 | 3300050494 | Bacteria | 1201 |
| 1045 | nmdc:mga06z11_2201_c1 | 3300050494 | Bacteria | 7403 |
| 1046 | nmdc:mga06z11_82275_c1 | 3300050494 | Bacteria | 1730 |
| 1047 | nmdc:mga04h51_90062_c1 | 3300050495 | Bacteria | 1103 |
| 1048 | nmdc:mga07m45_135581_c1 | 3300050496 | Bacteria | 1425 |
| 1049 | nmdc:mga07m45_14332_c1 | 3300050496 | Bacteria | 4221 |
| 1050 | nmdc:mga05p37_16785_c1 | 3300050507 | Bacteria | 8826 |
| 1051 | nmdc:mga08y16_263276_c1 | 3300050511 | Bacteria | 1780 |
| 1052 | nmdc:mga08y16_514553_c1 | 3300050511 | Bacteria | 1215 |
| 1053 | nmdc:mga08y16_792478_c1 | 3300050511 | Bacteria | 941 |
| 1054 | nmdc:mga0n895_54520_c1 | 3300050512 | Bacteria | 3933 |
| 1055 | nmdc:mga0n895_574276_c1 | 3300050512 | Bacteria | 1132 |
| 1056 | nmdc:mga0rr50_30428_c1 | 3300050513 | Bacteria | 3822 |
| 1057 | nmdc:mga0rr50_400664_c1 | 3300050513 | Bacteria | 1159 |
| 1058 | nmdc:mga0rr50_84036_c1 | 3300050513 | Bacteria | 2463 |
| 1059 | nmdc:mga08x19_385_c1 | 3300050514 | Bacteria | 31031 |
| 1060 | nmdc:mga08x19_567685_c1 | 3300050514 | Bacteria | 803 |
| 1061 | nmdc:mga08x19_78001_c1 | 3300050514 | Bacteria | 2170 |
| 1062 | nmdc:mga0a205_59017_c1 | 3300050515 | Bacteria | 3706 |
| 1063 | nmdc:mga0sz30_276759_c1 | 3300050516 | Bacteria | 748 |
| 1064 | Ga0495601_0006582 | 3300053077 | Bacteria | 6795 |
| 1065 | Ga0495601_0042864 | 3300053077 | Bacteria | 2841 |
| 1066 | Ga0495601_0052397 | 3300053077 | Bacteria | 2576 |
| 1067 | Ga0495601_0243152 | 3300053077 | Bacteria | 1175 |
| 1068 | Ga0495601_0622022 | 3300053077 | Unclassified | 692 |
| 1069 | Ga0495601_0729729 | 3300053077 | Bacteria | 631 |
| 1070 | Ga0495612_0008895 | 3300053078 | Bacteria | 4069 |
| 1071 | Ga0495612_0021744 | 3300053078 | Bacteria | 2573 |
| 1072 | Ga0495595_0015072 | 3300053084 | Bacteria | 3291 |
| 1073 | Ga0495595_0022370 | 3300053084 | Bacteria | 2775 |
| 1074 | Ga0495595_0118598 | 3300053084 | Bacteria | 1288 |
| 1075 | Ga0495595_0335813 | 3300053084 | Bacteria | 762 |
| 1076 | Ga0495619_0001498 | 3300053085 | Bacteria | 15394 |
| 1077 | Ga0495619_0003381 | 3300053085 | Bacteria | 10311 |
| 1078 | Ga0495619_0015555 | 3300053085 | Bacteria | 4814 |
| 1079 | Ga0495619_0057783 | 3300053085 | Bacteria | 2574 |
| 1080 | Ga0500578_0099973 | 3300053086 | Bacteria | 1836 |
| 1081 | Ga0500643_020438 | 3300053087 | Bacteria | 2165 |
| 1082 | Ga0500644_0129367 | 3300053088 | Bacteria | 992 |
| 1083 | Ga0500581_350604 | 3300053089 | Bacteria | 559 |
| 1084 | Ga0500646_0012929 | 3300053090 | Bacteria | 2159 |
| 1085 | Ga0500583_0128116 | 3300053092 | Bacteria | 1258 |
| 1086 | Ga0500651_0131840 | 3300053093 | Bacteria | 1511 |
| 1087 | Ga0500641_0014666 | 3300053096 | Bacteria | 2894 |
| 1088 | Ga0500641_0040818 | 3300053096 | Bacteria | 1875 |
| 1089 | Ga0500650_0003179 | 3300053098 | Bacteria | 5640 |
| 1090 | Ga0500555_010336 | 3300053103 | Bacteria | 2675 |
| 1091 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 1092 | Ga0500562_021012 | 3300053108 | Bacteria | 1695 |
| 1093 | Ga0500569_002523 | 3300053109 | Bacteria | 3621 |
| 1094 | Ga0500569_113399 | 3300053109 | Bacteria | 898 |
| 1095 | Ga0500592_002541 | 3300053116 | Bacteria | 2929 |
| 1096 | Ga0500594_0007830 | 3300053118 | Bacteria | 2422 |
| 1097 | Ga0500618_030349 | 3300053125 | Bacteria | 1272 |
| 1098 | Ga0500642_0069549 | 3300053130 | Bacteria | 1599 |
| 1099 | Ga0500652_000308 | 3300053131 | Bacteria | 17703 |
| 1100 | Ga0500655_032263 | 3300053133 | Bacteria | 1011 |
| 1101 | Ga0500658_0043021 | 3300053134 | Bacteria | 1817 |
| 1102 | Ga0500658_0162204 | 3300053134 | Bacteria | 1012 |
| 1103 | Ga0500559_0027141 | 3300053136 | Bacteria | 2443 |
| 1104 | Ga0500561_0098936 | 3300053137 | Bacteria | 872 |
| 1105 | Ga0500568_0001108 | 3300053139 | Bacteria | 18102 |
| 1106 | Ga0500568_0002973 | 3300053139 | Bacteria | 9699 |
| 1107 | Ga0500588_0026501 | 3300053146 | Bacteria | 1622 |
| 1108 | Ga0500589_144075 | 3300053147 | Bacteria | 978 |
| 1109 | Ga0500603_264010 | 3300053150 | Bacteria | 555 |
| 1110 | Ga0500604_0001327 | 3300053151 | Bacteria | 6881 |
| 1111 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 1112 | Ga0500622_0002439 | 3300053156 | Bacteria | 13426 |
| 1113 | Ga0500627_0027269 | 3300053158 | Bacteria | 2363 |
| 1114 | Ga0500633_0164550 | 3300053160 | Bacteria | 832 |
| 1115 | Ga0500636_0006978 | 3300053177 | Bacteria | 6512 |
| 1116 | Ga0500637_0324071 | 3300053178 | Bacteria | 831 |
| 1117 | Ga0500570_068096 | 3300053724 | Bacteria | 1678 |
| 1118 | Ga0500611_020368 | 3300053727 | Bacteria | 1251 |
| 1119 | Ga0500645_049728 | 3300053730 | Bacteria | 1225 |
| 1120 | Ga0500645_141472 | 3300053730 | Bacteria | 665 |
| 1121 | Ga0500645_172834 | 3300053730 | Bacteria | 590 |
| 1122 | Ga0500656_064851 | 3300053732 | Bacteria | 554 |
| 1123 | Ga0501084_0256827 | 3300054114 | Bacteria | 1475 |
| 1124 | Ga0501084_0305024 | 3300054114 | Bacteria | 1345 |
| 1125 | Ga0590075_102911 | 3300059424 | Bacteria | 744 |
| 1126 | Ga0587073_0070410 | 3300059492 | Bacteria | 844 |
| 1127 | Ga0587073_0089077 | 3300059492 | Bacteria | 781 |
| 1128 | Ga0587073_0147584 | 3300059492 | Bacteria | 662 |
| 1129 | Ga0587073_0183640 | 3300059492 | Bacteria | 616 |
| 1130 | Ga0587077_090800 | 3300059493 | Bacteria | 718 |
| 1131 | Ga0587080_064058 | 3300059503 | Bacteria | 722 |
| 1132 | Ga0587082_073584 | 3300059504 | Bacteria | 699 |
| 1133 | Ga0587082_084638 | 3300059504 | Bacteria | 667 |
| 1134 | Ga0587088_137651 | 3300059508 | Bacteria | 580 |
| 1135 | Ga0587129_011806 | 3300059608 | Bacteria | 691 |
| 1136 | Ga0587072_094761 | 3300059643 | Bacteria | 662 |
| 1137 | Ga0501082_0043509 | 3300060353 | Bacteria | 3872 |
| 1138 | Ga0501082_0169930 | 3300060353 | Bacteria | 1895 |
| 1139 | Ga0501082_1428585 | 3300060353 | Bacteria | 604 |
| 1140 | Ga0530510_0080336 | 3300061734 | Bacteria | 2373 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025907 | Ga0207645_10005784 | Ga0207645_1000578410 | 151 |
| 2 | 3300046501 | Ga0495607_0455181 | Ga0495607_0455181_21_497 | 151 |
| 3 | 3300046689 | Ga0495613_0819128 | Ga0495613_0819128_20_496 | 151 |
| 4 | 3300010375 | Ga0105239_10091468 | Ga0105239_100914685 | 155 |
| 5 | 3300005578 | Ga0068854_101707607 | Ga0068854_1017076071 | 156 |
| 6 | 3300001979 | JGI24740J21852_10024470 | JGI24740J21852_100244702 | 157 |
| 7 | 3300001989 | JGI24739J22299_10007360 | JGI24739J22299_100073602 | 157 |
| 8 | 3300001990 | JGI24737J22298_10008541 | JGI24737J22298_100085414 | 157 |
| 9 | 3300002067 | JGI24735J21928_10013907 | JGI24735J21928_100139072 | 157 |
| 10 | 3300005455 | Ga0070663_100113623 | Ga0070663_1001136234 | 157 |
| 11 | 3300005455 | Ga0070663_100420146 | Ga0070663_1004201461 | 157 |
| 12 | 3300005457 | Ga0070662_101063909 | Ga0070662_1010639091 | 157 |
| 13 | 3300005539 | Ga0068853_100039011 | Ga0068853_1000390113 | 157 |
| 14 | 3300005539 | Ga0068853_100130476 | Ga0068853_1001304761 | 157 |
| 15 | 3300005563 | Ga0068855_100110751 | Ga0068855_1001107512 | 157 |
| 16 | 3300005564 | Ga0070664_100481716 | Ga0070664_1004817162 | 157 |
| 17 | 3300005577 | Ga0068857_100020850 | Ga0068857_1000208503 | 157 |
| 18 | 3300005578 | Ga0068854_100006791 | Ga0068854_1000067914 | 157 |
| 19 | 3300005578 | Ga0068854_100006800 | Ga0068854_1000068002 | 157 |
| 20 | 3300005614 | Ga0068856_100028283 | Ga0068856_1000282832 | 157 |
| 21 | 3300005616 | Ga0068852_100391373 | Ga0068852_1003913732 | 157 |
| 22 | 3300005834 | Ga0068851_10009198 | Ga0068851_100091984 | 157 |
| 23 | 3300009093 | Ga0105240_10030730 | Ga0105240_100307304 | 157 |
| 24 | 3300009093 | Ga0105240_10196998 | Ga0105240_101969982 | 157 |
| 25 | 3300009174 | Ga0105241_10066421 | Ga0105241_100664212 | 157 |
| 26 | 3300009174 | Ga0105241_10406303 | Ga0105241_104063031 | 157 |
| 27 | 3300009545 | Ga0105237_10317584 | Ga0105237_103175842 | 157 |
| 28 | 3300009551 | Ga0105238_10035982 | Ga0105238_100359823 | 157 |
| 29 | 3300009551 | Ga0105238_10049838 | Ga0105238_100498383 | 157 |
| 30 | 3300010375 | Ga0105239_10152572 | Ga0105239_101525721 | 157 |
| 31 | 3300025904 | Ga0207647_10005519 | Ga0207647_100055194 | 157 |
| 32 | 3300025911 | Ga0207654_10002142 | Ga0207654_100021428 | 157 |
| 33 | 3300025913 | Ga0207695_10015064 | Ga0207695_100150643 | 157 |
| 34 | 3300025914 | Ga0207671_10008930 | Ga0207671_100089308 | 157 |
| 35 | 3300025914 | Ga0207671_10716188 | Ga0207671_107161881 | 157 |
| 36 | 3300025924 | Ga0207694_10000275 | Ga0207694_1000027526 | 157 |
| 37 | 3300025933 | Ga0207706_10186103 | Ga0207706_101861031 | 157 |
| 38 | 3300025949 | Ga0207667_10061756 | Ga0207667_100617562 | 157 |
| 39 | 3300025981 | Ga0207640_10062060 | Ga0207640_100620601 | 157 |
| 40 | 3300026041 | Ga0207639_10056687 | Ga0207639_100566873 | 157 |
| 41 | 3300026041 | Ga0207639_10126168 | Ga0207639_101261681 | 157 |
| 42 | 3300026067 | Ga0207678_10047593 | Ga0207678_100475932 | 157 |
| 43 | 3300026078 | Ga0207702_10000026 | Ga0207702_10000026183 | 157 |
| 44 | 3300026078 | Ga0207702_10122685 | Ga0207702_101226854 | 157 |
| 45 | 3300026116 | Ga0207674_10010326 | Ga0207674_100103269 | 157 |
| 46 | 3300026116 | Ga0207674_10011498 | Ga0207674_100114984 | 157 |
| 47 | 3300026142 | Ga0207698_10726318 | Ga0207698_107263182 | 157 |
| 48 | 3300001977 | JGI24746J21847_1021252 | JGI24746J21847_10212521 | 161 |
| 49 | 3300001978 | JGI24747J21853_1042903 | JGI24747J21853_10429031 | 161 |
| 50 | 3300001990 | JGI24737J22298_10126944 | JGI24737J22298_101269441 | 161 |
| 51 | 3300001991 | JGI24743J22301_10050615 | JGI24743J22301_100506151 | 161 |
| 52 | 3300002070 | JGI24750J21931_1036810 | JGI24750J21931_10368101 | 161 |
| 53 | 3300002076 | JGI24749J21850_1023924 | JGI24749J21850_10239241 | 161 |
| 54 | 3300002077 | JGI24744J21845_10067843 | JGI24744J21845_100678431 | 161 |
| 55 | 3300002155 | JGI24033J26618_1025586 | JGI24033J26618_10255861 | 161 |
| 56 | 3300002239 | JGI24034J26672_10035091 | JGI24034J26672_100350911 | 161 |
| 57 | 3300002244 | JGI24742J22300_10042532 | JGI24742J22300_100425321 | 161 |
| 58 | 3300002244 | JGI24742J22300_10059722 | JGI24742J22300_100597221 | 161 |
| 59 | 3300002459 | JGI24751J29686_10018533 | JGI24751J29686_100185332 | 161 |
| 60 | 3300003308 | Ga0006777J48905_1012696 | Ga0006777J48905_10126961 | 161 |
| 61 | 3300003693 | Ga0032354_1012960 | Ga0032354_10129601 | 161 |
| 62 | 3300004801 | Ga0058860_12115543 | Ga0058860_121155431 | 161 |
| 63 | 3300005327 | Ga0070658_10719580 | Ga0070658_107195801 | 161 |
| 64 | 3300005331 | Ga0070670_100131914 | Ga0070670_1001319142 | 161 |
| 65 | 3300005334 | Ga0068869_100313946 | Ga0068869_1003139463 | 161 |
| 66 | 3300005335 | Ga0070666_10316492 | Ga0070666_103164922 | 161 |
| 67 | 3300005338 | Ga0068868_100147810 | Ga0068868_1001478102 | 161 |
| 68 | 3300005339 | Ga0070660_100834516 | Ga0070660_1008345162 | 161 |
| 69 | 3300005344 | Ga0070661_100024323 | Ga0070661_1000243231 | 161 |
| 70 | 3300005345 | Ga0070692_10548936 | Ga0070692_105489362 | 161 |
| 71 | 3300005347 | Ga0070668_100248629 | Ga0070668_1002486291 | 161 |
| 72 | 3300005353 | Ga0070669_100335643 | Ga0070669_1003356431 | 161 |
| 73 | 3300005355 | Ga0070671_100063284 | Ga0070671_1000632843 | 161 |
| 74 | 3300005356 | Ga0070674_100068947 | Ga0070674_1000689471 | 161 |
| 75 | 3300005364 | Ga0070673_100169492 | Ga0070673_1001694922 | 161 |
| 76 | 3300005365 | Ga0070688_100130134 | Ga0070688_1001301342 | 161 |
| 77 | 3300005366 | Ga0070659_100123679 | Ga0070659_1001236792 | 161 |
| 78 | 3300005367 | Ga0070667_100291770 | Ga0070667_1002917701 | 161 |
| 79 | 3300005438 | Ga0070701_10182050 | Ga0070701_101820502 | 161 |
