F490944

General Info

Members Datasets Scaffolds Average Seq Length
1156 524 1140 167

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0314542|Ga0395905_0314542_288_896
Length 202
Sequence MQIVLVAQYTENDAVFFIVFPHEEARCWATRRIAMGLFTRDIKTMDDLFVHQLQDIYYAEKQLVKALPKMAEKANDNQLKQGFLGHLEQTKGHVTRLEQVFQMHGVTPKAVTCPAIDGIIEEADEVAGEVADKQVLDAALINAAQAAEHYEITRYGTLVTWAKRLGRNDCAAVLQKTLDEEKATDKKLTQLAESGINLKAAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
5 2643221651 Afipia sp. Root123D2 Isolate Unclassified
6 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
7 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
8 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
9 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
12 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
13 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
14 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
134 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
157 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
161 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
162 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
165 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
166 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
174 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300023684 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
251 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
264 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
265 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
266 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
267 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
268 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
269 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
272 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
273 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
274 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
275 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
278 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
283 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
284 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
285 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
286 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
287 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
288 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
289 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
290 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
291 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
308 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
309 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
310 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
316 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
323 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
326 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
327 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
328 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
329 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
330 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
331 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
334 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
339 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
344 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
348 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
355 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
356 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
357 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
364 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
367 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
368 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
369 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
370 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
371 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
372 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
373 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
374 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
375 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
376 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
377 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
378 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
379 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
382 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
383 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
393 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
399 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
441 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
442 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
443 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
444 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
445 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
446 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
447 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
448 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
466 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
467 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
472 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
475 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
476 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
477 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
478 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
479 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
482 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
483 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
484 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
485 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
486 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
487 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
488 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
489 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
490 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
495 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
496 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
497 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
498 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
499 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
500 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
505 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
506 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
507 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
508 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
509 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
510 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
511 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
512 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
513 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
521 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
522 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
523 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
524 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.18
Metatranscriptomes 7.44
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.09
Nodule 0.43
Rhizoplane 5.28
Rhizosphere 81.75
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3951670 2162886007 Bacteria 800
2 JGI24746J21847_1021252 3300001977 Bacteria 907
3 JGI24747J21853_1042903 3300001978 Bacteria 539
4 JGI24740J21852_10024470 3300001979 Bacteria 2048
5 JGI24739J22299_10007360 3300001989 Bacteria 4133
6 JGI24737J22298_10008541 3300001990 Bacteria 3425
7 JGI24737J22298_10126944 3300001990 Bacteria 753
8 JGI24743J22301_10050615 3300001991 Bacteria 846
9 JGI24735J21928_10013907 3300002067 Bacteria 2524
10 JGI24750J21931_1036810 3300002070 Bacteria 734
11 JGI24749J21850_1023924 3300002076 Bacteria 868
12 JGI24744J21845_10067843 3300002077 Bacteria 651
13 JGI24033J26618_1025586 3300002155 Bacteria 775
14 JGI24034J26672_10035091 3300002239 Bacteria 828
15 JGI24742J22300_10042532 3300002244 Bacteria 812
16 JGI24742J22300_10059722 3300002244 Bacteria 699
17 JGI24751J29686_10018533 3300002459 Bacteria 1440
18 JGI25406J46586_10002904 3300003203 Bacteria 8083
19 Ga0006777J48905_1012696 3300003308 Bacteria 553
20 Ga0006777J48905_1040219 3300003308 Bacteria 567
21 Ga0006777J48905_1058774 3300003308 Bacteria 953
22 Ga0006781J51513_1035190 3300003568 Bacteria 587
23 Ga0007410J51695_1043051 3300003574 Bacteria 586
24 Ga0007409J51694_1088714 3300003575 Bacteria 562
25 Ga0007429J51699_1021511 3300003579 Bacteria 651
26 Ga0007429J51699_1059805 3300003579 Bacteria 589
27 JGI25404J52841_10022797 3300003659 Bacteria 1352
28 JGI25404J52841_10033517 3300003659 Bacteria 1094
29 Ga0032354_1012960 3300003693 Bacteria 654
30 Ga0032354_1047272 3300003693 Bacteria 546
31 Ga0032354_1052366 3300003693 Bacteria 825
32 Ga0006780_1021799 3300003735 Bacteria 605
33 Ga0058863_11574013 3300004799 Bacteria 670
34 Ga0058860_12115543 3300004801 Bacteria 611
35 Ga0058860_12149836 3300004801 Bacteria 713
36 Ga0065715_10500263 3300005293 Bacteria 780
37 Ga0065707_10331906 3300005295 Bacteria 948
38 Ga0070658_10122009 3300005327 Bacteria 2166
39 Ga0070658_10719580 3300005327 Bacteria 867
40 Ga0070676_10214685 3300005328 Bacteria 1268
41 Ga0070683_100116918 3300005329 Bacteria 2518
42 Ga0070683_100186787 3300005329 Bacteria 1967
43 Ga0070690_100312075 3300005330 Bacteria 1131
44 Ga0070670_100036037 3300005331 Bacteria 4258
45 Ga0070670_100131914 3300005331 Bacteria 2158
46 Ga0070670_101179141 3300005331 Bacteria 700
47 Ga0068869_100143438 3300005334 Bacteria 1846
48 Ga0068869_100177601 3300005334 Bacteria 1668
49 Ga0068869_100313946 3300005334 Bacteria 1269
50 Ga0070666_10091734 3300005335 Bacteria 2087
51 Ga0070666_10316492 3300005335 Bacteria 1113
52 Ga0070680_100013974 3300005336 Bacteria 6267
53 Ga0070682_100068797 3300005337 Bacteria 2259
54 Ga0070682_100095633 3300005337 Bacteria 1951
55 Ga0070682_100479432 3300005337 Bacteria 959
56 Ga0068868_100147810 3300005338 Bacteria 1933
57 Ga0068868_100725833 3300005338 Bacteria 891
58 Ga0068868_100968955 3300005338 Bacteria 776
59 Ga0070660_100235492 3300005339 Bacteria 1490
60 Ga0070660_100278994 3300005339 Bacteria 1367
61 Ga0070660_100834516 3300005339 Bacteria 776
62 Ga0070660_100857848 3300005339 Bacteria 765
63 Ga0070689_100032271 3300005340 Bacteria 3982
64 Ga0070691_10075852 3300005341 Bacteria 1638
65 Ga0070687_100237656 3300005343 Bacteria 1125
66 Ga0070661_100024323 3300005344 Bacteria 4344
67 Ga0070661_100214230 3300005344 Bacteria 1475
68 Ga0070661_100598004 3300005344 Bacteria 891
69 Ga0070692_10548936 3300005345 Bacteria 757
70 Ga0070668_100217633 3300005347 Bacteria 1574
71 Ga0070668_100248629 3300005347 Bacteria 1475
72 Ga0070668_100275195 3300005347 Bacteria 1404
73 Ga0070669_100129738 3300005353 Bacteria 1932
74 Ga0070669_100335643 3300005353 Bacteria 1224
75 Ga0070671_100063284 3300005355 Bacteria 3080
76 Ga0070671_100172520 3300005355 Bacteria 1829
77 Ga0070671_101044787 3300005355 Bacteria 717
78 Ga0070674_100068947 3300005356 Bacteria 2493
79 Ga0070674_100654750 3300005356 Bacteria 893
80 Ga0070673_100169492 3300005364 Bacteria 1862
81 Ga0070673_100474346 3300005364 Bacteria 1128
82 Ga0070673_100737795 3300005364 Bacteria 906
83 Ga0070688_100130134 3300005365 Bacteria 1697
84 Ga0070688_100199709 3300005365 Bacteria 1398
85 Ga0070659_100044581 3300005366 Bacteria 3473
86 Ga0070659_100123679 3300005366 Bacteria 2097
87 Ga0070659_100224555 3300005366 Bacteria 1551
88 Ga0070659_100299217 3300005366 Bacteria 1341
89 Ga0070659_100666840 3300005366 Bacteria 898
90 Ga0070659_101470739 3300005366 Bacteria 607
91 Ga0070667_100042228 3300005367 Bacteria 3826
92 Ga0070667_100291770 3300005367 Bacteria 1467
93 Ga0070667_100461147 3300005367 Bacteria 1162
94 Ga0070703_10168139 3300005406 Bacteria 838
95 Ga0070703_10207770 3300005406 Bacteria 772
96 Ga0070709_10001015 3300005434 Bacteria 15518
97 Ga0070714_100008787 3300005435 Bacteria 7901
98 Ga0070714_100160074 3300005435 Bacteria 2036
99 Ga0070714_101523020 3300005435 Bacteria 653
100 Ga0070713_100002311 3300005436 Bacteria 12409
101 Ga0070713_100102531 3300005436 Bacteria 2482
102 Ga0070713_100504541 3300005436 Bacteria 1142
103 Ga0070710_10013948 3300005437 Bacteria 4035
104 Ga0070710_10446128 3300005437 Bacteria 876
105 Ga0070710_10557628 3300005437 Bacteria 792
106 Ga0070701_10170254 3300005438 Bacteria 1268
107 Ga0070701_10182050 3300005438 Bacteria 1231
108 Ga0070711_100147022 3300005439 Bacteria 1773
109 Ga0070711_100184808 3300005439 Bacteria 1598
110 Ga0070705_100354370 3300005440 Bacteria 1071
111 Ga0070705_100414755 3300005440 Bacteria 1001
112 Ga0070700_100014021 3300005441 Bacteria 4518
113 Ga0070700_100258660 3300005441 Bacteria 1252
114 Ga0070700_100959397 3300005441 Bacteria 700
115 Ga0070694_100085125 3300005444 Bacteria 2207
116 Ga0070694_100153679 3300005444 Bacteria 1683
117 Ga0070694_100299584 3300005444 Bacteria 1231
118 Ga0070694_100502318 3300005444 Bacteria 965
119 Ga0070663_100008060 3300005455 Bacteria 6460
120 Ga0070663_100086075 3300005455 Bacteria 2320
121 Ga0070663_100113623 3300005455 Bacteria 2038
122 Ga0070663_100159559 3300005455 Bacteria 1735
123 Ga0070663_100182877 3300005455 Bacteria 1627
124 Ga0070663_100420146 3300005455 Bacteria 1096
125 Ga0070663_100773989 3300005455 Bacteria 821
126 Ga0070663_100809046 3300005455 Bacteria 804
127 Ga0070678_100135175 3300005456 Bacteria 1965
128 Ga0070678_100418545 3300005456 Bacteria 1167
129 Ga0070678_100855993 3300005456 Bacteria 829
130 Ga0070662_100054508 3300005457 Bacteria 2897
131 Ga0070662_100057011 3300005457 Bacteria 2837
132 Ga0070662_100084041 3300005457 Bacteria 2377
133 Ga0070662_100230727 3300005457 Bacteria 1481
134 Ga0070662_101063909 3300005457 Bacteria 694
135 Ga0070681_10013083 3300005458 Bacteria 8240
136 Ga0070681_10070681 3300005458 Bacteria 3455
137 Ga0070685_10251199 3300005466 Bacteria 1172
138 Ga0070698_100053016 3300005471 Bacteria 4124
139 Ga0070679_100126829 3300005530 Bacteria 2534
140 Ga0070679_100267934 3300005530 Bacteria 1662
141 Ga0070679_100652430 3300005530 Bacteria 995
142 Ga0070679_100754742 3300005530 Bacteria 916
143 Ga0070684_100092938 3300005535 Bacteria 2685
144 Ga0070684_100626745 3300005535 Bacteria 1000
145 Ga0070697_100064835 3300005536 Bacteria 2984
146 Ga0068853_100004957 3300005539 Bacteria 10372
147 Ga0068853_100039011 3300005539 Bacteria 4049
148 Ga0068853_100130476 3300005539 Bacteria 2249
149 Ga0068853_100663727 3300005539 Bacteria 993
150 Ga0068853_100767883 3300005539 Bacteria 922
151 Ga0070672_100586816 3300005543 Bacteria 970
152 Ga0070686_100050014 3300005544 Bacteria 2654
153 Ga0070686_100404916 3300005544 Bacteria 1039
154 Ga0070686_100665765 3300005544 Bacteria 827
155 Ga0070695_100042844 3300005545 Bacteria 2875
156 Ga0070695_100315310 3300005545 Bacteria 1160
157 Ga0070696_100000971 3300005546 Bacteria 18578
158 Ga0070696_100044480 3300005546 Bacteria 3075
159 Ga0070696_100246081 3300005546 Bacteria 1350
160 Ga0070693_100017592 3300005547 Bacteria 3719
161 Ga0070693_100987912 3300005547 Bacteria 636
162 Ga0070693_100988161 3300005547 Bacteria 636
163 Ga0070665_100003902 3300005548 Bacteria 15759
164 Ga0070665_100053521 3300005548 Bacteria 4048
165 Ga0070665_100113980 3300005548 Bacteria 2706
166 Ga0070665_100546810 3300005548 Bacteria 1170
167 Ga0070665_100550745 3300005548 Bacteria 1166
168 Ga0070665_100891149 3300005548 Bacteria 902
169 Ga0070704_100181227 3300005549 Bacteria 1685
170 Ga0070704_100238813 3300005549 Bacteria 1486
171 Ga0068855_100075381 3300005563 Bacteria 3917
172 Ga0068855_100110751 3300005563 Bacteria 3151
173 Ga0068855_100227171 3300005563 Bacteria 2091
174 Ga0068855_100272230 3300005563 Bacteria 1883
175 Ga0068855_100337368 3300005563 Bacteria 1663
176 Ga0070664_100351050 3300005564 Bacteria 1342
177 Ga0070664_100481716 3300005564 Bacteria 1142
178 Ga0068857_100020850 3300005577 Bacteria 5765
179 Ga0068857_100334791 3300005577 Bacteria 1399
180 Ga0068854_100006791 3300005578 Bacteria 7294
181 Ga0068854_100006800 3300005578 Bacteria 7290
182 Ga0068854_101698589 3300005578 Bacteria 577
183 Ga0068854_101707607 3300005578 Bacteria 576
184 Ga0068856_100000363 3300005614 Bacteria 49777
185 Ga0068856_100028283 3300005614 Bacteria 5473
186 Ga0068856_100154754 3300005614 Bacteria 2302
187 Ga0068856_100411333 3300005614 Bacteria 1372
188 Ga0070702_100003979 3300005615 Bacteria 6703
189 Ga0070702_100104963 3300005615 Bacteria 1740
190 Ga0068852_100005807 3300005616 Bacteria 8861
191 Ga0068852_100391373 3300005616 Bacteria 1365
192 Ga0068859_100117890 3300005617 Bacteria 2720
193 Ga0068859_100224959 3300005617 Bacteria 1964