| 80 | 3300005441 | Ga0070700_100258660 | Ga0070700_1002586602 | 161 |
| 81 | 3300005444 | Ga0070694_100299584 | Ga0070694_1002995842 | 161 |
| 82 | 3300005456 | Ga0070678_100418545 | Ga0070678_1004185451 | 161 |
| 83 | 3300005456 | Ga0070678_100855993 | Ga0070678_1008559931 | 161 |
| 84 | 3300005457 | Ga0070662_100084041 | Ga0070662_1000840415 | 161 |
| 85 | 3300005539 | Ga0068853_100767883 | Ga0068853_1007678831 | 161 |
| 86 | 3300005543 | Ga0070672_100586816 | Ga0070672_1005868161 | 161 |
| 87 | 3300005544 | Ga0070686_100050014 | Ga0070686_1000500141 | 161 |
| 88 | 3300005545 | Ga0070695_100315310 | Ga0070695_1003153102 | 161 |
| 89 | 3300005548 | Ga0070665_100053521 | Ga0070665_1000535213 | 161 |
| 90 | 3300005563 | Ga0068855_100337368 | Ga0068855_1003373682 | 161 |
| 91 | 3300005577 | Ga0068857_100334791 | Ga0068857_1003347913 | 161 |
| 92 | 3300005614 | Ga0068856_100411333 | Ga0068856_1004113332 | 161 |
| 93 | 3300005615 | Ga0070702_100104963 | Ga0070702_1001049632 | 161 |
| 94 | 3300005617 | Ga0068859_100117890 | Ga0068859_1001178901 | 161 |
| 95 | 3300005618 | Ga0068864_100064661 | Ga0068864_1000646614 | 161 |
| 96 | 3300005834 | Ga0068851_10147229 | Ga0068851_101472291 | 161 |
| 97 | 3300005840 | Ga0068870_10049659 | Ga0068870_100496593 | 161 |
| 98 | 3300005841 | Ga0068863_100020353 | Ga0068863_1000203538 | 161 |
| 99 | 3300005842 | Ga0068858_100249886 | Ga0068858_1002498863 | 161 |
| 100 | 3300005843 | Ga0068860_100067286 | Ga0068860_1000672862 | 161 |
| 101 | 3300005844 | Ga0068862_100889847 | Ga0068862_1008898471 | 161 |
| 102 | 3300006028 | Ga0070717_10207693 | Ga0070717_102076934 | 161 |
| 103 | 3300006038 | Ga0075365_10262762 | Ga0075365_102627622 | 161 |
| 104 | 3300006051 | Ga0075364_10136743 | Ga0075364_101367433 | 161 |
| 105 | 3300006237 | Ga0097621_100074213 | Ga0097621_1000742134 | 161 |
| 106 | 3300006358 | Ga0068871_100104255 | Ga0068871_1001042552 | 161 |
| 107 | 3300006847 | Ga0075431_100465897 | Ga0075431_1004658971 | 161 |
| 108 | 3300006931 | Ga0097620_100117884 | Ga0097620_1001178841 | 161 |
| 109 | 3300009011 | Ga0105251_10313106 | Ga0105251_103131061 | 161 |
| 110 | 3300009036 | Ga0105244_10088248 | Ga0105244_100882483 | 161 |
| 111 | 3300009101 | Ga0105247_10095694 | Ga0105247_100956942 | 161 |
| 112 | 3300009147 | Ga0114129_10037544 | Ga0114129_100375444 | 161 |
| 113 | 3300009148 | Ga0105243_10076785 | Ga0105243_100767854 | 161 |
| 114 | 3300009176 | Ga0105242_10322965 | Ga0105242_103229652 | 161 |
| 115 | 3300009177 | Ga0105248_10061998 | Ga0105248_100619984 | 161 |
| 116 | 3300009545 | Ga0105237_10176281 | Ga0105237_101762811 | 161 |
| 117 | 3300009551 | Ga0105238_10347316 | Ga0105238_103473161 | 161 |
| 118 | 3300009553 | Ga0105249_10092015 | Ga0105249_100920153 | 161 |
| 119 | 3300011119 | Ga0105246_10547708 | Ga0105246_105477082 | 161 |
| 120 | 3300013297 | Ga0157378_10074128 | Ga0157378_100741281 | 161 |
| 121 | 3300014325 | Ga0163163_11988878 | Ga0163163_119888781 | 161 |
| 122 | 3300014745 | Ga0157377_10048477 | Ga0157377_100484773 | 161 |
| 123 | 3300014969 | Ga0157376_10267523 | Ga0157376_102675232 | 161 |
| 124 | 3300020080 | Ga0206350_10365195 | Ga0206350_103651951 | 161 |
| 125 | 3300020082 | Ga0206353_10883923 | Ga0206353_108839231 | 161 |
| 126 | 3300022467 | Ga0224712_10295154 | Ga0224712_102951541 | 161 |
| 127 | 3300025321 | Ga0207656_10126512 | Ga0207656_101265122 | 161 |
| 128 | 3300025899 | Ga0207642_10230011 | Ga0207642_102300112 | 161 |
| 129 | 3300025901 | Ga0207688_10000896 | Ga0207688_100008969 | 161 |
| 130 | 3300025903 | Ga0207680_10601969 | Ga0207680_106019691 | 161 |
| 131 | 3300025904 | Ga0207647_10086076 | Ga0207647_100860762 | 161 |
| 132 | 3300025908 | Ga0207643_10005864 | Ga0207643_100058647 | 161 |
| 133 | 3300025909 | Ga0207705_10690578 | Ga0207705_106905781 | 161 |
| 134 | 3300025914 | Ga0207671_10223604 | Ga0207671_102236041 | 161 |
| 135 | 3300025915 | Ga0207693_10037124 | Ga0207693_100371242 | 161 |
| 136 | 3300025918 | Ga0207662_10006236 | Ga0207662_100062367 | 161 |
| 137 | 3300025919 | Ga0207657_10042348 | Ga0207657_100423484 | 161 |
| 138 | 3300025920 | Ga0207649_10037057 | Ga0207649_100370572 | 161 |
| 139 | 3300025924 | Ga0207694_10128284 | Ga0207694_101282842 | 161 |
| 140 | 3300025925 | Ga0207650_10179565 | Ga0207650_101795651 | 161 |
| 141 | 3300025926 | Ga0207659_10524947 | Ga0207659_105249471 | 161 |
| 142 | 3300025927 | Ga0207687_10300546 | Ga0207687_103005463 | 161 |
| 143 | 3300025928 | Ga0207700_10135523 | Ga0207700_101355232 | 161 |
| 144 | 3300025931 | Ga0207644_10746250 | Ga0207644_107462501 | 161 |
| 145 | 3300025933 | Ga0207706_10007357 | Ga0207706_1000735711 | 161 |
| 146 | 3300025935 | Ga0207709_10560673 | Ga0207709_105606731 | 161 |
| 147 | 3300025936 | Ga0207670_10228092 | Ga0207670_102280922 | 161 |
| 148 | 3300025937 | Ga0207669_10983171 | Ga0207669_109831711 | 161 |
| 149 | 3300025940 | Ga0207691_10016710 | Ga0207691_100167108 | 161 |
| 150 | 3300025941 | Ga0207711_10028906 | Ga0207711_100289062 | 161 |
| 151 | 3300025942 | Ga0207689_10002364 | Ga0207689_1000236415 | 161 |
| 152 | 3300025944 | Ga0207661_10968211 | Ga0207661_109682111 | 161 |
| 153 | 3300025960 | Ga0207651_10357019 | Ga0207651_103570193 | 161 |
| 154 | 3300025961 | Ga0207712_10434904 | Ga0207712_104349042 | 161 |
| 155 | 3300025981 | Ga0207640_10148236 | Ga0207640_101482362 | 161 |
| 156 | 3300025986 | Ga0207658_10134836 | Ga0207658_101348361 | 161 |
| 157 | 3300026035 | Ga0207703_10351960 | Ga0207703_103519601 | 161 |
| 158 | 3300026075 | Ga0207708_10001706 | Ga0207708_1000170611 | 161 |
| 159 | 3300026088 | Ga0207641_10152237 | Ga0207641_101522371 | 161 |
| 160 | 3300026089 | Ga0207648_10001075 | Ga0207648_1000107512 | 161 |
| 161 | 3300026095 | Ga0207676_11575435 | Ga0207676_115754351 | 161 |
| 162 | 3300026116 | Ga0207674_10095357 | Ga0207674_100953572 | 161 |
| 163 | 3300026118 | Ga0207675_100078028 | Ga0207675_1000780284 | 161 |
| 164 | 3300026121 | Ga0207683_10231562 | Ga0207683_102315621 | 161 |
| 165 | 3300026121 | Ga0207683_11079303 | Ga0207683_110793031 | 161 |
| 166 | 3300026142 | Ga0207698_10502536 | Ga0207698_105025362 | 161 |
| 167 | 3300027907 | Ga0207428_10557741 | Ga0207428_105577411 | 161 |
| 168 | 3300028379 | Ga0268266_10270862 | Ga0268266_102708622 | 161 |
| 169 | 3300028380 | Ga0268265_10227273 | Ga0268265_102272733 | 161 |
| 170 | 3300028381 | Ga0268264_10583177 | Ga0268264_105831772 | 161 |
| 171 | 3300035691 | Ga0373931_0199953 | Ga0373931_0199953_584_1090 | 161 |
| 172 | 3300035692 | Ga0373935_0399675 | Ga0373935_0399675_92_598 | 161 |
| 173 | 3300037068 | Ga0373925_0268518 | Ga0373925_0268518_149_655 | 161 |
| 174 | 3300046513 | Ga0495616_0312848 | Ga0495616_0312848_97_603 | 161 |
| 175 | 3300046683 | Ga0495658_0444063 | Ga0495658_0444063_98_604 | 161 |
| 176 | 3300048903 | Ga0496100_0100720 | Ga0496100_0100720_657_1163 | 161 |
| 177 | 3300048905 | Ga0496102_0032922 | Ga0496102_0032922_382_888 | 161 |
| 178 | 3300048906 | Ga0496103_0071414 | Ga0496103_0071414_835_1341 | 161 |
| 179 | 3300048908 | Ga0496105_0162145 | Ga0496105_0162145_1070_1576 | 161 |
| 180 | 3300048909 | Ga0496106_0029877 | Ga0496106_0029877_582_1088 | 161 |
| 181 | 3300048910 | Ga0496107_0473597 | Ga0496107_0473597_155_661 | 161 |
| 182 | 3300048911 | Ga0496108_0005621 | Ga0496108_0005621_2439_2945 | 161 |
| 183 | 3300048912 | Ga0496109_0328581 | Ga0496109_0328581_812_1318 | 161 |
| 184 | 3300048913 | Ga0496110_0065588 | Ga0496110_0065588_1904_2410 | 161 |
| 185 | 3300048914 | Ga0496111_0219840 | Ga0496111_0219840_750_1256 | 161 |
| 186 | 3300048916 | Ga0496113_0030783 | Ga0496113_0030783_2909_3415 | 161 |
| 187 | 3300048917 | Ga0496114_0060904 | Ga0496114_0060904_1682_2188 | 161 |
| 188 | 3300048917 | Ga0496114_0333238 | Ga0496114_0333238_462_968 | 161 |
| 189 | 3300048918 | Ga0496115_0033633 | Ga0496115_0033633_138_644 | 161 |
| 190 | 3300048918 | Ga0496115_0214364 | Ga0496115_0214364_130_636 | 161 |
| 191 | 3300050490 | nmdc:mga03n38_313483_c1 | nmdc:mga03n38_313483_c1_240_746 | 161 |
| 192 | 3300050491 | nmdc:mga00v17_505748_c1 | nmdc:mga00v17_505748_c1_262_768 | 161 |
| 193 | 3300050494 | nmdc:mga06z11_82275_c1 | nmdc:mga06z11_82275_c1_954_1460 | 161 |
| 194 | 3300050507 | nmdc:mga05p37_16785_c1 | nmdc:mga05p37_16785_c1_5632_6138 | 161 |
| 195 | 3300053077 | Ga0495601_0042864 | Ga0495601_0042864_582_1088 | 161 |
| 196 | 3300053084 | Ga0495595_0335813 | Ga0495595_0335813_26_532 | 161 |
| 197 | 3300020069 | Ga0197907_11501374 | Ga0197907_115013741 | 162 |
| 198 | 3300020075 | Ga0206349_1463205 | Ga0206349_14632051 | 162 |
| 199 | 3300022467 | Ga0224712_10511958 | Ga0224712_105119581 | 162 |
| 200 | 3300046537 | Ga0495598_0067460 | Ga0495598_0067460_141_632 | 162 |
| 201 | 3300005719 | Ga0068861_100101152 | Ga0068861_1001011522 | 163 |
| 202 | iso_pu_bacteria | 2513237098 | 2513673199 | 163 |
| 203 | iso_pu_bacteria | 2513237101 | 2513695404 | 163 |
| 204 | iso_pu_bacteria | 2602042107 | 2603860801 | 163 |
| 205 | iso_pu_bacteria | 2643221651 | 2644289600 | 163 |
| 206 | iso_pu_bacteria | 2738541281 | 2738744710 | 163 |
| 207 | iso_pu_bacteria | 2738543032 | 2739353940 | 163 |
| 208 | iso_pu_bacteria | 2857524615 | 2857524756 | 163 |
| 209 | iso_pu_bacteria | 2874604998 | 2874612225 | 163 |
| 210 | iso_pu_bacteria | 2889033259 | 2889042007 | 163 |
| 211 | iso_pu_bacteria | 2893066018 | 2893069277 | 163 |
| 212 | iso_pu_bacteria | 2902405164 | 2902411331 | 163 |
| 213 | iso_pu_bacteria | 2919073203 | 2919078640 | 163 |
| 214 | iso_pu_bacteria | 2922386360 | 2922386792 | 163 |
| 215 | iso_pu_bacteria | 8006964411 | 8006964993 | 163 |
| 216 | iso_pu_bacteria | 8006984368 | 8006988641 | 163 |
| 217 | 3300035114 | Ga0373939_0327484 | Ga0373939_0327484_102_602 | 165 |
| 218 | 3300020080 | Ga0206350_10388215 | Ga0206350_103882151 | 166 |
| 219 | 3300041491 | Ga0451833_1205776 | Ga0451833_1205776_16_516 | 166 |
| 220 | 2162886007 | SwRhRL2b_contig_3951670 | SwRhRL2b_0721.00001740 | 167 |
| 221 | 3300003203 | JGI25406J46586_10002904 | JGI25406J46586_100029042 | 167 |
| 222 | 3300003308 | Ga0006777J48905_1040219 | Ga0006777J48905_10402191 | 167 |
| 223 | 3300003308 | Ga0006777J48905_1058774 | Ga0006777J48905_10587741 | 167 |
| 224 | 3300003568 | Ga0006781J51513_1035190 | Ga0006781J51513_10351901 | 167 |
| 225 | 3300003574 | Ga0007410J51695_1043051 | Ga0007410J51695_10430511 | 167 |
| 226 | 3300003575 | Ga0007409J51694_1088714 | Ga0007409J51694_10887141 | 167 |
| 227 | 3300003579 | Ga0007429J51699_1021511 | Ga0007429J51699_10215111 | 167 |
| 228 | 3300003579 | Ga0007429J51699_1059805 | Ga0007429J51699_10598051 | 167 |
| 229 | 3300003659 | JGI25404J52841_10022797 | JGI25404J52841_100227971 | 167 |
| 230 | 3300003659 | JGI25404J52841_10033517 | JGI25404J52841_100335172 | 167 |
| 231 | 3300003693 | Ga0032354_1047272 | Ga0032354_10472721 | 167 |
| 232 | 3300003693 | Ga0032354_1052366 | Ga0032354_10523661 | 167 |
| 233 | 3300003735 | Ga0006780_1021799 | Ga0006780_10217991 | 167 |
| 234 | 3300004799 | Ga0058863_11574013 | Ga0058863_115740131 | 167 |
| 235 | 3300004801 | Ga0058860_12149836 | Ga0058860_121498361 | 167 |
| 236 | 3300005293 | Ga0065715_10500263 | Ga0065715_105002631 | 167 |
| 237 | 3300005295 | Ga0065707_10331906 | Ga0065707_103319061 | 167 |
| 238 | 3300005327 | Ga0070658_10122009 | Ga0070658_101220092 | 167 |
| 239 | 3300005328 | Ga0070676_10214685 | Ga0070676_102146852 | 167 |
| 240 | 3300005329 | Ga0070683_100116918 | Ga0070683_1001169182 | 167 |
| 241 | 3300005329 | Ga0070683_100186787 | Ga0070683_1001867872 | 167 |