194 Ga0068864_100064661 3300005618 Bacteria 3173
195 Ga0068864_100109309 3300005618 Bacteria 2461
196 Ga0068864_101347514 3300005618 Bacteria 715
197 Ga0068866_10418506 3300005718 Bacteria 869
198 Ga0068861_100028388 3300005719 Bacteria 4082
199 Ga0068861_100101152 3300005719 Bacteria 2292
200 Ga0068861_100152343 3300005719 Bacteria 1898
201 Ga0068851_10009198 3300005834 Bacteria 4587
202 Ga0068851_10034585 3300005834 Bacteria 2523
203 Ga0068851_10147229 3300005834 Bacteria 1285
204 Ga0068870_10049659 3300005840 Bacteria 2214
205 Ga0068863_100020353 3300005841 Bacteria 6344
206 Ga0068858_100249886 3300005842 Bacteria 1684
207 Ga0068858_100482037 3300005842 Bacteria 1197
208 Ga0068858_101021531 3300005842 Bacteria 810
209 Ga0068860_100061571 3300005843 Bacteria 3565
210 Ga0068860_100067286 3300005843 Bacteria 3404
211 Ga0068860_101207093 3300005843 Bacteria 777
212 Ga0068862_100131627 3300005844 Bacteria 2213
213 Ga0068862_100889847 3300005844 Bacteria 875
214 Ga0081455_10000633 3300005937 Bacteria 45582
215 Ga0081455_10045282 3300005937 Bacteria 3829
216 Ga0081540_1001350 3300005983 Bacteria 21352
217 Ga0081540_1005948 3300005983 Bacteria 9003
218 Ga0081540_1013070 3300005983 Bacteria 5422
219 Ga0081540_1023275 3300005983 Bacteria 3629
220 Ga0081539_10000864 3300005985 Bacteria 58047
221 Ga0081539_10064473 3300005985 Bacteria 1993
222 Ga0070717_10008605 3300006028 Bacteria 7627
223 Ga0070717_10207693 3300006028 Bacteria 1718
224 Ga0070717_10349425 3300006028 Bacteria 1322
225 Ga0075365_10007938 3300006038 Bacteria 5983
226 Ga0075365_10142814 3300006038 Bacteria 1662
227 Ga0075365_10262762 3300006038 Bacteria 1214
228 Ga0075365_10600407 3300006038 Bacteria 778
229 Ga0075368_10022861 3300006042 Bacteria 2383
230 Ga0075363_100001181 3300006048 Bacteria 9618
231 Ga0075364_10025549 3300006051 Bacteria 3760
232 Ga0075364_10136743 3300006051 Bacteria 1647
233 Ga0075364_10194511 3300006051 Bacteria 1374
234 Ga0070716_100019318 3300006173 Bacteria 3560
235 Ga0070712_100006584 3300006175 Bacteria 7215
236 Ga0075362_10020047 3300006177 Bacteria 2790
237 Ga0075362_10227062 3300006177 Bacteria 914
238 Ga0075362_10246177 3300006177 Bacteria 879
239 Ga0075367_10001700 3300006178 Bacteria 9620
240 Ga0075367_10017229 3300006178 Bacteria 3962
241 Ga0075367_10065669 3300006178 Bacteria 2173
242 Ga0075367_10249851 3300006178 Bacteria 1112
243 Ga0075369_10091556 3300006186 Bacteria 1357
244 Ga0075369_10245394 3300006186 Bacteria 831
245 Ga0075366_10845597 3300006195 Bacteria 569
246 Ga0097621_100026518 3300006237 Bacteria 4546
247 Ga0097621_100074213 3300006237 Bacteria 2817
248 Ga0097621_100316295 3300006237 Bacteria 1382
249 Ga0075370_10020128 3300006353 Bacteria 3643
250 Ga0075370_10028239 3300006353 Bacteria 3118
251 Ga0068871_100035821 3300006358 Bacteria 3946
252 Ga0068871_100104255 3300006358 Bacteria 2379
253 Ga0075428_100070086 3300006844 Bacteria 3833
254 Ga0075430_100109997 3300006846 Bacteria 2298
255 Ga0075430_100917106 3300006846 Bacteria 722
256 Ga0075431_100465897 3300006847 Bacteria 1258
257 Ga0075433_10809127 3300006852 Bacteria 819
258 Ga0075433_10833840 3300006852 Bacteria 805
259 Ga0075434_100044641 3300006871 Bacteria 4396
260 Ga0075434_100125713 3300006871 Bacteria 2581
261 Ga0075434_100510301 3300006871 Bacteria 1223
262 Ga0068865_100001775 3300006881 Bacteria 12654
263 Ga0075436_100005858 3300006914 Bacteria 8445
264 Ga0075436_100692290 3300006914 Unclassified 755
265 Ga0075436_101191223 3300006914 Bacteria 575
266 Ga0097620_100117884 3300006931 Bacteria 2720
267 Ga0097620_100224948 3300006931 Bacteria 1964
268 Ga0075435_100073638 3300007076 Bacteria 2793
269 Ga0075435_100111808 3300007076 Bacteria 2272
270 Ga0075435_100468897 3300007076 Bacteria 1087
271 Ga0099794_10381339 3300007265 Bacteria 735
272 Ga0099795_10021043 3300007788 Bacteria 2134
273 Ga0099795_10030236 3300007788 Bacteria 1857
274 Ga0099795_10048728 3300007788 Bacteria 1535
275 Ga0105251_10097573 3300009011 Bacteria 1345
276 Ga0105251_10313106 3300009011 Bacteria 713
277 Ga0105244_10088248 3300009036 Bacteria 1528
278 Ga0105250_10030865 3300009092 Bacteria 2154
279 Ga0105250_10046623 3300009092 Bacteria 1738
280 Ga0105240_10016715 3300009093 Bacteria 9924
281 Ga0105240_10030730 3300009093 Bacteria 6976
282 Ga0105240_10196998 3300009093 Bacteria 2364
283 Ga0105240_12090505 3300009093 Bacteria 588
284 Ga0111539_10315761 3300009094 Bacteria 1818
285 Ga0111539_10663958 3300009094 Bacteria 1214
286 Ga0105245_10312564 3300009098 Bacteria 1545
287 Ga0105245_10359871 3300009098 Bacteria 1444
288 Ga0105245_10530627 3300009098 Bacteria 1197
289 Ga0105245_10791723 3300009098 Bacteria 986
290 Ga0105245_10968353 3300009098 Bacteria 894
291 Ga0105247_10095694 3300009101 Bacteria 1891
292 Ga0114129_10037544 3300009147 Bacteria 6839
293 Ga0114129_10784305 3300009147 Bacteria 1217
294 Ga0105243_10076785 3300009148 Bacteria 2715
295 Ga0105243_10319515 3300009148 Bacteria 1414
296 Ga0105243_10501399 3300009148 Bacteria 1150
297 Ga0105241_10066421 3300009174 Bacteria 2789
298 Ga0105241_10070808 3300009174 Bacteria 2706
299 Ga0105241_10406303 3300009174 Bacteria 1196
300 Ga0105241_10493630 3300009174 Bacteria 1090
301 Ga0105242_10022368 3300009176 Bacteria 4970
302 Ga0105242_10322965 3300009176 Bacteria 1416
303 Ga0105248_10061998 3300009177 Bacteria 4199
304 Ga0105248_10272244 3300009177 Bacteria 1907
305 Ga0105237_10040252 3300009545 Bacteria 4714
306 Ga0105237_10176281 3300009545 Bacteria 2138
307 Ga0105237_10317584 3300009545 Bacteria 1561
308 Ga0105237_10396831 3300009545 Bacteria 1384
309 Ga0105238_10012175 3300009551 Bacteria 8671
310 Ga0105238_10035982 3300009551 Bacteria 5033
311 Ga0105238_10049838 3300009551 Bacteria 4216
312 Ga0105238_10102283 3300009551 Bacteria 2847
313 Ga0105238_10264456 3300009551 Bacteria 1700
314 Ga0105238_10347316 3300009551 Bacteria 1472
315 Ga0105249_10074945 3300009553 Bacteria 3133
316 Ga0105249_10092015 3300009553 Bacteria 2839
317 Ga0105249_10133651 3300009553 Bacteria 2371
318 Ga0099796_10061656 3300010159 Bacteria 1331
319 Ga0105239_10091468 3300010375 Bacteria 3357
320 Ga0105239_10152572 3300010375 Bacteria 2578
321 Ga0105239_10153070 3300010375 Bacteria 2574
322 Ga0105239_10428627 3300010375 Bacteria 1499
323 Ga0105239_10560225 3300010375 Bacteria 1302
324 Ga0105239_10644628 3300010375 Bacteria 1210
325 Ga0105239_11920494 3300010375 Bacteria 687
326 Ga0105246_10095430 3300011119 Bacteria 2153
327 Ga0105246_10547708 3300011119 Bacteria 991
328 Ga0105246_10581741 3300011119 Bacteria 964
329 Ga0157344_1004409 3300012476 Bacteria 837
330 Ga0157326_1003126 3300012513 Bacteria 1751
331 Ga0157373_10585099 3300013100 Bacteria 812
332 Ga0157373_10730117 3300013100 Bacteria 727
333 Ga0157370_10158045 3300013104 Bacteria 2109
334 Ga0157370_10538178 3300013104 Bacteria 1071
335 Ga0157370_10810914 3300013104 Bacteria 851
336 Ga0157374_10510630 3300013296 Bacteria 1207
337 Ga0157378_10074128 3300013297 Bacteria 3062
338 Ga0157378_10077086 3300013297 Bacteria 3005
339 Ga0157378_10367816 3300013297 Bacteria 1409
340 Ga0157378_10661797 3300013297 Bacteria 1061
341 Ga0163162_10010007 3300013306 Bacteria 9221
342 Ga0163162_10321503 3300013306 Bacteria 1680
343 Ga0163162_10394122 3300013306 Bacteria 1517
344 Ga0157372_10218610 3300013307 Bacteria 2208
345 Ga0157372_10855203 3300013307 Bacteria 1056
346 Ga0157375_10724238 3300013308 Bacteria 1147
347 Ga0163163_10064503 3300014325 Bacteria 3634
348 Ga0163163_10075022 3300014325 Bacteria 3375
349 Ga0163163_11988878 3300014325 Bacteria 641
350 Ga0157380_10186461 3300014326 Bacteria 1827
351 Ga0157380_10215780 3300014326 Bacteria 1713
352 Ga0157380_10426265 3300014326 Bacteria 1267
353 Ga0157380_12527629 3300014326 Bacteria 579
354 Ga0157377_10048477 3300014745 Bacteria 2383
355 Ga0157376_10188927 3300014969 Bacteria 1888
356 Ga0157376_10267523 3300014969 Bacteria 1604
357 Ga0157376_11224350 3300014969 Bacteria 779
358 Ga0163161_10112438 3300017792 Bacteria 2037
359 Ga0197907_10889824 3300020069 Bacteria 574
360 Ga0197907_11053528 3300020069 Bacteria 633
361 Ga0197907_11501374 3300020069 Unclassified 664
362 Ga0206356_10247621 3300020070 Bacteria 626
363 Ga0206356_10594276 3300020070 Bacteria 568
364 Ga0206356_11474439 3300020070 Bacteria 620
365 Ga0206356_11572529 3300020070 Bacteria 629
366 Ga0206356_11733153 3300020070 Bacteria 582
367 Ga0206356_11743097 3300020070 Bacteria 581
368 Ga0206356_11836906 3300020070 Bacteria 1183
369 Ga0206349_1020691 3300020075 Bacteria 556
370 Ga0206349_1186858 3300020075 Bacteria 588
371 Ga0206349_1197767 3300020075 Bacteria 550
372 Ga0206349_1262994 3300020075 Bacteria 882
373 Ga0206349_1463205 3300020075 Bacteria 572
374 Ga0206349_1946070 3300020075 Bacteria 691
375 Ga0206355_1093692 3300020076 Bacteria 615
376 Ga0206355_1113466 3300020076 Bacteria 587
377 Ga0206355_1164344 3300020076 Unclassified 1069
378 Ga0206355_1358260 3300020076 Bacteria 668
379 Ga0206355_1367435 3300020076 Bacteria 586
380 Ga0206351_10032476 3300020077 Bacteria 639
381 Ga0206351_10751612 3300020077 Bacteria 609
382 Ga0206352_10138666 3300020078 Bacteria 618
383 Ga0206350_10122239 3300020080 Bacteria 592
384 Ga0206350_10365195 3300020080 Bacteria 665
385 Ga0206350_10388215 3300020080 Bacteria 633
386 Ga0206350_10511773 3300020080 Bacteria 590
387 Ga0206350_10646272 3300020080 Bacteria 632
388 Ga0206350_10677610 3300020080 Bacteria 719
389 Ga0206350_10924274 3300020080 Bacteria 634
390 Ga0206350_11081022 3300020080 Bacteria 674
391 Ga0206350_11355059 3300020080 Bacteria 567
392 Ga0206354_10089617 3300020081 Bacteria 1824
393 Ga0206354_11086759 3300020081 Bacteria 708
394 Ga0206354_11428798 3300020081 Bacteria 589
395 Ga0206353_10116796 3300020082 Bacteria 1490
396 Ga0206353_10362445 3300020082 Bacteria 902
397 Ga0206353_10411745 3300020082 Bacteria 651
398 Ga0206353_10504062 3300020082 Bacteria 579
399 Ga0206353_10883923 3300020082 Bacteria 855
400 Ga0206353_11374616 3300020082 Bacteria 681
401 Ga0206353_11504878 3300020082 Bacteria 604
402 Ga0206353_11657362 3300020082 Bacteria 592
403 Ga0154015_1321397 3300020610 Bacteria 725
404 Ga0224712_10182083 3300022467 Bacteria 947
405 Ga0224712_10278123 3300022467 Bacteria 778
406 Ga0224712_10295154 3300022467 Bacteria 757
407 Ga0224712_10304103 3300022467 Bacteria 746
408 Ga0224712_10305207 3300022467 Bacteria 745
409 Ga0224712_10448592 3300022467 Bacteria 619
410 Ga0224712_10488207 3300022467 Bacteria 594
411 Ga0224712_10494070 3300022467 Bacteria 591
412 Ga0224712_10511958 3300022467 Bacteria 581
413 Ga0247551_102201 3300023552 Bacteria 703
414 Ga0247523_112525 3300023684 Bacteria 697
415 Ga0209455_1002093 3300025272 Bacteria 7978
416 Ga0209758_1008352 3300025297 Bacteria 6736
417 Ga0207426_1075567 3300025302 Bacteria 927
418 Ga0207656_10126512 3300025321 Bacteria 1194
419 Ga0207656_10163908 3300025321 Bacteria 1059
420 Ga0207713_1073333 3300025735 Bacteria 1256
421 Ga0207653_10007478 3300025885 Bacteria 3405
422 Ga0207653_10039302 3300025885 Bacteria 1549
423 Ga0207692_10027517 3300025898 Bacteria 2679
424 Ga0207642_10081749 3300025899 Bacteria 1571
425 Ga0207642_10230011 3300025899 Bacteria 1041
426 Ga0207710_10011489 3300025900 Bacteria 3728
427 Ga0207688_10000896 3300025901 Bacteria 15032
428 Ga0207680_10009686 3300025903 Bacteria 4791
429 Ga0207680_10601969 3300025903 Bacteria 786
430 Ga0207647_10005519 3300025904 Bacteria 9261
431 Ga0207647_10086076 3300025904 Bacteria 1879
432 Ga0207647_10091272 3300025904 Bacteria 1816
433 Ga0207699_10000463 3300025906 Bacteria 20679
434 Ga0207699_10107996 3300025906 Bacteria 1779
435 Ga0207645_10005784 3300025907 Bacteria 8919
436 Ga0207645_10227158 3300025907 Bacteria 1231
437 Ga0207645_10336316 3300025907 Bacteria 1009
438 Ga0207643_10005864 3300025908 Bacteria 6561
439 Ga0207705_10109530 3300025909 Bacteria 2039
440 Ga0207705_10177512 3300025909 Bacteria 1606
441 Ga0207705_10690578 3300025909 Bacteria 793
442 Ga0207684_11024328 3300025910 Bacteria 690
443 Ga0207654_10002142 3300025911 Bacteria 10111
444 Ga0207654_10126759 3300025911 Bacteria 1611
445 Ga0207654_10156278 3300025911 Bacteria 1469
446 Ga0207654_10550951 3300025911 Bacteria 819
447 Ga0207707_10014498 3300025912 Bacteria 6863
448 Ga0207707_10024561 3300025912 Bacteria 5275
449 Ga0207695_10015064 3300025913 Bacteria 9121
450 Ga0207695_10056580 3300025913 Bacteria 4080
451 Ga0207671_10008930 3300025914 Bacteria 8436
452 Ga0207671_10073879 3300025914 Bacteria 2548
453 Ga0207671_10170843 3300025914 Bacteria 1688
454 Ga0207671_10223604 3300025914 Bacteria 1475
455 Ga0207671_10716188 3300025914 Bacteria 796
456 Ga0207671_10968571 3300025914 Bacteria 671
457 Ga0207693_10000640 3300025915 Bacteria 31338
458 Ga0207693_10037124 3300025915 Bacteria 3840
459 Ga0207693_10070055 3300025915 Bacteria 2744
460 Ga0207663_10373124 3300025916 Bacteria 1085
461 Ga0207663_11025368 3300025916 Bacteria 662
462 Ga0207662_10006236 3300025918 Bacteria 6419
463 Ga0207657_10006779 3300025919 Bacteria 11827
464 Ga0207657_10042348 3300025919 Bacteria 4018
465 Ga0207657_10386797 3300025919 Bacteria 1101
466 Ga0207649_10037057 3300025920 Bacteria 2943
467 Ga0207649_10073668 3300025920 Bacteria 2188
468 Ga0207652_10014385 3300025921 Bacteria 6411
469 Ga0207652_10227920 3300025921 Bacteria 1679
470 Ga0207694_10000275 3300025924 Bacteria 48774
471 Ga0207694_10128284 3300025924 Bacteria 2031
472 Ga0207694_10151091 3300025924 Bacteria 1871
473 Ga0207650_10179565 3300025925 Bacteria 1686
474 Ga0207659_10524947 3300025926 Bacteria 1004
475 Ga0207659_10779263 3300025926 Bacteria 821
476 Ga0207687_10074887 3300025927 Bacteria 2428
477 Ga0207687_10300546 3300025927 Bacteria 1293
478 Ga0207700_10135523 3300025928 Bacteria 2016
479 Ga0207700_10981429 3300025928 Bacteria 756
480 Ga0207664_10163043 3300025929 Bacteria 1902
481 Ga0207664_10332650 3300025929 Bacteria 1342
482 Ga0207664_11066688 3300025929 Bacteria 723
483 Ga0207644_10026008 3300025931 Bacteria 4028
484 Ga0207644_10065213 3300025931 Bacteria 2648
485 Ga0207644_10746250 3300025931 Bacteria 817
486 Ga0207690_10099075 3300025932 Bacteria 2077
487 Ga0207690_10224525 3300025932 Bacteria 1439
488 Ga0207706_10007357 3300025933 Bacteria 10175
489 Ga0207706_10059285 3300025933 Bacteria 3371
490 Ga0207706_10067153 3300025933 Bacteria 3155
491 Ga0207706_10186103 3300025933 Bacteria 1823
492 Ga0207706_10482924 3300025933 Bacteria 1070
493 Ga0207686_10074963 3300025934 Bacteria 2188
494 Ga0207686_10247460 3300025934 Bacteria 1301
495 Ga0207709_10139546 3300025935 Bacteria 1664
496 Ga0207709_10560673 3300025935 Bacteria 900
497 Ga0207709_10569188 3300025935 Bacteria 893
498 Ga0207670_10186147 3300025936 Bacteria 1567
499 Ga0207670_10228092 3300025936 Bacteria 1429
500 Ga0207669_10529931 3300025937 Bacteria 947
501 Ga0207669_10983171 3300025937 Bacteria 708
502 Ga0207704_10004344 3300025938 Bacteria 6482
503 Ga0207665_10001240 3300025939 Bacteria 17200
504 Ga0207691_10016710 3300025940 Bacteria 6968
505 Ga0207691_10037607 3300025940 Bacteria 4481
506 Ga0207711_10028906 3300025941 Bacteria 4670
507 Ga0207711_10030859 3300025941 Bacteria 4521
508 Ga0207711_10815829 3300025941 Bacteria 869
509 Ga0207689_10002364 3300025942 Bacteria 17614
510 Ga0207689_10424621 3300025942 Bacteria 1109
511 Ga0207689_10572682 3300025942 Unclassified 949
512 Ga0207661_10055213 3300025944 Bacteria 3185
513 Ga0207661_10127093 3300025944 Bacteria 2178
514 Ga0207661_10968211 3300025944 Bacteria 784
515 Ga0207679_11108163 3300025945 Unclassified 726
516 Ga0207667_10061756 3300025949 Bacteria 3920
517 Ga0207651_10357019 3300025960 Bacteria 1232
518 Ga0207651_10421006 3300025960 Bacteria 1140
519 Ga0207651_10782063 3300025960 Bacteria 845
520 Ga0207712_10434904 3300025961 Bacteria 1110
521 Ga0207668_10023778 3300025972 Bacteria 3944
522 Ga0207668_10125228 3300025972 Bacteria 1953
523 Ga0207668_10281391 3300025972 Bacteria 1364
524 Ga0207640_10062060 3300025981 Bacteria 2478
525 Ga0207640_10148236 3300025981 Bacteria 1720
526 Ga0207658_10028993 3300025986 Bacteria 3903
527 Ga0207658_10134836 3300025986 Bacteria 1989
528 Ga0207677_11102657 3300026023 Bacteria 724
529 Ga0207703_10205828 3300026035 Bacteria 1751
530 Ga0207703_10351960 3300026035 Bacteria 1356
531 Ga0207703_10393125 3300026035 Bacteria 1285
532 Ga0207639_10056687 3300026041 Bacteria 3004
533 Ga0207639_10126168 3300026041 Bacteria 2111
534 Ga0207678_10013706 3300026067 Bacteria 7122
535 Ga0207678_10043711 3300026067 Bacteria 3876
536 Ga0207678_10047593 3300026067 Bacteria 3708
537 Ga0207678_10094228 3300026067 Bacteria 2558
538 Ga0207678_10143127 3300026067 Bacteria 2041
539 Ga0207678_10368890 3300026067 Bacteria 1240
540 Ga0207678_10396695 3300026067 Bacteria 1194
541 Ga0207678_10459519 3300026067 Bacteria 1107
542 Ga0207678_11083551 3300026067 Bacteria 709
543 Ga0207708_10001706 3300026075 Bacteria 16253