| 242 | 3300005330 | Ga0070690_100312075 | Ga0070690_1003120751 | 167 |
| 243 | 3300005331 | Ga0070670_100036037 | Ga0070670_1000360375 | 167 |
| 244 | 3300005331 | Ga0070670_101179141 | Ga0070670_1011791411 | 167 |
| 245 | 3300005334 | Ga0068869_100143438 | Ga0068869_1001434383 | 167 |
| 246 | 3300005334 | Ga0068869_100177601 | Ga0068869_1001776012 | 167 |
| 247 | 3300005335 | Ga0070666_10091734 | Ga0070666_100917341 | 167 |
| 248 | 3300005336 | Ga0070680_100013974 | Ga0070680_1000139743 | 167 |
| 249 | 3300005337 | Ga0070682_100068797 | Ga0070682_1000687972 | 167 |
| 250 | 3300005337 | Ga0070682_100095633 | Ga0070682_1000956332 | 167 |
| 251 | 3300005337 | Ga0070682_100479432 | Ga0070682_1004794322 | 167 |
| 252 | 3300005338 | Ga0068868_100725833 | Ga0068868_1007258331 | 167 |
| 253 | 3300005338 | Ga0068868_100968955 | Ga0068868_1009689552 | 167 |
| 254 | 3300005339 | Ga0070660_100235492 | Ga0070660_1002354922 | 167 |
| 255 | 3300005339 | Ga0070660_100278994 | Ga0070660_1002789942 | 167 |
| 256 | 3300005339 | Ga0070660_100857848 | Ga0070660_1008578481 | 167 |
| 257 | 3300005340 | Ga0070689_100032271 | Ga0070689_1000322713 | 167 |
| 258 | 3300005341 | Ga0070691_10075852 | Ga0070691_100758522 | 167 |
| 259 | 3300005343 | Ga0070687_100237656 | Ga0070687_1002376562 | 167 |
| 260 | 3300005344 | Ga0070661_100214230 | Ga0070661_1002142302 | 167 |
| 261 | 3300005344 | Ga0070661_100598004 | Ga0070661_1005980042 | 167 |
| 262 | 3300005347 | Ga0070668_100217633 | Ga0070668_1002176332 | 167 |
| 263 | 3300005347 | Ga0070668_100275195 | Ga0070668_1002751952 | 167 |
| 264 | 3300005353 | Ga0070669_100129738 | Ga0070669_1001297383 | 167 |
| 265 | 3300005355 | Ga0070671_100172520 | Ga0070671_1001725202 | 167 |
| 266 | 3300005355 | Ga0070671_101044787 | Ga0070671_1010447871 | 167 |
| 267 | 3300005356 | Ga0070674_100654750 | Ga0070674_1006547501 | 167 |
| 268 | 3300005364 | Ga0070673_100474346 | Ga0070673_1004743461 | 167 |
| 269 | 3300005364 | Ga0070673_100737795 | Ga0070673_1007377951 | 167 |
| 270 | 3300005365 | Ga0070688_100199709 | Ga0070688_1001997092 | 167 |
| 271 | 3300005366 | Ga0070659_100044581 | Ga0070659_1000445813 | 167 |
| 272 | 3300005366 | Ga0070659_100224555 | Ga0070659_1002245551 | 167 |
| 273 | 3300005366 | Ga0070659_100299217 | Ga0070659_1002992171 | 167 |
| 274 | 3300005366 | Ga0070659_100666840 | Ga0070659_1006668401 | 167 |
| 275 | 3300005366 | Ga0070659_101470739 | Ga0070659_1014707391 | 167 |
| 276 | 3300005367 | Ga0070667_100042228 | Ga0070667_1000422282 | 167 |
| 277 | 3300005367 | Ga0070667_100461147 | Ga0070667_1004611471 | 167 |
| 278 | 3300005406 | Ga0070703_10168139 | Ga0070703_101681391 | 167 |
| 279 | 3300005406 | Ga0070703_10207770 | Ga0070703_102077701 | 167 |
| 280 | 3300005434 | Ga0070709_10001015 | Ga0070709_100010155 | 167 |
| 281 | 3300005435 | Ga0070714_100008787 | Ga0070714_1000087875 | 167 |
| 282 | 3300005435 | Ga0070714_100160074 | Ga0070714_1001600742 | 167 |
| 283 | 3300005435 | Ga0070714_101523020 | Ga0070714_1015230201 | 167 |
| 284 | 3300005436 | Ga0070713_100002311 | Ga0070713_1000023114 | 167 |
| 285 | 3300005436 | Ga0070713_100102531 | Ga0070713_1001025314 | 167 |
| 286 | 3300005436 | Ga0070713_100504541 | Ga0070713_1005045412 | 167 |
| 287 | 3300005437 | Ga0070710_10013948 | Ga0070710_100139482 | 167 |
| 288 | 3300005437 | Ga0070710_10446128 | Ga0070710_104461281 | 167 |
| 289 | 3300005437 | Ga0070710_10557628 | Ga0070710_105576281 | 167 |
| 290 | 3300005438 | Ga0070701_10170254 | Ga0070701_101702542 | 167 |
| 291 | 3300005439 | Ga0070711_100147022 | Ga0070711_1001470222 | 167 |
| 292 | 3300005439 | Ga0070711_100184808 | Ga0070711_1001848082 | 167 |
| 293 | 3300005440 | Ga0070705_100354370 | Ga0070705_1003543702 | 167 |
| 294 | 3300005440 | Ga0070705_100414755 | Ga0070705_1004147552 | 167 |
| 295 | 3300005441 | Ga0070700_100014021 | Ga0070700_1000140213 | 167 |
| 296 | 3300005441 | Ga0070700_100959397 | Ga0070700_1009593971 | 167 |
| 297 | 3300005444 | Ga0070694_100085125 | Ga0070694_1000851253 | 167 |
| 298 | 3300005444 | Ga0070694_100153679 | Ga0070694_1001536792 | 167 |
| 299 | 3300005444 | Ga0070694_100502318 | Ga0070694_1005023182 | 167 |
| 300 | 3300005455 | Ga0070663_100008060 | Ga0070663_1000080602 | 167 |
| 301 | 3300005455 | Ga0070663_100086075 | Ga0070663_1000860752 | 167 |
| 302 | 3300005455 | Ga0070663_100159559 | Ga0070663_1001595592 | 167 |
| 303 | 3300005455 | Ga0070663_100182877 | Ga0070663_1001828772 | 167 |
| 304 | 3300005455 | Ga0070663_100773989 | Ga0070663_1007739891 | 167 |
| 305 | 3300005455 | Ga0070663_100809046 | Ga0070663_1008090461 | 167 |
| 306 | 3300005456 | Ga0070678_100135175 | Ga0070678_1001351751 | 167 |
| 307 | 3300005457 | Ga0070662_100054508 | Ga0070662_1000545083 | 167 |
| 308 | 3300005457 | Ga0070662_100057011 | Ga0070662_1000570111 | 167 |
| 309 | 3300005457 | Ga0070662_100230727 | Ga0070662_1002307272 | 167 |
| 310 | 3300005458 | Ga0070681_10013083 | Ga0070681_100130833 | 167 |
| 311 | 3300005458 | Ga0070681_10070681 | Ga0070681_100706812 | 167 |
| 312 | 3300005466 | Ga0070685_10251199 | Ga0070685_102511991 | 167 |
| 313 | 3300005471 | Ga0070698_100053016 | Ga0070698_1000530162 | 167 |
| 314 | 3300005530 | Ga0070679_100126829 | Ga0070679_1001268293 | 167 |
| 315 | 3300005530 | Ga0070679_100267934 | Ga0070679_1002679342 | 167 |
| 316 | 3300005530 | Ga0070679_100652430 | Ga0070679_1006524302 | 167 |
| 317 | 3300005530 | Ga0070679_100754742 | Ga0070679_1007547422 | 167 |
| 318 | 3300005535 | Ga0070684_100092938 | Ga0070684_1000929383 | 167 |
| 319 | 3300005535 | Ga0070684_100626745 | Ga0070684_1006267451 | 167 |
| 320 | 3300005536 | Ga0070697_100064835 | Ga0070697_1000648351 | 167 |
| 321 | 3300005539 | Ga0068853_100004957 | Ga0068853_1000049573 | 167 |
| 322 | 3300005539 | Ga0068853_100663727 | Ga0068853_1006637271 | 167 |
| 323 | 3300005544 | Ga0070686_100404916 | Ga0070686_1004049162 | 167 |
| 324 | 3300005544 | Ga0070686_100665765 | Ga0070686_1006657652 | 167 |
| 325 | 3300005545 | Ga0070695_100042844 | Ga0070695_1000428441 | 167 |
| 326 | 3300005546 | Ga0070696_100000971 | Ga0070696_1000009711 | 167 |
| 327 | 3300005546 | Ga0070696_100044480 | Ga0070696_1000444803 | 167 |
| 328 | 3300005546 | Ga0070696_100246081 | Ga0070696_1002460812 | 167 |
| 329 | 3300005547 | Ga0070693_100017592 | Ga0070693_1000175922 | 167 |
| 330 | 3300005547 | Ga0070693_100987912 | Ga0070693_1009879121 | 167 |
| 331 | 3300005547 | Ga0070693_100988161 | Ga0070693_1009881611 | 167 |
| 332 | 3300005548 | Ga0070665_100003902 | Ga0070665_1000039023 | 167 |
| 333 | 3300005548 | Ga0070665_100113980 | Ga0070665_1001139802 | 167 |
| 334 | 3300005548 | Ga0070665_100546810 | Ga0070665_1005468102 | 167 |
| 335 | 3300005548 | Ga0070665_100550745 | Ga0070665_1005507452 | 167 |
| 336 | 3300005548 | Ga0070665_100891149 | Ga0070665_1008911491 | 167 |
| 337 | 3300005549 | Ga0070704_100181227 | Ga0070704_1001812271 | 167 |
| 338 | 3300005549 | Ga0070704_100238813 | Ga0070704_1002388131 | 167 |
| 339 | 3300005563 | Ga0068855_100075381 | Ga0068855_1000753813 | 167 |
| 340 | 3300005563 | Ga0068855_100227171 | Ga0068855_1002271712 | 167 |
| 341 | 3300005563 | Ga0068855_100272230 | Ga0068855_1002722302 | 167 |
| 342 | 3300005564 | Ga0070664_100351050 | Ga0070664_1003510503 | 167 |
| 343 | 3300005578 | Ga0068854_101698589 | Ga0068854_1016985891 | 167 |
| 344 | 3300005614 | Ga0068856_100000363 | Ga0068856_10000036321 | 167 |
| 345 | 3300005614 | Ga0068856_100154754 | Ga0068856_1001547542 | 167 |
| 346 | 3300005615 | Ga0070702_100003979 | Ga0070702_1000039794 | 167 |
| 347 | 3300005616 | Ga0068852_100005807 | Ga0068852_1000058077 | 167 |
| 348 | 3300005617 | Ga0068859_100224959 | Ga0068859_1002249592 | 167 |
| 349 | 3300005618 | Ga0068864_100109309 | Ga0068864_1001093092 | 167 |
| 350 | 3300005618 | Ga0068864_101347514 | Ga0068864_1013475141 | 167 |
| 351 | 3300005718 | Ga0068866_10418506 | Ga0068866_104185061 | 167 |
| 352 | 3300005719 | Ga0068861_100028388 | Ga0068861_1000283882 | 167 |
| 353 | 3300005719 | Ga0068861_100152343 | Ga0068861_1001523431 | 167 |
| 354 | 3300005834 | Ga0068851_10034585 | Ga0068851_100345852 | 167 |
| 355 | 3300005842 | Ga0068858_100482037 | Ga0068858_1004820372 | 167 |
| 356 | 3300005842 | Ga0068858_101021531 | Ga0068858_1010215312 | 167 |
| 357 | 3300005843 | Ga0068860_100061571 | Ga0068860_1000615713 | 167 |
| 358 | 3300005843 | Ga0068860_101207093 | Ga0068860_1012070931 | 167 |
| 359 | 3300005844 | Ga0068862_100131627 | Ga0068862_1001316272 | 167 |
| 360 | 3300005937 | Ga0081455_10000633 | Ga0081455_100006339 | 167 |
| 361 | 3300005937 | Ga0081455_10045282 | Ga0081455_100452823 | 167 |
| 362 | 3300005983 | Ga0081540_1001350 | Ga0081540_10013507 | 167 |
| 363 | 3300005983 | Ga0081540_1005948 | Ga0081540_10059481 | 167 |
| 364 | 3300005983 | Ga0081540_1013070 | Ga0081540_10130703 | 167 |
| 365 | 3300005983 | Ga0081540_1023275 | Ga0081540_10232752 | 167 |
| 366 | 3300005985 | Ga0081539_10000864 | Ga0081539_1000086439 | 167 |
| 367 | 3300005985 | Ga0081539_10064473 | Ga0081539_100644732 | 167 |
| 368 | 3300006028 | Ga0070717_10008605 | Ga0070717_100086054 | 167 |
| 369 | 3300006028 | Ga0070717_10349425 | Ga0070717_103494252 | 167 |
| 370 | 3300006038 | Ga0075365_10007938 | Ga0075365_100079382 | 167 |
| 371 | 3300006038 | Ga0075365_10142814 | Ga0075365_101428142 | 167 |
| 372 | 3300006038 | Ga0075365_10600407 | Ga0075365_106004071 | 167 |
| 373 | 3300006042 | Ga0075368_10022861 | Ga0075368_100228612 | 167 |
| 374 | 3300006048 | Ga0075363_100001181 | Ga0075363_1000011813 | 167 |
| 375 | 3300006051 | Ga0075364_10025549 | Ga0075364_100255492 | 167 |
| 376 | 3300006051 | Ga0075364_10194511 | Ga0075364_101945113 | 167 |
| 377 | 3300006173 | Ga0070716_100019318 | Ga0070716_1000193182 | 167 |
| 378 | 3300006175 | Ga0070712_100006584 | Ga0070712_1000065842 | 167 |
| 379 | 3300006177 | Ga0075362_10020047 | Ga0075362_100200472 | 167 |
| 380 | 3300006177 | Ga0075362_10227062 | Ga0075362_102270621 | 167 |
| 381 | 3300006177 | Ga0075362_10246177 | Ga0075362_102461771 | 167 |
| 382 | 3300006178 | Ga0075367_10001700 | Ga0075367_100017007 | 167 |
| 383 | 3300006178 | Ga0075367_10017229 | Ga0075367_100172293 | 167 |
| 384 | 3300006178 | Ga0075367_10065669 | Ga0075367_100656692 | 167 |
| 385 | 3300006178 | Ga0075367_10249851 | Ga0075367_102498512 | 167 |
| 386 | 3300006186 | Ga0075369_10091556 | Ga0075369_100915562 | 167 |
| 387 | 3300006186 | Ga0075369_10245394 | Ga0075369_102453942 | 167 |
| 388 | 3300006195 | Ga0075366_10845597 | Ga0075366_108455971 | 167 |
| 389 | 3300006237 | Ga0097621_100026518 | Ga0097621_1000265183 | 167 |
| 390 | 3300006237 | Ga0097621_100316295 | Ga0097621_1003162952 | 167 |
| 391 | 3300006353 | Ga0075370_10020128 | Ga0075370_100201283 | 167 |
| 392 | 3300006353 | Ga0075370_10028239 | Ga0075370_100282392 | 167 |
| 393 | 3300006358 | Ga0068871_100035821 | Ga0068871_1000358211 | 167 |
| 394 | 3300006844 | Ga0075428_100070086 | Ga0075428_1000700863 | 167 |
| 395 | 3300006846 | Ga0075430_100109997 | Ga0075430_1001099973 | 167 |
| 396 | 3300006846 | Ga0075430_100917106 | Ga0075430_1009171061 | 167 |
| 397 | 3300006852 | Ga0075433_10809127 | Ga0075433_108091271 | 167 |
| 398 | 3300006852 | Ga0075433_10833840 | Ga0075433_108338401 | 167 |
| 399 | 3300006871 | Ga0075434_100044641 | Ga0075434_1000446414 | 167 |
| 400 | 3300006871 | Ga0075434_100125713 | Ga0075434_1001257132 | 167 |
| 401 | 3300006871 | Ga0075434_100510301 | Ga0075434_1005103011 | 167 |
| 402 | 3300006881 | Ga0068865_100001775 | Ga0068865_1000017759 | 167 |
| 403 | 3300006914 | Ga0075436_100005858 | Ga0075436_1000058583 | 167 |
| 404 | 3300006914 | Ga0075436_100692290 | Ga0075436_1006922901 | 167 |
| 405 | 3300006914 | Ga0075436_101191223 | Ga0075436_1011912231 | 167 |
| 406 | 3300006931 | Ga0097620_100224948 | Ga0097620_1002249482 | 167 |
| 407 | 3300007076 | Ga0075435_100073638 | Ga0075435_1000736382 | 167 |
| 408 | 3300007076 | Ga0075435_100111808 | Ga0075435_1001118082 | 167 |
| 409 | 3300007076 | Ga0075435_100468897 | Ga0075435_1004688972 | 167 |
| 410 | 3300007265 | Ga0099794_10381339 | Ga0099794_103813391 | 167 |
| 411 | 3300007788 | Ga0099795_10021043 | Ga0099795_100210432 | 167 |
| 412 | 3300007788 | Ga0099795_10030236 | Ga0099795_100302362 | 167 |
| 413 | 3300007788 | Ga0099795_10048728 | Ga0099795_100487282 | 167 |
| 414 | 3300009011 | Ga0105251_10097573 | Ga0105251_100975732 | 167 |
| 415 | 3300009092 | Ga0105250_10030865 | Ga0105250_100308652 | 167 |
| 416 | 3300009092 | Ga0105250_10046623 | Ga0105250_100466232 | 167 |
| 417 | 3300009093 | Ga0105240_10016715 | Ga0105240_100167159 | 167 |
| 418 | 3300009093 | Ga0105240_12090505 | Ga0105240_120905051 | 167 |
| 419 | 3300009094 | Ga0111539_10315761 | Ga0111539_103157612 | 167 |
| 420 | 3300009094 | Ga0111539_10663958 | Ga0111539_106639582 | 167 |
| 421 | 3300009098 | Ga0105245_10312564 | Ga0105245_103125642 | 167 |
| 422 | 3300009098 | Ga0105245_10359871 | Ga0105245_103598711 | 167 |
| 423 | 3300009098 | Ga0105245_10530627 | Ga0105245_105306272 | 167 |
| 424 | 3300009098 | Ga0105245_10791723 | Ga0105245_107917231 | 167 |
| 425 | 3300009098 | Ga0105245_10968353 | Ga0105245_109683531 | 167 |
| 426 | 3300009147 | Ga0114129_10784305 | Ga0114129_107843051 | 167 |
| 427 | 3300009148 | Ga0105243_10319515 | Ga0105243_103195151 | 167 |
| 428 | 3300009148 | Ga0105243_10501399 | Ga0105243_105013992 | 167 |
| 429 | 3300009174 | Ga0105241_10070808 | Ga0105241_100708082 | 167 |
| 430 | 3300009174 | Ga0105241_10493630 | Ga0105241_104936301 | 167 |
| 431 | 3300009176 | Ga0105242_10022368 | Ga0105242_100223682 | 167 |
| 432 | 3300009177 | Ga0105248_10272244 | Ga0105248_102722441 | 167 |
| 433 | 3300009545 | Ga0105237_10040252 | Ga0105237_100402524 | 167 |
| 434 | 3300009545 | Ga0105237_10396831 | Ga0105237_103968312 | 167 |
| 435 | 3300009551 | Ga0105238_10012175 | Ga0105238_100121756 | 167 |
| 436 | 3300009551 | Ga0105238_10102283 | Ga0105238_101022832 | 167 |
| 437 | 3300009551 | Ga0105238_10264456 | Ga0105238_102644562 | 167 |
| 438 | 3300009553 | Ga0105249_10074945 | Ga0105249_100749452 | 167 |
| 439 | 3300009553 | Ga0105249_10133651 | Ga0105249_101336511 | 167 |
| 440 | 3300010159 | Ga0099796_10061656 | Ga0099796_100616562 | 167 |
| 441 | 3300010375 | Ga0105239_10153070 | Ga0105239_101530702 | 167 |
| 442 | 3300010375 | Ga0105239_10428627 | Ga0105239_104286271 | 167 |
| 443 | 3300010375 | Ga0105239_10560225 | Ga0105239_105602251 | 167 |
| 444 | 3300010375 | Ga0105239_10644628 | Ga0105239_106446282 | 167 |
| 445 | 3300010375 | Ga0105239_11920494 | Ga0105239_119204941 | 167 |
| 446 | 3300011119 | Ga0105246_10095430 | Ga0105246_100954302 | 167 |
| 447 | 3300011119 | Ga0105246_10581741 | Ga0105246_105817411 | 167 |
| 448 | 3300012476 | Ga0157344_1004409 | Ga0157344_10044091 | 167 |
| 449 | 3300012513 | Ga0157326_1003126 | Ga0157326_10031262 | 167 |
| 450 | 3300013100 | Ga0157373_10585099 | Ga0157373_105850991 | 167 |
| 451 | 3300013100 | Ga0157373_10730117 | Ga0157373_107301172 | 167 |
| 452 | 3300013104 | Ga0157370_10158045 | Ga0157370_101580452 | 167 |
| 453 | 3300013104 | Ga0157370_10538178 | Ga0157370_105381782 | 167 |
| 454 | 3300013104 | Ga0157370_10810914 | Ga0157370_108109142 | 167 |
| 455 | 3300013296 | Ga0157374_10510630 | Ga0157374_105106302 | 167 |
| 456 | 3300013297 | Ga0157378_10077086 | Ga0157378_100770863 | 167 |
| 457 | 3300013297 | Ga0157378_10367816 | Ga0157378_103678162 | 167 |
| 458 | 3300013297 | Ga0157378_10661797 | Ga0157378_106617972 | 167 |
| 459 | 3300013306 | Ga0163162_10010007 | Ga0163162_100100076 | 167 |
| 460 | 3300013306 | Ga0163162_10321503 | Ga0163162_103215032 | 167 |
| 461 | 3300013306 | Ga0163162_10394122 | Ga0163162_103941221 | 167 |
| 462 | 3300013307 | Ga0157372_10218610 | Ga0157372_102186102 | 167 |
| 463 | 3300013307 | Ga0157372_10855203 | Ga0157372_108552032 | 167 |
| 464 | 3300013308 | Ga0157375_10724238 | Ga0157375_107242381 | 167 |
| 465 | 3300014325 | Ga0163163_10064503 | Ga0163163_100645031 | 167 |
| 466 | 3300014325 | Ga0163163_10075022 | Ga0163163_100750222 | 167 |
| 467 | 3300014326 | Ga0157380_10186461 | Ga0157380_101864611 | 167 |
| 468 | 3300014326 | Ga0157380_10215780 | Ga0157380_102157802 | 167 |
| 469 | 3300014326 | Ga0157380_10426265 | Ga0157380_104262652 | 167 |
| 470 | 3300014326 | Ga0157380_12527629 | Ga0157380_125276291 | 167 |
| 471 | 3300014969 | Ga0157376_10188927 | Ga0157376_101889272 | 167 |
| 472 | 3300014969 | Ga0157376_11224350 | Ga0157376_112243501 | 167 |
| 473 | 3300017792 | Ga0163161_10112438 | Ga0163161_101124382 | 167 |
| 474 | 3300020069 | Ga0197907_10889824 | Ga0197907_108898241 | 167 |
| 475 | 3300020069 | Ga0197907_11053528 | Ga0197907_110535281 | 167 |
| 476 | 3300020070 | Ga0206356_10247621 | Ga0206356_102476211 | 167 |
| 477 | 3300020070 | Ga0206356_10594276 | Ga0206356_105942761 | 167 |
| 478 | 3300020070 | Ga0206356_11474439 | Ga0206356_114744391 | 167 |
| 479 | 3300020070 | Ga0206356_11572529 | Ga0206356_115725291 | 167 |
| 480 | 3300020070 | Ga0206356_11733153 | Ga0206356_117331531 | 167 |
| 481 | 3300020070 | Ga0206356_11743097 | Ga0206356_117430971 | 167 |
| 482 | 3300020070 | Ga0206356_11836906 | Ga0206356_118369061 | 167 |
| 483 | 3300020075 | Ga0206349_1020691 | Ga0206349_10206911 | 167 |
| 484 | 3300020075 | Ga0206349_1186858 | Ga0206349_11868581 | 167 |
| 485 | 3300020075 | Ga0206349_1197767 | Ga0206349_11977671 | 167 |
| 486 | 3300020075 | Ga0206349_1262994 | Ga0206349_12629942 | 167 |
| 487 | 3300020075 | Ga0206349_1946070 | Ga0206349_19460701 | 167 |
| 488 | 3300020076 | Ga0206355_1093692 | Ga0206355_10936921 | 167 |
| 489 | 3300020076 | Ga0206355_1113466 | Ga0206355_11134661 | 167 |
| 490 | 3300020076 | Ga0206355_1164344 | Ga0206355_11643442 | 167 |
| 491 | 3300020076 | Ga0206355_1358260 | Ga0206355_13582601 | 167 |
| 492 | 3300020076 | Ga0206355_1367435 | Ga0206355_13674351 | 167 |
| 493 | 3300020077 | Ga0206351_10032476 | Ga0206351_100324761 | 167 |
| 494 | 3300020077 | Ga0206351_10751612 | Ga0206351_107516121 | 167 |
| 495 | 3300020078 | Ga0206352_10138666 | Ga0206352_101386661 | 167 |
| 496 | 3300020080 | Ga0206350_10122239 | Ga0206350_101222391 | 167 |
| 497 | 3300020080 | Ga0206350_10511773 | Ga0206350_105117731 | 167 |
| 498 | 3300020080 | Ga0206350_10646272 | Ga0206350_106462722 | 167 |
| 499 | 3300020080 | Ga0206350_10677610 | Ga0206350_106776101 | 167 |
| 500 | 3300020080 | Ga0206350_10924274 | Ga0206350_109242741 | 167 |
| 501 | 3300020080 | Ga0206350_11081022 | Ga0206350_110810221 | 167 |
| 502 | 3300020080 | Ga0206350_11355059 | Ga0206350_113550591 | 167 |
| 503 | 3300020081 | Ga0206354_10089617 | Ga0206354_100896172 | 167 |
| 504 | 3300020081 | Ga0206354_11086759 | Ga0206354_110867591 | 167 |
| 505 | 3300020081 | Ga0206354_11428798 | Ga0206354_114287981 | 167 |
| 506 | 3300020082 | Ga0206353_10116796 | Ga0206353_101167962 | 167 |
| 507 | 3300020082 | Ga0206353_10362445 | Ga0206353_103624451 | 167 |
| 508 | 3300020082 | Ga0206353_10411745 | Ga0206353_104117451 | 167 |
| 509 | 3300020082 | Ga0206353_10504062 | Ga0206353_105040621 | 167 |
| 510 | 3300020082 | Ga0206353_11374616 | Ga0206353_113746161 | 167 |
| 511 | 3300020082 | Ga0206353_11504878 | Ga0206353_115048781 | 167 |
| 512 | 3300020082 | Ga0206353_11657362 | Ga0206353_116573621 | 167 |
| 513 | 3300020610 | Ga0154015_1321397 | Ga0154015_13213971 | 167 |
| 514 | 3300022467 | Ga0224712_10182083 | Ga0224712_101820832 | 167 |
| 515 | 3300022467 | Ga0224712_10278123 | Ga0224712_102781232 | 167 |
| 516 | 3300022467 | Ga0224712_10304103 | Ga0224712_103041031 | 167 |
| 517 | 3300022467 | Ga0224712_10305207 | Ga0224712_103052071 | 167 |
| 518 | 3300022467 | Ga0224712_10448592 | Ga0224712_104485921 | 167 |
| 519 | 3300022467 | Ga0224712_10488207 | Ga0224712_104882071 | 167 |
| 520 | 3300022467 | Ga0224712_10494070 | Ga0224712_104940701 | 167 |
| 521 | 3300023552 | Ga0247551_102201 | Ga0247551_1022011 | 167 |
| 522 | 3300023684 | Ga0247523_112525 | Ga0247523_1125251 | 167 |
| 523 | 3300025272 | Ga0209455_1002093 | Ga0209455_10020936 | 167 |
| 524 | 3300025297 | Ga0209758_1008352 | Ga0209758_10083523 | 167 |
| 525 | 3300025302 | Ga0207426_1075567 | Ga0207426_10755671 | 167 |
| 526 | 3300025321 | Ga0207656_10163908 | Ga0207656_101639081 | 167 |
| 527 | 3300025735 | Ga0207713_1073333 | Ga0207713_10733332 | 167 |
| 528 | 3300025885 | Ga0207653_10007478 | Ga0207653_100074781 | 167 |
| 529 | 3300025885 | Ga0207653_10039302 | Ga0207653_100393022 | 167 |
| 530 | 3300025898 | Ga0207692_10027517 | Ga0207692_100275172 | 167 |
| 531 | 3300025899 | Ga0207642_10081749 | Ga0207642_100817492 | 167 |
| 532 | 3300025900 | Ga0207710_10011489 | Ga0207710_100114892 | 167 |
| 533 | 3300025903 | Ga0207680_10009686 | Ga0207680_100096862 | 167 |
| 534 | 3300025904 | Ga0207647_10091272 | Ga0207647_100912721 | 167 |
| 535 | 3300025906 | Ga0207699_10000463 | Ga0207699_100004639 | 167 |
| 536 | 3300025906 | Ga0207699_10107996 | Ga0207699_101079961 | 167 |
| 537 | 3300025907 | Ga0207645_10227158 | Ga0207645_102271581 | 167 |
| 538 | 3300025907 | Ga0207645_10336316 | Ga0207645_103363161 | 167 |
| 539 | 3300025909 | Ga0207705_10109530 | Ga0207705_101095302 | 167 |
| 540 | 3300025909 | Ga0207705_10177512 | Ga0207705_101775122 | 167 |
| 541 | 3300025910 | Ga0207684_11024328 | Ga0207684_110243281 | 167 |
| 542 | 3300025911 | Ga0207654_10126759 | Ga0207654_101267592 | 167 |
| 543 | 3300025911 | Ga0207654_10156278 | Ga0207654_101562782 | 167 |
| 544 | 3300025911 | Ga0207654_10550951 | Ga0207654_105509511 | 167 |
| 545 | 3300025912 | Ga0207707_10014498 | Ga0207707_100144985 | 167 |
| 546 | 3300025912 | Ga0207707_10024561 | Ga0207707_100245615 | 167 |
| 547 | 3300025913 | Ga0207695_10056580 | Ga0207695_100565806 | 167 |
| 548 | 3300025914 | Ga0207671_10073879 | Ga0207671_100738791 | 167 |
| 549 | 3300025914 | Ga0207671_10170843 | Ga0207671_101708434 | 167 |
| 550 | 3300025914 | Ga0207671_10968571 | Ga0207671_109685711 | 167 |
| 551 | 3300025915 | Ga0207693_10000640 | Ga0207693_100006409 | 167 |
| 552 | 3300025915 | Ga0207693_10070055 | Ga0207693_100700554 | 167 |
| 553 | 3300025916 | Ga0207663_10373124 | Ga0207663_103731242 | 167 |
| 554 | 3300025916 | Ga0207663_11025368 | Ga0207663_110253682 | 167 |
| 555 | 3300025919 | Ga0207657_10006779 | Ga0207657_100067792 | 167 |
| 556 | 3300025919 | Ga0207657_10386797 | Ga0207657_103867971 | 167 |
| 557 | 3300025920 | Ga0207649_10073668 | Ga0207649_100736682 | 167 |
| 558 | 3300025921 | Ga0207652_10014385 | Ga0207652_100143852 | 167 |
| 559 | 3300025921 | Ga0207652_10227920 | Ga0207652_102279202 | 167 |
| 560 | 3300025924 | Ga0207694_10151091 | Ga0207694_101510912 | 167 |
| 561 | 3300025926 | Ga0207659_10779263 | Ga0207659_107792631 | 167 |
| 562 | 3300025927 | Ga0207687_10074887 | Ga0207687_100748872 | 167 |
| 563 | 3300025928 | Ga0207700_10981429 | Ga0207700_109814291 | 167 |
| 564 | 3300025929 | Ga0207664_10163043 | Ga0207664_101630432 | 167 |
| 565 | 3300025929 | Ga0207664_10332650 | Ga0207664_103326502 | 167 |
| 566 | 3300025929 | Ga0207664_11066688 | Ga0207664_110666881 | 167 |
| 567 | 3300025931 | Ga0207644_10026008 | Ga0207644_100260082 | 167 |
| 568 | 3300025931 | Ga0207644_10065213 | Ga0207644_100652132 | 167 |