544 Ga0207702_10000026 3300026078 Bacteria 186067
545 Ga0207702_10000261 3300026078 Bacteria 61023
546 Ga0207702_10018370 3300026078 Bacteria 5785
547 Ga0207702_10122685 3300026078 Bacteria 2328
548 Ga0207702_10189685 3300026078 Bacteria 1898
549 Ga0207641_10152237 3300026088 Bacteria 2095
550 Ga0207641_11075545 3300026088 Unclassified 802
551 Ga0207648_10001075 3300026089 Bacteria 30605
552 Ga0207648_10918263 3300026089 Bacteria 818
553 Ga0207676_10144444 3300026095 Bacteria 2041
554 Ga0207676_10557049 3300026095 Bacteria 1096
555 Ga0207676_11575435 3300026095 Bacteria 654
556 Ga0207674_10010326 3300026116 Bacteria 10586
557 Ga0207674_10011498 3300026116 Bacteria 9941
558 Ga0207674_10095357 3300026116 Bacteria 2961
559 Ga0207675_100019330 3300026118 Bacteria 6356
560 Ga0207675_100075468 3300026118 Bacteria 3156
561 Ga0207675_100078028 3300026118 Bacteria 3103
562 Ga0207675_100459020 3300026118 Bacteria 1263
563 Ga0207683_10005431 3300026121 Bacteria 10918
564 Ga0207683_10231562 3300026121 Bacteria 1685
565 Ga0207683_10529706 3300026121 Bacteria 1089
566 Ga0207683_11079303 3300026121 Bacteria 745
567 Ga0207698_10502536 3300026142 Bacteria 1180
568 Ga0207698_10726318 3300026142 Bacteria 990
569 Ga0207698_10935451 3300026142 Bacteria 875
570 Ga0209588_1076492 3300027671 Bacteria 1082
571 Ga0209813_10075398 3300027866 Bacteria 1105
572 Ga0207428_10039794 3300027907 Bacteria 3817
573 Ga0207428_10557741 3300027907 Bacteria 828
574 Ga0268266_10061845 3300028379 Bacteria 3229
575 Ga0268266_10089000 3300028379 Bacteria 2702
576 Ga0268266_10091874 3300028379 Bacteria 2662
577 Ga0268266_10270862 3300028379 Bacteria 1576
578 Ga0268266_10615691 3300028379 Bacteria 1043
579 Ga0268266_10757559 3300028379 Bacteria 937
580 Ga0268265_10054641 3300028380 Bacteria 3031
581 Ga0268265_10220268 3300028380 Bacteria 1660
582 Ga0268265_10227273 3300028380 Bacteria 1637
583 Ga0268264_10328562 3300028381 Bacteria 1448
584 Ga0268264_10424356 3300028381 Bacteria 1283
585 Ga0268264_10583177 3300028381 Bacteria 1100
586 Ga0307515_10163003 3300028794 Bacteria 2263
587 Ga0307515_10419659 3300028794 Bacteria 959
588 Ga0265766_1015316 3300030863 Bacteria 591
589 Ga0265328_10244845 3300031239 Bacteria 686
590 Ga0265325_10001626 3300031241 Bacteria 15661
591 Ga0265325_10011302 3300031241 Bacteria 5130
592 Ga0265339_10005018 3300031249 Bacteria 8901
593 Ga0307513_10154734 3300031456 Bacteria 2195
594 Ga0307513_10445618 3300031456 Bacteria 1020
595 Ga0307509_10508846 3300031507 Bacteria 887
596 Ga0307509_10577547 3300031507 Bacteria 799
597 Ga0307408_100421690 3300031548 Bacteria 1151
598 Ga0307408_100536846 3300031548 Bacteria 1030
599 Ga0310117_124297 3300031592 Bacteria 597
600 Ga0265313_10004507 3300031595 Bacteria 10658
601 Ga0265313_10030909 3300031595 Bacteria 2750
602 Ga0265313_10054763 3300031595 Bacteria 1893
603 Ga0307508_10146318 3300031616 Bacteria 1967
604 Ga0265342_10059304 3300031712 Bacteria 2261
605 Ga0316043_127489 3300031828 Bacteria 583
606 Ga0307406_10316115 3300031901 Bacteria 1206
607 Ga0307416_100168750 3300032002 Bacteria 2034
608 Ga0307415_100036591 3300032126 Bacteria 3218
609 Ga0307507_10213161 3300033179 Bacteria 1313
610 Ga0307510_10062648 3300033180 Bacteria 3798
611 Ga0307510_10440666 3300033180 Bacteria 744
612 Ga0373948_0008489 3300034817 Bacteria 1750
613 Ga0373958_0001587 3300034819 Bacteria 3078
614 Ga0373926_0005541 3300035083 Bacteria 4164
615 Ga0373934_0054317 3300035086 Bacteria 1590
616 Ga0373944_0000364 3300035089 Bacteria 10277
617 Ga0373944_0010085 3300035089 Bacteria 2569
618 Ga0373944_0097139 3300035089 Unclassified 991
619 Ga0373949_0021242 3300035090 Bacteria 1491
620 Ga0373951_0023092 3300035091 Bacteria 1435
621 Ga0373951_0112944 3300035091 Bacteria 733
622 Ga0373923_0005611 3300035111 Bacteria 4272
623 Ga0373923_0009594 3300035111 Bacteria 3499
624 Ga0373923_0183843 3300035111 Bacteria 961
625 Ga0373936_0008721 3300035113 Bacteria 3819
626 Ga0373936_0081898 3300035113 Bacteria 1344
627 Ga0373939_0133078 3300035114 Unclassified 889
628 Ga0373939_0327484 3300035114 Bacteria 618
629 Ga0373941_0013347 3300035115 Bacteria 2170
630 Ga0373945_0000604 3300035116 Bacteria 10308
631 Ga0373945_0013010 3300035116 Unclassified 2772
632 Ga0373945_0066848 3300035116 Bacteria 1352
633 Ga0373953_0031765 3300035117 Bacteria 2055
634 Ga0373953_0038873 3300035117 Bacteria 1884
635 Ga0373954_0011230 3300035118 Bacteria 3965
636 Ga0373954_0048759 3300035118 Bacteria 1984
637 Ga0373956_0084357 3300035119 Bacteria 1460
638 Ga0373956_0381736 3300035119 Bacteria 672
639 Ga0373957_0003340 3300035120 Bacteria 4729
640 Ga0373957_0062844 3300035120 Bacteria 1441
641 Ga0373943_0006934 3300035170 Bacteria 5082
642 Ga0373943_0031393 3300035170 Bacteria 2520
643 Ga0373946_0029874 3300035171 Bacteria 2172
644 Ga0373946_0033120 3300035171 Bacteria 2078
645 Ga0373955_0002404 3300035172 Bacteria 8159
646 Ga0373955_0007268 3300035172 Bacteria 5084
647 Ga0373955_0114546 3300035172 Bacteria 1562
648 Ga0373961_0002416 3300035241 Bacteria 4853
649 Ga0373962_0112365 3300035242 Unclassified 861
650 Ga0373924_0006081 3300035410 Bacteria 4311
651 Ga0373924_0006172 3300035410 Bacteria 4284
652 Ga0373931_0096660 3300035691 Bacteria 1655
653 Ga0373931_0199953 3300035691 Bacteria 1193
654 Ga0373935_0013235 3300035692 Bacteria 4976
655 Ga0373935_0399675 3300035692 Bacteria 987
656 Ga0373935_0465733 3300035692 Bacteria 914
657 Ga0373935_0800384 3300035692 Bacteria 696
658 Ga0373927_0001118 3300035695 Bacteria 20382
659 Ga0373927_0011708 3300035695 Bacteria 5839
660 Ga0373927_0014273 3300035695 Bacteria 5264
661 Ga0373933_0011886 3300035724 Bacteria 4806
662 Ga0373933_0088546 3300035724 Bacteria 1907
663 Ga0373947_0000372 3300035725 Bacteria 25344
664 Ga0373947_0017773 3300035725 Bacteria 4090
665 Ga0373947_0026529 3300035725 Bacteria 3387
666 Ga0373937_0030143 3300036401 Bacteria 4914
667 Ga0373937_0101470 3300036401 Bacteria 2671
668 Ga0373937_0106945 3300036401 Bacteria 2600
669 Ga0373937_0114684 3300036401 Bacteria 2508
670 Ga0373937_0995412 3300036401 Bacteria 787
671 Ga0310109_046298 3300036534 Bacteria 563
672 Ga0373925_0006079 3300037068 Bacteria 8931
673 Ga0373925_0035309 3300037068 Bacteria 3687
674 Ga0373925_0043061 3300037068 Bacteria 3350
675 Ga0373925_0263159 3300037068 Bacteria 1386
676 Ga0373925_0268518 3300037068 Bacteria 1372
677 Ga0395905_0217267 3300037471 Bacteria 1790
678 Ga0395905_0314542 3300037471 Bacteria 1455
679 Ga0436360_0599366 3300039438 Bacteria 2885
680 Ga0436360_0645480 3300039438 Bacteria 1322
681 Ga0436363_1293311 3300039450 Bacteria 6055
682 Ga0436362_1029460 3300039453 Bacteria 3668
683 Ga0439461_0128559 3300041410 Bacteria 639
684 Ga0451802_0955069 3300041460 Bacteria 661
685 Ga0451833_1205776 3300041491 Bacteria 606
686 Ga0451853_3246118 3300041512 Bacteria 687
687 Ga0466966_0005575 3300044684 Bacteria 8277
688 Ga0466966_0252929 3300044684 Bacteria 1061
689 Ga0466963_0038531 3300044694 Bacteria 3126
690 Ga0466963_0955214 3300044694 Bacteria 604
691 Ga0466968_0005113 3300044735 Bacteria 4908
692 Ga0466959_0010598 3300045049 Bacteria 6598
693 Ga0466959_0329301 3300045049 Bacteria 1043
694 Ga0466959_0444672 3300045049 Bacteria 879
695 Ga0466967_0021546 3300045976 Bacteria 5240
696 Ga0495627_103522 3300046453 Bacteria 811
697 Ga0495592_0001055 3300046454 Bacteria 19077
698 Ga0495592_0010832 3300046454 Bacteria 6878
699 Ga0495603_0014865 3300046455 Bacteria 4709
700 Ga0495603_0024400 3300046455 Bacteria 3657
701 Ga0495603_0026152 3300046455 Bacteria 3526
702 Ga0495603_0223293 3300046455 Bacteria 1087
703 Ga0495590_0030522 3300046457 Bacteria 1888
704 Ga0495629_0003357 3300046459 Bacteria 12088
705 Ga0495629_0019076 3300046459 Bacteria 4903
706 Ga0495629_0112714 3300046459 Bacteria 1896
707 Ga0495629_0177175 3300046459 Bacteria 1478
708 Ga0495638_0105696 3300046460 Bacteria 1677
709 Ga0495638_0127089 3300046460 Bacteria 1501
710 Ga0495641_0012702 3300046461 Bacteria 4688
711 Ga0495651_0009559 3300046462 Bacteria 7449
712 Ga0495651_0039188 3300046462 Bacteria 3690
713 Ga0495651_0055997 3300046462 Bacteria 3029
714 Ga0495651_0099648 3300046462 Bacteria 2166
715 Ga0495653_0008585 3300046463 Bacteria 8375
716 Ga0495653_0017321 3300046463 Bacteria 5860
717 Ga0495653_0267673 3300046463 Bacteria 1127
718 Ga0495580_0013690 3300046472 Bacteria 6180
719 Ga0495580_0222805 3300046472 Bacteria 1296
720 Ga0495582_0011471 3300046473 Bacteria 4882
721 Ga0495582_0031598 3300046473 Bacteria 2910
722 Ga0495639_0004110 3300046475 Bacteria 6235
723 Ga0495662_0003064 3300046476 Bacteria 8427
724 Ga0495662_0362007 3300046476 Bacteria 713
725 Ga0495664_0008779 3300046477 Bacteria 5647
726 Ga0495664_0269855 3300046477 Bacteria 1028
727 Ga0495584_0034642 3300046491 Bacteria 2553
728 Ga0495585_0056846 3300046492 Bacteria 2160
729 Ga0495594_0005321 3300046499 Bacteria 6610
730 Ga0495594_0143479 3300046499 Bacteria 1355
731 Ga0495607_0044310 3300046501 Bacteria 2624
732 Ga0495607_0455181 3300046501 Bacteria 574
733 Ga0495583_0042395 3300046506 Bacteria 2126
734 Ga0495606_0055888 3300046507 Bacteria 2550
735 Ga0495608_0033105 3300046511 Bacteria 3495
736 Ga0495610_0044346 3300046512 Bacteria 2207
737 Ga0495616_0035528 3300046513 Bacteria 2578
738 Ga0495616_0113607 3300046513 Bacteria 1256
739 Ga0495616_0312848 3300046513 Bacteria 661
740 Ga0495618_0002517 3300046514 Bacteria 11741
741 Ga0495618_0045723 3300046514 Bacteria 2762
742 Ga0495618_0722148 3300046514 Bacteria 585
743 Ga0495628_0087042 3300046516 Bacteria 2422
744 Ga0495628_0087330 3300046516 Bacteria 2418
745 Ga0495628_0348576 3300046516 Bacteria 1089
746 Ga0495630_0017717 3300046517 Bacteria 5222
747 Ga0495630_0025849 3300046517 Bacteria 4343
748 Ga0495631_0109239 3300046518 Bacteria 1189
749 Ga0495631_0199360 3300046518 Bacteria 856
750 Ga0495632_0021367 3300046519 Bacteria 3489
751 Ga0495637_0033862 3300046520 Bacteria 2241
752 Ga0495643_0206760 3300046522 Bacteria 939
753 Ga0495644_0002732 3300046523 Bacteria 7000
754 Ga0495663_0046978 3300046525 Bacteria 1328
755 Ga0495666_0006077 3300046526 Bacteria 6079
756 Ga0495666_0020392 3300046526 Bacteria 3285
757 Ga0495666_0152763 3300046526 Bacteria 1073
758 Ga0495652_0108337 3300046529 Bacteria 2239
759 Ga0495652_0145992 3300046529 Bacteria 1854
760 Ga0495665_0032754 3300046531 Bacteria 2780
761 Ga0495640_0006867 3300046533 Bacteria 8966
762 Ga0495640_0051277 3300046533 Bacteria 2836
763 Ga0495640_0183560 3300046533 Bacteria 1332
764 Ga0495586_0087335 3300046535 Bacteria 1719
765 Ga0495586_0230257 3300046535 Bacteria 1054
766 Ga0495587_0026482 3300046536 Bacteria 3536
767 Ga0495587_0051328 3300046536 Bacteria 2438
768 Ga0495598_0058368 3300046537 Bacteria 1183
769 Ga0495598_0067460 3300046537 Bacteria 1119
770 Ga0495609_0033203 3300046538 Bacteria 2343
771 Ga0495621_0013532 3300046539 Bacteria 2566
772 Ga0495597_0092747 3300046542 Bacteria 1280
773 Ga0495622_0006399 3300046557 Bacteria 5467
774 Ga0495633_0009880 3300046558 Bacteria 5241
775 Ga0495633_0018095 3300046558 Bacteria 3584
776 Ga0495667_0008737 3300046559 Bacteria 6882
777 Ga0495667_0020910 3300046559 Bacteria 4416
778 Ga0495667_0078258 3300046559 Bacteria 2150
779 Ga0495667_0106403 3300046559 Bacteria 1813
780 Ga0495656_0000064 3300046615 Bacteria 48582
781 Ga0495656_0046515 3300046615 Bacteria 1836
782 Ga0495656_0048334 3300046615 Bacteria 1807
783 Ga0495668_0025416 3300046616 Bacteria 3364
784 Ga0495634_0026538 3300046642 Bacteria 4041
785 Ga0495634_0047460 3300046642 Bacteria 2893
786 Ga0495611_0105572 3300046648 Bacteria 1310
787 Ga0495611_0124745 3300046648 Bacteria 1201
788 Ga0495611_0226481 3300046648 Bacteria 869
789 Ga0495625_0006076 3300046660 Bacteria 10838
790 Ga0495625_0047212 3300046660 Bacteria 3105
791 Ga0495625_0658367 3300046660 Bacteria 623
792 Ga0495635_0008796 3300046663 Bacteria 7049
793 Ga0495635_0037890 3300046663 Bacteria 3338
794 Ga0495635_0122079 3300046663 Bacteria 1776
795 Ga0495659_0208813 3300046664 Bacteria 803
796 Ga0495661_0036088 3300046665 Bacteria 3097
797 Ga0495661_0150914 3300046665 Bacteria 1255
798 Ga0495661_0225380 3300046665 Bacteria 969
799 Ga0495588_0011011 3300046674 Bacteria 4231
800 Ga0495588_0018681 3300046674 Bacteria 3384
801 Ga0495657_0047604 3300046675 Bacteria 2897
802 Ga0495657_0106638 3300046675 Bacteria 1779
803 Ga0495657_0202029 3300046675 Bacteria 1211
804 Ga0495657_0509451 3300046675 Bacteria 701
805 Ga0495599_0021867 3300046678 Bacteria 3993
806 Ga0495599_0043307 3300046678 Bacteria 2824
807 Ga0495623_0036443 3300046679 Bacteria 3150
808 Ga0495623_0248643 3300046679 Bacteria 1001
809 Ga0495646_0003336 3300046680 Bacteria 9986
810 Ga0495647_0015713 3300046681 Bacteria 2657
811 Ga0495647_0017786 3300046681 Bacteria 2520
812 Ga0495658_0001834 3300046683 Bacteria 10873
813 Ga0495658_0010431 3300046683 Bacteria 4648
814 Ga0495658_0311236 3300046683 Bacteria 997
815 Ga0495658_0444063 3300046683 Bacteria 828
816 Ga0495669_0241913 3300046684 Bacteria 866
817 Ga0495669_0266358 3300046684 Bacteria 823
818 Ga0495613_0033299 3300046689 Bacteria 3829
819 Ga0495613_0102619 3300046689 Bacteria 2065
820 Ga0495613_0182144 3300046689 Bacteria 1487
821 Ga0495613_0819128 3300046689 Bacteria 607
822 Ga0495624_0005807 3300046690 Bacteria 8837
823 Ga0495624_0045904 3300046690 Bacteria 2779
824 Ga0495670_0090641 3300046691 Bacteria 1564
825 Ga0495671_0013849 3300046692 Bacteria 4351
826 Ga0495589_0247988 3300046794 Bacteria 832
827 Ga0495600_0000716 3300046809 Bacteria 17441
828 Ga0495600_0001994 3300046809 Bacteria 11472
829 Ga0495600_0181124 3300046809 Bacteria 1358
830 Ga0495660_0128889 3300046810 Bacteria 1271
831 Ga0495660_0343500 3300046810 Bacteria 665
832 Ga0495581_0020045 3300047315 Bacteria 3882
833 Ga0495581_0072896 3300047315 Bacteria 1987
834 Ga0495581_0073317 3300047315 Bacteria 1981
835 Ga0495604_0025973 3300047317 Bacteria 4665
836 Ga0495604_0039798 3300047317 Bacteria 3693
837 Ga0495604_0054739 3300047317 Bacteria 3077
838 Ga0495636_0095471 3300047318 Bacteria 1295
839 Ga0495674_0088487 3300047319 Bacteria 2648
840 Ga0495674_0345361 3300047319 Bacteria 1209
841 Ga0495672_0079076 3300047320 Bacteria 1837
842 Ga0495676_0030061 3300047321 Bacteria 4617
843 Ga0495676_0050140 3300047321 Bacteria 3350
844 Ga0495676_0052812 3300047321 Bacteria 3242
845 Ga0495676_0346310 3300047321 Unclassified 994
846 Ga0495680_0011117 3300047322 Bacteria 7991
847 Ga0495680_0014218 3300047322 Bacteria 6903
848 Ga0495680_0045137 3300047322 Bacteria 3481
849 Ga0495680_0301870 3300047322 Bacteria 1124
850 Ga0495675_0104372 3300047444 Bacteria 1771
851 Ga0495675_0154536 3300047444 Bacteria 1416
852 Ga0495673_0035535 3300047469 Bacteria 2295
853 Ga0495684_0003050 3300047471 Bacteria 13176
854 Ga0495684_0006284 3300047471 Bacteria 9233
855 Ga0495684_0022194 3300047471 Bacteria 4886
856 Ga0495684_0220457 3300047471 Bacteria 1391
857 Ga0495684_0324079 3300047471 Bacteria 1101
858 Ga0495684_0332537 3300047471 Bacteria 1083
859 Ga0495686_0017077 3300047472 Bacteria 4900
860 Ga0495686_0223799 3300047472 Bacteria 1069
861 Ga0495593_0003538 3300047673 Bacteria 9347
862 Ga0495593_0003546 3300047673 Bacteria 9336
863 Ga0495593_0007526 3300047673 Bacteria 6367
864 Ga0495593_0029887 3300047673 Bacteria 2985
865 Ga0495593_0093302 3300047673 Bacteria 1549
866 Ga0495602_0086153 3300048088 Bacteria 2623
867 Ga0495602_0094544 3300048088 Bacteria 2469
868 Ga0495602_0215159 3300048088 Bacteria 1455
869 Ga0495602_0237050 3300048088 Bacteria 1367
870 Ga0495602_0271223 3300048088 Bacteria 1254
871 Ga0495602_0561486 3300048088 Bacteria 790
872 Ga0495614_0012122 3300048089 Bacteria 3786
873 Ga0495626_0086193 3300048091 Bacteria 1388
874 Ga0495626_0260181 3300048091 Bacteria 694
875 Ga0496100_0007837 3300048903 Bacteria 5926
876 Ga0496100_0100720 3300048903 Bacteria 1990
877 Ga0496101_0138194 3300048904 Bacteria 1855
878 Ga0496101_0266194 3300048904 Bacteria 1338
879 Ga0496101_0401158 3300048904 Bacteria 1080
880 Ga0496102_0032922 3300048905 Bacteria 4658
881 Ga0496102_0041408 3300048905 Bacteria 4171
882 Ga0496102_0061565 3300048905 Bacteria 3435
883 Ga0496102_0123500 3300048905 Bacteria 2419
884 Ga0496102_0131901 3300048905 Bacteria 2339
885 Ga0496102_0362100 3300048905 Bacteria 1365
886 Ga0496103_0071414 3300048906 Bacteria 2172
887 Ga0496103_0097141 3300048906 Bacteria 1862
888 Ga0496103_0381642 3300048906 Bacteria 905
889 Ga0496104_0008842 3300048907 Bacteria 8953
890 Ga0496104_0219238 3300048907 Bacteria 1815
891 Ga0496104_0926033 3300048907 Bacteria 776
892 Ga0496105_0162145 3300048908 Bacteria 1835
893 Ga0496105_0502104 3300048908 Bacteria 952
894 Ga0496105_0585446 3300048908 Unclassified 867
895 Ga0496106_0029877 3300048909 Bacteria 4062
896 Ga0496106_0041002 3300048909 Bacteria 3468
897 Ga0496106_0097958 3300048909 Bacteria 2271
898 Ga0496107_0138809 3300048910 Bacteria 1796