| 569 | 3300025932 | Ga0207690_10099075 | Ga0207690_100990752 | 167 |
| 570 | 3300025932 | Ga0207690_10224525 | Ga0207690_102245252 | 167 |
| 571 | 3300025933 | Ga0207706_10059285 | Ga0207706_100592853 | 167 |
| 572 | 3300025933 | Ga0207706_10067153 | Ga0207706_100671533 | 167 |
| 573 | 3300025933 | Ga0207706_10482924 | Ga0207706_104829242 | 167 |
| 574 | 3300025934 | Ga0207686_10074963 | Ga0207686_100749631 | 167 |
| 575 | 3300025934 | Ga0207686_10247460 | Ga0207686_102474602 | 167 |
| 576 | 3300025935 | Ga0207709_10139546 | Ga0207709_101395461 | 167 |
| 577 | 3300025935 | Ga0207709_10569188 | Ga0207709_105691881 | 167 |
| 578 | 3300025936 | Ga0207670_10186147 | Ga0207670_101861472 | 167 |
| 579 | 3300025937 | Ga0207669_10529931 | Ga0207669_105299311 | 167 |
| 580 | 3300025938 | Ga0207704_10004344 | Ga0207704_100043444 | 167 |
| 581 | 3300025939 | Ga0207665_10001240 | Ga0207665_100012404 | 167 |
| 582 | 3300025940 | Ga0207691_10037607 | Ga0207691_100376073 | 167 |
| 583 | 3300025941 | Ga0207711_10030859 | Ga0207711_100308591 | 167 |
| 584 | 3300025941 | Ga0207711_10815829 | Ga0207711_108158291 | 167 |
| 585 | 3300025942 | Ga0207689_10424621 | Ga0207689_104246212 | 167 |
| 586 | 3300025942 | Ga0207689_10572682 | Ga0207689_105726822 | 167 |
| 587 | 3300025944 | Ga0207661_10055213 | Ga0207661_100552132 | 167 |
| 588 | 3300025944 | Ga0207661_10127093 | Ga0207661_101270932 | 167 |
| 589 | 3300025945 | Ga0207679_11108163 | Ga0207679_111081631 | 167 |
| 590 | 3300025960 | Ga0207651_10421006 | Ga0207651_104210062 | 167 |
| 591 | 3300025960 | Ga0207651_10782063 | Ga0207651_107820631 | 167 |
| 592 | 3300025972 | Ga0207668_10023778 | Ga0207668_100237783 | 167 |
| 593 | 3300025972 | Ga0207668_10125228 | Ga0207668_101252282 | 167 |
| 594 | 3300025972 | Ga0207668_10281391 | Ga0207668_102813911 | 167 |
| 595 | 3300025986 | Ga0207658_10028993 | Ga0207658_100289932 | 167 |
| 596 | 3300026023 | Ga0207677_11102657 | Ga0207677_111026572 | 167 |
| 597 | 3300026035 | Ga0207703_10205828 | Ga0207703_102058282 | 167 |
| 598 | 3300026035 | Ga0207703_10393125 | Ga0207703_103931252 | 167 |
| 599 | 3300026067 | Ga0207678_10013706 | Ga0207678_100137062 | 167 |
| 600 | 3300026067 | Ga0207678_10043711 | Ga0207678_100437112 | 167 |
| 601 | 3300026067 | Ga0207678_10094228 | Ga0207678_100942282 | 167 |
| 602 | 3300026067 | Ga0207678_10143127 | Ga0207678_101431272 | 167 |
| 603 | 3300026067 | Ga0207678_10368890 | Ga0207678_103688902 | 167 |
| 604 | 3300026067 | Ga0207678_10396695 | Ga0207678_103966952 | 167 |
| 605 | 3300026067 | Ga0207678_10459519 | Ga0207678_104595192 | 167 |
| 606 | 3300026067 | Ga0207678_11083551 | Ga0207678_110835511 | 167 |
| 607 | 3300026078 | Ga0207702_10000261 | Ga0207702_1000026165 | 167 |
| 608 | 3300026078 | Ga0207702_10018370 | Ga0207702_100183702 | 167 |
| 609 | 3300026078 | Ga0207702_10189685 | Ga0207702_101896852 | 167 |
| 610 | 3300026088 | Ga0207641_11075545 | Ga0207641_110755452 | 167 |
| 611 | 3300026089 | Ga0207648_10918263 | Ga0207648_109182631 | 167 |
| 612 | 3300026095 | Ga0207676_10144444 | Ga0207676_101444442 | 167 |
| 613 | 3300026095 | Ga0207676_10557049 | Ga0207676_105570491 | 167 |
| 614 | 3300026118 | Ga0207675_100019330 | Ga0207675_1000193305 | 167 |
| 615 | 3300026118 | Ga0207675_100075468 | Ga0207675_1000754683 | 167 |
| 616 | 3300026118 | Ga0207675_100459020 | Ga0207675_1004590202 | 167 |
| 617 | 3300026121 | Ga0207683_10005431 | Ga0207683_100054312 | 167 |
| 618 | 3300026121 | Ga0207683_10529706 | Ga0207683_105297061 | 167 |
| 619 | 3300026142 | Ga0207698_10935451 | Ga0207698_109354511 | 167 |
| 620 | 3300027671 | Ga0209588_1076492 | Ga0209588_10764922 | 167 |
| 621 | 3300027866 | Ga0209813_10075398 | Ga0209813_100753981 | 167 |
| 622 | 3300027907 | Ga0207428_10039794 | Ga0207428_100397944 | 167 |
| 623 | 3300028379 | Ga0268266_10061845 | Ga0268266_100618453 | 167 |
| 624 | 3300028379 | Ga0268266_10089000 | Ga0268266_100890002 | 167 |
| 625 | 3300028379 | Ga0268266_10091874 | Ga0268266_100918742 | 167 |
| 626 | 3300028379 | Ga0268266_10615691 | Ga0268266_106156911 | 167 |
| 627 | 3300028379 | Ga0268266_10757559 | Ga0268266_107575592 | 167 |
| 628 | 3300028380 | Ga0268265_10054641 | Ga0268265_100546412 | 167 |
| 629 | 3300028380 | Ga0268265_10220268 | Ga0268265_102202682 | 167 |
| 630 | 3300028381 | Ga0268264_10328562 | Ga0268264_103285621 | 167 |
| 631 | 3300028381 | Ga0268264_10424356 | Ga0268264_104243561 | 167 |
| 632 | 3300028794 | Ga0307515_10163003 | Ga0307515_101630033 | 167 |
| 633 | 3300028794 | Ga0307515_10419659 | Ga0307515_104196591 | 167 |
| 634 | 3300030863 | Ga0265766_1015316 | Ga0265766_10153161 | 167 |
| 635 | 3300031239 | Ga0265328_10244845 | Ga0265328_102448451 | 167 |
| 636 | 3300031241 | Ga0265325_10001626 | Ga0265325_1000162612 | 167 |
| 637 | 3300031241 | Ga0265325_10011302 | Ga0265325_100113024 | 167 |
| 638 | 3300031249 | Ga0265339_10005018 | Ga0265339_100050187 | 167 |
| 639 | 3300031456 | Ga0307513_10154734 | Ga0307513_101547342 | 167 |
| 640 | 3300031456 | Ga0307513_10445618 | Ga0307513_104456181 | 167 |
| 641 | 3300031507 | Ga0307509_10508846 | Ga0307509_105088461 | 167 |
| 642 | 3300031507 | Ga0307509_10577547 | Ga0307509_105775471 | 167 |
| 643 | 3300031548 | Ga0307408_100421690 | Ga0307408_1004216901 | 167 |
| 644 | 3300031548 | Ga0307408_100536846 | Ga0307408_1005368461 | 167 |
| 645 | 3300031592 | Ga0310117_124297 | Ga0310117_1242971 | 167 |
| 646 | 3300031595 | Ga0265313_10004507 | Ga0265313_100045077 | 167 |
| 647 | 3300031595 | Ga0265313_10030909 | Ga0265313_100309092 | 167 |
| 648 | 3300031595 | Ga0265313_10054763 | Ga0265313_100547633 | 167 |
| 649 | 3300031616 | Ga0307508_10146318 | Ga0307508_101463182 | 167 |
| 650 | 3300031712 | Ga0265342_10059304 | Ga0265342_100593042 | 167 |
| 651 | 3300031828 | Ga0316043_127489 | Ga0316043_1274891 | 167 |
| 652 | 3300031901 | Ga0307406_10316115 | Ga0307406_103161152 | 167 |
| 653 | 3300032002 | Ga0307416_100168750 | Ga0307416_1001687501 | 167 |
| 654 | 3300032126 | Ga0307415_100036591 | Ga0307415_1000365911 | 167 |
| 655 | 3300033179 | Ga0307507_10213161 | Ga0307507_102131611 | 167 |
| 656 | 3300033180 | Ga0307510_10062648 | Ga0307510_100626482 | 167 |
| 657 | 3300033180 | Ga0307510_10440666 | Ga0307510_104406661 | 167 |
| 658 | 3300034817 | Ga0373948_0008489 | Ga0373948_0008489_521_1024 | 167 |
| 659 | 3300034819 | Ga0373958_0001587 | Ga0373958_0001587_988_1491 | 167 |
| 660 | 3300035083 | Ga0373926_0005541 | Ga0373926_0005541_2071_2574 | 167 |
| 661 | 3300035086 | Ga0373934_0054317 | Ga0373934_0054317_895_1398 | 167 |
| 662 | 3300035089 | Ga0373944_0000364 | Ga0373944_0000364_7273_7776 | 167 |
| 663 | 3300035089 | Ga0373944_0010085 | Ga0373944_0010085_93_596 | 167 |
| 664 | 3300035089 | Ga0373944_0097139 | Ga0373944_0097139_417_920 | 167 |
| 665 | 3300035090 | Ga0373949_0021242 | Ga0373949_0021242_41_544 | 167 |
| 666 | 3300035091 | Ga0373951_0023092 | Ga0373951_0023092_329_832 | 167 |
| 667 | 3300035091 | Ga0373951_0112944 | Ga0373951_0112944_17_586 | 167 |
| 668 | 3300035111 | Ga0373923_0005611 | Ga0373923_0005611_2402_2905 | 167 |
| 669 | 3300035111 | Ga0373923_0009594 | Ga0373923_0009594_1609_2115 | 167 |
| 670 | 3300035111 | Ga0373923_0183843 | Ga0373923_0183843_407_910 | 167 |
| 671 | 3300035113 | Ga0373936_0008721 | Ga0373936_0008721_1698_2201 | 167 |
| 672 | 3300035113 | Ga0373936_0081898 | Ga0373936_0081898_749_1255 | 167 |
| 673 | 3300035114 | Ga0373939_0133078 | Ga0373939_0133078_194_697 | 167 |
| 674 | 3300035115 | Ga0373941_0013347 | Ga0373941_0013347_752_1255 | 167 |
| 675 | 3300035116 | Ga0373945_0000604 | Ga0373945_0000604_8448_8951 | 167 |
| 676 | 3300035116 | Ga0373945_0013010 | Ga0373945_0013010_10_561 | 167 |
| 677 | 3300035116 | Ga0373945_0066848 | Ga0373945_0066848_720_1223 | 167 |
| 678 | 3300035117 | Ga0373953_0031765 | Ga0373953_0031765_458_964 | 167 |
| 679 | 3300035117 | Ga0373953_0038873 | Ga0373953_0038873_263_766 | 167 |
| 680 | 3300035118 | Ga0373954_0011230 | Ga0373954_0011230_2383_2886 | 167 |
| 681 | 3300035118 | Ga0373954_0048759 | Ga0373954_0048759_798_1304 | 167 |
| 682 | 3300035119 | Ga0373956_0084357 | Ga0373956_0084357_74_580 | 167 |
| 683 | 3300035119 | Ga0373956_0381736 | Ga0373956_0381736_31_537 | 167 |
| 684 | 3300035120 | Ga0373957_0003340 | Ga0373957_0003340_3039_3545 | 167 |
| 685 | 3300035120 | Ga0373957_0062844 | Ga0373957_0062844_440_943 | 167 |
| 686 | 3300035170 | Ga0373943_0006934 | Ga0373943_0006934_4485_4988 | 167 |
| 687 | 3300035170 | Ga0373943_0031393 | Ga0373943_0031393_1767_2270 | 167 |
| 688 | 3300035171 | Ga0373946_0029874 | Ga0373946_0029874_952_1455 | 167 |
| 689 | 3300035171 | Ga0373946_0033120 | Ga0373946_0033120_538_1041 | 167 |
| 690 | 3300035172 | Ga0373955_0002404 | Ga0373955_0002404_1654_2160 | 167 |
| 691 | 3300035172 | Ga0373955_0007268 | Ga0373955_0007268_2154_2657 | 167 |
| 692 | 3300035172 | Ga0373955_0114546 | Ga0373955_0114546_198_701 | 167 |
| 693 | 3300035241 | Ga0373961_0002416 | Ga0373961_0002416_1745_2248 | 167 |
| 694 | 3300035242 | Ga0373962_0112365 | Ga0373962_0112365_236_739 | 167 |
| 695 | 3300035410 | Ga0373924_0006081 | Ga0373924_0006081_1811_2314 | 167 |
| 696 | 3300035410 | Ga0373924_0006172 | Ga0373924_0006172_3639_4145 | 167 |
| 697 | 3300035691 | Ga0373931_0096660 | Ga0373931_0096660_408_914 | 167 |
| 698 | 3300035692 | Ga0373935_0013235 | Ga0373935_0013235_2015_2518 | 167 |
| 699 | 3300035692 | Ga0373935_0465733 | Ga0373935_0465733_394_897 | 167 |
| 700 | 3300035692 | Ga0373935_0800384 | Ga0373935_0800384_174_680 | 167 |
| 701 | 3300035695 | Ga0373927_0001118 | Ga0373927_0001118_8306_8809 | 167 |
| 702 | 3300035695 | Ga0373927_0011708 | Ga0373927_0011708_1063_1566 | 167 |
| 703 | 3300035695 | Ga0373927_0014273 | Ga0373927_0014273_3810_4313 | 167 |
| 704 | 3300035724 | Ga0373933_0011886 | Ga0373933_0011886_1964_2470 | 167 |
| 705 | 3300035724 | Ga0373933_0088546 | Ga0373933_0088546_965_1468 | 167 |
| 706 | 3300035725 | Ga0373947_0000372 | Ga0373947_0000372_1851_2354 | 167 |
| 707 | 3300035725 | Ga0373947_0017773 | Ga0373947_0017773_3178_3681 | 167 |
| 708 | 3300035725 | Ga0373947_0026529 | Ga0373947_0026529_1698_2201 | 167 |
| 709 | 3300036401 | Ga0373937_0030143 | Ga0373937_0030143_2916_3419 | 167 |
| 710 | 3300036401 | Ga0373937_0101470 | Ga0373937_0101470_697_1203 | 167 |
| 711 | 3300036401 | Ga0373937_0106945 | Ga0373937_0106945_1185_1691 | 167 |
| 712 | 3300036401 | Ga0373937_0114684 | Ga0373937_0114684_887_1390 | 167 |
| 713 | 3300036401 | Ga0373937_0995412 | Ga0373937_0995412_147_653 | 167 |
| 714 | 3300036534 | Ga0310109_046298 | Ga0310109_046298_21_527 | 167 |
| 715 | 3300037068 | Ga0373925_0006079 | Ga0373925_0006079_2274_2777 | 167 |
| 716 | 3300037068 | Ga0373925_0035309 | Ga0373925_0035309_1463_1966 | 167 |
| 717 | 3300037068 | Ga0373925_0043061 | Ga0373925_0043061_996_1499 | 167 |
| 718 | 3300037068 | Ga0373925_0263159 | Ga0373925_0263159_583_1089 | 167 |
| 719 | 3300037471 | Ga0395905_0217267 | Ga0395905_0217267_1238_1744 | 167 |
| 720 | 3300037471 | Ga0395905_0314542 | Ga0395905_0314542_288_896 | 167 |
| 721 | 3300039438 | Ga0436360_0599366 | Ga0436360_0599366_1758_2264 | 167 |
| 722 | 3300039438 | Ga0436360_0645480 | Ga0436360_0645480_415_918 | 167 |
| 723 | 3300039450 | Ga0436363_1293311 | Ga0436363_1293311_694_1200 | 167 |
| 724 | 3300039453 | Ga0436362_1029460 | Ga0436362_1029460_1285_1788 | 167 |
| 725 | 3300041410 | Ga0439461_0128559 | Ga0439461_0128559_92_598 | 167 |
| 726 | 3300041460 | Ga0451802_0955069 | Ga0451802_0955069_121_627 | 167 |
| 727 | 3300041512 | Ga0451853_3246118 | Ga0451853_3246118_10_513 | 167 |
| 728 | 3300044684 | Ga0466966_0005575 | Ga0466966_0005575_6903_7406 | 167 |
| 729 | 3300044684 | Ga0466966_0252929 | Ga0466966_0252929_239_745 | 167 |
| 730 | 3300044694 | Ga0466963_0038531 | Ga0466963_0038531_600_1106 | 167 |
| 731 | 3300044694 | Ga0466963_0955214 | Ga0466963_0955214_61_564 | 167 |
| 732 | 3300044735 | Ga0466968_0005113 | Ga0466968_0005113_373_876 | 167 |
| 733 | 3300045049 | Ga0466959_0010598 | Ga0466959_0010598_4804_5307 | 167 |
| 734 | 3300045049 | Ga0466959_0329301 | Ga0466959_0329301_442_948 | 167 |
| 735 | 3300045049 | Ga0466959_0444672 | Ga0466959_0444672_297_803 | 167 |
| 736 | 3300045976 | Ga0466967_0021546 | Ga0466967_0021546_3465_3971 | 167 |
| 737 | 3300046453 | Ga0495627_103522 | Ga0495627_103522_57_563 | 167 |
| 738 | 3300046454 | Ga0495592_0001055 | Ga0495592_0001055_6088_6594 | 167 |
| 739 | 3300046454 | Ga0495592_0010832 | Ga0495592_0010832_5863_6366 | 167 |
| 740 | 3300046455 | Ga0495603_0014865 | Ga0495603_0014865_4108_4614 | 167 |
| 741 | 3300046455 | Ga0495603_0024400 | Ga0495603_0024400_611_1117 | 167 |
| 742 | 3300046455 | Ga0495603_0026152 | Ga0495603_0026152_137_640 | 167 |
| 743 | 3300046455 | Ga0495603_0223293 | Ga0495603_0223293_291_797 | 167 |
| 744 | 3300046457 | Ga0495590_0030522 | Ga0495590_0030522_1330_1836 | 167 |
| 745 | 3300046459 | Ga0495629_0003357 | Ga0495629_0003357_1895_2398 | 167 |
| 746 | 3300046459 | Ga0495629_0019076 | Ga0495629_0019076_3537_4040 | 167 |
| 747 | 3300046459 | Ga0495629_0112714 | Ga0495629_0112714_690_1196 | 167 |
| 748 | 3300046459 | Ga0495629_0177175 | Ga0495629_0177175_338_841 | 167 |
| 749 | 3300046460 | Ga0495638_0105696 | Ga0495638_0105696_31_537 | 167 |
| 750 | 3300046460 | Ga0495638_0127089 | Ga0495638_0127089_669_1175 | 167 |
| 751 | 3300046461 | Ga0495641_0012702 | Ga0495641_0012702_2498_3001 | 167 |
| 752 | 3300046462 | Ga0495651_0009559 | Ga0495651_0009559_4935_5438 | 167 |
| 753 | 3300046462 | Ga0495651_0039188 | Ga0495651_0039188_2962_3465 | 167 |
| 754 | 3300046462 | Ga0495651_0055997 | Ga0495651_0055997_1786_2292 | 167 |
| 755 | 3300046462 | Ga0495651_0099648 | Ga0495651_0099648_751_1257 | 167 |
| 756 | 3300046463 | Ga0495653_0008585 | Ga0495653_0008585_723_1226 | 167 |
| 757 | 3300046463 | Ga0495653_0017321 | Ga0495653_0017321_1833_2339 | 167 |
| 758 | 3300046463 | Ga0495653_0267673 | Ga0495653_0267673_609_1112 | 167 |
| 759 | 3300046472 | Ga0495580_0013690 | Ga0495580_0013690_3865_4368 | 167 |
| 760 | 3300046472 | Ga0495580_0222805 | Ga0495580_0222805_180_683 | 167 |
| 761 | 3300046473 | Ga0495582_0011471 | Ga0495582_0011471_1470_1973 | 167 |
| 762 | 3300046473 | Ga0495582_0031598 | Ga0495582_0031598_824_1327 | 167 |
| 763 | 3300046475 | Ga0495639_0004110 | Ga0495639_0004110_1699_2202 | 167 |
| 764 | 3300046476 | Ga0495662_0003064 | Ga0495662_0003064_5889_6392 | 167 |
| 765 | 3300046476 | Ga0495662_0362007 | Ga0495662_0362007_10_516 | 167 |
| 766 | 3300046477 | Ga0495664_0008779 | Ga0495664_0008779_2065_2568 | 167 |
| 767 | 3300046477 | Ga0495664_0269855 | Ga0495664_0269855_40_546 | 167 |
| 768 | 3300046491 | Ga0495584_0034642 | Ga0495584_0034642_1659_2165 | 167 |
| 769 | 3300046492 | Ga0495585_0056846 | Ga0495585_0056846_848_1354 | 167 |
| 770 | 3300046499 | Ga0495594_0005321 | Ga0495594_0005321_3058_3561 | 167 |
| 771 | 3300046499 | Ga0495594_0143479 | Ga0495594_0143479_295_801 | 167 |
| 772 | 3300046501 | Ga0495607_0044310 | Ga0495607_0044310_880_1383 | 167 |
| 773 | 3300046506 | Ga0495583_0042395 | Ga0495583_0042395_486_992 | 167 |
| 774 | 3300046507 | Ga0495606_0055888 | Ga0495606_0055888_1549_2055 | 167 |
| 775 | 3300046511 | Ga0495608_0033105 | Ga0495608_0033105_681_1187 | 167 |
| 776 | 3300046512 | Ga0495610_0044346 | Ga0495610_0044346_342_848 | 167 |
| 777 | 3300046513 | Ga0495616_0035528 | Ga0495616_0035528_1153_1659 | 167 |
| 778 | 3300046513 | Ga0495616_0113607 | Ga0495616_0113607_399_905 | 167 |
| 779 | 3300046514 | Ga0495618_0002517 | Ga0495618_0002517_61_612 | 167 |
| 780 | 3300046514 | Ga0495618_0045723 | Ga0495618_0045723_2009_2512 | 167 |
| 781 | 3300046514 | Ga0495618_0722148 | Ga0495618_0722148_25_531 | 167 |
| 782 | 3300046516 | Ga0495628_0087042 | Ga0495628_0087042_1178_1684 | 167 |
| 783 | 3300046516 | Ga0495628_0087330 | Ga0495628_0087330_43_549 | 167 |
| 784 | 3300046516 | Ga0495628_0348576 | Ga0495628_0348576_471_974 | 167 |
| 785 | 3300046517 | Ga0495630_0017717 | Ga0495630_0017717_2881_3384 | 167 |
| 786 | 3300046517 | Ga0495630_0025849 | Ga0495630_0025849_123_626 | 167 |
| 787 | 3300046518 | Ga0495631_0109239 | Ga0495631_0109239_230_736 | 167 |
| 788 | 3300046518 | Ga0495631_0199360 | Ga0495631_0199360_78_581 | 167 |
| 789 | 3300046519 | Ga0495632_0021367 | Ga0495632_0021367_898_1404 | 167 |
| 790 | 3300046520 | Ga0495637_0033862 | Ga0495637_0033862_857_1363 | 167 |
| 791 | 3300046522 | Ga0495643_0206760 | Ga0495643_0206760_390_896 | 167 |
| 792 | 3300046523 | Ga0495644_0002732 | Ga0495644_0002732_2568_3071 | 167 |
| 793 | 3300046525 | Ga0495663_0046978 | Ga0495663_0046978_581_1087 | 167 |
| 794 | 3300046526 | Ga0495666_0006077 | Ga0495666_0006077_1598_2101 | 167 |
| 795 | 3300046526 | Ga0495666_0020392 | Ga0495666_0020392_976_1479 | 167 |
| 796 | 3300046526 | Ga0495666_0152763 | Ga0495666_0152763_486_992 | 167 |
| 797 | 3300046529 | Ga0495652_0108337 | Ga0495652_0108337_1268_1774 | 167 |
| 798 | 3300046529 | Ga0495652_0145992 | Ga0495652_0145992_38_541 | 167 |
| 799 | 3300046531 | Ga0495665_0032754 | Ga0495665_0032754_816_1319 | 167 |
| 800 | 3300046533 | Ga0495640_0006867 | Ga0495640_0006867_7270_7776 | 167 |
| 801 | 3300046533 | Ga0495640_0051277 | Ga0495640_0051277_1447_1950 | 167 |
| 802 | 3300046533 | Ga0495640_0183560 | Ga0495640_0183560_680_1183 | 167 |
| 803 | 3300046535 | Ga0495586_0087335 | Ga0495586_0087335_952_1455 | 167 |
| 804 | 3300046535 | Ga0495586_0230257 | Ga0495586_0230257_44_547 | 167 |
| 805 | 3300046536 | Ga0495587_0026482 | Ga0495587_0026482_469_972 | 167 |
| 806 | 3300046536 | Ga0495587_0051328 | Ga0495587_0051328_681_1187 | 167 |
| 807 | 3300046537 | Ga0495598_0058368 | Ga0495598_0058368_31_537 | 167 |
| 808 | 3300046538 | Ga0495609_0033203 | Ga0495609_0033203_1257_1760 | 167 |
| 809 | 3300046539 | Ga0495621_0013532 | Ga0495621_0013532_1389_1895 | 167 |
| 810 | 3300046542 | Ga0495597_0092747 | Ga0495597_0092747_730_1236 | 167 |
| 811 | 3300046557 | Ga0495622_0006399 | Ga0495622_0006399_584_1087 | 167 |
| 812 | 3300046558 | Ga0495633_0009880 | Ga0495633_0009880_2101_2604 | 167 |
| 813 | 3300046558 | Ga0495633_0018095 | Ga0495633_0018095_651_1157 | 167 |
| 814 | 3300046559 | Ga0495667_0008737 | Ga0495667_0008737_4666_5169 | 167 |
| 815 | 3300046559 | Ga0495667_0020910 | Ga0495667_0020910_1769_2275 | 167 |
| 816 | 3300046559 | Ga0495667_0078258 | Ga0495667_0078258_1609_2112 | 167 |
| 817 | 3300046559 | Ga0495667_0106403 | Ga0495667_0106403_42_548 | 167 |
| 818 | 3300046615 | Ga0495656_0000064 | Ga0495656_0000064_15355_15858 | 167 |
| 819 | 3300046615 | Ga0495656_0046515 | Ga0495656_0046515_159_665 | 167 |
| 820 | 3300046615 | Ga0495656_0048334 | Ga0495656_0048334_1006_1512 | 167 |
| 821 | 3300046616 | Ga0495668_0025416 | Ga0495668_0025416_2689_3285 | 167 |
| 822 | 3300046642 | Ga0495634_0026538 | Ga0495634_0026538_2896_3399 | 167 |
| 823 | 3300046642 | Ga0495634_0047460 | Ga0495634_0047460_2268_2771 | 167 |
| 824 | 3300046648 | Ga0495611_0105572 | Ga0495611_0105572_120_626 | 167 |
| 825 | 3300046648 | Ga0495611_0124745 | Ga0495611_0124745_357_860 | 167 |
| 826 | 3300046648 | Ga0495611_0226481 | Ga0495611_0226481_22_528 | 167 |
| 827 | 3300046660 | Ga0495625_0006076 | Ga0495625_0006076_9934_10530 | 167 |
| 828 | 3300046660 | Ga0495625_0047212 | Ga0495625_0047212_2273_2779 | 167 |
| 829 | 3300046660 | Ga0495625_0658367 | Ga0495625_0658367_77_583 | 167 |
| 830 | 3300046663 | Ga0495635_0008796 | Ga0495635_0008796_3591_4094 | 167 |
| 831 | 3300046663 | Ga0495635_0037890 | Ga0495635_0037890_266_769 | 167 |
| 832 | 3300046663 | Ga0495635_0122079 | Ga0495635_0122079_965_1468 | 167 |
| 833 | 3300046664 | Ga0495659_0208813 | Ga0495659_0208813_35_541 | 167 |
| 834 | 3300046665 | Ga0495661_0036088 | Ga0495661_0036088_712_1218 | 167 |
| 835 | 3300046665 | Ga0495661_0150914 | Ga0495661_0150914_458_964 | 167 |
| 836 | 3300046665 | Ga0495661_0225380 | Ga0495661_0225380_165_668 | 167 |
| 837 | 3300046674 | Ga0495588_0011011 | Ga0495588_0011011_1446_1949 | 167 |
| 838 | 3300046674 | Ga0495588_0018681 | Ga0495588_0018681_518_1024 | 167 |
| 839 | 3300046675 | Ga0495657_0047604 | Ga0495657_0047604_1641_2147 | 167 |
| 840 | 3300046675 | Ga0495657_0106638 | Ga0495657_0106638_617_1120 | 167 |
| 841 | 3300046675 | Ga0495657_0202029 | Ga0495657_0202029_94_600 | 167 |
| 842 | 3300046675 | Ga0495657_0509451 | Ga0495657_0509451_93_599 | 167 |
| 843 | 3300046678 | Ga0495599_0021867 | Ga0495599_0021867_979_1482 | 167 |
| 844 | 3300046678 | Ga0495599_0043307 | Ga0495599_0043307_2256_2762 | 167 |
| 845 | 3300046679 | Ga0495623_0036443 | Ga0495623_0036443_1393_1899 | 167 |
| 846 | 3300046679 | Ga0495623_0248643 | Ga0495623_0248643_350_856 | 167 |
| 847 | 3300046680 | Ga0495646_0003336 | Ga0495646_0003336_1942_2445 | 167 |
| 848 | 3300046681 | Ga0495647_0015713 | Ga0495647_0015713_2119_2622 | 167 |
| 849 | 3300046681 | Ga0495647_0017786 | Ga0495647_0017786_1767_2270 | 167 |
| 850 | 3300046683 | Ga0495658_0001834 | Ga0495658_0001834_8260_8763 | 167 |
| 851 | 3300046683 | Ga0495658_0010431 | Ga0495658_0010431_3458_3961 | 167 |
| 852 | 3300046683 | Ga0495658_0311236 | Ga0495658_0311236_110_613 | 167 |
| 853 | 3300046684 | Ga0495669_0241913 | Ga0495669_0241913_261_764 | 167 |
| 854 | 3300046684 | Ga0495669_0266358 | Ga0495669_0266358_139_645 | 167 |
| 855 | 3300046689 | Ga0495613_0033299 | Ga0495613_0033299_1560_2063 | 167 |
| 856 | 3300046689 | Ga0495613_0102619 | Ga0495613_0102619_1433_1939 | 167 |
| 857 | 3300046689 | Ga0495613_0182144 | Ga0495613_0182144_148_651 | 167 |
| 858 | 3300046690 | Ga0495624_0005807 | Ga0495624_0005807_3076_3579 | 167 |
| 859 | 3300046690 | Ga0495624_0045904 | Ga0495624_0045904_348_851 | 167 |
| 860 | 3300046691 | Ga0495670_0090641 | Ga0495670_0090641_521_1027 | 167 |
| 861 | 3300046692 | Ga0495671_0013849 | Ga0495671_0013849_1161_1667 | 167 |
| 862 | 3300046794 | Ga0495589_0247988 | Ga0495589_0247988_312_818 | 167 |
| 863 | 3300046809 | Ga0495600_0000716 | Ga0495600_0000716_14599_15105 | 167 |
| 864 | 3300046809 | Ga0495600_0001994 | Ga0495600_0001994_4364_4867 | 167 |
| 865 | 3300046809 | Ga0495600_0181124 | Ga0495600_0181124_424_927 | 167 |
| 866 | 3300046810 | Ga0495660_0128889 | Ga0495660_0128889_125_631 | 167 |
| 867 | 3300046810 | Ga0495660_0343500 | Ga0495660_0343500_76_582 | 167 |
| 868 | 3300047315 | Ga0495581_0020045 | Ga0495581_0020045_1485_1988 | 167 |
| 869 | 3300047315 | Ga0495581_0072896 | Ga0495581_0072896_1039_1542 | 167 |
| 870 | 3300047315 | Ga0495581_0073317 | Ga0495581_0073317_1367_1870 | 167 |
| 871 | 3300047317 | Ga0495604_0025973 | Ga0495604_0025973_1936_2439 | 167 |
| 872 | 3300047317 | Ga0495604_0039798 | Ga0495604_0039798_2256_2762 | 167 |
| 873 | 3300047317 | Ga0495604_0054739 | Ga0495604_0054739_1479_1982 | 167 |
| 874 | 3300047318 | Ga0495636_0095471 | Ga0495636_0095471_506_1012 | 167 |
| 875 | 3300047319 | Ga0495674_0088487 | Ga0495674_0088487_251_754 | 167 |
| 876 | 3300047319 | Ga0495674_0345361 | Ga0495674_0345361_127_630 | 167 |
| 877 | 3300047320 | Ga0495672_0079076 | Ga0495672_0079076_1304_1810 | 167 |
| 878 | 3300047321 | Ga0495676_0030061 | Ga0495676_0030061_2545_3048 | 167 |