899 Ga0496107_0473597 3300048910 Bacteria 929
900 Ga0496107_1142889 3300048910 Bacteria 561
901 Ga0496108_0005621 3300048911 Bacteria 10146
902 Ga0496108_0181363 3300048911 Bacteria 1823
903 Ga0496109_0076356 3300048912 Bacteria 3081
904 Ga0496109_0315076 3300048912 Bacteria 1476
905 Ga0496109_0328581 3300048912 Bacteria 1443
906 Ga0496110_0065588 3300048913 Bacteria 3210
907 Ga0496110_0320163 3300048913 Bacteria 1413
908 Ga0496110_0384154 3300048913 Bacteria 1279
909 Ga0496110_0430367 3300048913 Bacteria 1203
910 Ga0496110_0453250 3300048913 Bacteria 1169
911 Ga0496111_0048697 3300048914 Bacteria 3053
912 Ga0496111_0219840 3300048914 Bacteria 1411
913 Ga0496111_0454743 3300048914 Unclassified 944
914 Ga0496112_0006027 3300048915 Bacteria 10582
915 Ga0496112_0331113 3300048915 Bacteria 1466
916 Ga0496112_0406145 3300048915 Bacteria 1301
917 Ga0496112_0776215 3300048915 Bacteria 884
918 Ga0496113_0030783 3300048916 Bacteria 3887
919 Ga0496113_0130337 3300048916 Bacteria 1973
920 Ga0496113_0149706 3300048916 Bacteria 1840
921 Ga0496113_0163115 3300048916 Bacteria 1762
922 Ga0496114_0060904 3300048917 Bacteria 3155
923 Ga0496114_0152579 3300048917 Bacteria 2004
924 Ga0496114_0208628 3300048917 Bacteria 1713
925 Ga0496114_0307910 3300048917 Bacteria 1399
926 Ga0496114_0333238 3300048917 Bacteria 1341
927 Ga0496115_0033633 3300048918 Bacteria 4048
928 Ga0496115_0046778 3300048918 Bacteria 3459
929 Ga0496115_0121803 3300048918 Bacteria 2147
930 Ga0496115_0214364 3300048918 Bacteria 1590
931 Ga0496115_0215701 3300048918 Bacteria 1584
932 Ga0496115_0231623 3300048918 Bacteria 1523
933 Ga0496115_0353296 3300048918 Bacteria 1198
934 Ga0496116_0349539 3300048919 Bacteria 678
935 Ga0496117_0202176 3300048920 Bacteria 1121
936 Ga0496118_0059696 3300048921 Bacteria 2837
937 Ga0496118_0116918 3300048921 Bacteria 1751
938 Ga0496118_0224777 3300048921 Bacteria 1089
939 Ga0496120_0080935 3300048923 Bacteria 1759
940 Ga0496120_0131365 3300048923 Bacteria 1282
941 Ga0496121_0000300 3300048924 Bacteria 102506
942 Ga0496121_0026815 3300048924 Bacteria 5413
943 Ga0496121_0027734 3300048924 Bacteria 5293
944 Ga0496121_0041567 3300048924 Bacteria 4016
945 Ga0496121_0074274 3300048924 Bacteria 2720
946 Ga0496121_0179884 3300048924 Bacteria 1527
947 Ga0496121_0279163 3300048924 Bacteria 1144
948 Ga0496121_0592625 3300048924 Bacteria 685
949 Ga0496121_0597692 3300048924 Bacteria 681
950 Ga0496122_0010659 3300048925 Bacteria 9438
951 Ga0496122_0082401 3300048925 Bacteria 2234
952 Ga0496122_0246162 3300048925 Bacteria 1004
953 Ga0496123_0072978 3300048926 Bacteria 2132
954 Ga0496123_0073217 3300048926 Bacteria 2126
955 Ga0496123_0181476 3300048926 Bacteria 1099
956 Ga0496124_0215824 3300048927 Bacteria 1447
957 Ga0496124_0305892 3300048927 Bacteria 1146
958 Ga0496125_0000063 3300048928 Bacteria 250260
959 Ga0496125_0057601 3300048928 Bacteria 3145
960 Ga0496126_0008064 3300048929 Bacteria 11410
961 Ga0496126_0008100 3300048929 Bacteria 11382
962 Ga0496126_0031081 3300048929 Bacteria 5049
963 Ga0496126_0099390 3300048929 Bacteria 2548
964 Ga0496126_0133791 3300048929 Bacteria 2140
965 Ga0496126_0139126 3300048929 Bacteria 2092
966 Ga0496126_0174394 3300048929 Bacteria 1830
967 Ga0496126_0254741 3300048929 Bacteria 1461
968 Ga0501031_0502400 3300049568 Bacteria 782
969 Ga0501032_0001391 3300049569 Bacteria 19212
970 Ga0501033_0000304 3300049570 Bacteria 46485
971 Ga0501033_0257829 3300049570 Bacteria 1235
972 Ga0501034_0028770 3300049571 Bacteria 5654
973 Ga0501034_0061482 3300049571 Bacteria 3771
974 Ga0501036_0093458 3300049572 Bacteria 2541
975 Ga0501036_0117424 3300049572 Bacteria 2247
976 Ga0501037_0000154 3300049573 Bacteria 64077
977 Ga0501037_0202150 3300049573 Bacteria 1404
978 Ga0501037_0322494 3300049573 Bacteria 1069
979 Ga0501038_0465060 3300049574 Bacteria 971
980 Ga0501038_0951447 3300049574 Bacteria 632
981 Ga0501039_0190507 3300049575 Bacteria 1613
982 Ga0501041_0009638 3300049577 Bacteria 5694
983 Ga0501041_0433754 3300049577 Bacteria 834
984 Ga0501042_0027891 3300049578 Bacteria 3973
985 Ga0501043_0000007 3300049579 Bacteria 224595
986 Ga0501043_0337856 3300049579 Bacteria 1146
987 Ga0501047_0000740 3300049581 Bacteria 34045
988 Ga0501047_0036680 3300049581 Bacteria 4739
989 Ga0501047_0124460 3300049581 Bacteria 2459
990 Ga0501047_0462930 3300049581 Bacteria 1097
991 Ga0501048_0048949 3300049582 Bacteria 3014
992 Ga0501067_0027605 3300049583 Bacteria 3146
993 Ga0501067_0159701 3300049583 Bacteria 1255
994 Ga0501067_0197413 3300049583 Bacteria 1121
995 Ga0501067_0650151 3300049583 Bacteria 592
996 Ga0501068_0180196 3300049584 Bacteria 1336
997 Ga0501068_0342319 3300049584 Bacteria 960
998 Ga0501069_0000027 3300049585 Bacteria 106217
999 Ga0501069_0019796 3300049585 Bacteria 3641
1000 Ga0501069_0061284 3300049585 Bacteria 2100
1001 Ga0501069_0299895 3300049585 Bacteria 942
1002 Ga0501070_0000160 3300049586 Bacteria 61662
1003 Ga0501070_0000457 3300049586 Bacteria 37005
1004 Ga0501070_0039896 3300049586 Bacteria 3915
1005 Ga0501070_0064803 3300049586 Bacteria 3025
1006 Ga0501070_0067828 3300049586 Bacteria 2954
1007 Ga0501071_0006794 3300049587 Bacteria 7452
1008 Ga0501071_0462787 3300049587 Bacteria 971
1009 Ga0501071_0745146 3300049587 Bacteria 755
1010 Ga0501072_1048843 3300049588 Bacteria 635
1011 Ga0501073_0017148 3300049589 Bacteria 5245
1012 Ga0501073_0027588 3300049589 Bacteria 4060
1013 Ga0501074_0000066 3300049590 Bacteria 50258
1014 Ga0501074_0025835 3300049590 Bacteria 4261
1015 Ga0501074_0037426 3300049590 Bacteria 3517
1016 Ga0501074_0781597 3300049590 Bacteria 673
1017 Ga0501075_0029046 3300049591 Bacteria 4087
1018 Ga0501076_0011562 3300049592 Bacteria 6582
1019 Ga0501077_0022301 3300049593 Bacteria 4010
1020 Ga0501079_0387449 3300049741 Bacteria 1096
1021 Ga0501080_0000667 3300049742 Bacteria 27300
1022 Ga0501080_0002747 3300049742 Bacteria 15450
1023 Ga0501080_0053345 3300049742 Bacteria 3763
1024 Ga0501081_0218907 3300049743 Bacteria 1384
1025 Ga0501083_0000012 3300049744 Bacteria 178668
1026 Ga0501083_0053745 3300049744 Bacteria 2704
1027 Ga0501083_0284373 3300049744 Bacteria 1076
1028 Ga0501035_0000073 3300049822 Bacteria 122603
1029 Ga0501035_0000806 3300049822 Bacteria 33416
1030 Ga0501035_0004991 3300049822 Bacteria 12570
1031 Ga0501035_0012174 3300049822 Bacteria 7956
1032 Ga0501044_0000118 3300049823 Bacteria 95218
1033 Ga0501044_0063285 3300049823 Bacteria 3780
1034 Ga0501044_0084403 3300049823 Bacteria 3210
1035 Ga0501044_0101385 3300049823 Bacteria 2896
1036 Ga0501045_0008186 3300049824 Bacteria 7281
1037 nmdc:mga03n38_1260_c1 3300050490 Bacteria 7117
1038 nmdc:mga03n38_313483_c1 3300050490 Bacteria 845
1039 nmdc:mga00v17_36886_c1 3300050491 Bacteria 2916
1040 nmdc:mga00v17_505748_c1 3300050491 Bacteria 783
1041 nmdc:mga0yw44_42149_c1 3300050492 Bacteria 2721
1042 nmdc:mga0k408_92180_c1 3300050493 Bacteria 1780
1043 nmdc:mga06z11_105767_c1 3300050494 Bacteria 1551
1044 nmdc:mga06z11_185807_c1 3300050494 Bacteria 1201
1045 nmdc:mga06z11_2201_c1 3300050494 Bacteria 7403
1046 nmdc:mga06z11_82275_c1 3300050494 Bacteria 1730
1047 nmdc:mga04h51_90062_c1 3300050495 Bacteria 1103
1048 nmdc:mga07m45_135581_c1 3300050496 Bacteria 1425
1049 nmdc:mga07m45_14332_c1 3300050496 Bacteria 4221
1050 nmdc:mga05p37_16785_c1 3300050507 Bacteria 8826
1051 nmdc:mga08y16_263276_c1 3300050511 Bacteria 1780
1052 nmdc:mga08y16_514553_c1 3300050511 Bacteria 1215
1053 nmdc:mga08y16_792478_c1 3300050511 Bacteria 941
1054 nmdc:mga0n895_54520_c1 3300050512 Bacteria 3933
1055 nmdc:mga0n895_574276_c1 3300050512 Bacteria 1132
1056 nmdc:mga0rr50_30428_c1 3300050513 Bacteria 3822
1057 nmdc:mga0rr50_400664_c1 3300050513 Bacteria 1159
1058 nmdc:mga0rr50_84036_c1 3300050513 Bacteria 2463
1059 nmdc:mga08x19_385_c1 3300050514 Bacteria 31031
1060 nmdc:mga08x19_567685_c1 3300050514 Bacteria 803
1061 nmdc:mga08x19_78001_c1 3300050514 Bacteria 2170
1062 nmdc:mga0a205_59017_c1 3300050515 Bacteria 3706
1063 nmdc:mga0sz30_276759_c1 3300050516 Bacteria 748
1064 Ga0495601_0006582 3300053077 Bacteria 6795
1065 Ga0495601_0042864 3300053077 Bacteria 2841
1066 Ga0495601_0052397 3300053077 Bacteria 2576
1067 Ga0495601_0243152 3300053077 Bacteria 1175
1068 Ga0495601_0622022 3300053077 Unclassified 692
1069 Ga0495601_0729729 3300053077 Bacteria 631
1070 Ga0495612_0008895 3300053078 Bacteria 4069
1071 Ga0495612_0021744 3300053078 Bacteria 2573
1072 Ga0495595_0015072 3300053084 Bacteria 3291
1073 Ga0495595_0022370 3300053084 Bacteria 2775
1074 Ga0495595_0118598 3300053084 Bacteria 1288
1075 Ga0495595_0335813 3300053084 Bacteria 762
1076 Ga0495619_0001498 3300053085 Bacteria 15394
1077 Ga0495619_0003381 3300053085 Bacteria 10311
1078 Ga0495619_0015555 3300053085 Bacteria 4814
1079 Ga0495619_0057783 3300053085 Bacteria 2574
1080 Ga0500578_0099973 3300053086 Bacteria 1836
1081 Ga0500643_020438 3300053087 Bacteria 2165
1082 Ga0500644_0129367 3300053088 Bacteria 992
1083 Ga0500581_350604 3300053089 Bacteria 559
1084 Ga0500646_0012929 3300053090 Bacteria 2159
1085 Ga0500583_0128116 3300053092 Bacteria 1258
1086 Ga0500651_0131840 3300053093 Bacteria 1511
1087 Ga0500641_0014666 3300053096 Bacteria 2894
1088 Ga0500641_0040818 3300053096 Bacteria 1875
1089 Ga0500650_0003179 3300053098 Bacteria 5640
1090 Ga0500555_010336 3300053103 Bacteria 2675
1091 Ga0500556_0000015 3300053104 Bacteria 202598
1092 Ga0500562_021012 3300053108 Bacteria 1695
1093 Ga0500569_002523 3300053109 Bacteria 3621
1094 Ga0500569_113399 3300053109 Bacteria 898
1095 Ga0500592_002541 3300053116 Bacteria 2929
1096 Ga0500594_0007830 3300053118 Bacteria 2422
1097 Ga0500618_030349 3300053125 Bacteria 1272
1098 Ga0500642_0069549 3300053130 Bacteria 1599
1099 Ga0500652_000308 3300053131 Bacteria 17703
1100 Ga0500655_032263 3300053133 Bacteria 1011
1101 Ga0500658_0043021 3300053134 Bacteria 1817
1102 Ga0500658_0162204 3300053134 Bacteria 1012
1103 Ga0500559_0027141 3300053136 Bacteria 2443
1104 Ga0500561_0098936 3300053137 Bacteria 872
1105 Ga0500568_0001108 3300053139 Bacteria 18102
1106 Ga0500568_0002973 3300053139 Bacteria 9699
1107 Ga0500588_0026501 3300053146 Bacteria 1622
1108 Ga0500589_144075 3300053147 Bacteria 978
1109 Ga0500603_264010 3300053150 Bacteria 555
1110 Ga0500604_0001327 3300053151 Bacteria 6881
1111 Ga0500616_0000041 3300053153 Bacteria 359328
1112 Ga0500622_0002439 3300053156 Bacteria 13426
1113 Ga0500627_0027269 3300053158 Bacteria 2363
1114 Ga0500633_0164550 3300053160 Bacteria 832
1115 Ga0500636_0006978 3300053177 Bacteria 6512
1116 Ga0500637_0324071 3300053178 Bacteria 831
1117 Ga0500570_068096 3300053724 Bacteria 1678
1118 Ga0500611_020368 3300053727 Bacteria 1251
1119 Ga0500645_049728 3300053730 Bacteria 1225
1120 Ga0500645_141472 3300053730 Bacteria 665
1121 Ga0500645_172834 3300053730 Bacteria 590
1122 Ga0500656_064851 3300053732 Bacteria 554
1123 Ga0501084_0256827 3300054114 Bacteria 1475
1124 Ga0501084_0305024 3300054114 Bacteria 1345
1125 Ga0590075_102911 3300059424 Bacteria 744
1126 Ga0587073_0070410 3300059492 Bacteria 844
1127 Ga0587073_0089077 3300059492 Bacteria 781
1128 Ga0587073_0147584 3300059492 Bacteria 662
1129 Ga0587073_0183640 3300059492 Bacteria 616
1130 Ga0587077_090800 3300059493 Bacteria 718
1131 Ga0587080_064058 3300059503 Bacteria 722
1132 Ga0587082_073584 3300059504 Bacteria 699
1133 Ga0587082_084638 3300059504 Bacteria 667
1134 Ga0587088_137651 3300059508 Bacteria 580
1135 Ga0587129_011806 3300059608 Bacteria 691
1136 Ga0587072_094761 3300059643 Bacteria 662
1137 Ga0501082_0043509 3300060353 Bacteria 3872
1138 Ga0501082_0169930 3300060353 Bacteria 1895
1139 Ga0501082_1428585 3300060353 Bacteria 604
1140 Ga0530510_0080336 3300061734 Bacteria 2373

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10005784 Ga0207645_1000578410 151
2 3300046501 Ga0495607_0455181 Ga0495607_0455181_21_497 151
3 3300046689 Ga0495613_0819128 Ga0495613_0819128_20_496 151
4 3300010375 Ga0105239_10091468 Ga0105239_100914685 155
5 3300005578 Ga0068854_101707607 Ga0068854_1017076071 156
6 3300001979 JGI24740J21852_10024470 JGI24740J21852_100244702 157
7 3300001989 JGI24739J22299_10007360 JGI24739J22299_100073602 157
8 3300001990 JGI24737J22298_10008541 JGI24737J22298_100085414 157
9 3300002067 JGI24735J21928_10013907 JGI24735J21928_100139072 157
10 3300005455 Ga0070663_100113623 Ga0070663_1001136234 157
11 3300005455 Ga0070663_100420146 Ga0070663_1004201461 157
12 3300005457 Ga0070662_101063909 Ga0070662_1010639091 157
13 3300005539 Ga0068853_100039011 Ga0068853_1000390113 157
14 3300005539 Ga0068853_100130476 Ga0068853_1001304761 157
15 3300005563 Ga0068855_100110751 Ga0068855_1001107512 157
16 3300005564 Ga0070664_100481716 Ga0070664_1004817162 157
17 3300005577 Ga0068857_100020850 Ga0068857_1000208503 157
18 3300005578 Ga0068854_100006791 Ga0068854_1000067914 157
19 3300005578 Ga0068854_100006800 Ga0068854_1000068002 157
20 3300005614 Ga0068856_100028283 Ga0068856_1000282832 157
21 3300005616 Ga0068852_100391373 Ga0068852_1003913732 157
22 3300005834 Ga0068851_10009198 Ga0068851_100091984 157
23 3300009093 Ga0105240_10030730 Ga0105240_100307304 157
24 3300009093 Ga0105240_10196998 Ga0105240_101969982 157
25 3300009174 Ga0105241_10066421 Ga0105241_100664212 157
26 3300009174 Ga0105241_10406303 Ga0105241_104063031 157
27 3300009545 Ga0105237_10317584 Ga0105237_103175842 157
28 3300009551 Ga0105238_10035982 Ga0105238_100359823 157
29 3300009551 Ga0105238_10049838 Ga0105238_100498383 157
30 3300010375 Ga0105239_10152572 Ga0105239_101525721 157
31 3300025904 Ga0207647_10005519 Ga0207647_100055194 157
32 3300025911 Ga0207654_10002142 Ga0207654_100021428 157
33 3300025913 Ga0207695_10015064 Ga0207695_100150643 157
34 3300025914 Ga0207671_10008930 Ga0207671_100089308 157
35 3300025914 Ga0207671_10716188 Ga0207671_107161881 157
36 3300025924 Ga0207694_10000275 Ga0207694_1000027526 157
37 3300025933 Ga0207706_10186103 Ga0207706_101861031 157
38 3300025949 Ga0207667_10061756 Ga0207667_100617562 157
39 3300025981 Ga0207640_10062060 Ga0207640_100620601 157
40 3300026041 Ga0207639_10056687 Ga0207639_100566873 157
41 3300026041 Ga0207639_10126168 Ga0207639_101261681 157
42 3300026067 Ga0207678_10047593 Ga0207678_100475932 157
43 3300026078 Ga0207702_10000026 Ga0207702_10000026183 157
44 3300026078 Ga0207702_10122685 Ga0207702_101226854 157
45 3300026116 Ga0207674_10010326 Ga0207674_100103269 157
46 3300026116 Ga0207674_10011498 Ga0207674_100114984 157
47 3300026142 Ga0207698_10726318 Ga0207698_107263182 157
48 3300001977 JGI24746J21847_1021252 JGI24746J21847_10212521 161
49 3300001978 JGI24747J21853_1042903 JGI24747J21853_10429031 161
50 3300001990 JGI24737J22298_10126944 JGI24737J22298_101269441 161
51 3300001991 JGI24743J22301_10050615 JGI24743J22301_100506151 161
52 3300002070 JGI24750J21931_1036810 JGI24750J21931_10368101 161
53 3300002076 JGI24749J21850_1023924 JGI24749J21850_10239241 161
54 3300002077 JGI24744J21845_10067843 JGI24744J21845_100678431 161
55 3300002155 JGI24033J26618_1025586 JGI24033J26618_10255861 161
56 3300002239 JGI24034J26672_10035091 JGI24034J26672_100350911 161
57 3300002244 JGI24742J22300_10042532 JGI24742J22300_100425321 161
58 3300002244 JGI24742J22300_10059722 JGI24742J22300_100597221 161
59 3300002459 JGI24751J29686_10018533 JGI24751J29686_100185332 161
60 3300003308 Ga0006777J48905_1012696 Ga0006777J48905_10126961 161
61 3300003693 Ga0032354_1012960 Ga0032354_10129601 161
62 3300004801 Ga0058860_12115543 Ga0058860_121155431 161
63 3300005327 Ga0070658_10719580 Ga0070658_107195801 161
64 3300005331 Ga0070670_100131914 Ga0070670_1001319142 161
65 3300005334 Ga0068869_100313946 Ga0068869_1003139463 161
66 3300005335 Ga0070666_10316492 Ga0070666_103164922 161
67 3300005338 Ga0068868_100147810 Ga0068868_1001478102 161
68 3300005339 Ga0070660_100834516 Ga0070660_1008345162 161
69 3300005344 Ga0070661_100024323 Ga0070661_1000243231 161
70 3300005345 Ga0070692_10548936 Ga0070692_105489362 161
71 3300005347 Ga0070668_100248629 Ga0070668_1002486291 161
72 3300005353 Ga0070669_100335643 Ga0070669_1003356431 161
73 3300005355 Ga0070671_100063284 Ga0070671_1000632843 161
74 3300005356 Ga0070674_100068947 Ga0070674_1000689471 161
75 3300005364 Ga0070673_100169492 Ga0070673_1001694922 161
76 3300005365 Ga0070688_100130134 Ga0070688_1001301342 161
77 3300005366 Ga0070659_100123679 Ga0070659_1001236792 161
78 3300005367 Ga0070667_100291770 Ga0070667_1002917701 161
79 3300005438 Ga0070701_10182050 Ga0070701_101820502 161
80 3300005441 Ga0070700_100258660 Ga0070700_1002586602 161
81 3300005444 Ga0070694_100299584 Ga0070694_1002995842 161
82 3300005456 Ga0070678_100418545 Ga0070678_1004185451 161
83 3300005456 Ga0070678_100855993 Ga0070678_1008559931 161
84 3300005457 Ga0070662_100084041 Ga0070662_1000840415 161
85 3300005539 Ga0068853_100767883 Ga0068853_1007678831 161
86 3300005543 Ga0070672_100586816 Ga0070672_1005868161 161
87 3300005544 Ga0070686_100050014 Ga0070686_1000500141 161
88 3300005545 Ga0070695_100315310 Ga0070695_1003153102 161
89 3300005548 Ga0070665_100053521 Ga0070665_1000535213 161
90 3300005563 Ga0068855_100337368 Ga0068855_1003373682 161
91 3300005577 Ga0068857_100334791 Ga0068857_1003347913 161
92 3300005614 Ga0068856_100411333 Ga0068856_1004113332 161
93 3300005615 Ga0070702_100104963 Ga0070702_1001049632 161
94 3300005617 Ga0068859_100117890 Ga0068859_1001178901 161
95 3300005618 Ga0068864_100064661 Ga0068864_1000646614 161
96 3300005834 Ga0068851_10147229 Ga0068851_101472291 161
97 3300005840 Ga0068870_10049659 Ga0068870_100496593 161
98 3300005841 Ga0068863_100020353 Ga0068863_1000203538 161
99 3300005842 Ga0068858_100249886 Ga0068858_1002498863 161
100 3300005843 Ga0068860_100067286 Ga0068860_1000672862 161
101 3300005844 Ga0068862_100889847 Ga0068862_1008898471 161
102 3300006028 Ga0070717_10207693 Ga0070717_102076934 161
103 3300006038 Ga0075365_10262762 Ga0075365_102627622 161
104 3300006051 Ga0075364_10136743 Ga0075364_101367433 161
105 3300006237 Ga0097621_100074213 Ga0097621_1000742134 161
106 3300006358 Ga0068871_100104255 Ga0068871_1001042552 161
107 3300006847 Ga0075431_100465897 Ga0075431_1004658971 161
108 3300006931 Ga0097620_100117884 Ga0097620_1001178841 161
109 3300009011 Ga0105251_10313106 Ga0105251_103131061 161
110 3300009036 Ga0105244_10088248 Ga0105244_100882483 161
111 3300009101 Ga0105247_10095694 Ga0105247_100956942 161
112 3300009147 Ga0114129_10037544 Ga0114129_100375444 161
113 3300009148 Ga0105243_10076785 Ga0105243_100767854 161
114 3300009176 Ga0105242_10322965 Ga0105242_103229652 161
115 3300009177 Ga0105248_10061998 Ga0105248_100619984 161
116 3300009545 Ga0105237_10176281 Ga0105237_101762811 161
117 3300009551 Ga0105238_10347316 Ga0105238_103473161 161
118 3300009553 Ga0105249_10092015 Ga0105249_100920153 161
119 3300011119 Ga0105246_10547708 Ga0105246_105477082 161
120 3300013297 Ga0157378_10074128 Ga0157378_100741281 161
121 3300014325 Ga0163163_11988878 Ga0163163_119888781 161
122 3300014745 Ga0157377_10048477 Ga0157377_100484773 161
123 3300014969 Ga0157376_10267523 Ga0157376_102675232 161
124 3300020080 Ga0206350_10365195 Ga0206350_103651951 161
125 3300020082 Ga0206353_10883923 Ga0206353_108839231 161
126 3300022467 Ga0224712_10295154 Ga0224712_102951541 161
127 3300025321 Ga0207656_10126512 Ga0207656_101265122 161
128 3300025899 Ga0207642_10230011 Ga0207642_102300112 161
129 3300025901 Ga0207688_10000896 Ga0207688_100008969 161
130 3300025903 Ga0207680_10601969 Ga0207680_106019691 161
131 3300025904 Ga0207647_10086076 Ga0207647_100860762 161
132 3300025908 Ga0207643_10005864 Ga0207643_100058647 161
133 3300025909 Ga0207705_10690578 Ga0207705_106905781 161
134 3300025914 Ga0207671_10223604 Ga0207671_102236041 161
135 3300025915 Ga0207693_10037124 Ga0207693_100371242 161
136 3300025918 Ga0207662_10006236 Ga0207662_100062367 161
137 3300025919 Ga0207657_10042348 Ga0207657_100423484 161
138 3300025920 Ga0207649_10037057 Ga0207649_100370572 161
139 3300025924 Ga0207694_10128284 Ga0207694_101282842 161
140 3300025925 Ga0207650_10179565 Ga0207650_101795651 161
141 3300025926 Ga0207659_10524947 Ga0207659_105249471 161
142 3300025927 Ga0207687_10300546 Ga0207687_103005463 161
143 3300025928 Ga0207700_10135523 Ga0207700_101355232 161
144 3300025931 Ga0207644_10746250 Ga0207644_107462501 161
145 3300025933 Ga0207706_10007357 Ga0207706_1000735711 161
146 3300025935 Ga0207709_10560673 Ga0207709_105606731 161
147 3300025936 Ga0207670_10228092 Ga0207670_102280922 161
148 3300025937 Ga0207669_10983171 Ga0207669_109831711 161
149 3300025940 Ga0207691_10016710 Ga0207691_100167108 161
150 3300025941 Ga0207711_10028906 Ga0207711_100289062 161
151 3300025942 Ga0207689_10002364 Ga0207689_1000236415 161
152 3300025944 Ga0207661_10968211 Ga0207661_109682111 161
153 3300025960 Ga0207651_10357019 Ga0207651_103570193 161
154 3300025961 Ga0207712_10434904 Ga0207712_104349042 161
155 3300025981 Ga0207640_10148236 Ga0207640_101482362 161
156 3300025986 Ga0207658_10134836 Ga0207658_101348361 161
157 3300026035 Ga0207703_10351960 Ga0207703_103519601 161
158 3300026075 Ga0207708_10001706 Ga0207708_1000170611 161
159 3300026088 Ga0207641_10152237 Ga0207641_101522371 161
160 3300026089 Ga0207648_10001075 Ga0207648_1000107512 161
161 3300026095 Ga0207676_11575435 Ga0207676_115754351 161
162 3300026116 Ga0207674_10095357 Ga0207674_100953572 161
163 3300026118 Ga0207675_100078028 Ga0207675_1000780284 161
164 3300026121 Ga0207683_10231562 Ga0207683_102315621 161
165 3300026121 Ga0207683_11079303 Ga0207683_110793031 161
166 3300026142 Ga0207698_10502536 Ga0207698_105025362 161
167 3300027907 Ga0207428_10557741 Ga0207428_105577411 161
168 3300028379 Ga0268266_10270862 Ga0268266_102708622 161
169 3300028380 Ga0268265_10227273 Ga0268265_102272733 161
170 3300028381 Ga0268264_10583177 Ga0268264_105831772 161
171 3300035691 Ga0373931_0199953 Ga0373931_0199953_584_1090 161
172 3300035692 Ga0373935_0399675 Ga0373935_0399675_92_598 161
173 3300037068 Ga0373925_0268518 Ga0373925_0268518_149_655 161
174 3300046513 Ga0495616_0312848 Ga0495616_0312848_97_603 161
175 3300046683 Ga0495658_0444063 Ga0495658_0444063_98_604 161
176 3300048903 Ga0496100_0100720 Ga0496100_0100720_657_1163 161
177 3300048905 Ga0496102_0032922 Ga0496102_0032922_382_888 161
178 3300048906 Ga0496103_0071414 Ga0496103_0071414_835_1341 161
179 3300048908 Ga0496105_0162145 Ga0496105_0162145_1070_1576 161
180 3300048909 Ga0496106_0029877 Ga0496106_0029877_582_1088 161
181 3300048910 Ga0496107_0473597 Ga0496107_0473597_155_661 161
182 3300048911 Ga0496108_0005621 Ga0496108_0005621_2439_2945 161
183 3300048912 Ga0496109_0328581 Ga0496109_0328581_812_1318 161
184 3300048913 Ga0496110_0065588 Ga0496110_0065588_1904_2410 161
185 3300048914 Ga0496111_0219840 Ga0496111_0219840_750_1256 161
186 3300048916 Ga0496113_0030783 Ga0496113_0030783_2909_3415 161
187 3300048917 Ga0496114_0060904 Ga0496114_0060904_1682_2188 161
188 3300048917 Ga0496114_0333238 Ga0496114_0333238_462_968 161
189 3300048918 Ga0496115_0033633 Ga0496115_0033633_138_644 161
190 3300048918 Ga0496115_0214364 Ga0496115_0214364_130_636 161
191 3300050490 nmdc:mga03n38_313483_c1 nmdc:mga03n38_313483_c1_240_746 161
192 3300050491 nmdc:mga00v17_505748_c1 nmdc:mga00v17_505748_c1_262_768 161
193 3300050494 nmdc:mga06z11_82275_c1 nmdc:mga06z11_82275_c1_954_1460 161
194 3300050507 nmdc:mga05p37_16785_c1 nmdc:mga05p37_16785_c1_5632_6138 161
195 3300053077 Ga0495601_0042864 Ga0495601_0042864_582_1088 161
196 3300053084 Ga0495595_0335813 Ga0495595_0335813_26_532 161
197 3300020069 Ga0197907_11501374 Ga0197907_115013741 162
198 3300020075 Ga0206349_1463205 Ga0206349_14632051 162
199 3300022467 Ga0224712_10511958 Ga0224712_105119581 162
200 3300046537 Ga0495598_0067460 Ga0495598_0067460_141_632 162
201 3300005719 Ga0068861_100101152 Ga0068861_1001011522 163
202 iso_pu_bacteria 2513237098 2513673199 163
203 iso_pu_bacteria 2513237101 2513695404 163
204 iso_pu_bacteria 2602042107 2603860801 163
205 iso_pu_bacteria 2643221651 2644289600 163
206 iso_pu_bacteria 2738541281 2738744710 163
207 iso_pu_bacteria 2738543032 2739353940 163
208 iso_pu_bacteria 2857524615 2857524756 163
209 iso_pu_bacteria 2874604998 2874612225 163
210 iso_pu_bacteria 2889033259 2889042007 163
211 iso_pu_bacteria 2893066018 2893069277 163
212 iso_pu_bacteria 2902405164 2902411331 163
213 iso_pu_bacteria 2919073203 2919078640 163
214 iso_pu_bacteria 2922386360 2922386792 163
215 iso_pu_bacteria 8006964411 8006964993 163
216 iso_pu_bacteria 8006984368 8006988641 163
217 3300035114 Ga0373939_0327484 Ga0373939_0327484_102_602 165
218 3300020080 Ga0206350_10388215 Ga0206350_103882151 166
219 3300041491 Ga0451833_1205776 Ga0451833_1205776_16_516 166
220 2162886007 SwRhRL2b_contig_3951670 SwRhRL2b_0721.00001740 167
221 3300003203 JGI25406J46586_10002904 JGI25406J46586_100029042 167
222 3300003308 Ga0006777J48905_1040219 Ga0006777J48905_10402191 167
223 3300003308 Ga0006777J48905_1058774 Ga0006777J48905_10587741 167
224 3300003568 Ga0006781J51513_1035190 Ga0006781J51513_10351901 167
225 3300003574 Ga0007410J51695_1043051 Ga0007410J51695_10430511 167
226 3300003575 Ga0007409J51694_1088714 Ga0007409J51694_10887141 167
227 3300003579 Ga0007429J51699_1021511 Ga0007429J51699_10215111 167
228 3300003579 Ga0007429J51699_1059805 Ga0007429J51699_10598051 167
229 3300003659 JGI25404J52841_10022797 JGI25404J52841_100227971 167
230 3300003659 JGI25404J52841_10033517 JGI25404J52841_100335172 167
231 3300003693 Ga0032354_1047272 Ga0032354_10472721 167
232 3300003693 Ga0032354_1052366 Ga0032354_10523661 167
233 3300003735 Ga0006780_1021799 Ga0006780_10217991 167
234 3300004799 Ga0058863_11574013 Ga0058863_115740131 167
235 3300004801 Ga0058860_12149836 Ga0058860_121498361 167
236 3300005293 Ga0065715_10500263 Ga0065715_105002631 167
237 3300005295 Ga0065707_10331906 Ga0065707_103319061 167
238 3300005327 Ga0070658_10122009 Ga0070658_101220092 167
239 3300005328 Ga0070676_10214685 Ga0070676_102146852 167
240 3300005329 Ga0070683_100116918 Ga0070683_1001169182 167
241 3300005329 Ga0070683_100186787 Ga0070683_1001867872 167
242 3300005330 Ga0070690_100312075 Ga0070690_1003120751 167
243 3300005331 Ga0070670_100036037 Ga0070670_1000360375 167
244 3300005331 Ga0070670_101179141 Ga0070670_1011791411 167
245 3300005334 Ga0068869_100143438 Ga0068869_1001434383 167
246 3300005334 Ga0068869_100177601 Ga0068869_1001776012 167
247 3300005335 Ga0070666_10091734 Ga0070666_100917341 167
248 3300005336 Ga0070680_100013974 Ga0070680_1000139743 167
249 3300005337 Ga0070682_100068797 Ga0070682_1000687972 167
250 3300005337 Ga0070682_100095633 Ga0070682_1000956332 167
251 3300005337 Ga0070682_100479432 Ga0070682_1004794322 167
252 3300005338 Ga0068868_100725833 Ga0068868_1007258331 167
253 3300005338 Ga0068868_100968955 Ga0068868_1009689552 167
254 3300005339 Ga0070660_100235492 Ga0070660_1002354922 167
255 3300005339 Ga0070660_100278994 Ga0070660_1002789942 167
256 3300005339 Ga0070660_100857848 Ga0070660_1008578481 167
257 3300005340 Ga0070689_100032271 Ga0070689_1000322713 167
258 3300005341 Ga0070691_10075852 Ga0070691_100758522 167
259 3300005343 Ga0070687_100237656 Ga0070687_1002376562 167
260 3300005344 Ga0070661_100214230 Ga0070661_1002142302 167
261 3300005344 Ga0070661_100598004 Ga0070661_1005980042 167
262 3300005347 Ga0070668_100217633 Ga0070668_1002176332 167
263 3300005347 Ga0070668_100275195 Ga0070668_1002751952 167
264 3300005353 Ga0070669_100129738 Ga0070669_1001297383 167
265 3300005355 Ga0070671_100172520 Ga0070671_1001725202 167
266 3300005355 Ga0070671_101044787 Ga0070671_1010447871 167
267 3300005356 Ga0070674_100654750 Ga0070674_1006547501 167
268 3300005364 Ga0070673_100474346 Ga0070673_1004743461 167
269 3300005364 Ga0070673_100737795 Ga0070673_1007377951 167
270 3300005365 Ga0070688_100199709 Ga0070688_1001997092 167
271 3300005366 Ga0070659_100044581 Ga0070659_1000445813 167
272 3300005366 Ga0070659_100224555 Ga0070659_1002245551 167
273 3300005366 Ga0070659_100299217 Ga0070659_1002992171 167
274 3300005366 Ga0070659_100666840 Ga0070659_1006668401 167
275 3300005366 Ga0070659_101470739 Ga0070659_1014707391 167
276 3300005367 Ga0070667_100042228 Ga0070667_1000422282 167
277 3300005367 Ga0070667_100461147 Ga0070667_1004611471 167
278 3300005406 Ga0070703_10168139 Ga0070703_101681391 167
279 3300005406 Ga0070703_10207770 Ga0070703_102077701 167
280 3300005434 Ga0070709_10001015 Ga0070709_100010155 167
281 3300005435 Ga0070714_100008787 Ga0070714_1000087875 167
282 3300005435 Ga0070714_100160074 Ga0070714_1001600742 167
283 3300005435 Ga0070714_101523020 Ga0070714_1015230201 167
284 3300005436 Ga0070713_100002311 Ga0070713_1000023114 167
285 3300005436 Ga0070713_100102531 Ga0070713_1001025314 167
286 3300005436 Ga0070713_100504541 Ga0070713_1005045412 167
287 3300005437 Ga0070710_10013948 Ga0070710_100139482 167
288 3300005437 Ga0070710_10446128 Ga0070710_104461281 167
289 3300005437 Ga0070710_10557628 Ga0070710_105576281 167
290 3300005438 Ga0070701_10170254 Ga0070701_101702542 167
291 3300005439 Ga0070711_100147022 Ga0070711_1001470222 167
292 3300005439 Ga0070711_100184808 Ga0070711_1001848082 167
293 3300005440 Ga0070705_100354370 Ga0070705_1003543702 167
294 3300005440 Ga0070705_100414755 Ga0070705_1004147552 167
295 3300005441 Ga0070700_100014021 Ga0070700_1000140213 167
296 3300005441 Ga0070700_100959397 Ga0070700_1009593971 167
297 3300005444 Ga0070694_100085125 Ga0070694_1000851253 167
298 3300005444 Ga0070694_100153679 Ga0070694_1001536792 167
299 3300005444 Ga0070694_100502318 Ga0070694_1005023182 167
300 3300005455 Ga0070663_100008060 Ga0070663_1000080602 167
301 3300005455 Ga0070663_100086075 Ga0070663_1000860752 167
302 3300005455 Ga0070663_100159559 Ga0070663_1001595592 167
303 3300005455 Ga0070663_100182877 Ga0070663_1001828772 167
304 3300005455 Ga0070663_100773989 Ga0070663_1007739891 167
305 3300005455 Ga0070663_100809046 Ga0070663_1008090461 167
306 3300005456 Ga0070678_100135175 Ga0070678_1001351751 167
307 3300005457 Ga0070662_100054508 Ga0070662_1000545083 167
308 3300005457 Ga0070662_100057011 Ga0070662_1000570111 167
309 3300005457 Ga0070662_100230727 Ga0070662_1002307272 167
310 3300005458 Ga0070681_10013083 Ga0070681_100130833 167
311 3300005458 Ga0070681_10070681 Ga0070681_100706812 167
312 3300005466 Ga0070685_10251199 Ga0070685_102511991 167
313 3300005471 Ga0070698_100053016 Ga0070698_1000530162 167
314 3300005530 Ga0070679_100126829 Ga0070679_1001268293 167
315 3300005530 Ga0070679_100267934 Ga0070679_1002679342 167
316 3300005530 Ga0070679_100652430 Ga0070679_1006524302 167
317 3300005530 Ga0070679_100754742 Ga0070679_1007547422 167
318 3300005535 Ga0070684_100092938 Ga0070684_1000929383 167
319 3300005535 Ga0070684_100626745 Ga0070684_1006267451 167
320 3300005536 Ga0070697_100064835 Ga0070697_1000648351 167
321 3300005539 Ga0068853_100004957 Ga0068853_1000049573 167
322 3300005539 Ga0068853_100663727 Ga0068853_1006637271 167
323 3300005544 Ga0070686_100404916 Ga0070686_1004049162 167
324 3300005544 Ga0070686_100665765 Ga0070686_1006657652 167
325 3300005545 Ga0070695_100042844 Ga0070695_1000428441 167
326 3300005546 Ga0070696_100000971 Ga0070696_1000009711 167
327 3300005546 Ga0070696_100044480 Ga0070696_1000444803 167
328 3300005546 Ga0070696_100246081 Ga0070696_1002460812 167
329 3300005547 Ga0070693_100017592 Ga0070693_1000175922 167
330 3300005547 Ga0070693_100987912 Ga0070693_1009879121 167
331 3300005547 Ga0070693_100988161 Ga0070693_1009881611 167
332 3300005548 Ga0070665_100003902 Ga0070665_1000039023 167
333 3300005548 Ga0070665_100113980 Ga0070665_1001139802 167
334 3300005548 Ga0070665_100546810 Ga0070665_1005468102 167
335 3300005548 Ga0070665_100550745 Ga0070665_1005507452 167
336 3300005548 Ga0070665_100891149 Ga0070665_1008911491 167
337 3300005549 Ga0070704_100181227 Ga0070704_1001812271 167
338 3300005549 Ga0070704_100238813 Ga0070704_1002388131 167
339 3300005563 Ga0068855_100075381 Ga0068855_1000753813 167
340 3300005563 Ga0068855_100227171 Ga0068855_1002271712 167
341 3300005563 Ga0068855_100272230 Ga0068855_1002722302 167
342 3300005564 Ga0070664_100351050 Ga0070664_1003510503 167
343 3300005578 Ga0068854_101698589 Ga0068854_1016985891 167
344 3300005614 Ga0068856_100000363 Ga0068856_10000036321 167
345 3300005614 Ga0068856_100154754 Ga0068856_1001547542 167
346 3300005615 Ga0070702_100003979 Ga0070702_1000039794 167
347 3300005616 Ga0068852_100005807 Ga0068852_1000058077 167
348 3300005617 Ga0068859_100224959 Ga0068859_1002249592 167
349 3300005618 Ga0068864_100109309 Ga0068864_1001093092 167
350 3300005618 Ga0068864_101347514 Ga0068864_1013475141 167
351 3300005718 Ga0068866_10418506 Ga0068866_104185061 167
352 3300005719 Ga0068861_100028388 Ga0068861_1000283882 167
353 3300005719 Ga0068861_100152343 Ga0068861_1001523431 167
354 3300005834 Ga0068851_10034585 Ga0068851_100345852 167
355 3300005842 Ga0068858_100482037 Ga0068858_1004820372 167
356 3300005842 Ga0068858_101021531 Ga0068858_1010215312 167
357 3300005843 Ga0068860_100061571 Ga0068860_1000615713 167
358 3300005843 Ga0068860_101207093 Ga0068860_1012070931 167
359 3300005844 Ga0068862_100131627 Ga0068862_1001316272 167
360 3300005937 Ga0081455_10000633 Ga0081455_100006339 167
361 3300005937 Ga0081455_10045282 Ga0081455_100452823 167
362 3300005983 Ga0081540_1001350 Ga0081540_10013507 167
363 3300005983 Ga0081540_1005948 Ga0081540_10059481 167
364 3300005983 Ga0081540_1013070 Ga0081540_10130703 167
365 3300005983 Ga0081540_1023275 Ga0081540_10232752 167
366 3300005985 Ga0081539_10000864 Ga0081539_1000086439 167
367 3300005985 Ga0081539_10064473 Ga0081539_100644732 167
368 3300006028 Ga0070717_10008605 Ga0070717_100086054 167