| 879 | 3300047321 | Ga0495676_0050140 | Ga0495676_0050140_2259_2765 | 167 |
| 880 | 3300047321 | Ga0495676_0052812 | Ga0495676_0052812_575_1078 | 167 |
| 881 | 3300047321 | Ga0495676_0346310 | Ga0495676_0346310_87_590 | 167 |
| 882 | 3300047322 | Ga0495680_0011117 | Ga0495680_0011117_6704_7210 | 167 |
| 883 | 3300047322 | Ga0495680_0014218 | Ga0495680_0014218_251_754 | 167 |
| 884 | 3300047322 | Ga0495680_0045137 | Ga0495680_0045137_1947_2450 | 167 |
| 885 | 3300047322 | Ga0495680_0301870 | Ga0495680_0301870_242_745 | 167 |
| 886 | 3300047444 | Ga0495675_0104372 | Ga0495675_0104372_1005_1511 | 167 |
| 887 | 3300047444 | Ga0495675_0154536 | Ga0495675_0154536_275_778 | 167 |
| 888 | 3300047469 | Ga0495673_0035535 | Ga0495673_0035535_241_747 | 167 |
| 889 | 3300047471 | Ga0495684_0003050 | Ga0495684_0003050_1898_2401 | 167 |
| 890 | 3300047471 | Ga0495684_0006284 | Ga0495684_0006284_2909_3412 | 167 |
| 891 | 3300047471 | Ga0495684_0022194 | Ga0495684_0022194_1556_2062 | 167 |
| 892 | 3300047471 | Ga0495684_0220457 | Ga0495684_0220457_622_1125 | 167 |
| 893 | 3300047471 | Ga0495684_0324079 | Ga0495684_0324079_301_807 | 167 |
| 894 | 3300047471 | Ga0495684_0332537 | Ga0495684_0332537_144_647 | 167 |
| 895 | 3300047472 | Ga0495686_0017077 | Ga0495686_0017077_3857_4363 | 167 |
| 896 | 3300047472 | Ga0495686_0223799 | Ga0495686_0223799_349_855 | 167 |
| 897 | 3300047673 | Ga0495593_0003538 | Ga0495593_0003538_7283_7789 | 167 |
| 898 | 3300047673 | Ga0495593_0003546 | Ga0495593_0003546_4356_4859 | 167 |
| 899 | 3300047673 | Ga0495593_0007526 | Ga0495593_0007526_493_996 | 167 |
| 900 | 3300047673 | Ga0495593_0029887 | Ga0495593_0029887_1629_2132 | 167 |
| 901 | 3300047673 | Ga0495593_0093302 | Ga0495593_0093302_422_925 | 167 |
| 902 | 3300048088 | Ga0495602_0086153 | Ga0495602_0086153_2085_2588 | 167 |
| 903 | 3300048088 | Ga0495602_0094544 | Ga0495602_0094544_1294_1800 | 167 |
| 904 | 3300048088 | Ga0495602_0215159 | Ga0495602_0215159_651_1157 | 167 |
| 905 | 3300048088 | Ga0495602_0237050 | Ga0495602_0237050_719_1222 | 167 |
| 906 | 3300048088 | Ga0495602_0271223 | Ga0495602_0271223_40_546 | 167 |
| 907 | 3300048088 | Ga0495602_0561486 | Ga0495602_0561486_12_515 | 167 |
| 908 | 3300048089 | Ga0495614_0012122 | Ga0495614_0012122_693_1196 | 167 |
| 909 | 3300048091 | Ga0495626_0086193 | Ga0495626_0086193_774_1280 | 167 |
| 910 | 3300048091 | Ga0495626_0260181 | Ga0495626_0260181_148_654 | 167 |
| 911 | 3300048903 | Ga0496100_0007837 | Ga0496100_0007837_5227_5730 | 167 |
| 912 | 3300048904 | Ga0496101_0138194 | Ga0496101_0138194_729_1232 | 167 |
| 913 | 3300048904 | Ga0496101_0266194 | Ga0496101_0266194_20_526 | 167 |
| 914 | 3300048904 | Ga0496101_0401158 | Ga0496101_0401158_304_810 | 167 |
| 915 | 3300048905 | Ga0496102_0041408 | Ga0496102_0041408_1305_1811 | 167 |
| 916 | 3300048905 | Ga0496102_0061565 | Ga0496102_0061565_1196_1702 | 167 |
| 917 | 3300048905 | Ga0496102_0123500 | Ga0496102_0123500_932_1435 | 167 |
| 918 | 3300048905 | Ga0496102_0131901 | Ga0496102_0131901_567_1070 | 167 |
| 919 | 3300048905 | Ga0496102_0362100 | Ga0496102_0362100_296_799 | 167 |
| 920 | 3300048906 | Ga0496103_0097141 | Ga0496103_0097141_617_1123 | 167 |
| 921 | 3300048906 | Ga0496103_0381642 | Ga0496103_0381642_354_857 | 167 |
| 922 | 3300048907 | Ga0496104_0008842 | Ga0496104_0008842_6811_7317 | 167 |
| 923 | 3300048907 | Ga0496104_0219238 | Ga0496104_0219238_229_732 | 167 |
| 924 | 3300048907 | Ga0496104_0926033 | Ga0496104_0926033_88_594 | 167 |
| 925 | 3300048908 | Ga0496105_0502104 | Ga0496105_0502104_253_759 | 167 |
| 926 | 3300048908 | Ga0496105_0585446 | Ga0496105_0585446_119_622 | 167 |
| 927 | 3300048909 | Ga0496106_0041002 | Ga0496106_0041002_2744_3247 | 167 |
| 928 | 3300048909 | Ga0496106_0097958 | Ga0496106_0097958_966_1472 | 167 |
| 929 | 3300048910 | Ga0496107_0138809 | Ga0496107_0138809_1138_1641 | 167 |
| 930 | 3300048910 | Ga0496107_1142889 | Ga0496107_1142889_17_526 | 167 |
| 931 | 3300048911 | Ga0496108_0181363 | Ga0496108_0181363_883_1386 | 167 |
| 932 | 3300048912 | Ga0496109_0076356 | Ga0496109_0076356_567_1070 | 167 |
| 933 | 3300048912 | Ga0496109_0315076 | Ga0496109_0315076_279_785 | 167 |
| 934 | 3300048913 | Ga0496110_0320163 | Ga0496110_0320163_634_1137 | 167 |
| 935 | 3300048913 | Ga0496110_0384154 | Ga0496110_0384154_495_998 | 167 |
| 936 | 3300048913 | Ga0496110_0430367 | Ga0496110_0430367_215_721 | 167 |
| 937 | 3300048913 | Ga0496110_0453250 | Ga0496110_0453250_28_534 | 167 |
| 938 | 3300048914 | Ga0496111_0048697 | Ga0496111_0048697_283_789 | 167 |
| 939 | 3300048914 | Ga0496111_0454743 | Ga0496111_0454743_229_732 | 167 |
| 940 | 3300048915 | Ga0496112_0006027 | Ga0496112_0006027_8573_9079 | 167 |
| 941 | 3300048915 | Ga0496112_0331113 | Ga0496112_0331113_229_732 | 167 |
| 942 | 3300048915 | Ga0496112_0406145 | Ga0496112_0406145_564_1067 | 167 |
| 943 | 3300048915 | Ga0496112_0776215 | Ga0496112_0776215_347_853 | 167 |
| 944 | 3300048916 | Ga0496113_0130337 | Ga0496113_0130337_93_599 | 167 |
| 945 | 3300048916 | Ga0496113_0149706 | Ga0496113_0149706_1269_1772 | 167 |
| 946 | 3300048916 | Ga0496113_0163115 | Ga0496113_0163115_918_1421 | 167 |
| 947 | 3300048917 | Ga0496114_0152579 | Ga0496114_0152579_1363_1866 | 167 |
| 948 | 3300048917 | Ga0496114_0208628 | Ga0496114_0208628_308_814 | 167 |
| 949 | 3300048917 | Ga0496114_0307910 | Ga0496114_0307910_82_588 | 167 |
| 950 | 3300048918 | Ga0496115_0046778 | Ga0496115_0046778_2845_3351 | 167 |
| 951 | 3300048918 | Ga0496115_0121803 | Ga0496115_0121803_156_662 | 167 |
| 952 | 3300048918 | Ga0496115_0215701 | Ga0496115_0215701_617_1120 | 167 |
| 953 | 3300048918 | Ga0496115_0231623 | Ga0496115_0231623_825_1331 | 167 |
| 954 | 3300048918 | Ga0496115_0353296 | Ga0496115_0353296_150_653 | 167 |
| 955 | 3300048919 | Ga0496116_0349539 | Ga0496116_0349539_37_543 | 167 |
| 956 | 3300048920 | Ga0496117_0202176 | Ga0496117_0202176_513_1019 | 167 |
| 957 | 3300048921 | Ga0496118_0059696 | Ga0496118_0059696_2128_2634 | 167 |
| 958 | 3300048921 | Ga0496118_0116918 | Ga0496118_0116918_115_621 | 167 |
| 959 | 3300048921 | Ga0496118_0224777 | Ga0496118_0224777_370_873 | 167 |
| 960 | 3300048923 | Ga0496120_0080935 | Ga0496120_0080935_1106_1609 | 167 |
| 961 | 3300048923 | Ga0496120_0131365 | Ga0496120_0131365_406_912 | 167 |
| 962 | 3300048924 | Ga0496121_0000300 | Ga0496121_0000300_101185_101691 | 167 |
| 963 | 3300048924 | Ga0496121_0026815 | Ga0496121_0026815_3132_3653 | 167 |
| 964 | 3300048924 | Ga0496121_0027734 | Ga0496121_0027734_4204_4710 | 167 |
| 965 | 3300048924 | Ga0496121_0041567 | Ga0496121_0041567_1688_2194 | 167 |
| 966 | 3300048924 | Ga0496121_0074274 | Ga0496121_0074274_2191_2697 | 167 |
| 967 | 3300048924 | Ga0496121_0179884 | Ga0496121_0179884_468_974 | 167 |
| 968 | 3300048924 | Ga0496121_0279163 | Ga0496121_0279163_290_793 | 167 |
| 969 | 3300048924 | Ga0496121_0592625 | Ga0496121_0592625_156_662 | 167 |
| 970 | 3300048924 | Ga0496121_0597692 | Ga0496121_0597692_122_628 | 167 |
| 971 | 3300048925 | Ga0496122_0010659 | Ga0496122_0010659_2685_3188 | 167 |
| 972 | 3300048925 | Ga0496122_0082401 | Ga0496122_0082401_525_1031 | 167 |
| 973 | 3300048925 | Ga0496122_0246162 | Ga0496122_0246162_390_896 | 167 |
| 974 | 3300048926 | Ga0496123_0072978 | Ga0496123_0072978_60_563 | 167 |
| 975 | 3300048926 | Ga0496123_0073217 | Ga0496123_0073217_358_864 | 167 |
| 976 | 3300048926 | Ga0496123_0181476 | Ga0496123_0181476_212_718 | 167 |
| 977 | 3300048927 | Ga0496124_0215824 | Ga0496124_0215824_468_974 | 167 |
| 978 | 3300048927 | Ga0496124_0305892 | Ga0496124_0305892_121_624 | 167 |
| 979 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_139237_139743 | 167 |
| 980 | 3300048928 | Ga0496125_0057601 | Ga0496125_0057601_2241_2747 | 167 |
| 981 | 3300048929 | Ga0496126_0008064 | Ga0496126_0008064_4311_4817 | 167 |
| 982 | 3300048929 | Ga0496126_0008100 | Ga0496126_0008100_5310_5843 | 167 |
| 983 | 3300048929 | Ga0496126_0031081 | Ga0496126_0031081_3513_4019 | 167 |
| 984 | 3300048929 | Ga0496126_0099390 | Ga0496126_0099390_227_733 | 167 |
| 985 | 3300048929 | Ga0496126_0133791 | Ga0496126_0133791_1570_2076 | 167 |
| 986 | 3300048929 | Ga0496126_0139126 | Ga0496126_0139126_407_913 | 167 |
| 987 | 3300048929 | Ga0496126_0174394 | Ga0496126_0174394_1197_1703 | 167 |
| 988 | 3300048929 | Ga0496126_0254741 | Ga0496126_0254741_664_1170 | 167 |
| 989 | 3300049568 | Ga0501031_0502400 | Ga0501031_0502400_57_560 | 167 |
| 990 | 3300049569 | Ga0501032_0001391 | Ga0501032_0001391_4163_4666 | 167 |
| 991 | 3300049570 | Ga0501033_0000304 | Ga0501033_0000304_32636_33139 | 167 |
| 992 | 3300049570 | Ga0501033_0257829 | Ga0501033_0257829_95_598 | 167 |
| 993 | 3300049571 | Ga0501034_0028770 | Ga0501034_0028770_3063_3566 | 167 |
| 994 | 3300049571 | Ga0501034_0061482 | Ga0501034_0061482_2517_3023 | 167 |
| 995 | 3300049572 | Ga0501036_0093458 | Ga0501036_0093458_1866_2369 | 167 |
| 996 | 3300049572 | Ga0501036_0117424 | Ga0501036_0117424_173_676 | 167 |
| 997 | 3300049573 | Ga0501037_0000154 | Ga0501037_0000154_38692_39195 | 167 |
| 998 | 3300049573 | Ga0501037_0202150 | Ga0501037_0202150_630_1133 | 167 |
| 999 | 3300049573 | Ga0501037_0322494 | Ga0501037_0322494_46_549 | 167 |
| 1000 | 3300049574 | Ga0501038_0465060 | Ga0501038_0465060_454_957 | 167 |
| 1001 | 3300049574 | Ga0501038_0951447 | Ga0501038_0951447_116_619 | 167 |
| 1002 | 3300049575 | Ga0501039_0190507 | Ga0501039_0190507_177_680 | 167 |
| 1003 | 3300049577 | Ga0501041_0009638 | Ga0501041_0009638_1948_2451 | 167 |
| 1004 | 3300049577 | Ga0501041_0433754 | Ga0501041_0433754_283_789 | 167 |
| 1005 | 3300049578 | Ga0501042_0027891 | Ga0501042_0027891_2463_2966 | 167 |
| 1006 | 3300049579 | Ga0501043_0000007 | Ga0501043_0000007_43309_43812 | 167 |
| 1007 | 3300049579 | Ga0501043_0337856 | Ga0501043_0337856_612_1115 | 167 |
| 1008 | 3300049581 | Ga0501047_0000740 | Ga0501047_0000740_22512_23015 | 167 |
| 1009 | 3300049581 | Ga0501047_0036680 | Ga0501047_0036680_1673_2176 | 167 |
| 1010 | 3300049581 | Ga0501047_0124460 | Ga0501047_0124460_1588_2091 | 167 |
| 1011 | 3300049581 | Ga0501047_0462930 | Ga0501047_0462930_203_706 | 167 |
| 1012 | 3300049582 | Ga0501048_0048949 | Ga0501048_0048949_2488_2991 | 167 |
| 1013 | 3300049583 | Ga0501067_0027605 | Ga0501067_0027605_501_1007 | 167 |
| 1014 | 3300049583 | Ga0501067_0159701 | Ga0501067_0159701_48_551 | 167 |
| 1015 | 3300049583 | Ga0501067_0197413 | Ga0501067_0197413_24_530 | 167 |
| 1016 | 3300049583 | Ga0501067_0650151 | Ga0501067_0650151_79_582 | 167 |
| 1017 | 3300049584 | Ga0501068_0180196 | Ga0501068_0180196_40_543 | 167 |
| 1018 | 3300049584 | Ga0501068_0342319 | Ga0501068_0342319_182_685 | 167 |
| 1019 | 3300049585 | Ga0501069_0000027 | Ga0501069_0000027_62401_62904 | 167 |
| 1020 | 3300049585 | Ga0501069_0019796 | Ga0501069_0019796_577_1080 | 167 |
| 1021 | 3300049585 | Ga0501069_0061284 | Ga0501069_0061284_752_1255 | 167 |
| 1022 | 3300049585 | Ga0501069_0299895 | Ga0501069_0299895_179_697 | 167 |
| 1023 | 3300049586 | Ga0501070_0000160 | Ga0501070_0000160_7859_8362 | 167 |
| 1024 | 3300049586 | Ga0501070_0000457 | Ga0501070_0000457_9434_9952 | 167 |
| 1025 | 3300049586 | Ga0501070_0039896 | Ga0501070_0039896_185_688 | 167 |
| 1026 | 3300049586 | Ga0501070_0064803 | Ga0501070_0064803_2197_2700 | 167 |
| 1027 | 3300049586 | Ga0501070_0067828 | Ga0501070_0067828_509_1012 | 167 |
| 1028 | 3300049587 | Ga0501071_0006794 | Ga0501071_0006794_3278_3781 | 167 |
| 1029 | 3300049587 | Ga0501071_0462787 | Ga0501071_0462787_417_920 | 167 |
| 1030 | 3300049587 | Ga0501071_0745146 | Ga0501071_0745146_135_638 | 167 |