369 3300006028 Ga0070717_10349425 Ga0070717_103494252 167
370 3300006038 Ga0075365_10007938 Ga0075365_100079382 167
371 3300006038 Ga0075365_10142814 Ga0075365_101428142 167
372 3300006038 Ga0075365_10600407 Ga0075365_106004071 167
373 3300006042 Ga0075368_10022861 Ga0075368_100228612 167
374 3300006048 Ga0075363_100001181 Ga0075363_1000011813 167
375 3300006051 Ga0075364_10025549 Ga0075364_100255492 167
376 3300006051 Ga0075364_10194511 Ga0075364_101945113 167
377 3300006173 Ga0070716_100019318 Ga0070716_1000193182 167
378 3300006175 Ga0070712_100006584 Ga0070712_1000065842 167
379 3300006177 Ga0075362_10020047 Ga0075362_100200472 167
380 3300006177 Ga0075362_10227062 Ga0075362_102270621 167
381 3300006177 Ga0075362_10246177 Ga0075362_102461771 167
382 3300006178 Ga0075367_10001700 Ga0075367_100017007 167
383 3300006178 Ga0075367_10017229 Ga0075367_100172293 167
384 3300006178 Ga0075367_10065669 Ga0075367_100656692 167
385 3300006178 Ga0075367_10249851 Ga0075367_102498512 167
386 3300006186 Ga0075369_10091556 Ga0075369_100915562 167
387 3300006186 Ga0075369_10245394 Ga0075369_102453942 167
388 3300006195 Ga0075366_10845597 Ga0075366_108455971 167
389 3300006237 Ga0097621_100026518 Ga0097621_1000265183 167
390 3300006237 Ga0097621_100316295 Ga0097621_1003162952 167
391 3300006353 Ga0075370_10020128 Ga0075370_100201283 167
392 3300006353 Ga0075370_10028239 Ga0075370_100282392 167
393 3300006358 Ga0068871_100035821 Ga0068871_1000358211 167
394 3300006844 Ga0075428_100070086 Ga0075428_1000700863 167
395 3300006846 Ga0075430_100109997 Ga0075430_1001099973 167
396 3300006846 Ga0075430_100917106 Ga0075430_1009171061 167
397 3300006852 Ga0075433_10809127 Ga0075433_108091271 167
398 3300006852 Ga0075433_10833840 Ga0075433_108338401 167
399 3300006871 Ga0075434_100044641 Ga0075434_1000446414 167
400 3300006871 Ga0075434_100125713 Ga0075434_1001257132 167
401 3300006871 Ga0075434_100510301 Ga0075434_1005103011 167
402 3300006881 Ga0068865_100001775 Ga0068865_1000017759 167
403 3300006914 Ga0075436_100005858 Ga0075436_1000058583 167
404 3300006914 Ga0075436_100692290 Ga0075436_1006922901 167
405 3300006914 Ga0075436_101191223 Ga0075436_1011912231 167
406 3300006931 Ga0097620_100224948 Ga0097620_1002249482 167
407 3300007076 Ga0075435_100073638 Ga0075435_1000736382 167
408 3300007076 Ga0075435_100111808 Ga0075435_1001118082 167
409 3300007076 Ga0075435_100468897 Ga0075435_1004688972 167
410 3300007265 Ga0099794_10381339 Ga0099794_103813391 167
411 3300007788 Ga0099795_10021043 Ga0099795_100210432 167
412 3300007788 Ga0099795_10030236 Ga0099795_100302362 167
413 3300007788 Ga0099795_10048728 Ga0099795_100487282 167
414 3300009011 Ga0105251_10097573 Ga0105251_100975732 167
415 3300009092 Ga0105250_10030865 Ga0105250_100308652 167
416 3300009092 Ga0105250_10046623 Ga0105250_100466232 167
417 3300009093 Ga0105240_10016715 Ga0105240_100167159 167
418 3300009093 Ga0105240_12090505 Ga0105240_120905051 167
419 3300009094 Ga0111539_10315761 Ga0111539_103157612 167
420 3300009094 Ga0111539_10663958 Ga0111539_106639582 167
421 3300009098 Ga0105245_10312564 Ga0105245_103125642 167
422 3300009098 Ga0105245_10359871 Ga0105245_103598711 167
423 3300009098 Ga0105245_10530627 Ga0105245_105306272 167
424 3300009098 Ga0105245_10791723 Ga0105245_107917231 167
425 3300009098 Ga0105245_10968353 Ga0105245_109683531 167
426 3300009147 Ga0114129_10784305 Ga0114129_107843051 167
427 3300009148 Ga0105243_10319515 Ga0105243_103195151 167
428 3300009148 Ga0105243_10501399 Ga0105243_105013992 167
429 3300009174 Ga0105241_10070808 Ga0105241_100708082 167
430 3300009174 Ga0105241_10493630 Ga0105241_104936301 167
431 3300009176 Ga0105242_10022368 Ga0105242_100223682 167
432 3300009177 Ga0105248_10272244 Ga0105248_102722441 167
433 3300009545 Ga0105237_10040252 Ga0105237_100402524 167
434 3300009545 Ga0105237_10396831 Ga0105237_103968312 167
435 3300009551 Ga0105238_10012175 Ga0105238_100121756 167
436 3300009551 Ga0105238_10102283 Ga0105238_101022832 167
437 3300009551 Ga0105238_10264456 Ga0105238_102644562 167
438 3300009553 Ga0105249_10074945 Ga0105249_100749452 167
439 3300009553 Ga0105249_10133651 Ga0105249_101336511 167
440 3300010159 Ga0099796_10061656 Ga0099796_100616562 167
441 3300010375 Ga0105239_10153070 Ga0105239_101530702 167
442 3300010375 Ga0105239_10428627 Ga0105239_104286271 167
443 3300010375 Ga0105239_10560225 Ga0105239_105602251 167
444 3300010375 Ga0105239_10644628 Ga0105239_106446282 167
445 3300010375 Ga0105239_11920494 Ga0105239_119204941 167
446 3300011119 Ga0105246_10095430 Ga0105246_100954302 167
447 3300011119 Ga0105246_10581741 Ga0105246_105817411 167
448 3300012476 Ga0157344_1004409 Ga0157344_10044091 167
449 3300012513 Ga0157326_1003126 Ga0157326_10031262 167
450 3300013100 Ga0157373_10585099 Ga0157373_105850991 167
451 3300013100 Ga0157373_10730117 Ga0157373_107301172 167
452 3300013104 Ga0157370_10158045 Ga0157370_101580452 167
453 3300013104 Ga0157370_10538178 Ga0157370_105381782 167
454 3300013104 Ga0157370_10810914 Ga0157370_108109142 167
455 3300013296 Ga0157374_10510630 Ga0157374_105106302 167
456 3300013297 Ga0157378_10077086 Ga0157378_100770863 167
457 3300013297 Ga0157378_10367816 Ga0157378_103678162 167
458 3300013297 Ga0157378_10661797 Ga0157378_106617972 167
459 3300013306 Ga0163162_10010007 Ga0163162_100100076 167
460 3300013306 Ga0163162_10321503 Ga0163162_103215032 167
461 3300013306 Ga0163162_10394122 Ga0163162_103941221 167
462 3300013307 Ga0157372_10218610 Ga0157372_102186102 167
463 3300013307 Ga0157372_10855203 Ga0157372_108552032 167
464 3300013308 Ga0157375_10724238 Ga0157375_107242381 167
465 3300014325 Ga0163163_10064503 Ga0163163_100645031 167
466 3300014325 Ga0163163_10075022 Ga0163163_100750222 167
467 3300014326 Ga0157380_10186461 Ga0157380_101864611 167
468 3300014326 Ga0157380_10215780 Ga0157380_102157802 167
469 3300014326 Ga0157380_10426265 Ga0157380_104262652 167
470 3300014326 Ga0157380_12527629 Ga0157380_125276291 167
471 3300014969 Ga0157376_10188927 Ga0157376_101889272 167
472 3300014969 Ga0157376_11224350 Ga0157376_112243501 167
473 3300017792 Ga0163161_10112438 Ga0163161_101124382 167
474 3300020069 Ga0197907_10889824 Ga0197907_108898241 167
475 3300020069 Ga0197907_11053528 Ga0197907_110535281 167
476 3300020070 Ga0206356_10247621 Ga0206356_102476211 167
477 3300020070 Ga0206356_10594276 Ga0206356_105942761 167
478 3300020070 Ga0206356_11474439 Ga0206356_114744391 167
479 3300020070 Ga0206356_11572529 Ga0206356_115725291 167
480 3300020070 Ga0206356_11733153 Ga0206356_117331531 167
481 3300020070 Ga0206356_11743097 Ga0206356_117430971 167
482 3300020070 Ga0206356_11836906 Ga0206356_118369061 167
483 3300020075 Ga0206349_1020691 Ga0206349_10206911 167
484 3300020075 Ga0206349_1186858 Ga0206349_11868581 167
485 3300020075 Ga0206349_1197767 Ga0206349_11977671 167
486 3300020075 Ga0206349_1262994 Ga0206349_12629942 167
487 3300020075 Ga0206349_1946070 Ga0206349_19460701 167
488 3300020076 Ga0206355_1093692 Ga0206355_10936921 167
489 3300020076 Ga0206355_1113466 Ga0206355_11134661 167
490 3300020076 Ga0206355_1164344 Ga0206355_11643442 167
491 3300020076 Ga0206355_1358260 Ga0206355_13582601 167
492 3300020076 Ga0206355_1367435 Ga0206355_13674351 167
493 3300020077 Ga0206351_10032476 Ga0206351_100324761 167
494 3300020077 Ga0206351_10751612 Ga0206351_107516121 167
495 3300020078 Ga0206352_10138666 Ga0206352_101386661 167
496 3300020080 Ga0206350_10122239 Ga0206350_101222391 167
497 3300020080 Ga0206350_10511773 Ga0206350_105117731 167
498 3300020080 Ga0206350_10646272 Ga0206350_106462722 167
499 3300020080 Ga0206350_10677610 Ga0206350_106776101 167
500 3300020080 Ga0206350_10924274 Ga0206350_109242741 167
501 3300020080 Ga0206350_11081022 Ga0206350_110810221 167
502 3300020080 Ga0206350_11355059 Ga0206350_113550591 167
503 3300020081 Ga0206354_10089617 Ga0206354_100896172 167
504 3300020081 Ga0206354_11086759 Ga0206354_110867591 167
505 3300020081 Ga0206354_11428798 Ga0206354_114287981 167
506 3300020082 Ga0206353_10116796 Ga0206353_101167962 167
507 3300020082 Ga0206353_10362445 Ga0206353_103624451 167
508 3300020082 Ga0206353_10411745 Ga0206353_104117451 167
509 3300020082 Ga0206353_10504062 Ga0206353_105040621 167
510 3300020082 Ga0206353_11374616 Ga0206353_113746161 167
511 3300020082 Ga0206353_11504878 Ga0206353_115048781 167
512 3300020082 Ga0206353_11657362 Ga0206353_116573621 167
513 3300020610 Ga0154015_1321397 Ga0154015_13213971 167
514 3300022467 Ga0224712_10182083 Ga0224712_101820832 167
515 3300022467 Ga0224712_10278123 Ga0224712_102781232 167
516 3300022467 Ga0224712_10304103 Ga0224712_103041031 167
517 3300022467 Ga0224712_10305207 Ga0224712_103052071 167
518 3300022467 Ga0224712_10448592 Ga0224712_104485921 167
519 3300022467 Ga0224712_10488207 Ga0224712_104882071 167
520 3300022467 Ga0224712_10494070 Ga0224712_104940701 167
521 3300023552 Ga0247551_102201 Ga0247551_1022011 167
522 3300023684 Ga0247523_112525 Ga0247523_1125251 167
523 3300025272 Ga0209455_1002093 Ga0209455_10020936 167
524 3300025297 Ga0209758_1008352 Ga0209758_10083523 167
525 3300025302 Ga0207426_1075567 Ga0207426_10755671 167
526 3300025321 Ga0207656_10163908 Ga0207656_101639081 167
527 3300025735 Ga0207713_1073333 Ga0207713_10733332 167
528 3300025885 Ga0207653_10007478 Ga0207653_100074781 167
529 3300025885 Ga0207653_10039302 Ga0207653_100393022 167
530 3300025898 Ga0207692_10027517 Ga0207692_100275172 167
531 3300025899 Ga0207642_10081749 Ga0207642_100817492 167
532 3300025900 Ga0207710_10011489 Ga0207710_100114892 167
533 3300025903 Ga0207680_10009686 Ga0207680_100096862 167
534 3300025904 Ga0207647_10091272 Ga0207647_100912721 167
535 3300025906 Ga0207699_10000463 Ga0207699_100004639 167
536 3300025906 Ga0207699_10107996 Ga0207699_101079961 167
537 3300025907 Ga0207645_10227158 Ga0207645_102271581 167
538 3300025907 Ga0207645_10336316 Ga0207645_103363161 167
539 3300025909 Ga0207705_10109530 Ga0207705_101095302 167
540 3300025909 Ga0207705_10177512 Ga0207705_101775122 167
541 3300025910 Ga0207684_11024328 Ga0207684_110243281 167
542 3300025911 Ga0207654_10126759 Ga0207654_101267592 167
543 3300025911 Ga0207654_10156278 Ga0207654_101562782 167
544 3300025911 Ga0207654_10550951 Ga0207654_105509511 167
545 3300025912 Ga0207707_10014498 Ga0207707_100144985 167
546 3300025912 Ga0207707_10024561 Ga0207707_100245615 167
547 3300025913 Ga0207695_10056580 Ga0207695_100565806 167
548 3300025914 Ga0207671_10073879 Ga0207671_100738791 167
549 3300025914 Ga0207671_10170843 Ga0207671_101708434 167
550 3300025914 Ga0207671_10968571 Ga0207671_109685711 167
551 3300025915 Ga0207693_10000640 Ga0207693_100006409 167
552 3300025915 Ga0207693_10070055 Ga0207693_100700554 167
553 3300025916 Ga0207663_10373124 Ga0207663_103731242 167
554 3300025916 Ga0207663_11025368 Ga0207663_110253682 167
555 3300025919 Ga0207657_10006779 Ga0207657_100067792 167
556 3300025919 Ga0207657_10386797 Ga0207657_103867971 167
557 3300025920 Ga0207649_10073668 Ga0207649_100736682 167
558 3300025921 Ga0207652_10014385 Ga0207652_100143852 167
559 3300025921 Ga0207652_10227920 Ga0207652_102279202 167
560 3300025924 Ga0207694_10151091 Ga0207694_101510912 167
561 3300025926 Ga0207659_10779263 Ga0207659_107792631 167
562 3300025927 Ga0207687_10074887 Ga0207687_100748872 167
563 3300025928 Ga0207700_10981429 Ga0207700_109814291 167
564 3300025929 Ga0207664_10163043 Ga0207664_101630432 167
565 3300025929 Ga0207664_10332650 Ga0207664_103326502 167
566 3300025929 Ga0207664_11066688 Ga0207664_110666881 167
567 3300025931 Ga0207644_10026008 Ga0207644_100260082 167
568 3300025931 Ga0207644_10065213 Ga0207644_100652132 167
569 3300025932 Ga0207690_10099075 Ga0207690_100990752 167
570 3300025932 Ga0207690_10224525 Ga0207690_102245252 167
571 3300025933 Ga0207706_10059285 Ga0207706_100592853 167
572 3300025933 Ga0207706_10067153 Ga0207706_100671533 167
573 3300025933 Ga0207706_10482924 Ga0207706_104829242 167
574 3300025934 Ga0207686_10074963 Ga0207686_100749631 167
575 3300025934 Ga0207686_10247460 Ga0207686_102474602 167
576 3300025935 Ga0207709_10139546 Ga0207709_101395461 167
577 3300025935 Ga0207709_10569188 Ga0207709_105691881 167
578 3300025936 Ga0207670_10186147 Ga0207670_101861472 167
579 3300025937 Ga0207669_10529931 Ga0207669_105299311 167
580 3300025938 Ga0207704_10004344 Ga0207704_100043444 167
581 3300025939 Ga0207665_10001240 Ga0207665_100012404 167
582 3300025940 Ga0207691_10037607 Ga0207691_100376073 167
583 3300025941 Ga0207711_10030859 Ga0207711_100308591 167
584 3300025941 Ga0207711_10815829 Ga0207711_108158291 167
585 3300025942 Ga0207689_10424621 Ga0207689_104246212 167
586 3300025942 Ga0207689_10572682 Ga0207689_105726822 167
587 3300025944 Ga0207661_10055213 Ga0207661_100552132 167
588 3300025944 Ga0207661_10127093 Ga0207661_101270932 167
589 3300025945 Ga0207679_11108163 Ga0207679_111081631 167
590 3300025960 Ga0207651_10421006 Ga0207651_104210062 167
591 3300025960 Ga0207651_10782063 Ga0207651_107820631 167
592 3300025972 Ga0207668_10023778 Ga0207668_100237783 167
593 3300025972 Ga0207668_10125228 Ga0207668_101252282 167
594 3300025972 Ga0207668_10281391 Ga0207668_102813911 167
595 3300025986 Ga0207658_10028993 Ga0207658_100289932 167
596 3300026023 Ga0207677_11102657 Ga0207677_111026572 167
597 3300026035 Ga0207703_10205828 Ga0207703_102058282 167
598 3300026035 Ga0207703_10393125 Ga0207703_103931252 167
599 3300026067 Ga0207678_10013706 Ga0207678_100137062 167
600 3300026067 Ga0207678_10043711 Ga0207678_100437112 167
601 3300026067 Ga0207678_10094228 Ga0207678_100942282 167
602 3300026067 Ga0207678_10143127 Ga0207678_101431272 167
603 3300026067 Ga0207678_10368890 Ga0207678_103688902 167
604 3300026067 Ga0207678_10396695 Ga0207678_103966952 167
605 3300026067 Ga0207678_10459519 Ga0207678_104595192 167
606 3300026067 Ga0207678_11083551 Ga0207678_110835511 167
607 3300026078 Ga0207702_10000261 Ga0207702_1000026165 167
608 3300026078 Ga0207702_10018370 Ga0207702_100183702 167
609 3300026078 Ga0207702_10189685 Ga0207702_101896852 167
610 3300026088 Ga0207641_11075545 Ga0207641_110755452 167
611 3300026089 Ga0207648_10918263 Ga0207648_109182631 167
612 3300026095 Ga0207676_10144444 Ga0207676_101444442 167
613 3300026095 Ga0207676_10557049 Ga0207676_105570491 167
614 3300026118 Ga0207675_100019330 Ga0207675_1000193305 167
615 3300026118 Ga0207675_100075468 Ga0207675_1000754683 167
616 3300026118 Ga0207675_100459020 Ga0207675_1004590202 167
617 3300026121 Ga0207683_10005431 Ga0207683_100054312 167
618 3300026121 Ga0207683_10529706 Ga0207683_105297061 167
619 3300026142 Ga0207698_10935451 Ga0207698_109354511 167
620 3300027671 Ga0209588_1076492 Ga0209588_10764922 167
621 3300027866 Ga0209813_10075398 Ga0209813_100753981 167
622 3300027907 Ga0207428_10039794 Ga0207428_100397944 167
623 3300028379 Ga0268266_10061845 Ga0268266_100618453 167
624 3300028379 Ga0268266_10089000 Ga0268266_100890002 167
625 3300028379 Ga0268266_10091874 Ga0268266_100918742 167
626 3300028379 Ga0268266_10615691 Ga0268266_106156911 167
627 3300028379 Ga0268266_10757559 Ga0268266_107575592 167
628 3300028380 Ga0268265_10054641 Ga0268265_100546412 167
629 3300028380 Ga0268265_10220268 Ga0268265_102202682 167
630 3300028381 Ga0268264_10328562 Ga0268264_103285621 167
631 3300028381 Ga0268264_10424356 Ga0268264_104243561 167
632 3300028794 Ga0307515_10163003 Ga0307515_101630033 167
633 3300028794 Ga0307515_10419659 Ga0307515_104196591 167
634 3300030863 Ga0265766_1015316 Ga0265766_10153161 167
635 3300031239 Ga0265328_10244845 Ga0265328_102448451 167
636 3300031241 Ga0265325_10001626 Ga0265325_1000162612 167
637 3300031241 Ga0265325_10011302 Ga0265325_100113024 167
638 3300031249 Ga0265339_10005018 Ga0265339_100050187 167
639 3300031456 Ga0307513_10154734 Ga0307513_101547342 167
640 3300031456 Ga0307513_10445618 Ga0307513_104456181 167
641 3300031507 Ga0307509_10508846 Ga0307509_105088461 167
642 3300031507 Ga0307509_10577547 Ga0307509_105775471 167
643 3300031548 Ga0307408_100421690 Ga0307408_1004216901 167
644 3300031548 Ga0307408_100536846 Ga0307408_1005368461 167
645 3300031592 Ga0310117_124297 Ga0310117_1242971 167
646 3300031595 Ga0265313_10004507 Ga0265313_100045077 167
647 3300031595 Ga0265313_10030909 Ga0265313_100309092 167
648 3300031595 Ga0265313_10054763 Ga0265313_100547633 167
649 3300031616 Ga0307508_10146318 Ga0307508_101463182 167
650 3300031712 Ga0265342_10059304 Ga0265342_100593042 167
651 3300031828 Ga0316043_127489 Ga0316043_1274891 167
652 3300031901 Ga0307406_10316115 Ga0307406_103161152 167
653 3300032002 Ga0307416_100168750 Ga0307416_1001687501 167
654 3300032126 Ga0307415_100036591 Ga0307415_1000365911 167
655 3300033179 Ga0307507_10213161 Ga0307507_102131611 167
656 3300033180 Ga0307510_10062648 Ga0307510_100626482 167
657 3300033180 Ga0307510_10440666 Ga0307510_104406661 167
658 3300034817 Ga0373948_0008489 Ga0373948_0008489_521_1024 167
659 3300034819 Ga0373958_0001587 Ga0373958_0001587_988_1491 167
660 3300035083 Ga0373926_0005541 Ga0373926_0005541_2071_2574 167
661 3300035086 Ga0373934_0054317 Ga0373934_0054317_895_1398 167
662 3300035089 Ga0373944_0000364 Ga0373944_0000364_7273_7776 167
663 3300035089 Ga0373944_0010085 Ga0373944_0010085_93_596 167
664 3300035089 Ga0373944_0097139 Ga0373944_0097139_417_920 167
665 3300035090 Ga0373949_0021242 Ga0373949_0021242_41_544 167
666 3300035091 Ga0373951_0023092 Ga0373951_0023092_329_832 167
667 3300035091 Ga0373951_0112944 Ga0373951_0112944_17_586 167
668 3300035111 Ga0373923_0005611 Ga0373923_0005611_2402_2905 167
669 3300035111 Ga0373923_0009594 Ga0373923_0009594_1609_2115 167
670 3300035111 Ga0373923_0183843 Ga0373923_0183843_407_910 167
671 3300035113 Ga0373936_0008721 Ga0373936_0008721_1698_2201 167
672 3300035113 Ga0373936_0081898 Ga0373936_0081898_749_1255 167
673 3300035114 Ga0373939_0133078 Ga0373939_0133078_194_697 167
674 3300035115 Ga0373941_0013347 Ga0373941_0013347_752_1255 167
675 3300035116 Ga0373945_0000604 Ga0373945_0000604_8448_8951 167
676 3300035116 Ga0373945_0013010 Ga0373945_0013010_10_561 167
677 3300035116 Ga0373945_0066848 Ga0373945_0066848_720_1223 167
678 3300035117 Ga0373953_0031765 Ga0373953_0031765_458_964 167
679 3300035117 Ga0373953_0038873 Ga0373953_0038873_263_766 167
680 3300035118 Ga0373954_0011230 Ga0373954_0011230_2383_2886 167
681 3300035118 Ga0373954_0048759 Ga0373954_0048759_798_1304 167
682 3300035119 Ga0373956_0084357 Ga0373956_0084357_74_580 167
683 3300035119 Ga0373956_0381736 Ga0373956_0381736_31_537 167
684 3300035120 Ga0373957_0003340 Ga0373957_0003340_3039_3545 167
685 3300035120 Ga0373957_0062844 Ga0373957_0062844_440_943 167
686 3300035170 Ga0373943_0006934 Ga0373943_0006934_4485_4988 167
687 3300035170 Ga0373943_0031393 Ga0373943_0031393_1767_2270 167
688 3300035171 Ga0373946_0029874 Ga0373946_0029874_952_1455 167
689 3300035171 Ga0373946_0033120 Ga0373946_0033120_538_1041 167
690 3300035172 Ga0373955_0002404 Ga0373955_0002404_1654_2160 167
691 3300035172 Ga0373955_0007268 Ga0373955_0007268_2154_2657 167
692 3300035172 Ga0373955_0114546 Ga0373955_0114546_198_701 167
693 3300035241 Ga0373961_0002416 Ga0373961_0002416_1745_2248 167
694 3300035242 Ga0373962_0112365 Ga0373962_0112365_236_739 167
695 3300035410 Ga0373924_0006081 Ga0373924_0006081_1811_2314 167
696 3300035410 Ga0373924_0006172 Ga0373924_0006172_3639_4145 167
697 3300035691 Ga0373931_0096660 Ga0373931_0096660_408_914 167
698 3300035692 Ga0373935_0013235 Ga0373935_0013235_2015_2518 167
699 3300035692 Ga0373935_0465733 Ga0373935_0465733_394_897 167
700 3300035692 Ga0373935_0800384 Ga0373935_0800384_174_680 167
701 3300035695 Ga0373927_0001118 Ga0373927_0001118_8306_8809 167
702 3300035695 Ga0373927_0011708 Ga0373927_0011708_1063_1566 167
703 3300035695 Ga0373927_0014273 Ga0373927_0014273_3810_4313 167
704 3300035724 Ga0373933_0011886 Ga0373933_0011886_1964_2470 167
705 3300035724 Ga0373933_0088546 Ga0373933_0088546_965_1468 167
706 3300035725 Ga0373947_0000372 Ga0373947_0000372_1851_2354 167
707 3300035725 Ga0373947_0017773 Ga0373947_0017773_3178_3681 167
708 3300035725 Ga0373947_0026529 Ga0373947_0026529_1698_2201 167
709 3300036401 Ga0373937_0030143 Ga0373937_0030143_2916_3419 167
710 3300036401 Ga0373937_0101470 Ga0373937_0101470_697_1203 167
711 3300036401 Ga0373937_0106945 Ga0373937_0106945_1185_1691 167
712 3300036401 Ga0373937_0114684 Ga0373937_0114684_887_1390 167
713 3300036401 Ga0373937_0995412 Ga0373937_0995412_147_653 167
714 3300036534 Ga0310109_046298 Ga0310109_046298_21_527 167
715 3300037068 Ga0373925_0006079 Ga0373925_0006079_2274_2777 167
716 3300037068 Ga0373925_0035309 Ga0373925_0035309_1463_1966 167
717 3300037068 Ga0373925_0043061 Ga0373925_0043061_996_1499 167
718 3300037068 Ga0373925_0263159 Ga0373925_0263159_583_1089 167
719 3300037471 Ga0395905_0217267 Ga0395905_0217267_1238_1744 167
720 3300037471 Ga0395905_0314542 Ga0395905_0314542_288_896 167
721 3300039438 Ga0436360_0599366 Ga0436360_0599366_1758_2264 167
722 3300039438 Ga0436360_0645480 Ga0436360_0645480_415_918 167
723 3300039450 Ga0436363_1293311 Ga0436363_1293311_694_1200 167
724 3300039453 Ga0436362_1029460 Ga0436362_1029460_1285_1788 167
725 3300041410 Ga0439461_0128559 Ga0439461_0128559_92_598 167
726 3300041460 Ga0451802_0955069 Ga0451802_0955069_121_627 167
727 3300041512 Ga0451853_3246118 Ga0451853_3246118_10_513 167
728 3300044684 Ga0466966_0005575 Ga0466966_0005575_6903_7406 167
729 3300044684 Ga0466966_0252929 Ga0466966_0252929_239_745 167
730 3300044694 Ga0466963_0038531 Ga0466963_0038531_600_1106 167
731 3300044694 Ga0466963_0955214 Ga0466963_0955214_61_564 167
732 3300044735 Ga0466968_0005113 Ga0466968_0005113_373_876 167
733 3300045049 Ga0466959_0010598 Ga0466959_0010598_4804_5307 167
734 3300045049 Ga0466959_0329301 Ga0466959_0329301_442_948 167
735 3300045049 Ga0466959_0444672 Ga0466959_0444672_297_803 167
736 3300045976 Ga0466967_0021546 Ga0466967_0021546_3465_3971 167
737 3300046453 Ga0495627_103522 Ga0495627_103522_57_563 167
738 3300046454 Ga0495592_0001055 Ga0495592_0001055_6088_6594 167
739 3300046454 Ga0495592_0010832 Ga0495592_0010832_5863_6366 167
740 3300046455 Ga0495603_0014865 Ga0495603_0014865_4108_4614 167
741 3300046455 Ga0495603_0024400 Ga0495603_0024400_611_1117 167
742 3300046455 Ga0495603_0026152 Ga0495603_0026152_137_640 167
743 3300046455 Ga0495603_0223293 Ga0495603_0223293_291_797 167
744 3300046457 Ga0495590_0030522 Ga0495590_0030522_1330_1836 167
745 3300046459 Ga0495629_0003357 Ga0495629_0003357_1895_2398 167
746 3300046459 Ga0495629_0019076 Ga0495629_0019076_3537_4040 167
747 3300046459 Ga0495629_0112714 Ga0495629_0112714_690_1196 167
748 3300046459 Ga0495629_0177175 Ga0495629_0177175_338_841 167
749 3300046460 Ga0495638_0105696 Ga0495638_0105696_31_537 167
750 3300046460 Ga0495638_0127089 Ga0495638_0127089_669_1175 167
751 3300046461 Ga0495641_0012702 Ga0495641_0012702_2498_3001 167
752 3300046462 Ga0495651_0009559 Ga0495651_0009559_4935_5438 167
753 3300046462 Ga0495651_0039188 Ga0495651_0039188_2962_3465 167
754 3300046462 Ga0495651_0055997 Ga0495651_0055997_1786_2292 167
755 3300046462 Ga0495651_0099648 Ga0495651_0099648_751_1257 167
756 3300046463 Ga0495653_0008585 Ga0495653_0008585_723_1226 167
757 3300046463 Ga0495653_0017321 Ga0495653_0017321_1833_2339 167
758 3300046463 Ga0495653_0267673 Ga0495653_0267673_609_1112 167
759 3300046472 Ga0495580_0013690 Ga0495580_0013690_3865_4368 167
760 3300046472 Ga0495580_0222805 Ga0495580_0222805_180_683 167
761 3300046473 Ga0495582_0011471 Ga0495582_0011471_1470_1973 167
762 3300046473 Ga0495582_0031598 Ga0495582_0031598_824_1327 167
763 3300046475 Ga0495639_0004110 Ga0495639_0004110_1699_2202 167
764 3300046476 Ga0495662_0003064 Ga0495662_0003064_5889_6392 167
765 3300046476 Ga0495662_0362007 Ga0495662_0362007_10_516 167
766 3300046477 Ga0495664_0008779 Ga0495664_0008779_2065_2568 167
767 3300046477 Ga0495664_0269855 Ga0495664_0269855_40_546 167
768 3300046491 Ga0495584_0034642 Ga0495584_0034642_1659_2165 167
769 3300046492 Ga0495585_0056846 Ga0495585_0056846_848_1354 167
770 3300046499 Ga0495594_0005321 Ga0495594_0005321_3058_3561 167
771 3300046499 Ga0495594_0143479 Ga0495594_0143479_295_801 167
772 3300046501 Ga0495607_0044310 Ga0495607_0044310_880_1383 167
773 3300046506 Ga0495583_0042395 Ga0495583_0042395_486_992 167
774 3300046507 Ga0495606_0055888 Ga0495606_0055888_1549_2055 167
775 3300046511 Ga0495608_0033105 Ga0495608_0033105_681_1187 167
776 3300046512 Ga0495610_0044346 Ga0495610_0044346_342_848 167
777 3300046513 Ga0495616_0035528 Ga0495616_0035528_1153_1659 167
778 3300046513 Ga0495616_0113607 Ga0495616_0113607_399_905 167
779 3300046514 Ga0495618_0002517 Ga0495618_0002517_61_612 167
780 3300046514 Ga0495618_0045723 Ga0495618_0045723_2009_2512 167
781 3300046514 Ga0495618_0722148 Ga0495618_0722148_25_531 167
782 3300046516 Ga0495628_0087042 Ga0495628_0087042_1178_1684 167
783 3300046516 Ga0495628_0087330 Ga0495628_0087330_43_549 167
784 3300046516 Ga0495628_0348576 Ga0495628_0348576_471_974 167
785 3300046517 Ga0495630_0017717 Ga0495630_0017717_2881_3384 167
786 3300046517 Ga0495630_0025849 Ga0495630_0025849_123_626 167
787 3300046518 Ga0495631_0109239 Ga0495631_0109239_230_736 167
788 3300046518 Ga0495631_0199360 Ga0495631_0199360_78_581 167
789 3300046519 Ga0495632_0021367 Ga0495632_0021367_898_1404 167
790 3300046520 Ga0495637_0033862 Ga0495637_0033862_857_1363 167
791 3300046522 Ga0495643_0206760 Ga0495643_0206760_390_896 167
792 3300046523 Ga0495644_0002732 Ga0495644_0002732_2568_3071 167
793 3300046525 Ga0495663_0046978 Ga0495663_0046978_581_1087 167
794 3300046526 Ga0495666_0006077 Ga0495666_0006077_1598_2101 167
795 3300046526 Ga0495666_0020392 Ga0495666_0020392_976_1479 167
796 3300046526 Ga0495666_0152763 Ga0495666_0152763_486_992 167
797 3300046529 Ga0495652_0108337 Ga0495652_0108337_1268_1774 167
798 3300046529 Ga0495652_0145992 Ga0495652_0145992_38_541 167
799 3300046531 Ga0495665_0032754 Ga0495665_0032754_816_1319 167
800 3300046533 Ga0495640_0006867 Ga0495640_0006867_7270_7776 167
801 3300046533 Ga0495640_0051277 Ga0495640_0051277_1447_1950 167
802 3300046533 Ga0495640_0183560 Ga0495640_0183560_680_1183 167
803 3300046535 Ga0495586_0087335 Ga0495586_0087335_952_1455 167
804 3300046535 Ga0495586_0230257 Ga0495586_0230257_44_547 167
805 3300046536 Ga0495587_0026482 Ga0495587_0026482_469_972 167
806 3300046536 Ga0495587_0051328 Ga0495587_0051328_681_1187 167
807 3300046537 Ga0495598_0058368 Ga0495598_0058368_31_537 167
808 3300046538 Ga0495609_0033203 Ga0495609_0033203_1257_1760 167
809 3300046539 Ga0495621_0013532 Ga0495621_0013532_1389_1895 167
810 3300046542 Ga0495597_0092747 Ga0495597_0092747_730_1236 167
811 3300046557 Ga0495622_0006399 Ga0495622_0006399_584_1087 167
812 3300046558 Ga0495633_0009880 Ga0495633_0009880_2101_2604 167
813 3300046558 Ga0495633_0018095 Ga0495633_0018095_651_1157 167
814 3300046559 Ga0495667_0008737 Ga0495667_0008737_4666_5169 167
815 3300046559 Ga0495667_0020910 Ga0495667_0020910_1769_2275 167
816 3300046559 Ga0495667_0078258 Ga0495667_0078258_1609_2112 167
817 3300046559 Ga0495667_0106403 Ga0495667_0106403_42_548 167
818 3300046615 Ga0495656_0000064 Ga0495656_0000064_15355_15858 167
819 3300046615 Ga0495656_0046515 Ga0495656_0046515_159_665 167
820 3300046615 Ga0495656_0048334 Ga0495656_0048334_1006_1512 167
821 3300046616 Ga0495668_0025416 Ga0495668_0025416_2689_3285 167
822 3300046642 Ga0495634_0026538 Ga0495634_0026538_2896_3399 167
823 3300046642 Ga0495634_0047460 Ga0495634_0047460_2268_2771 167
824 3300046648 Ga0495611_0105572 Ga0495611_0105572_120_626 167
825 3300046648 Ga0495611_0124745 Ga0495611_0124745_357_860 167
826 3300046648 Ga0495611_0226481 Ga0495611_0226481_22_528 167
827 3300046660 Ga0495625_0006076 Ga0495625_0006076_9934_10530 167
828 3300046660 Ga0495625_0047212 Ga0495625_0047212_2273_2779 167
829 3300046660 Ga0495625_0658367 Ga0495625_0658367_77_583 167
830 3300046663 Ga0495635_0008796 Ga0495635_0008796_3591_4094 167
831 3300046663 Ga0495635_0037890 Ga0495635_0037890_266_769 167
832 3300046663 Ga0495635_0122079 Ga0495635_0122079_965_1468 167
833 3300046664 Ga0495659_0208813 Ga0495659_0208813_35_541 167
834 3300046665 Ga0495661_0036088 Ga0495661_0036088_712_1218 167
835 3300046665 Ga0495661_0150914 Ga0495661_0150914_458_964 167
836 3300046665 Ga0495661_0225380 Ga0495661_0225380_165_668 167
837 3300046674 Ga0495588_0011011 Ga0495588_0011011_1446_1949 167
838 3300046674 Ga0495588_0018681 Ga0495588_0018681_518_1024 167
839 3300046675 Ga0495657_0047604 Ga0495657_0047604_1641_2147 167
840 3300046675 Ga0495657_0106638 Ga0495657_0106638_617_1120 167
841 3300046675 Ga0495657_0202029 Ga0495657_0202029_94_600 167
842 3300046675 Ga0495657_0509451 Ga0495657_0509451_93_599 167
843 3300046678 Ga0495599_0021867 Ga0495599_0021867_979_1482 167
844 3300046678 Ga0495599_0043307 Ga0495599_0043307_2256_2762 167
845 3300046679 Ga0495623_0036443 Ga0495623_0036443_1393_1899 167
846 3300046679 Ga0495623_0248643 Ga0495623_0248643_350_856 167
847 3300046680 Ga0495646_0003336 Ga0495646_0003336_1942_2445 167
848 3300046681 Ga0495647_0015713 Ga0495647_0015713_2119_2622 167
849 3300046681 Ga0495647_0017786 Ga0495647_0017786_1767_2270 167
850 3300046683 Ga0495658_0001834 Ga0495658_0001834_8260_8763 167
851 3300046683 Ga0495658_0010431 Ga0495658_0010431_3458_3961 167
852 3300046683 Ga0495658_0311236 Ga0495658_0311236_110_613 167
853 3300046684 Ga0495669_0241913 Ga0495669_0241913_261_764 167
854 3300046684 Ga0495669_0266358 Ga0495669_0266358_139_645 167
855 3300046689 Ga0495613_0033299 Ga0495613_0033299_1560_2063 167
856 3300046689 Ga0495613_0102619 Ga0495613_0102619_1433_1939 167
857 3300046689 Ga0495613_0182144 Ga0495613_0182144_148_651 167
858 3300046690 Ga0495624_0005807 Ga0495624_0005807_3076_3579 167
859 3300046690 Ga0495624_0045904 Ga0495624_0045904_348_851 167
860 3300046691 Ga0495670_0090641 Ga0495670_0090641_521_1027 167
861 3300046692 Ga0495671_0013849 Ga0495671_0013849_1161_1667 167
862 3300046794 Ga0495589_0247988 Ga0495589_0247988_312_818 167
863 3300046809 Ga0495600_0000716 Ga0495600_0000716_14599_15105 167
864 3300046809 Ga0495600_0001994 Ga0495600_0001994_4364_4867 167
865 3300046809 Ga0495600_0181124 Ga0495600_0181124_424_927 167
866 3300046810 Ga0495660_0128889 Ga0495660_0128889_125_631 167
867 3300046810 Ga0495660_0343500 Ga0495660_0343500_76_582 167
868 3300047315 Ga0495581_0020045 Ga0495581_0020045_1485_1988 167
869 3300047315 Ga0495581_0072896 Ga0495581_0072896_1039_1542 167
870 3300047315 Ga0495581_0073317 Ga0495581_0073317_1367_1870 167
871 3300047317 Ga0495604_0025973 Ga0495604_0025973_1936_2439 167
872 3300047317 Ga0495604_0039798 Ga0495604_0039798_2256_2762 167
873 3300047317 Ga0495604_0054739 Ga0495604_0054739_1479_1982 167
874 3300047318 Ga0495636_0095471 Ga0495636_0095471_506_1012 167
875 3300047319 Ga0495674_0088487 Ga0495674_0088487_251_754 167
876 3300047319 Ga0495674_0345361 Ga0495674_0345361_127_630 167
877 3300047320 Ga0495672_0079076 Ga0495672_0079076_1304_1810 167
878 3300047321 Ga0495676_0030061 Ga0495676_0030061_2545_3048 167
879 3300047321 Ga0495676_0050140 Ga0495676_0050140_2259_2765 167
880 3300047321 Ga0495676_0052812 Ga0495676_0052812_575_1078 167
881 3300047321 Ga0495676_0346310 Ga0495676_0346310_87_590 167
882 3300047322 Ga0495680_0011117 Ga0495680_0011117_6704_7210 167
883 3300047322 Ga0495680_0014218 Ga0495680_0014218_251_754 167
884 3300047322 Ga0495680_0045137 Ga0495680_0045137_1947_2450 167
885 3300047322 Ga0495680_0301870 Ga0495680_0301870_242_745 167
886 3300047444 Ga0495675_0104372 Ga0495675_0104372_1005_1511 167
887 3300047444 Ga0495675_0154536 Ga0495675_0154536_275_778 167
888 3300047469 Ga0495673_0035535 Ga0495673_0035535_241_747 167
889 3300047471 Ga0495684_0003050 Ga0495684_0003050_1898_2401 167
890 3300047471 Ga0495684_0006284 Ga0495684_0006284_2909_3412 167
891 3300047471 Ga0495684_0022194 Ga0495684_0022194_1556_2062 167
892 3300047471 Ga0495684_0220457 Ga0495684_0220457_622_1125 167
893 3300047471 Ga0495684_0324079 Ga0495684_0324079_301_807 167
894 3300047471 Ga0495684_0332537 Ga0495684_0332537_144_647 167
895 3300047472 Ga0495686_0017077 Ga0495686_0017077_3857_4363 167
896 3300047472 Ga0495686_0223799 Ga0495686_0223799_349_855 167
897 3300047673 Ga0495593_0003538 Ga0495593_0003538_7283_7789 167
898 3300047673 Ga0495593_0003546 Ga0495593_0003546_4356_4859 167
899 3300047673 Ga0495593_0007526 Ga0495593_0007526_493_996 167
900 3300047673 Ga0495593_0029887 Ga0495593_0029887_1629_2132 167
901 3300047673 Ga0495593_0093302 Ga0495593_0093302_422_925 167
902 3300048088 Ga0495602_0086153 Ga0495602_0086153_2085_2588 167
903 3300048088 Ga0495602_0094544 Ga0495602_0094544_1294_1800 167
904 3300048088 Ga0495602_0215159 Ga0495602_0215159_651_1157 167
905 3300048088 Ga0495602_0237050 Ga0495602_0237050_719_1222 167
906 3300048088 Ga0495602_0271223 Ga0495602_0271223_40_546 167
907 3300048088 Ga0495602_0561486 Ga0495602_0561486_12_515 167
908 3300048089 Ga0495614_0012122 Ga0495614_0012122_693_1196 167
909 3300048091 Ga0495626_0086193 Ga0495626_0086193_774_1280 167
910 3300048091 Ga0495626_0260181 Ga0495626_0260181_148_654 167
911 3300048903 Ga0496100_0007837 Ga0496100_0007837_5227_5730 167
912 3300048904 Ga0496101_0138194 Ga0496101_0138194_729_1232 167
913 3300048904 Ga0496101_0266194 Ga0496101_0266194_20_526 167
914 3300048904 Ga0496101_0401158 Ga0496101_0401158_304_810 167
915 3300048905 Ga0496102_0041408 Ga0496102_0041408_1305_1811 167
916 3300048905 Ga0496102_0061565 Ga0496102_0061565_1196_1702 167
917 3300048905 Ga0496102_0123500 Ga0496102_0123500_932_1435 167
918 3300048905 Ga0496102_0131901 Ga0496102_0131901_567_1070 167
919 3300048905 Ga0496102_0362100 Ga0496102_0362100_296_799 167
920 3300048906 Ga0496103_0097141 Ga0496103_0097141_617_1123 167
921 3300048906 Ga0496103_0381642 Ga0496103_0381642_354_857 167
922 3300048907 Ga0496104_0008842 Ga0496104_0008842_6811_7317 167
923 3300048907 Ga0496104_0219238 Ga0496104_0219238_229_732 167
924 3300048907 Ga0496104_0926033 Ga0496104_0926033_88_594 167
925 3300048908 Ga0496105_0502104 Ga0496105_0502104_253_759 167
926 3300048908 Ga0496105_0585446 Ga0496105_0585446_119_622 167
927 3300048909 Ga0496106_0041002 Ga0496106_0041002_2744_3247 167
928 3300048909 Ga0496106_0097958 Ga0496106_0097958_966_1472 167
929 3300048910 Ga0496107_0138809 Ga0496107_0138809_1138_1641 167
930 3300048910 Ga0496107_1142889 Ga0496107_1142889_17_526 167
931 3300048911 Ga0496108_0181363 Ga0496108_0181363_883_1386 167
932 3300048912 Ga0496109_0076356 Ga0496109_0076356_567_1070 167
933 3300048912 Ga0496109_0315076 Ga0496109_0315076_279_785 167
934 3300048913 Ga0496110_0320163 Ga0496110_0320163_634_1137 167
935 3300048913 Ga0496110_0384154 Ga0496110_0384154_495_998 167
936 3300048913 Ga0496110_0430367 Ga0496110_0430367_215_721 167
937 3300048913 Ga0496110_0453250 Ga0496110_0453250_28_534 167
938 3300048914 Ga0496111_0048697 Ga0496111_0048697_283_789 167
939 3300048914 Ga0496111_0454743 Ga0496111_0454743_229_732 167
940 3300048915 Ga0496112_0006027 Ga0496112_0006027_8573_9079 167
941 3300048915 Ga0496112_0331113 Ga0496112_0331113_229_732 167
942 3300048915 Ga0496112_0406145 Ga0496112_0406145_564_1067 167
943 3300048915 Ga0496112_0776215 Ga0496112_0776215_347_853 167
944 3300048916 Ga0496113_0130337 Ga0496113_0130337_93_599 167
945 3300048916 Ga0496113_0149706 Ga0496113_0149706_1269_1772 167
946 3300048916 Ga0496113_0163115 Ga0496113_0163115_918_1421 167
947 3300048917 Ga0496114_0152579 Ga0496114_0152579_1363_1866 167
948 3300048917 Ga0496114_0208628 Ga0496114_0208628_308_814 167
949 3300048917 Ga0496114_0307910 Ga0496114_0307910_82_588 167
950 3300048918 Ga0496115_0046778 Ga0496115_0046778_2845_3351 167
951 3300048918 Ga0496115_0121803 Ga0496115_0121803_156_662 167
952 3300048918 Ga0496115_0215701 Ga0496115_0215701_617_1120 167
953 3300048918 Ga0496115_0231623 Ga0496115_0231623_825_1331 167
954 3300048918 Ga0496115_0353296 Ga0496115_0353296_150_653 167
955 3300048919 Ga0496116_0349539 Ga0496116_0349539_37_543 167
956 3300048920 Ga0496117_0202176 Ga0496117_0202176_513_1019 167
957 3300048921 Ga0496118_0059696 Ga0496118_0059696_2128_2634 167
958 3300048921 Ga0496118_0116918 Ga0496118_0116918_115_621 167
959 3300048921 Ga0496118_0224777 Ga0496118_0224777_370_873 167
960 3300048923 Ga0496120_0080935 Ga0496120_0080935_1106_1609 167
961 3300048923 Ga0496120_0131365 Ga0496120_0131365_406_912 167
962 3300048924 Ga0496121_0000300 Ga0496121_0000300_101185_101691 167
963 3300048924 Ga0496121_0026815 Ga0496121_0026815_3132_3653 167
964 3300048924 Ga0496121_0027734 Ga0496121_0027734_4204_4710 167
965 3300048924 Ga0496121_0041567 Ga0496121_0041567_1688_2194 167
966 3300048924 Ga0496121_0074274 Ga0496121_0074274_2191_2697 167
967 3300048924 Ga0496121_0179884 Ga0496121_0179884_468_974 167
968 3300048924 Ga0496121_0279163 Ga0496121_0279163_290_793 167
969 3300048924 Ga0496121_0592625 Ga0496121_0592625_156_662 167
970 3300048924 Ga0496121_0597692 Ga0496121_0597692_122_628 167
971 3300048925 Ga0496122_0010659 Ga0496122_0010659_2685_3188 167
972 3300048925 Ga0496122_0082401 Ga0496122_0082401_525_1031 167
973 3300048925 Ga0496122_0246162 Ga0496122_0246162_390_896 167
974 3300048926 Ga0496123_0072978 Ga0496123_0072978_60_563 167
975 3300048926 Ga0496123_0073217 Ga0496123_0073217_358_864 167
976 3300048926 Ga0496123_0181476 Ga0496123_0181476_212_718 167
977 3300048927 Ga0496124_0215824 Ga0496124_0215824_468_974 167
978 3300048927 Ga0496124_0305892 Ga0496124_0305892_121_624 167
979 3300048928 Ga0496125_0000063 Ga0496125_0000063_139237_139743 167
980 3300048928 Ga0496125_0057601 Ga0496125_0057601_2241_2747 167
981 3300048929 Ga0496126_0008064 Ga0496126_0008064_4311_4817 167
982 3300048929 Ga0496126_0008100 Ga0496126_0008100_5310_5843 167
983 3300048929 Ga0496126_0031081 Ga0496126_0031081_3513_4019 167
984 3300048929 Ga0496126_0099390 Ga0496126_0099390_227_733 167
985 3300048929 Ga0496126_0133791 Ga0496126_0133791_1570_2076 167
986 3300048929 Ga0496126_0139126 Ga0496126_0139126_407_913 167
987 3300048929 Ga0496126_0174394 Ga0496126_0174394_1197_1703 167
988 3300048929 Ga0496126_0254741 Ga0496126_0254741_664_1170 167
989 3300049568 Ga0501031_0502400 Ga0501031_0502400_57_560 167
990 3300049569 Ga0501032_0001391 Ga0501032_0001391_4163_4666 167
991 3300049570 Ga0501033_0000304 Ga0501033_0000304_32636_33139 167
992 3300049570 Ga0501033_0257829 Ga0501033_0257829_95_598 167
993 3300049571 Ga0501034_0028770 Ga0501034_0028770_3063_3566 167
994 3300049571 Ga0501034_0061482 Ga0501034_0061482_2517_3023 167
995 3300049572 Ga0501036_0093458 Ga0501036_0093458_1866_2369 167
996 3300049572 Ga0501036_0117424 Ga0501036_0117424_173_676 167
997 3300049573 Ga0501037_0000154 Ga0501037_0000154_38692_39195 167
998 3300049573 Ga0501037_0202150 Ga0501037_0202150_630_1133 167
999 3300049573 Ga0501037_0322494 Ga0501037_0322494_46_549 167
1000 3300049574 Ga0501038_0465060 Ga0501038_0465060_454_957 167
1001 3300049574 Ga0501038_0951447 Ga0501038_0951447_116_619 167
1002 3300049575 Ga0501039_0190507 Ga0501039_0190507_177_680 167
1003 3300049577 Ga0501041_0009638 Ga0501041_0009638_1948_2451 167
1004 3300049577 Ga0501041_0433754 Ga0501041_0433754_283_789 167
1005 3300049578 Ga0501042_0027891 Ga0501042_0027891_2463_2966 167
1006 3300049579 Ga0501043_0000007 Ga0501043_0000007_43309_43812 167
1007 3300049579 Ga0501043_0337856 Ga0501043_0337856_612_1115 167
1008 3300049581 Ga0501047_0000740 Ga0501047_0000740_22512_23015 167
1009 3300049581 Ga0501047_0036680 Ga0501047_0036680_1673_2176 167
1010 3300049581 Ga0501047_0124460 Ga0501047_0124460_1588_2091 167
1011 3300049581 Ga0501047_0462930 Ga0501047_0462930_203_706 167
1012 3300049582 Ga0501048_0048949 Ga0501048_0048949_2488_2991 167
1013 3300049583 Ga0501067_0027605 Ga0501067_0027605_501_1007 167
1014 3300049583 Ga0501067_0159701 Ga0501067_0159701_48_551 167
1015 3300049583 Ga0501067_0197413 Ga0501067_0197413_24_530 167
1016 3300049583 Ga0501067_0650151 Ga0501067_0650151_79_582 167
1017 3300049584 Ga0501068_0180196 Ga0501068_0180196_40_543 167
1018 3300049584 Ga0501068_0342319 Ga0501068_0342319_182_685 167
1019 3300049585 Ga0501069_0000027 Ga0501069_0000027_62401_62904 167
1020 3300049585 Ga0501069_0019796 Ga0501069_0019796_577_1080 167
1021 3300049585 Ga0501069_0061284 Ga0501069_0061284_752_1255 167
1022 3300049585 Ga0501069_0299895 Ga0501069_0299895_179_697 167
1023 3300049586 Ga0501070_0000160 Ga0501070_0000160_7859_8362 167
1024 3300049586 Ga0501070_0000457 Ga0501070_0000457_9434_9952 167
1025 3300049586 Ga0501070_0039896 Ga0501070_0039896_185_688 167
1026 3300049586 Ga0501070_0064803 Ga0501070_0064803_2197_2700 167
1027 3300049586 Ga0501070_0067828 Ga0501070_0067828_509_1012 167
1028 3300049587 Ga0501071_0006794 Ga0501071_0006794_3278_3781 167
1029 3300049587 Ga0501071_0462787 Ga0501071_0462787_417_920 167
1030 3300049587 Ga0501071_0745146 Ga0501071_0745146_135_638 167
1031 3300049588 Ga0501072_1048843 Ga0501072_1048843_62_568 167
1032 3300049589 Ga0501073_0017148 Ga0501073_0017148_4158_4661 167
1033 3300049589 Ga0501073_0027588 Ga0501073_0027588_2733_3236 167
1034 3300049590 Ga0501074_0000066 Ga0501074_0000066_12702_13205 167
1035 3300049590 Ga0501074_0025835 Ga0501074_0025835_1699_2202 167
1036 3300049590 Ga0501074_0037426 Ga0501074_0037426_2594_3097 167
1037 3300049590 Ga0501074_0781597 Ga0501074_0781597_81_584 167
1038 3300049591 Ga0501075_0029046 Ga0501075_0029046_626_1129 167
1039 3300049592 Ga0501076_0011562 Ga0501076_0011562_2374_2877 167
1040 3300049593 Ga0501077_0022301 Ga0501077_0022301_2752_3255 167
1041 3300049741 Ga0501079_0387449 Ga0501079_0387449_554_1060 167
1042 3300049742 Ga0501080_0000667 Ga0501080_0000667_15317_15820 167
1043 3300049742 Ga0501080_0002747 Ga0501080_0002747_13037_13540 167
1044 3300049742 Ga0501080_0053345 Ga0501080_0053345_1515_2018 167
1045 3300049743 Ga0501081_0218907 Ga0501081_0218907_465_968 167
1046 3300049744 Ga0501083_0000012 Ga0501083_0000012_134700_135203 167
1047 3300049744 Ga0501083_0053745 Ga0501083_0053745_1461_1964 167
1048 3300049744 Ga0501083_0284373 Ga0501083_0284373_29_532 167
1049 3300049822 Ga0501035_0000073 Ga0501035_0000073_70808_71311 167
1050 3300049822 Ga0501035_0000806 Ga0501035_0000806_25642_26145 167
1051 3300049822 Ga0501035_0004991 Ga0501035_0004991_9727_10230 167
1052 3300049822 Ga0501035_0012174 Ga0501035_0012174_214_717 167
1053 3300049823 Ga0501044_0000118 Ga0501044_0000118_51379_51882 167
1054 3300049823 Ga0501044_0063285 Ga0501044_0063285_1976_2479 167
1055 3300049823 Ga0501044_0084403 Ga0501044_0084403_240_743 167
1056 3300049823 Ga0501044_0101385 Ga0501044_0101385_1590_2093 167
1057 3300049824 Ga0501045_0008186 Ga0501045_0008186_2551_3054 167
1058 3300050490 nmdc:mga03n38_1260_c1 nmdc:mga03n38_1260_c1_727_1233 167
1059 3300050491 nmdc:mga00v17_36886_c1 nmdc:mga00v17_36886_c1_1355_1861 167
1060 3300050492 nmdc:mga0yw44_42149_c1 nmdc:mga0yw44_42149_c1_1085_1591 167
1061 3300050493 nmdc:mga0k408_92180_c1 nmdc:mga0k408_92180_c1_97_600 167
1062 3300050494 nmdc:mga06z11_105767_c1 nmdc:mga06z11_105767_c1_46_618 167
1063 3300050494 nmdc:mga06z11_185807_c1 nmdc:mga06z11_185807_c1_521_1027 167
1064 3300050494 nmdc:mga06z11_2201_c1 nmdc:mga06z11_2201_c1_1719_2222 167
1065 3300050495 nmdc:mga04h51_90062_c1 nmdc:mga04h51_90062_c1_534_1040 167
1066 3300050496 nmdc:mga07m45_135581_c1 nmdc:mga07m45_135581_c1_531_1037 167
1067 3300050496 nmdc:mga07m45_14332_c1 nmdc:mga07m45_14332_c1_2975_3481 167
1068 3300050511 nmdc:mga08y16_263276_c1 nmdc:mga08y16_263276_c1_106_609 167
1069 3300050511 nmdc:mga08y16_514553_c1 nmdc:mga08y16_514553_c1_40_543 167
1070 3300050511 nmdc:mga08y16_792478_c1 nmdc:mga08y16_792478_c1_218_727 167
1071 3300050512 nmdc:mga0n895_54520_c1 nmdc:mga0n895_54520_c1_1705_2211 167
1072 3300050512 nmdc:mga0n895_574276_c1 nmdc:mga0n895_574276_c1_228_734 167
1073 3300050513 nmdc:mga0rr50_30428_c1 nmdc:mga0rr50_30428_c1_1573_2076 167
1074 3300050513 nmdc:mga0rr50_400664_c1 nmdc:mga0rr50_400664_c1_518_1021 167
1075 3300050513 nmdc:mga0rr50_84036_c1 nmdc:mga0rr50_84036_c1_1917_2423 167
1076 3300050514 nmdc:mga08x19_385_c1 nmdc:mga08x19_385_c1_29649_30155 167
1077 3300050514 nmdc:mga08x19_567685_c1 nmdc:mga08x19_567685_c1_70_573 167
1078 3300050514 nmdc:mga08x19_78001_c1 nmdc:mga08x19_78001_c1_195_698 167
1079 3300050515 nmdc:mga0a205_59017_c1 nmdc:mga0a205_59017_c1_291_794 167
1080 3300050516 nmdc:mga0sz30_276759_c1 nmdc:mga0sz30_276759_c1_183_689 167
1081 3300053077 Ga0495601_0006582 Ga0495601_0006582_2060_2563 167
1082 3300053077 Ga0495601_0052397 Ga0495601_0052397_887_1390 167
1083 3300053077 Ga0495601_0243152 Ga0495601_0243152_85_588 167
1084 3300053077 Ga0495601_0622022 Ga0495601_0622022_128_631 167
1085 3300053077 Ga0495601_0729729 Ga0495601_0729729_48_554 167
1086 3300053078 Ga0495612_0008895 Ga0495612_0008895_1000_1503 167
1087 3300053078 Ga0495612_0021744 Ga0495612_0021744_1740_2243 167
1088 3300053084 Ga0495595_0015072 Ga0495595_0015072_2754_3257 167
1089 3300053084 Ga0495595_0022370 Ga0495595_0022370_1269_1775 167
1090 3300053084 Ga0495595_0118598 Ga0495595_0118598_625_1131 167
1091 3300053085 Ga0495619_0001498 Ga0495619_0001498_11523_12026 167
1092 3300053085 Ga0495619_0003381 Ga0495619_0003381_35_538 167
1093 3300053085 Ga0495619_0015555 Ga0495619_0015555_3040_3546 167
1094 3300053085 Ga0495619_0057783 Ga0495619_0057783_1669_2172 167
1095 3300053086 Ga0500578_0099973 Ga0500578_0099973_973_1479 167
1096 3300053087 Ga0500643_020438 Ga0500643_020438_489_995 167
1097 3300053088 Ga0500644_0129367 Ga0500644_0129367_80_586 167
1098 3300053089 Ga0500581_350604 Ga0500581_350604_40_546 167
1099 3300053090 Ga0500646_0012929 Ga0500646_0012929_1377_1883 167
1100 3300053092 Ga0500583_0128116 Ga0500583_0128116_70_576 167
1101 3300053093 Ga0500651_0131840 Ga0500651_0131840_649_1155 167
1102 3300053096 Ga0500641_0014666 Ga0500641_0014666_1409_1915 167
1103 3300053096 Ga0500641_0040818 Ga0500641_0040818_294_800 167
1104 3300053098 Ga0500650_0003179 Ga0500650_0003179_2646_3152 167
1105 3300053103 Ga0500555_010336 Ga0500555_010336_1509_2015 167
1106 3300053104 Ga0500556_0000015 Ga0500556_0000015_98162_98668 167
1107 3300053108 Ga0500562_021012 Ga0500562_021012_395_901 167
1108 3300053109 Ga0500569_002523 Ga0500569_002523_2743_3249 167
1109 3300053109 Ga0500569_113399 Ga0500569_113399_304_810 167
1110 3300053116 Ga0500592_002541 Ga0500592_002541_1971_2477 167
1111 3300053118 Ga0500594_0007830 Ga0500594_0007830_1264_1770 167
1112 3300053125 Ga0500618_030349 Ga0500618_030349_493_999 167
1113 3300053130 Ga0500642_0069549 Ga0500642_0069549_211_717 167
1114 3300053131 Ga0500652_000308 Ga0500652_000308_2460_2966 167
1115 3300053133 Ga0500655_032263 Ga0500655_032263_289_795 167
1116 3300053134 Ga0500658_0043021 Ga0500658_0043021_49_555 167
1117 3300053134 Ga0500658_0162204 Ga0500658_0162204_415_921 167
1118 3300053136 Ga0500559_0027141 Ga0500559_0027141_1180_1686 167
1119 3300053137 Ga0500561_0098936 Ga0500561_0098936_302_808 167
1120 3300053139 Ga0500568_0001108 Ga0500568_0001108_11866_12372 167
1121 3300053139 Ga0500568_0002973 Ga0500568_0002973_2628_3134 167
1122 3300053146 Ga0500588_0026501 Ga0500588_0026501_657_1163 167
1123 3300053147 Ga0500589_144075 Ga0500589_144075_193_699 167
1124 3300053150 Ga0500603_264010 Ga0500603_264010_29_535 167
1125 3300053151 Ga0500604_0001327 Ga0500604_0001327_1409_1915 167
1126 3300053153 Ga0500616_0000041 Ga0500616_0000041_132881_133387 167
1127 3300053156 Ga0500622_0002439 Ga0500622_0002439_1510_2016 167
1128 3300053158 Ga0500627_0027269 Ga0500627_0027269_839_1345 167
1129 3300053160 Ga0500633_0164550 Ga0500633_0164550_112_618 167
1130 3300053177 Ga0500636_0006978 Ga0500636_0006978_351_857 167
1131 3300053178 Ga0500637_0324071 Ga0500637_0324071_35_541 167
1132 3300053724 Ga0500570_068096 Ga0500570_068096_1076_1582 167
1133 3300053727 Ga0500611_020368 Ga0500611_020368_644_1150 167
1134 3300053730 Ga0500645_049728 Ga0500645_049728_96_602 167
1135 3300053730 Ga0500645_141472 Ga0500645_141472_121_627 167
1136 3300053730 Ga0500645_172834 Ga0500645_172834_40_546 167
1137 3300053732 Ga0500656_064851 Ga0500656_064851_33_539 167
1138 3300054114 Ga0501084_0256827 Ga0501084_0256827_741_1244 167
1139 3300054114 Ga0501084_0305024 Ga0501084_0305024_476_982 167
1140 3300059424 Ga0590075_102911 Ga0590075_102911_194_697 167
1141 3300059492 Ga0587073_0070410 Ga0587073_0070410_182_685 167
1142 3300059492 Ga0587073_0089077 Ga0587073_0089077_166_669 167
1143 3300059492 Ga0587073_0147584 Ga0587073_0147584_64_570 167
1144 3300059492 Ga0587073_0183640 Ga0587073_0183640_46_552 167
1145 3300059493 Ga0587077_090800 Ga0587077_090800_170_676 167
1146 3300059503 Ga0587080_064058 Ga0587080_064058_56_559 167
1147 3300059504 Ga0587082_073584 Ga0587082_073584_75_578 167
1148 3300059504 Ga0587082_084638 Ga0587082_084638_60_563 167
1149 3300059508 Ga0587088_137651 Ga0587088_137651_10_513 167
1150 3300059608 Ga0587129_011806 Ga0587129_011806_127_630 167
1151 3300059643 Ga0587072_094761 Ga0587072_094761_47_550 167
1152 3300060353 Ga0501082_0043509 Ga0501082_0043509_2146_2649 167
1153 3300060353 Ga0501082_0169930 Ga0501082_0169930_707_1210 167
1154 3300060353 Ga0501082_1428585 Ga0501082_1428585_44_547 167
1155 3300061734 Ga0530510_0080336 Ga0530510_0080336_355_858 167
1156 iso_pu_bacteria 8001845381 8001848798 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

44

201

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.9781 4 155
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9666 7 158
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9657 6 158
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9549 8 163
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9424 7 158
ID Description Score Start End Superfamily
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9782 4 155 1.20.1260.10
4eruA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9573 6 158 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9507 1 161 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9414 4 155 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9393 1 161 1.20.1260.10
ID Description Score Start End GO Terms
AF-J6IXS8-F1-model_v4 Uncharacterized protein 0.9963 12 166
AF-A0A531KI21-F1-model_v4 Ferritin-like domain-containing protein 0.9963 34 166
AF-A0A2V8EWJ5-F1-model_v4 Ferritin-like domain-containing protein 0.9961 6 166
AF-A0A8B2P258-F1-model_v4 Ferritin-like metal-binding protein YciE 0.9955 8 166
AF-A0A1I7NHL4-F1-model_v4 Ferritin-like metal-binding protein YciE 0.9952 8 166

Feature Viewer

pLDDT pTM Quality
93.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map