| 1031 | 3300049588 | Ga0501072_1048843 | Ga0501072_1048843_62_568 | 167 |
| 1032 | 3300049589 | Ga0501073_0017148 | Ga0501073_0017148_4158_4661 | 167 |
| 1033 | 3300049589 | Ga0501073_0027588 | Ga0501073_0027588_2733_3236 | 167 |
| 1034 | 3300049590 | Ga0501074_0000066 | Ga0501074_0000066_12702_13205 | 167 |
| 1035 | 3300049590 | Ga0501074_0025835 | Ga0501074_0025835_1699_2202 | 167 |
| 1036 | 3300049590 | Ga0501074_0037426 | Ga0501074_0037426_2594_3097 | 167 |
| 1037 | 3300049590 | Ga0501074_0781597 | Ga0501074_0781597_81_584 | 167 |
| 1038 | 3300049591 | Ga0501075_0029046 | Ga0501075_0029046_626_1129 | 167 |
| 1039 | 3300049592 | Ga0501076_0011562 | Ga0501076_0011562_2374_2877 | 167 |
| 1040 | 3300049593 | Ga0501077_0022301 | Ga0501077_0022301_2752_3255 | 167 |
| 1041 | 3300049741 | Ga0501079_0387449 | Ga0501079_0387449_554_1060 | 167 |
| 1042 | 3300049742 | Ga0501080_0000667 | Ga0501080_0000667_15317_15820 | 167 |
| 1043 | 3300049742 | Ga0501080_0002747 | Ga0501080_0002747_13037_13540 | 167 |
| 1044 | 3300049742 | Ga0501080_0053345 | Ga0501080_0053345_1515_2018 | 167 |
| 1045 | 3300049743 | Ga0501081_0218907 | Ga0501081_0218907_465_968 | 167 |
| 1046 | 3300049744 | Ga0501083_0000012 | Ga0501083_0000012_134700_135203 | 167 |
| 1047 | 3300049744 | Ga0501083_0053745 | Ga0501083_0053745_1461_1964 | 167 |
| 1048 | 3300049744 | Ga0501083_0284373 | Ga0501083_0284373_29_532 | 167 |
| 1049 | 3300049822 | Ga0501035_0000073 | Ga0501035_0000073_70808_71311 | 167 |
| 1050 | 3300049822 | Ga0501035_0000806 | Ga0501035_0000806_25642_26145 | 167 |
| 1051 | 3300049822 | Ga0501035_0004991 | Ga0501035_0004991_9727_10230 | 167 |
| 1052 | 3300049822 | Ga0501035_0012174 | Ga0501035_0012174_214_717 | 167 |
| 1053 | 3300049823 | Ga0501044_0000118 | Ga0501044_0000118_51379_51882 | 167 |
| 1054 | 3300049823 | Ga0501044_0063285 | Ga0501044_0063285_1976_2479 | 167 |
| 1055 | 3300049823 | Ga0501044_0084403 | Ga0501044_0084403_240_743 | 167 |
| 1056 | 3300049823 | Ga0501044_0101385 | Ga0501044_0101385_1590_2093 | 167 |
| 1057 | 3300049824 | Ga0501045_0008186 | Ga0501045_0008186_2551_3054 | 167 |
| 1058 | 3300050490 | nmdc:mga03n38_1260_c1 | nmdc:mga03n38_1260_c1_727_1233 | 167 |
| 1059 | 3300050491 | nmdc:mga00v17_36886_c1 | nmdc:mga00v17_36886_c1_1355_1861 | 167 |
| 1060 | 3300050492 | nmdc:mga0yw44_42149_c1 | nmdc:mga0yw44_42149_c1_1085_1591 | 167 |
| 1061 | 3300050493 | nmdc:mga0k408_92180_c1 | nmdc:mga0k408_92180_c1_97_600 | 167 |
| 1062 | 3300050494 | nmdc:mga06z11_105767_c1 | nmdc:mga06z11_105767_c1_46_618 | 167 |
| 1063 | 3300050494 | nmdc:mga06z11_185807_c1 | nmdc:mga06z11_185807_c1_521_1027 | 167 |
| 1064 | 3300050494 | nmdc:mga06z11_2201_c1 | nmdc:mga06z11_2201_c1_1719_2222 | 167 |
| 1065 | 3300050495 | nmdc:mga04h51_90062_c1 | nmdc:mga04h51_90062_c1_534_1040 | 167 |
| 1066 | 3300050496 | nmdc:mga07m45_135581_c1 | nmdc:mga07m45_135581_c1_531_1037 | 167 |
| 1067 | 3300050496 | nmdc:mga07m45_14332_c1 | nmdc:mga07m45_14332_c1_2975_3481 | 167 |
| 1068 | 3300050511 | nmdc:mga08y16_263276_c1 | nmdc:mga08y16_263276_c1_106_609 | 167 |
| 1069 | 3300050511 | nmdc:mga08y16_514553_c1 | nmdc:mga08y16_514553_c1_40_543 | 167 |
| 1070 | 3300050511 | nmdc:mga08y16_792478_c1 | nmdc:mga08y16_792478_c1_218_727 | 167 |
| 1071 | 3300050512 | nmdc:mga0n895_54520_c1 | nmdc:mga0n895_54520_c1_1705_2211 | 167 |
| 1072 | 3300050512 | nmdc:mga0n895_574276_c1 | nmdc:mga0n895_574276_c1_228_734 | 167 |
| 1073 | 3300050513 | nmdc:mga0rr50_30428_c1 | nmdc:mga0rr50_30428_c1_1573_2076 | 167 |
| 1074 | 3300050513 | nmdc:mga0rr50_400664_c1 | nmdc:mga0rr50_400664_c1_518_1021 | 167 |
| 1075 | 3300050513 | nmdc:mga0rr50_84036_c1 | nmdc:mga0rr50_84036_c1_1917_2423 | 167 |
| 1076 | 3300050514 | nmdc:mga08x19_385_c1 | nmdc:mga08x19_385_c1_29649_30155 | 167 |
| 1077 | 3300050514 | nmdc:mga08x19_567685_c1 | nmdc:mga08x19_567685_c1_70_573 | 167 |
| 1078 | 3300050514 | nmdc:mga08x19_78001_c1 | nmdc:mga08x19_78001_c1_195_698 | 167 |
| 1079 | 3300050515 | nmdc:mga0a205_59017_c1 | nmdc:mga0a205_59017_c1_291_794 | 167 |
| 1080 | 3300050516 | nmdc:mga0sz30_276759_c1 | nmdc:mga0sz30_276759_c1_183_689 | 167 |
| 1081 | 3300053077 | Ga0495601_0006582 | Ga0495601_0006582_2060_2563 | 167 |
| 1082 | 3300053077 | Ga0495601_0052397 | Ga0495601_0052397_887_1390 | 167 |
| 1083 | 3300053077 | Ga0495601_0243152 | Ga0495601_0243152_85_588 | 167 |
| 1084 | 3300053077 | Ga0495601_0622022 | Ga0495601_0622022_128_631 | 167 |
| 1085 | 3300053077 | Ga0495601_0729729 | Ga0495601_0729729_48_554 | 167 |
| 1086 | 3300053078 | Ga0495612_0008895 | Ga0495612_0008895_1000_1503 | 167 |
| 1087 | 3300053078 | Ga0495612_0021744 | Ga0495612_0021744_1740_2243 | 167 |
| 1088 | 3300053084 | Ga0495595_0015072 | Ga0495595_0015072_2754_3257 | 167 |
| 1089 | 3300053084 | Ga0495595_0022370 | Ga0495595_0022370_1269_1775 | 167 |
| 1090 | 3300053084 | Ga0495595_0118598 | Ga0495595_0118598_625_1131 | 167 |
| 1091 | 3300053085 | Ga0495619_0001498 | Ga0495619_0001498_11523_12026 | 167 |
| 1092 | 3300053085 | Ga0495619_0003381 | Ga0495619_0003381_35_538 | 167 |
| 1093 | 3300053085 | Ga0495619_0015555 | Ga0495619_0015555_3040_3546 | 167 |
| 1094 | 3300053085 | Ga0495619_0057783 | Ga0495619_0057783_1669_2172 | 167 |
| 1095 | 3300053086 | Ga0500578_0099973 | Ga0500578_0099973_973_1479 | 167 |
| 1096 | 3300053087 | Ga0500643_020438 | Ga0500643_020438_489_995 | 167 |
| 1097 | 3300053088 | Ga0500644_0129367 | Ga0500644_0129367_80_586 | 167 |
| 1098 | 3300053089 | Ga0500581_350604 | Ga0500581_350604_40_546 | 167 |
| 1099 | 3300053090 | Ga0500646_0012929 | Ga0500646_0012929_1377_1883 | 167 |
| 1100 | 3300053092 | Ga0500583_0128116 | Ga0500583_0128116_70_576 | 167 |
| 1101 | 3300053093 | Ga0500651_0131840 | Ga0500651_0131840_649_1155 | 167 |
| 1102 | 3300053096 | Ga0500641_0014666 | Ga0500641_0014666_1409_1915 | 167 |
| 1103 | 3300053096 | Ga0500641_0040818 | Ga0500641_0040818_294_800 | 167 |
| 1104 | 3300053098 | Ga0500650_0003179 | Ga0500650_0003179_2646_3152 | 167 |
| 1105 | 3300053103 | Ga0500555_010336 | Ga0500555_010336_1509_2015 | 167 |
| 1106 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_98162_98668 | 167 |
| 1107 | 3300053108 | Ga0500562_021012 | Ga0500562_021012_395_901 | 167 |
| 1108 | 3300053109 | Ga0500569_002523 | Ga0500569_002523_2743_3249 | 167 |
| 1109 | 3300053109 | Ga0500569_113399 | Ga0500569_113399_304_810 | 167 |
| 1110 | 3300053116 | Ga0500592_002541 | Ga0500592_002541_1971_2477 | 167 |
| 1111 | 3300053118 | Ga0500594_0007830 | Ga0500594_0007830_1264_1770 | 167 |
| 1112 | 3300053125 | Ga0500618_030349 | Ga0500618_030349_493_999 | 167 |
| 1113 | 3300053130 | Ga0500642_0069549 | Ga0500642_0069549_211_717 | 167 |
| 1114 | 3300053131 | Ga0500652_000308 | Ga0500652_000308_2460_2966 | 167 |
| 1115 | 3300053133 | Ga0500655_032263 | Ga0500655_032263_289_795 | 167 |
| 1116 | 3300053134 | Ga0500658_0043021 | Ga0500658_0043021_49_555 | 167 |
| 1117 | 3300053134 | Ga0500658_0162204 | Ga0500658_0162204_415_921 | 167 |
| 1118 | 3300053136 | Ga0500559_0027141 | Ga0500559_0027141_1180_1686 | 167 |
| 1119 | 3300053137 | Ga0500561_0098936 | Ga0500561_0098936_302_808 | 167 |
| 1120 | 3300053139 | Ga0500568_0001108 | Ga0500568_0001108_11866_12372 | 167 |
| 1121 | 3300053139 | Ga0500568_0002973 | Ga0500568_0002973_2628_3134 | 167 |
| 1122 | 3300053146 | Ga0500588_0026501 | Ga0500588_0026501_657_1163 | 167 |
| 1123 | 3300053147 | Ga0500589_144075 | Ga0500589_144075_193_699 | 167 |
| 1124 | 3300053150 | Ga0500603_264010 | Ga0500603_264010_29_535 | 167 |
| 1125 | 3300053151 | Ga0500604_0001327 | Ga0500604_0001327_1409_1915 | 167 |
| 1126 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_132881_133387 | 167 |
| 1127 | 3300053156 | Ga0500622_0002439 | Ga0500622_0002439_1510_2016 | 167 |
| 1128 | 3300053158 | Ga0500627_0027269 | Ga0500627_0027269_839_1345 | 167 |
| 1129 | 3300053160 | Ga0500633_0164550 | Ga0500633_0164550_112_618 | 167 |
| 1130 | 3300053177 | Ga0500636_0006978 | Ga0500636_0006978_351_857 | 167 |
| 1131 | 3300053178 | Ga0500637_0324071 | Ga0500637_0324071_35_541 | 167 |
| 1132 | 3300053724 | Ga0500570_068096 | Ga0500570_068096_1076_1582 | 167 |
| 1133 | 3300053727 | Ga0500611_020368 | Ga0500611_020368_644_1150 | 167 |
| 1134 | 3300053730 | Ga0500645_049728 | Ga0500645_049728_96_602 | 167 |
| 1135 | 3300053730 | Ga0500645_141472 | Ga0500645_141472_121_627 | 167 |
| 1136 | 3300053730 | Ga0500645_172834 | Ga0500645_172834_40_546 | 167 |
| 1137 | 3300053732 | Ga0500656_064851 | Ga0500656_064851_33_539 | 167 |
| 1138 | 3300054114 | Ga0501084_0256827 | Ga0501084_0256827_741_1244 | 167 |
| 1139 | 3300054114 | Ga0501084_0305024 | Ga0501084_0305024_476_982 | 167 |
| 1140 | 3300059424 | Ga0590075_102911 | Ga0590075_102911_194_697 | 167 |
| 1141 | 3300059492 | Ga0587073_0070410 | Ga0587073_0070410_182_685 | 167 |
| 1142 | 3300059492 | Ga0587073_0089077 | Ga0587073_0089077_166_669 | 167 |
| 1143 | 3300059492 | Ga0587073_0147584 | Ga0587073_0147584_64_570 | 167 |
| 1144 | 3300059492 | Ga0587073_0183640 | Ga0587073_0183640_46_552 | 167 |
| 1145 | 3300059493 | Ga0587077_090800 | Ga0587077_090800_170_676 | 167 |
| 1146 | 3300059503 | Ga0587080_064058 | Ga0587080_064058_56_559 | 167 |
| 1147 | 3300059504 | Ga0587082_073584 | Ga0587082_073584_75_578 | 167 |
| 1148 | 3300059504 | Ga0587082_084638 | Ga0587082_084638_60_563 | 167 |
| 1149 | 3300059508 | Ga0587088_137651 | Ga0587088_137651_10_513 | 167 |
| 1150 | 3300059608 | Ga0587129_011806 | Ga0587129_011806_127_630 | 167 |
| 1151 | 3300059643 | Ga0587072_094761 | Ga0587072_094761_47_550 | 167 |
| 1152 | 3300060353 | Ga0501082_0043509 | Ga0501082_0043509_2146_2649 | 167 |
| 1153 | 3300060353 | Ga0501082_0169930 | Ga0501082_0169930_707_1210 | 167 |
| 1154 | 3300060353 | Ga0501082_1428585 | Ga0501082_1428585_44_547 | 167 |
| 1155 | 3300061734 | Ga0530510_0080336 | Ga0530510_0080336_355_858 | 167 |
| 1156 | iso_pu_bacteria | 8001845381 | 8001848798 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gyq-assembly1.cif.gz_B | ycfi, a putative structural protein from rhodopseudomonas palustris. | 0.9781 | 4 | 155 |
| 7tmv-assembly1.cif.gz_B | crystal structure of a putative structural protein from klebsiella pneumoniae | 0.9666 | 7 | 158 |
| 4eru-assembly1.cif.gz_B | crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica | 0.9657 | 6 | 158 |
| 2gs4-assembly1.cif.gz_A | the crystal structure of the e.coli stress protein ycif. | 0.9549 | 8 | 163 |
| 7tmv-assembly1.cif.gz_B | crystal structure of a putative structural protein from klebsiella pneumoniae | 0.9424 | 7 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gyqB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9782 | 4 | 155 | 1.20.1260.10 |
| 4eruA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9573 | 6 | 158 | 1.20.1260.10 |
| 2gyqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9507 | 1 | 161 | 1.20.1260.10 |
| 2gyqB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9414 | 4 | 155 | 1.20.1260.10 |
| 2gyqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9393 | 1 | 161 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J6IXS8-F1-model_v4 | Uncharacterized protein | 0.9963 | 12 | 166 |
|
| AF-A0A531KI21-F1-model_v4 | Ferritin-like domain-containing protein | 0.9963 | 34 | 166 |
|
| AF-A0A2V8EWJ5-F1-model_v4 | Ferritin-like domain-containing protein | 0.9961 | 6 | 166 |
|
| AF-A0A8B2P258-F1-model_v4 | Ferritin-like metal-binding protein YciE | 0.9955 | 8 | 166 |
|
| AF-A0A1I7NHL4-F1-model_v4 | Ferritin-like metal-binding protein YciE | 0.9952 | 8 | 166 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar