F490895

General Info

Members Datasets Scaffolds Average Seq Length
1153 1001 323 479

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306086|2551694173
Length 555
Sequence TYPVYGEITGPIVMIGFGSIGHGTLPLIERHFKYDKNRLIVVEPREDAKDTEIFVRHGVRHVRAAVTRDNYKELLKPLLTEGGGQGFCVNLSVDTSSLDIIKLCRKLDVLYVDTVIEPWLGFYFDAEMDNAARTNYALRETVRREKEKNPGGTTAVSTCGANPGMVSWFVKKALLNLADDLGLKYEEPHQDDREGWAKLMKKAGVKGVHIAERDTQRAKHPKPLNVFWNTWSVEGFISEGLQPAELGWGTHENWMPKNAKKHKKGCKAAIYLEQPGANTRVRSWCPTPGPQYGFLVTHNESISIADFFTVRDKDGEVSYRPTCHYAYHPANDAVLSLHEMFGNGGKAQPELHVLDEHELVDGVDELGVLLYGHAKNAYWYGSXXXPAASRPTRTPPACRSRAPFLPAWSGLLKTRRPASSKPTRWTTSAAWKCRCLISAPSRGTTPTGHRSMGARAFSRKTSTRRTPGSSGTFSSAEVHATKHDLSARSSPAPGLFFCECRARRAHARSCFQLMIAACFAQCSTRVSQKTHNGRCGALKRRTIAPGSVPIRAIMR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
13 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
14 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
19 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
20 2512875024 Mesorhizobium loti R88b Isolate Nodule
21 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
22 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
23 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
24 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
25 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
26 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
27 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
28 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
29 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
30 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
31 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
32 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
33 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
34 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
35 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
36 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
37 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
38 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
39 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
40 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
41 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
42 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
43 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
44 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
45 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
46 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
47 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
48 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
49 2516143018 Ensifer sp. BR816 Isolate Nodule
50 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
51 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
52 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
53 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
54 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
55 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
56 2519899620 Rhizobium sp. Pop5 Isolate Nodule
57 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
58 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
59 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
60 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
61 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
62 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
63 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
64 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
65 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
66 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
67 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
68 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
69 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
70 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
71 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
72 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
73 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
74 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
75 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
76 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
77 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
78 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
79 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
80 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
81 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
82 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
83 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
84 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
85 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
86 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
87 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
88 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
89 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
90 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
91 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
92 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
93 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
94 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
95 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
96 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
97 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
98 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
99 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
100 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
101 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
102 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
103 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
104 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
105 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
106 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
107 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
108 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
109 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
110 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
111 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
112 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
113 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
114 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
115 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
116 2643221557 Ensifer sp. Root558 Isolate Unclassified
117 2643221558 Rhizobium sp. Root149 Isolate Unclassified
118 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
119 2643221568 Rhizobium sp. Root564 Isolate Unclassified
120 2643221582 Rhizobium sp. Root651 Isolate Unclassified
121 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
122 2643221599 Rhizobium sp. Root708 Isolate Unclassified
123 2643221607 Rhizobium sp. Root73 Isolate Unclassified
124 2643221610 Ensifer sp. Root74 Isolate Unclassified
125 2643221618 Ensifer sp. Root231 Isolate Unclassified
126 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
127 2643221626 Ensifer sp. Root31 Isolate Unclassified
128 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
129 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
130 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
131 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
132 2643221655 Ensifer sp. Root1252 Isolate Unclassified
133 2643221659 Ensifer sp. Root127 Isolate Unclassified
134 2643221668 Ensifer sp. Root423 Isolate Unclassified
135 2643221675 Ensifer sp. Root1298 Isolate Unclassified
136 2643221680 Ensifer sp. Root1312 Isolate Unclassified
137 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
138 2643221688 Rhizobium sp. Root482 Isolate Unclassified
139 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
140 2643221693 Rhizobium sp. Root491 Isolate Unclassified
141 2643221698 Ensifer sp. Root142 Isolate Unclassified
142 2643221712 Ensifer sp. Root258 Isolate Unclassified
143 2643221718 Rhizobium sp. Root268 Isolate Unclassified
144 2643221723 Ensifer sp. Root278 Isolate Unclassified
145 2643221726 Ensifer sp. Root954 Isolate Unclassified
146 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
147 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
148 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
149 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
150 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
151 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
152 2718217882 Rhizobium sp. N741 Isolate Nodule
153 2718217927 Rhizobium sp. N324 Isolate Nodule
154 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
155 2718218009 Rhizobium sp. N561 Isolate Nodule
156 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
157 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
158 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
159 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
160 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
161 2718218363 Rhizobium sp. N113 Isolate Nodule
162 2718218365 Rhizobium sp. N731 Isolate Nodule
163 2718218366 Rhizobium sp. N621 Isolate Nodule
164 2718218423 Rhizobium sp. N941 Isolate Nodule
165 2721755514 Rhizobium sp. N6212 Isolate Nodule
166 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
167 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
168 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
169 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
170 2721755809 Rhizobium sp. N541 Isolate Nodule
171 2721755810 Rhizobium sp. N871 Isolate Nodule
172 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
173 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
174 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
175 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
176 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
177 2728369365 Rhizobium sp. N1341 Isolate Nodule
178 2728369397 Rhizobium sp. N1314 Isolate Nodule
179 2738541293 Rhizobium sp. GV031 Isolate Unclassified
180 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
181 2738543024 Aminobacter sp. AP02 Isolate Unclassified
182 2751185800 Brucella pituitosa AA2 Isolate Unclassified
183 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
184 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
185 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
186 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
187 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
188 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
189 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
190 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
191 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
192 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
193 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
194 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
195 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
196 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
197 2791355256 Rhizobium sp. M10 Isolate Nodule
198 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
199 2791355260 Rhizobium sp. L9 Isolate Nodule
200 2791355261 Rhizobium sp. J15 Isolate Nodule
201 2791355262 Rhizobium sp. M1 Isolate Nodule
202 2791355263 Rhizobium chutanense C5 Isolate Nodule
203 2791355264 Rhizobium sp. S9 Isolate Nodule
204 2791355265 Rhizobium sp. H4 Isolate Nodule
205 2791355266 Rhizobium sp. L43 Isolate Nodule
206 2791355267 Rhizobium sp. L18 Isolate Nodule
207 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
208 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
209 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
210 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
211 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
212 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
213 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
214 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
215 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
216 2802429633 Rhizobium anhuiense J3 Isolate Nodule
217 2802429634 Rhizobium anhuiense S10 Isolate Nodule
218 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
219 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
220 2802429637 Rhizobium anhuiense C15 Isolate Nodule
221 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
222 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
223 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
224 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
225 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
226 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
227 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
228 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
229 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
230 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
231 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
232 2838048938 Rhizobium pisi 27/80 Isolate Nodule
233 2838061910 Rhizobium phaseoli L15 Isolate Nodule
234 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
235 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
236 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
237 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
238 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
239 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
240 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
241 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
242 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
243 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
244 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
245 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
246 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
247 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
248 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
249 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
250 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
251 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
252 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
253 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
254 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
255 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
256 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
257 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
258 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
259 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
260 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
261 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
262 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
263 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
264 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
265 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
266 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
267 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
268 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
269 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
270 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
271 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
272 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
273 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
274 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
275 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
276 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
277 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
278 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
279 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
280 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
281 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
282 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
283 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
284 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
285 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
286 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
287 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
288 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
289 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
290 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
291 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
292 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
293 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
294 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
295 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
296 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
297 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
298 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
299 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
300 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
301 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
302 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
303 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
304 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
305 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
306 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
307 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
308 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
309 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
310 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
311 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
312 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
313 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
314 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
315 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
316 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
317 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
318 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
319 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
320 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
321 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
322 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
323 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
324 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
325 2854911287 Brucella lupini LUP21 Isolate Unclassified
326 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
327 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
328 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
329 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
330 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
331 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
332 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
333 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
334 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
335 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
336 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
337 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
338 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
339 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
340 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
341 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
342 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
343 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
344 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
345 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
346 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
347 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
348 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
349 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
350 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
351 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
352 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
353 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
354 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
355 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
356 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
357 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
358 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
359 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
360 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
361 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
362 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
363 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
364 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
365 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
366 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
367 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
368 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
369 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
370 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
371 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
372 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
373 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
374 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
375 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
376 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
377 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
378 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
379 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
380 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
381 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
382 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
383 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
384 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
385 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
386 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
387 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
388 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
389 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
390 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
391 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
392 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
393 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
394 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
395 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
396 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
397 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
398 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
399 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
400 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
401 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
402 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
403 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
404 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
405 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
406 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
407 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
408 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
409 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
410 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
411 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
412 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
413 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
414 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
415 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
416 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
417 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
418 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
419 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
420 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
421 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
422 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
423 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
424 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
425 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
426 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
427 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
428 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
429 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
430 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
431 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
432 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
433 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
434 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
435 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
436 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
437 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
438 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
439 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
440 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
441 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
442 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
443 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
444 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
445 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
446 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
447 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
448 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
449 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
450 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
451 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
452 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
453 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
454 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
455 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
456 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
457 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
458 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
459 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
460 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
461 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
462 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
463 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
464 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
465 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
466 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
467 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
468 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
469 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
470 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
471 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
472 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
473 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
474 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
475 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
476 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
477 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
478 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
479 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
480 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
481 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
482 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
483 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
484 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
485 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
486 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
487 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
488 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
489 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
490 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
491 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
492 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
493 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
494 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
495 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
496 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
497 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
498 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
499 2933599457 Rhizobium phaseoli M3 Isolate Nodule
500 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
501 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
502 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
503 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
504 2936381700 Rhizobium chutanense C16 Isolate Unclassified
505 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
506 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
507 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
508 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
509 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
510 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
511 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
512 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
513 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
514 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
515 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
516 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
517 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
518 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
519 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
520 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
521 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
522 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
523 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
524 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
525 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
526 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
527 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
528 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
529 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
530 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
531 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
532 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
533 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
534 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
535 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
536 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
537 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
538 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
539 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
540 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
541 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
542 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
543 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
544 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
545 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
546 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
547 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
548 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
549 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
550 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
551 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
552 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
553 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
554 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
555 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
556 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
557 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
558 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
559 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
560 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
561 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
562 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
563 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
564 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
565 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
566 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
567 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
568 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
569 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
570 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
571 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
572 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
573 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
574 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
575 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
576 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
577 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
578 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
579 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
580 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
581 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
582 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
583 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
584 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
585 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
586 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
587 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
588 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
589 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
590 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
591 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
592 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
593 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
594 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
595 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
596 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
597 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
598 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
599 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
600 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
601 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
602 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
603 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
604 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
605 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
606 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
607 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
608 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
609 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
610 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
611 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
612 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
613 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
614 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
615 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
616 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
617 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
618 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
619 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
620 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
621 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
622 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
623 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
624 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
625 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
626 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
627 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
628 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
629 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
630 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
631 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
632 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
633 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
634 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
635 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
636 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
637 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
638 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
639 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
640 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
641 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
642 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
643 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
644 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
645 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
646 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
647 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
648 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
649 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
650 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
651 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
652 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
653 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
654 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
655 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
656 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
657 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
658 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
659 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
660 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
661 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
662 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
663 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
664 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
665 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
666 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
667 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
668 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
669 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
670 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
671 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
672 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
673 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
674 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
675 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
676 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
677 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
678 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
679 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
680 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
681 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
682 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
683 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
684 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
685 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
686 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
687 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
688 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
689 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
690 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
691 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
692 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
693 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
694 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
695 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
696 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
697 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
698 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
699 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
700 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
701 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
702 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
703 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
704 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
705 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
706 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
707 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
708 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
709 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
710 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
711 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
712 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
713 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
714 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
715 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
716 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
717 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
718 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
719 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
720 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
721 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
722 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
723 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
724 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
725 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
726 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
727 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
728 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
729 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
730 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
731 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
732 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
733 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
734 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
735 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
736 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
737 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
738 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
739 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
740 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
741 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
742 2996887358 Rhizobium sp. R711 Isolate Nodule
743 2996893221 Rhizobium sp. R635 Isolate Nodule
744 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
745 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
746 3004167301 Mesorhizobium loti 582 Isolate Unclassified
747 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
748 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
749 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
750 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
751 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
752 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
753 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
754 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
755 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
756 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
757 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
758 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
759 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
760 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
761 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
762 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
763 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
764 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
765 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
766 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
767 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
768 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
769 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
770 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
771 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
772 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
773 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
774 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
775 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
776 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
777 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
778 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
779 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
780 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
781 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
782 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
783 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
784 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
785 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
786 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
787 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
788 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
789 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
790 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
791 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
792 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
793 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
794 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
795 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
796 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
797 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
798 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
799 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
800 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
801 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
802 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
803 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
804 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
805 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
806 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
807 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
808 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
809 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
810 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
811 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
812 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
813 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
814 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
815 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
816 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
817 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
818 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
819 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
820 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
821 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
822 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
823 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
824 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
825 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
826 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
827 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
828 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
829 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
830 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
831 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
832 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
833 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
834 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
835 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
836 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
837 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
838 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
839 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
840 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
841 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
842 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
843 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
844 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
845 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
846 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
847 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
848 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
849 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
850 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
851 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
852 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
853 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
854 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
855 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
856 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
857 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
858 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
859 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
860 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
861 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
862 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
863 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
864 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
865 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
866 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
867 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
868 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
869 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
870 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
871 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
872 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
873 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
874 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
875 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
876 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
877 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
878 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
879 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
880 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
881 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
882 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
883 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
884 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
885 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
886 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
887 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
888 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
889 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
890 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
891 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
892 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
893 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
894 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
895 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
896 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
897 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
898 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
899 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
900 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
901 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
902 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
903 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
904 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
905 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
906 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
907 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
908 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
909 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
910 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
911 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
912 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
913 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
914 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
915 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
916 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
917 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
918 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
919 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
920 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
921 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
922 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
923 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
924 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
925 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
926 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
927 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
928 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
929 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
930 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
931 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
932 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
933 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
934 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
935 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
936 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
937 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
938 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
939 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
940 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
941 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
942 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
943 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
944 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
945 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
946 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
947 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
948 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
949 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
950 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
951 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
952 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
953 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
954 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
955 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
956 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
957 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
958 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
959 8005258706 Rhizobium sp. R693 Isolate Nodule
960 8005275841 Rhizobium sp. N4311 Isolate Nodule
961 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
962 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
963 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
964 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
965 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
966 8005321885 Rhizobium sp. R72 Isolate Nodule
967 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
968 8005382845 Rhizobium sp. R634 Isolate Nodule
969 8005395548 Rhizobium sp. R339 Isolate Nodule
970 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
971 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
972 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
973 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
974 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
975 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
976 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
977 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
978 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
979 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
980 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
981 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
982 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
983 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
984 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
985 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
986 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
987 8018176218 Rhizobium sp. N122 Isolate Nodule
988 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
989 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
990 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
991 8024501048 Rhizobium sp. H4 Isolate Nodule
992 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
993 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
994 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
995 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
996 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
997 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
998 8056382006 Rhizobium croatiense 13T Isolate Nodule
999 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1000 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1001 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 27.93
Metatranscriptomes 0.09
Isolates 71.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 12.66
Nodule 56.9
Rhizoplane 0.78
Rhizosphere 15
Stem 0
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000215 3300002705 Bacteria 40194
2 JGI25154J39366_1000169 3300002738 Bacteria 50665
3 JGI25158J39367_1000249 3300002739 Bacteria 12392
4 JGI25157J39369_1000226 3300002741 Bacteria 44207
5 JGI25152J39213_1001612 3300002773 Bacteria 9433
6 JGI25152J39213_1002985 3300002773 Bacteria 6003
7 JGI25152J39213_1005237 3300002773 Bacteria 3854
8 JGI25152J39213_1010984 3300002773 Bacteria 2029
9 JGI25150J39212_1000142 3300002774 Bacteria 40535
10 JGI25159J45721_1000018 3300002987 Bacteria 132603
11 JGI25159J45721_1000470 3300002987 Bacteria 18595
12 JGI25159J45721_1006331 3300002987 Bacteria 3557
13 JGI25151J46595_10000031 3300003187 Bacteria 197865
14 JGI25151J46595_10001034 3300003187 Bacteria 20801
15 JGI25151J46595_10009744 3300003187 Bacteria 4525
16 JGI25151J46595_10027348 3300003187 Bacteria 2288
17 JGI25406J46586_10023766 3300003203 Bacteria 2416
18 JGI25165J46597_1000042 3300003214 Bacteria 271606
19 JGI25165J46597_1000443 3300003214 Bacteria 41663
20 JGI25165J46597_1001071 3300003214 Bacteria 17571
21 JGI25153J46596_10002913 3300003215 Bacteria 9684
22 JGI25160J50197_1000009 3300003354 Bacteria 282862
23 JGI25160J50197_1000114 3300003354 Bacteria 75947
24 JGI25160J50197_1000966 3300003354 Bacteria 15007
25 JGI25160J50197_1011262 3300003354 Bacteria 3180
26 JGI25161J50226_1000089 3300003374 Bacteria 73775
27 JGI25161J50226_1000114 3300003374 Bacteria 62957
28 JGI25161J50226_1000913 3300003374 Bacteria 10639
29 Ga0055542_1000981 3300003762 Bacteria 18535
30 Ga0055529_1001600 3300003763 Bacteria 6140
31 Ga0055526_1004043 3300003771 Bacteria 9009
32 Ga0055526_1006122 3300003771 Bacteria 6631
33 Ga0055524_1001259 3300003775 Bacteria 14879
34 Ga0055524_1001626 3300003775 Bacteria 12537
35 Ga0055524_1006998 3300003775 Bacteria 4844
36 Ga0055536_1002677 3300003781 Bacteria 9884
37 Ga0055536_1012610 3300003781 Bacteria 3120
38 Ga0055528_1010323 3300003790 Bacteria 3805
39 Ga0055530_10011658 3300003791 Bacteria 3138
40 Ga0055540_1006389 3300003792 Bacteria 4686
41 Ga0055531_10007080 3300003794 Bacteria 6201
42 Ga0055531_10034399 3300003794 Bacteria 1608
43 Ga0058692_1000707 3300003856 Bacteria 13669
44 Ga0058692_1000793 3300003856 Bacteria 12657
45 Ga0055543_1000002 3300004625 Bacteria 390020
46 Ga0055543_1000077 3300004625 Bacteria 86457
47 Ga0055543_1000379 3300004625 Bacteria 29065
48 Ga0055543_1002703 3300004625 Bacteria 5670
49 Ga0065165_1000020 3300005262 Bacteria 265570
50 Ga0065165_1000537 3300005262 Bacteria 57544
51 Ga0065165_1004996 3300005262 Bacteria 7772
52 Ga0070670_100002407 3300005331 Bacteria 15428
53 Ga0070668_100031812 3300005347 Bacteria 4015
54 Ga0070669_100034905 3300005353 Bacteria 3641
55 Ga0070671_100036933 3300005355 Bacteria 4051
56 Ga0070663_100042275 3300005455 Bacteria 3202
57 Ga0070665_100005334 3300005548 Bacteria 13283
58 Ga0068854_100071940 3300005578 Bacteria 2531
59 Ga0081539_10002331 3300005985 Bacteria 27334
60 Ga0075365_10000532 3300006038 Bacteria 14622
61 Ga0075365_10027524 3300006038 Bacteria 3619
62 Ga0075365_10044706 3300006038 Bacteria 2903
63 Ga0075365_10094439 3300006038 Bacteria 2041
64 Ga0075368_10000376 3300006042 Bacteria 13063
65 Ga0075363_100000028 3300006048 Bacteria 28528
66 Ga0075363_100016943 3300006048 Bacteria 3606
67 Ga0075364_10010752 3300006051 Bacteria 5537
68 Ga0075364_10028420 3300006051 Bacteria 3580
69 Ga0075362_10002625 3300006177 Bacteria 6088
70 Ga0075367_10062652 3300006178 Bacteria 2222
71 Ga0075369_10005611 3300006186 Bacteria 4699
72 Ga0075369_10054563 3300006186 Bacteria 1735
73 Ga0075366_10016141 3300006195 Bacteria 4288
74 Ga0075370_10001799 3300006353 Bacteria 9584
75 Ga0075370_10032952 3300006353 Bacteria 2899
76 Ga0079104_1002954 3300006946 Bacteria 8403
77 Ga0079104_1003793 3300006946 Bacteria 6799
78 Ga0099826_10016302 3300006948 Bacteria 5609
79 Ga0105240_10000019 3300009093 Bacteria 406211
80 Ga0105243_10006006 3300009148 Bacteria 9400
81 Ga0105248_10215580 3300009177 Bacteria 2162
82 Ga0105238_10005636 3300009551 Bacteria 12375
83 Ga0123342_1007669 3300009766 Bacteria 14126
84 Ga0105239_10006306 3300010375 Bacteria 13794
85 Ga0105239_10157357 3300010375 Bacteria 2538
86 Ga0157373_10026296 3300013100 Bacteria 4206
87 Ga0157371_10000002 3300013102 Bacteria 665040
88 Ga0157370_10000246 3300013104 Bacteria 69424
89 Ga0157370_10047724 3300013104 Bacteria 4104
90 Ga0171463_1006 3300013249 Bacteria 336402
91 Ga0183363_1018 3300015690 Bacteria 62625
92 Ga0214544_1001241 3300021320 Bacteria 52071
93 Ga0214542_1000115 3300021321 Bacteria 109873
94 Ga0214543_1000008 3300021327 Bacteria 385680
95 Ga0214543_1000098 3300021327 Bacteria 109894
96 Ga0228711_1000003 3300022739 Bacteria 258118
97 Ga0228710_1000003 3300022740 Bacteria 262981
98 Ga0209435_100005 3300025206 Bacteria 573745
99 Ga0209436_100050 3300025208 Bacteria 65942
100 Ga0209437_100078 3300025233 Bacteria 278088
101 Ga0209437_100291 3300025233 Bacteria 72764
102 Ga0207425_1000070 3300025245 Bacteria 116438
103 Ga0207425_1001972 3300025245 Bacteria 7681
104 Ga0209646_1000011 3300025246 Bacteria 573745
105 Ga0209026_1000008 3300025250 Bacteria 573745
106 Ga0209026_1000029 3300025250 Bacteria 337109
107 Ga0209677_100524 3300025253 Bacteria 21308
108 Ga0209148_1000080 3300025254 Bacteria 277806
109 Ga0209148_1005812 3300025254 Bacteria 2760
110 Ga0209759_1000004 3300025256 Bacteria 573745
111 Ga0209759_1000040 3300025256 Bacteria 254501
112 Ga0209129_1000080 3300025258 Bacteria 186416
113 Ga0209129_1003444 3300025258 Bacteria 6868
114 Ga0209233_1000028 3300025261 Bacteria 642062
115 Ga0209233_1000157 3300025261 Bacteria 164269
116 Ga0209233_1000192 3300025261 Bacteria 127171
117 Ga0209233_1000194 3300025261 Bacteria 126185
118 Ga0209455_1000171 3300025272 Bacteria 109696
119 Ga0209673_1000037 3300025273 Bacteria 313804
120 Ga0209673_1000060 3300025273 Bacteria 263602
121 Ga0209673_1000312 3300025273 Bacteria 89594
122 Ga0209673_1000439 3300025273 Bacteria 71645
123 Ga0209673_1003294 3300025273 Bacteria 9701
124 Ga0209673_1004728 3300025273 Bacteria 7166
125 Ga0209130_1000030 3300025284 Bacteria 323323
126 Ga0209130_1000037 3300025284 Bacteria 284019
127 Ga0209130_1000083 3300025284 Bacteria 162582
128 Ga0209676_1000239 3300025292 Bacteria 117696
129 Ga0209676_1010437 3300025292 Bacteria 3870
130 Ga0209025_1000052 3300025294 Bacteria 324648
131 Ga0209025_1000083 3300025294 Bacteria 265556
132 Ga0209025_1000196 3300025294 Bacteria 147356
133 Ga0209025_1000255 3300025294 Bacteria 125764
134 Ga0209025_1000389 3300025294 Bacteria 90997
135 Ga0209025_1003226 3300025294 Bacteria 15787
136 Ga0209025_1007724 3300025294 Bacteria 7932
137 Ga0209025_1014510 3300025294 Bacteria 4836
138 Ga0209025_1021093 3300025294 Bacteria 3527
139 Ga0209564_1000086 3300025295 Bacteria 251385
140 Ga0209564_1000116 3300025295 Bacteria 207889
141 Ga0209564_1000125 3300025295 Bacteria 201709
142 Ga0209564_1000281 3300025295 Bacteria 104019
143 Ga0209758_1000090 3300025297 Bacteria 246564
144 Ga0209758_1000357 3300025297 Bacteria 82792
145 Ga0209758_1000621 3300025297 Bacteria 54479
146 Ga0209758_1000657 3300025297 Bacteria 51923
147 Ga0209758_1001459 3300025297 Bacteria 27768
148 Ga0209758_1017627 3300025297 Bacteria 3542
149 Ga0209050_1005669 3300025298 Bacteria 7727
150 Ga0209050_1008097 3300025298 Bacteria 5706
151 Ga0209256_1000276 3300025299 Bacteria 89888
152 Ga0209256_1002576 3300025299 Bacteria 14467
153 Ga0209256_1002625 3300025299 Bacteria 14193
154 Ga0209256_1004253 3300025299 Bacteria 9159
155 Ga0209256_1006950 3300025299 Bacteria 5776
156 Ga0209256_1008128 3300025299 Bacteria 4941
157 Ga0207426_1000047 3300025302 Bacteria 417011
158 Ga0207426_1000048 3300025302 Bacteria 409127
159 Ga0207426_1000173 3300025302 Bacteria 162697
160 Ga0207426_1000268 3300025302 Bacteria 109321
161 Ga0207426_1000984 3300025302 Bacteria 27966
162 Ga0209051_1000874 3300025303 Bacteria 30458
163 Ga0209051_1003034 3300025303 Bacteria 11368
164 Ga0209051_1005608 3300025303 Bacteria 7279
165 Ga0209051_1008583 3300025303 Bacteria 5390
166 Ga0209257_1001192 3300025304 Bacteria 32713
167 Ga0209257_1005971 3300025304 Bacteria 8165
168 Ga0207705_10015368 3300025909 Bacteria 5491
169 Ga0207695_10000049 3300025913 Bacteria 406233
170 Ga0207671_10000860 3300025914 Bacteria 38458
171 Ga0207671_10007609 3300025914 Bacteria 9372
172 Ga0207694_10031647 3300025924 Bacteria 4043
173 Ga0207650_10009773 3300025925 Bacteria 6559
174 Ga0207644_10021552 3300025931 Bacteria 4391
175 Ga0207711_10128597 3300025941 Bacteria 2268
176 Ga0207640_10039577 3300025981 Bacteria 2985
177 Ga0207640_10152046 3300025981 Bacteria 1702
178 Ga0207678_10075566 3300026067 Bacteria 2886
179 Ga0207678_10081149 3300026067 Bacteria 2776
180 Ga0209281_1000081 3300027111 Bacteria 258084
181 Ga0209281_1000269 3300027111 Bacteria 100505
182 Ga0209371_1000003 3300027312 Bacteria 1122971
183 Ga0209371_1001136 3300027312 Bacteria 19534
184 Ga0209371_1005797 3300027312 Bacteria 4779
185 Ga0209282_1000040 3300027666 Bacteria 127969
186 Ga0209282_1000870 3300027666 Bacteria 15631
187 Ga0268266_10024157 3300028379 Bacteria 5172
188 Ga0268266_10047949 3300028379 Bacteria 3661
189 Ga0307515_10000263 3300028794 Bacteria 130303
190 Ga0307515_10000386 3300028794 Bacteria 107196
191 Ga0307515_10049328 3300028794 Bacteria 6338
192 Ga0268256_1000004 3300030500 Bacteria 1122967
193 Ga0268256_1004149 3300030500 Bacteria 6149
194 Ga0268256_1007306 3300030500 Bacteria 3960
195 Ga0307513_10015647 3300031456 Bacteria 9183
196 Ga0307513_10022547 3300031456 Bacteria 7395
197 Ga0307408_100093977 3300031548 Bacteria 2270
198 Ga0307516_10039908 3300031730 Bacteria 4676
199 Ga0307406_10005532 3300031901 Bacteria 6911
200 Ga0307406_10078406 3300031901 Bacteria 2188
201 Ga0307412_10003898 3300031911 Bacteria 8304
202 Ga0315914_1000002 3300031967 Bacteria 365357
203 Ga0315913_1000016 3300033430 Bacteria 113410
204 Ga0315915_1000005 3300033464 Bacteria 397591
205 Ga0373927_0000095 3300035695 Bacteria 66646
206 Ga0373925_0001900 3300037068 Bacteria 17334
207 Ga0395905_0000479 3300037471 Bacteria 55266
208 Ga0395905_0042590 3300037471 Bacteria 4260
209 Ga0395901_0097607 3300038443 Bacteria 3080
210 Ga0451841_0811656 3300041498 Bacteria 2572
211 Ga0451845_0612574 3300041501 Bacteria 2371
212 Ga0451847_0787006 3300041503 Bacteria 5398
213 Ga0451851_0687044 3300041507 Bacteria 3016
214 Ga0466972_0004602 3300044658 Bacteria 6911
215 Ga0466965_0032775 3300044683 Bacteria 2538
216 Ga0466960_0009402 3300044901 Bacteria 4028
217 Ga0495638_0000377 3300046460 Bacteria 55414
218 Ga0495606_0001835 3300046507 Bacteria 26895
219 Ga0495633_0016900 3300046558 Bacteria 3745
220 Ga0495625_0025060 3300046660 Bacteria 4528
221 Ga0495604_0021754 3300047317 Bacteria 5120
222 Ga0495687_035816 3300047443 Bacteria 2227
223 Ga0495681_0014334 3300047470 Bacteria 4549
224 Ga0496116_0009050 3300048919 Bacteria 8545
225 Ga0496116_0014212 3300048919 Bacteria 6370
226 Ga0496117_0000052 3300048920 Bacteria 280463
227 Ga0496118_0000709 3300048921 Bacteria 53670
228 Ga0496118_0032794 3300048921 Bacteria 4271
229 Ga0496119_0002287 3300048922 Bacteria 21206
230 Ga0496119_0016179 3300048922 Bacteria 5697
231 Ga0496119_0043664 3300048922 Bacteria 2830
232 Ga0496120_0000019 3300048923 Bacteria 260115
233 Ga0496120_0001370 3300048923 Bacteria 29844
234 Ga0496120_0048589 3300048923 Bacteria 2441
235 Ga0496121_0021259 3300048924 Bacteria 6367
236 Ga0496122_0000024 3300048925 Bacteria 372400
237 Ga0496122_0000053 3300048925 Bacteria 260120
238 Ga0496122_0002990 3300048925 Bacteria 23012
239 Ga0496122_0008551 3300048925 Bacteria 11011
240 Ga0496122_0008795 3300048925 Bacteria 10788
241 Ga0496123_0000038 3300048926 Bacteria 260120
242 Ga0496123_0000063 3300048926 Bacteria 216072
243 Ga0496123_0000086 3300048926 Bacteria 183266
244 Ga0496123_0007881 3300048926 Bacteria 9898
245 Ga0496123_0040184 3300048926 Bacteria 3262
246 Ga0496124_0000139 3300048927 Bacteria 149873
247 Ga0496124_0015328 3300048927 Bacteria 7355
248 Ga0496125_0020651 3300048928 Bacteria 6176
249 Ga0496126_0000763 3300048929 Bacteria 58240
250 Ga0496126_0109258 3300048929 Bacteria 2410
251 Ga0501031_0008039 3300049568 Bacteria 6869
252 Ga0501032_0000007 3300049569 Bacteria 253881
253 Ga0501032_0000248 3300049569 Bacteria 45043
254 Ga0501032_0011413 3300049569 Bacteria 6383
255 Ga0501033_0000051 3300049570 Bacteria 111291
256 Ga0501033_0001374 3300049570 Bacteria 21696
257 Ga0501033_0004047 3300049570 Bacteria 11840
258 Ga0501033_0016361 3300049570 Bacteria 5616
259 Ga0501034_0000029 3300049571 Bacteria 253881
260 Ga0501034_0000507 3300049571 Bacteria 62716
261 Ga0501034_0007241 3300049571 Bacteria 11841
262 Ga0501036_0000004 3300049572 Bacteria 253881
263 Ga0501036_0078483 3300049572 Bacteria 2792
264 Ga0501037_0000004 3300049573 Bacteria 253989
265 Ga0501037_0052678 3300049573 Bacteria 2975
266 Ga0501038_0000005 3300049574 Bacteria 253881
267 Ga0501038_0000238 3300049574 Bacteria 46357
268 Ga0501038_0090618 3300049574 Bacteria 2562
269 Ga0501039_0000009 3300049575 Bacteria 253881
270 Ga0501039_0000073 3300049575 Bacteria 75516
271 Ga0501039_0083683 3300049575 Bacteria 2484
272 Ga0501042_0007394 3300049578 Bacteria 7193
273 Ga0501043_0000214 3300049579 Bacteria 52431
274 Ga0501043_0001215 3300049579 Bacteria 22693
275 Ga0501046_0021719 3300049580 Bacteria 5294
276 Ga0501047_0040490 3300049581 Bacteria 4506
277 Ga0501047_0095191 3300049581 Bacteria 2857
278 Ga0501048_0006373 3300049582 Bacteria 8968
279 Ga0501068_0052683 3300049584 Bacteria 2462
280 Ga0501069_0004063 3300049585 Bacteria 7556
281 Ga0501070_0003212 3300049586 Bacteria 14212
282 Ga0501070_0023667 3300049586 Bacteria 5146
283 Ga0501070_0025370 3300049586 Bacteria 4972
284 Ga0501070_0058097 3300049586 Bacteria 3206
285 Ga0501070_0072673 3300049586 Bacteria 2847
286 Ga0501072_0028309 3300049588 Bacteria 4375
287 Ga0501073_0095743 3300049589 Bacteria 2062
288 Ga0501080_0017096 3300049742 Bacteria 6699
289 Ga0501035_0000014 3300049822 Bacteria 253874
290 Ga0501035_0000189 3300049822 Bacteria 75562
291 Ga0501035_0001928 3300049822 Bacteria 20781
292 Ga0501035_0012975 3300049822 Bacteria 7688
293 Ga0501035_0013614 3300049822 Bacteria 7504
294 Ga0501044_0000012 3300049823 Bacteria 253881
295 Ga0501044_0010493 3300049823 Bacteria 10054
296 Ga0501044_0027624 3300049823 Bacteria 5994
297 Ga0501044_0058787 3300049823 Bacteria 3941
298 Ga0501044_0111683 3300049823 Bacteria 2740
299 Ga0501044_0132916 3300049823 Bacteria 2481
300 Ga0501044_0240757 3300049823 Bacteria 1753
301 Ga0501045_0009505 3300049824 Bacteria 6805
302 nmdc:mga03683_124_c1 3300050489 Bacteria 25785
303 nmdc:mga03n38_17317_c1 3300050490 Bacteria 2820
304 nmdc:mga00v17_141469_c1 3300050491 Bacteria 1543
305 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
306 nmdc:mga00v17_97909_c1 3300050491 Bacteria 1849
307 nmdc:mga0yw44_11225_c1 3300050492 Bacteria 4613
308 nmdc:mga0k408_3360_c1 3300050493 Bacteria 8476
309 nmdc:mga06z11_103920_c1 3300050494 Bacteria 1563
310 nmdc:mga06z11_33873_c1 3300050494 Bacteria 2502
311 nmdc:mga07m45_50944_c1 3300050496 Bacteria 2334
312 nmdc:mga0sz30_586_c1 3300050516 Bacteria 13725
313 Ga0500578_0089628 3300053086 Bacteria 1952
314 Ga0500658_0000067 3300053134 Bacteria 48662
315 Ga0500561_0000105 3300053137 Bacteria 16341
316 Ga0500568_0000177 3300053139 Bacteria 55762
317 Ga0500616_0000526 3300053153 Bacteria 48257
318 Ga0500616_0022183 3300053153 Bacteria 3549
319 Ga0500624_000343 3300053157 Bacteria 15439
320 Ga0500634_0074198 3300053161 Bacteria 1772
321 Ga0500636_0000005 3300053177 Bacteria 197561
322 Ga0500636_0001535 3300053177 Bacteria 12578
323 Ga0587076_006715 3300059645 Bacteria 1544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0012975 Ga0501035_0012975_507_1751 414
2 3300048922 Ga0496119_0016179 Ga0496119_0016179_25_1380 451
3 3300031901 Ga0307406_10078406 Ga0307406_100784061 461
4 3300038443 Ga0395901_0097607 Ga0395901_0097607_29_1423 464
5 3300049581 Ga0501047_0095191 Ga0501047_0095191_1414_2808 464
6 3300049586 Ga0501070_0025370 Ga0501070_0025370_3538_4932 464
7 iso_pu_bacteria 2885326080 2885329761 464
8 3300006186 Ga0075369_10054563 Ga0075369_100545632 465
9 3300050491 nmdc:mga00v17_97909_c1 nmdc:mga00v17_97909_c1_189_1634 465
10 3300050494 nmdc:mga06z11_103920_c1 nmdc:mga06z11_103920_c1_95_1540 465
11 3300005347 Ga0070668_100031812 Ga0070668_1000318121 466
12 3300025273 Ga0209673_1003294 Ga0209673_10032949 466
13 3300026067 Ga0207678_10075566 Ga0207678_100755662 466
14 iso_pu_bacteria 2551306086 2551694173 469
15 iso_pu_bacteria 2551306087 2551699892 469
16 iso_pu_bacteria 2551306089 2551711433 469
17 iso_pu_bacteria 2551306090 2551724071 469
18 iso_pu_bacteria 2551306091 2551724961 469
19 iso_pu_bacteria 2551306092 2551737980 469
20 iso_pu_bacteria 2551306093 2551743385 473
21 3300003856 Ga0058692_1000793 Ga0058692_10007933 476
22 iso_pu_bacteria 2643221568 2643858208 476
23 iso_pu_bacteria 2891048133 2891049189 476
24 iso_pu_bacteria 2919166419 2919169828 476
25 iso_pu_bacteria 2978969890 2978972244 476
26 iso_pu_bacteria 2995392953 2995395481 476
27 iso_pu_bacteria 2503198000 2503199964 477
28 iso_pu_bacteria 2508501127 2509142586 477
29 iso_pu_bacteria 2509276022 2509394875 477
30 iso_pu_bacteria 2510065059 2510319258 477
31 iso_pu_bacteria 2510917030 2511198455 477
32 iso_pu_bacteria 2511231027 2511390326 477
33 iso_pu_bacteria 2512875016 2512932568 477
34 iso_pu_bacteria 2512875024 2512960582 477
35 iso_pu_bacteria 2513237090 2513608680 477
36 iso_pu_bacteria 2513237164 2514036328 477
37 iso_pu_bacteria 2513237305 2514416492 477
38 iso_pu_bacteria 2513237351 2514587536 477
39 iso_pu_bacteria 2537561587 2537873711 477
40 iso_pu_bacteria 2554235003 2554245186 477
41 iso_pu_bacteria 2558860242 2559296984 477
42 iso_pu_bacteria 2582581298 2585224834 477
43 iso_pu_bacteria 2585427529 2585547390 477
44 iso_pu_bacteria 2588253730 2588518647 477
45 iso_pu_bacteria 2597489875 2597812130 477
46 iso_pu_bacteria 2599185210 2599604685 477
47 iso_pu_bacteria 2599185301 2599936433 477
48 iso_pu_bacteria 2600255279 2601611169 477
49 iso_pu_bacteria 2600255308 2601747942 477
50 iso_pu_bacteria 2643221550 2643774406 477
51 iso_pu_bacteria 2643221551 2643776560 477
52 iso_pu_bacteria 2643221555 2643795007 477
53 iso_pu_bacteria 2643221558 2643813205 477
54 iso_pu_bacteria 2643221564 2643839068 477
55 iso_pu_bacteria 2643221582 2643916910 477
56 iso_pu_bacteria 2643221595 2643984875 477
57 iso_pu_bacteria 2643221623 2644133247 477
58 iso_pu_bacteria 2643221627 2644153202 477
59 iso_pu_bacteria 2643221693 2644521226 477
60 iso_pu_bacteria 2687453392 2688597214 477
61 iso_pu_bacteria 2693429783 2694628723 477
62 iso_pu_bacteria 2693429784 2694637363 477
63 iso_pu_bacteria 2721755686 2723574416 477
64 iso_pu_bacteria 2738543024 2739307517 477
65 iso_pu_bacteria 2751185800 2753357261 477
66 iso_pu_bacteria 2756170246 2756671504 477
67 iso_pu_bacteria 2757320392 2757571318 477
68 iso_pu_bacteria 2758568016 2758639667 477
69 iso_pu_bacteria 2765235802 2765466354 477
70 iso_pu_bacteria 2767802442 2770198989 477
71 iso_pu_bacteria 2775506902 2776270256 477
72 iso_pu_bacteria 2791355123 2792748001 477
73 iso_pu_bacteria 2808606387 2808989056 477
74 iso_pu_bacteria 2818991439 2819557183 477
75 iso_pu_bacteria 2838675328 2838678277 477
76 iso_pu_bacteria 2838714209 2838716817 477
77 iso_pu_bacteria 2838719591 2838722573 477
78 iso_pu_bacteria 2838724970 2838727566 477
79 iso_pu_bacteria 2839993093 2839998296 477
80 iso_pu_bacteria 2840764183 2840769132 477
81 iso_pu_bacteria 2841734538 2841738119 477
82 iso_pu_bacteria 2841846520 2841849172 477
83 iso_pu_bacteria 2841859092 2841861768 477
84 iso_pu_bacteria 2842124991 2842128079 477
85 iso_pu_bacteria 2842130223 2842133170 477
86 iso_pu_bacteria 2842152218 2842155164 477
87 iso_pu_bacteria 2842170452 2842173663 477
88 iso_pu_bacteria 2842175837 2842178785 477
89 iso_pu_bacteria 2842187318 2842189924 477
90 iso_pu_bacteria 2842211629 2842214238 477
91 iso_pu_bacteria 2842224351 2842226957 477
92 iso_pu_bacteria 2842515876 2842517966 477
93 iso_pu_bacteria 2842871566 2842872296 477
94 iso_pu_bacteria 2844002411 2844008585 477
95 iso_pu_bacteria 2844009547 2844012591 477
96 iso_pu_bacteria 2847686936 2847691097 477
97 iso_pu_bacteria 2854896431 2854900291 477
98 iso_pu_bacteria 2854911287 2854916739 477
99 iso_pu_bacteria 2854916844 2854919541 477
100 iso_pu_bacteria 2856320880 2856323076 477
101 iso_pu_bacteria 2856328259 2856334835 477
102 iso_pu_bacteria 2856334872 2856341614 477
103 iso_pu_bacteria 2856342000 2856347343 477
104 iso_pu_bacteria 2856349417 2856355457 477
105 iso_pu_bacteria 2856356410 2856362642 477
106 iso_pu_bacteria 2856364286 2856368035 477
107 iso_pu_bacteria 2857349434 2857351843 477
108 iso_pu_bacteria 2857367948 2857371263 477
109 iso_pu_bacteria 2869162929 2869163833 477
110 iso_pu_bacteria 2869234852 2869241551 477
111 iso_pu_bacteria 2869242130 2869247874 477
112 iso_pu_bacteria 2869249662 2869251591 477
113 iso_pu_bacteria 2869256925 2869260134 477
114 iso_pu_bacteria 2869264136 2869265207 477
115 iso_pu_bacteria 2869271264 2869271906 477
116 iso_pu_bacteria 2869278585 2869282627 477
117 iso_pu_bacteria 2869285874 2869290346 477
118 iso_pu_bacteria 2871429161 2871432630 477
119 iso_pu_bacteria 2871435913 2871436953 477
120 iso_pu_bacteria 2871451962 2871452301 477
121 iso_pu_bacteria 2871459585 2871460329 477
122 iso_pu_bacteria 2871466892 2871472024 477
123 iso_pu_bacteria 2871474448 2871474826 477
124 iso_pu_bacteria 2871481445 2871484516 477
125 iso_pu_bacteria 2871488783 2871493248 477
126 iso_pu_bacteria 2871495908 2871496773 477
127 iso_pu_bacteria 2874102143 2874108815 477
128 iso_pu_bacteria 2874116593 2874122146 477
129 iso_pu_bacteria 2874123672 2874124091 477
130 iso_pu_bacteria 2874131515 2874134836 477
131 iso_pu_bacteria 2874139085 2874142283 477
132 iso_pu_bacteria 2874146452 2874152597 477
133 iso_pu_bacteria 2874155637 2874159997 477
134 iso_pu_bacteria 2874162495 2874167987 477
135 iso_pu_bacteria 2874168670 2874174816 477
136 iso_pu_bacteria 2876363079 2876365179 477
137 iso_pu_bacteria 2876369609 2876377772 477
138 iso_pu_bacteria 2876377896 2876384842 477
139 iso_pu_bacteria 2876386047 2876387476 477
140 iso_pu_bacteria 2876392853 2876397994 477
141 iso_pu_bacteria 2876399893 2876402830 477
142 iso_pu_bacteria 2876406927 2876410727 477
143 iso_pu_bacteria 2876413966 2876418513 477
144 iso_pu_bacteria 2876420981 2876424288 477
145 iso_pu_bacteria 2878730984 2878735459 477
146 iso_pu_bacteria 2878738818 2878744533 477
147 iso_pu_bacteria 2878745973 2878750244 477
148 iso_pu_bacteria 2878753008 2878757293 477
149 iso_pu_bacteria 2878760144 2878760997 477
150 iso_pu_bacteria 2878767105 2878767961 477
151 iso_pu_bacteria 2878774303 2878778623 477
152 iso_pu_bacteria 2878781027 2878787598 477
153 iso_pu_bacteria 2878788777 2878794980 477
154 iso_pu_bacteria 2881147464 2881149892 477
155 iso_pu_bacteria 2881155292 2881161040 477
156 iso_pu_bacteria 2881161766 2881166773 477
157 iso_pu_bacteria 2881845957 2881848054 477
158 iso_pu_bacteria 2881853255 2881853881 477
159 iso_pu_bacteria 2881861095 2881866787 477
160 iso_pu_bacteria 2882632389 2882632533 477
161 iso_pu_bacteria 2882912400 2882917489 477
162 iso_pu_bacteria 2885305155 2885308289 477
163 iso_pu_bacteria 2885312484 2885312917 477
164 iso_pu_bacteria 2885318864 2885319789 477
165 iso_pu_bacteria 2885334103 2885334736 477
166 iso_pu_bacteria 2885350715 2885355399 477
167 iso_pu_bacteria 2888337043 2888338295 477
168 iso_pu_bacteria 2888343758 2888345898 477
169 iso_pu_bacteria 2888350351 2888355131 477
170 iso_pu_bacteria 2889010040 2889010107 477
171 iso_pu_bacteria 2889016732 2889018220 477
172 iso_pu_bacteria 2889790730 2889791348 477
173 iso_pu_bacteria 2889914905 2889919085 477
174 iso_pu_bacteria 2894652903 2894655584 477
175 iso_pu_bacteria 2899792073 2899792858 477
176 iso_pu_bacteria 2899845264 2899845418 477
177 iso_pu_bacteria 2903448605 2903450179 477
178 iso_pu_bacteria 2903492973 2903501020 477
179 iso_pu_bacteria 2903492973 2903504462 477
180 iso_pu_bacteria 2903521522 2903522086 477
181 iso_pu_bacteria 2903528002 2903528464 477
182 iso_pu_bacteria 2903540706 2903541569 477
183 iso_pu_bacteria 2904578770 2904582277 477
184 iso_pu_bacteria 2904659560 2904664645 477
185 iso_pu_bacteria 2906308376 2906312602 477
186 iso_pu_bacteria 2906321335 2906325311 477
187 iso_pu_bacteria 2906328253 2906330709 477
188 iso_pu_bacteria 2906363423 2906369660 477
189 iso_pu_bacteria 2906370794 2906373345 477
190 iso_pu_bacteria 2906378014 2906384637 477
191 iso_pu_bacteria 2906386501 2906389932 477
192 iso_pu_bacteria 2906401398 2906402527 477
193 iso_pu_bacteria 2906408224 2906411326 477
194 iso_pu_bacteria 2915650412 2915652006 477
195 iso_pu_bacteria 2919100787 2919104512 477
196 iso_pu_bacteria 2919114240 2919117008 477
197 iso_pu_bacteria 2919119836 2919122941 477
198 iso_pu_bacteria 2922158528 2922165226 477
199 iso_pu_bacteria 2922172374 2922172770 477
200 iso_pu_bacteria 2922185730 2922190610 477
201 iso_pu_bacteria 2924718760 2924719828 477
202 iso_pu_bacteria 2924726620 2924727508 477
203 iso_pu_bacteria 2924733363 2924737905 477
204 iso_pu_bacteria 2924741084 2924745802 477
205 iso_pu_bacteria 2924754689 2924762454 477
206 iso_pu_bacteria 2924762789 2924768114 477
207 iso_pu_bacteria 2924776078 2924782563 477
208 iso_pu_bacteria 2924784321 2924786598 477
209 iso_pu_bacteria 2926754445 2926758521 477
210 iso_pu_bacteria 2926760298 2926763947 477
211 iso_pu_bacteria 2928521798 2928524217 477
212 iso_pu_bacteria 2933006813 2933009457 477
213 iso_pu_bacteria 2933011516 2933013595 477
214 iso_pu_bacteria 2933594066 2933598152 477
215 iso_pu_bacteria 2937813078 2937819253 477
216 iso_pu_bacteria 2937822353 2937827804 477
217 iso_pu_bacteria 2937836603 2937842648 477
218 iso_pu_bacteria 2937848649 2937852032 477
219 iso_pu_bacteria 2937861824 2937862691 477
220 iso_pu_bacteria 2937868953 2937876295 477
221 iso_pu_bacteria 2937877337 2937881206 477
222 iso_pu_bacteria 2937891427 2937893821 477
223 iso_pu_bacteria 2937972304 2937977296 477
224 iso_pu_bacteria 2937980651 2937982519 477
225 iso_pu_bacteria 2937994558 2937995426 477
226 iso_pu_bacteria 2938014810 2938021136 477
227 iso_pu_bacteria 2954011201 2954013164 477
228 iso_pu_bacteria 2958034702 2958039410 477
229 iso_pu_bacteria 2958041894 2958052962 477
230 iso_pu_bacteria 2958041894 2958056449 477
231 iso_pu_bacteria 2958064165 2958064917 477
232 iso_pu_bacteria 2958071322 2958073754 477
233 iso_pu_bacteria 2958084443 2958088237 477
234 iso_pu_bacteria 2958100919 2958102181 477
235 iso_pu_bacteria 2958115193 2958115487 477
236 iso_pu_bacteria 2958122699 2958129448 477
237 iso_pu_bacteria 2958130278 2958134734 477
238 iso_pu_bacteria 2958137437 2958139938 477
239 iso_pu_bacteria 2958144490 2958151020 477
240 iso_pu_bacteria 2958158011 2958158728 477
241 iso_pu_bacteria 2958165035 2958165899 477
242 iso_pu_bacteria 2958172287 2958174115 477
243 iso_pu_bacteria 2958179912 2958186486 477
244 iso_pu_bacteria 2961077736 2961084985 477
245 iso_pu_bacteria 2961114664 2961119643 477
246 iso_pu_bacteria 2961127735 2961133139 477
247 iso_pu_bacteria 2961136820 2961137250 477
248 iso_pu_bacteria 2961163497 2961164362 477
249 iso_pu_bacteria 2961170736 2961175378 477
250 iso_pu_bacteria 2961183825 2961190230 477
251 iso_pu_bacteria 2963644680 2963646634 477
252 iso_pu_bacteria 2965018300 2965019348 477
253 iso_pu_bacteria 2965025482 2965027590 477
254 iso_pu_bacteria 2965032056 2965033270 477
255 iso_pu_bacteria 2965040258 2965043468 477
256 iso_pu_bacteria 2965047637 2965048960 477
257 iso_pu_bacteria 2965062239 2965062511 477
258 iso_pu_bacteria 2965089291 2965089583 477
259 iso_pu_bacteria 2965119406 2965123051 477
260 iso_pu_bacteria 2967996073 2967999620 477
261 iso_pu_bacteria 2968003550 2968007978 477
262 iso_pu_bacteria 2968016561 2968020737 477
263 iso_pu_bacteria 2968083720 2968090573 477
264 iso_pu_bacteria 2968091066 2968094745 477
265 iso_pu_bacteria 2968097103 2968103112 477
266 iso_pu_bacteria 2968110612 2968115898 477
267 iso_pu_bacteria 2968117919 2968119285 477
268 iso_pu_bacteria 2968128360 2968133685 477
269 iso_pu_bacteria 2968138860 2968142667 477
270 iso_pu_bacteria 2968171901 2968172763 477
271 iso_pu_bacteria 2970469710 2970474034 477
272 iso_pu_bacteria 2970489779 2970490673 477
273 iso_pu_bacteria 2970503327 2970507966 477
274 iso_pu_bacteria 2970510686 2970515331 477
275 iso_pu_bacteria 2970524798 2970527352 477
276 iso_pu_bacteria 2970540015 2970544680 477
277 iso_pu_bacteria 2970547951 2970552291 477
278 iso_pu_bacteria 2970554993 2970555855 477
279 iso_pu_bacteria 2970593180 2970597236 477
280 iso_pu_bacteria 2970627176 2970632740 477
281 iso_pu_bacteria 2977821940 2977826452 477
282 iso_pu_bacteria 2977828996 2977830304 477
283 iso_pu_bacteria 2977843712 2977848390 477
284 iso_pu_bacteria 2977851361 2977855562 477
285 iso_pu_bacteria 2977864932 2977865142 477
286 iso_pu_bacteria 2977872689 2977880107 477
287 iso_pu_bacteria 2977898635 2977906728 477
288 iso_pu_bacteria 2977907340 2977913904 477
289 iso_pu_bacteria 2977915119 2977916608 477
290 iso_pu_bacteria 2977922695 2977922954 477
291 iso_pu_bacteria 2977935797 2977940300 477
292 iso_pu_bacteria 2977942078 2977944763 477
293 iso_pu_bacteria 2977950692 2977952130 477
294 iso_pu_bacteria 2977957713 2977962328 477
295 iso_pu_bacteria 2977971508 2977974297 477
296 iso_pu_bacteria 2977986579 2977987806 477
297 iso_pu_bacteria 2979089926 2979090955 477
298 iso_pu_bacteria 2979100975 2979102215 477
299 iso_pu_bacteria 2979710463 2979713893 477
300 iso_pu_bacteria 2979742915 2979751324 477
301 iso_pu_bacteria 2979764755 2979770656 477
302 iso_pu_bacteria 2979772303 2979779282 477
303 iso_pu_bacteria 2979779861 2979785294 477
304 iso_pu_bacteria 2979793036 2979797575 477
305 iso_pu_bacteria 2979808191 2979813150 477
306 iso_pu_bacteria 2984509177 2984509837 477
307 iso_pu_bacteria 2984518228 2984519466 477
308 iso_pu_bacteria 2984537506 2984538176 477
309 iso_pu_bacteria 2984601300 2984604928 477
310 iso_pu_bacteria 2987636660 2987639027 477
311 iso_pu_bacteria 2987645492 2987647027 477
312 iso_pu_bacteria 2987652177 2987656065 477
313 iso_pu_bacteria 2987659509 2987660366 477
314 iso_pu_bacteria 2987666974 2987671464 477
315 iso_pu_bacteria 2987673487 2987680976 477
316 iso_pu_bacteria 2996310559 2996312116 477
317 iso_pu_bacteria 2996336353 2996338742 477
318 iso_pu_bacteria 2996348954 2996352646 477
319 iso_pu_bacteria 2996386984 2996389996 477
320 iso_pu_bacteria 3000135777 3000139601 477
321 iso_pu_bacteria 3004167301 3004167629 477
322 iso_pu_bacteria 3004188549 3004189417 477
323 iso_pu_bacteria 3004195979 3004203215 477
324 iso_pu_bacteria 3004203850 3004204730 477
325 iso_pu_bacteria 3004211236 3004218031 477
326 iso_pu_bacteria 3004218560 3004220921 477
327 iso_pu_bacteria 3004232784 3004234123 477
328 iso_pu_bacteria 3004239961 3004244116 477
329 iso_pu_bacteria 3004248173 3004249889 477
330 iso_pu_bacteria 3004268573 3004273930 477
331 iso_pu_bacteria 3004275668 3004279328 477
332 iso_pu_bacteria 3004289098 3004289268 477
333 iso_pu_bacteria 3004334049 3004335769 477
334 iso_pu_bacteria 3005445848 3005449227 477
335 iso_pu_bacteria 649633066 649871768 477
336 iso_pu_bacteria 650716007 650843405 477
337 iso_pu_bacteria 8002285264 8002291641 477
338 iso_pu_bacteria 8003570095 8003573002 477
339 iso_pu_bacteria 8004300914 8004302666 477
340 iso_pu_bacteria 8004312739 8004314180 477
341 iso_pu_bacteria 8004361976 8004362199 477
342 iso_pu_bacteria 8004374579 8004378868 477
343 iso_pu_bacteria 8004387939 8004392552 477
344 iso_pu_bacteria 8004395343 8004399313 477
345 iso_pu_bacteria 8004633249 8004633395 477
346 iso_pu_bacteria 8004640170 8004645156 477
347 iso_pu_bacteria 8004695233 8004699335 477
348 iso_pu_bacteria 8004703790 8004712081 477
349 iso_pu_bacteria 8004714634 8004718861 477
350 iso_pu_bacteria 8004727605 8004733726 477
351 iso_pu_bacteria 8054460903 8054463428 477
352 iso_pu_bacteria 8055617313 8055619442 477
353 iso_pu_bacteria 8056875544 8056876122 477
354 iso_pu_bacteria 2519899620 2520377898 478
355 iso_pu_bacteria 2894817345 2894818569 478
356 iso_pu_bacteria 2508501122 2509109796 479
357 iso_pu_bacteria 2509276019 2509379052 479
358 iso_pu_bacteria 2509276021 2509386430 479
359 iso_pu_bacteria 2509276021 2509389893 479
360 iso_pu_bacteria 2509276033 2509447861 479
361 iso_pu_bacteria 2510065019 2510134794 479
362 iso_pu_bacteria 2510065057 2510303637 479
363 iso_pu_bacteria 2510461076 2510896200 479
364 iso_pu_bacteria 2510917022 2511136607 479
365 iso_pu_bacteria 2510917026 2511170730 479
366 iso_pu_bacteria 2510917028 2511185144 479
367 iso_pu_bacteria 2511231052 2511502944 479
368 iso_pu_bacteria 2512047086 2512534187 479
369 iso_pu_bacteria 2512875026 2512973977 479
370 iso_pu_bacteria 2513237084 2513572559 479
371 iso_pu_bacteria 2513237085 2513581274 479
372 iso_pu_bacteria 2513237086 2513585271 479
373 iso_pu_bacteria 2513237088 2513597123 479
374 iso_pu_bacteria 2513237089 2513602305 479
375 iso_pu_bacteria 2513237091 2513620107 479
376 iso_pu_bacteria 2513237093 2513631367 479
377 iso_pu_bacteria 2513237103 2513710698 479
378 iso_pu_bacteria 2513237138 2513870860 479
379 iso_pu_bacteria 2513237140 2513885852 479
380 iso_pu_bacteria 2513237143 2513902872 479
381 iso_pu_bacteria 2513237144 2513908241 479
382 iso_pu_bacteria 2513237146 2513926895 479
383 iso_pu_bacteria 2513237156 2513985968 479
384 iso_pu_bacteria 2513237159 2513998048 479
385 iso_pu_bacteria 2513237160 2514003948 479
386 iso_pu_bacteria 2513237162 2514022383 479
387 iso_pu_bacteria 2515075009 2515113879 479
388 iso_pu_bacteria 2515154107 2515610395 479
389 iso_pu_bacteria 2515154113 2515634752 479
390 iso_pu_bacteria 2515154114 2515645946 479
391 iso_pu_bacteria 2515154116 2515656827 479
392 iso_pu_bacteria 2515154134 2515743606 479
393 iso_pu_bacteria 2516143018 2516205190 479
394 iso_pu_bacteria 2516653046 2516894349 479
395 iso_pu_bacteria 2516653077 2517037495 479
396 iso_pu_bacteria 2516653085 2517077794 479
397 iso_pu_bacteria 2517093000 2517096593 479
398 iso_pu_bacteria 2517287029 2517410309 479
399 iso_pu_bacteria 2517487022 2517570959 479
400 iso_pu_bacteria 2524023207 2524451816 479
401 iso_pu_bacteria 2524023209 2524460118 479
402 iso_pu_bacteria 2529292951 2530646904 479
403 iso_pu_bacteria 2534681796 2535519494 479
404 iso_pu_bacteria 2551306085 2551685992 479
405 iso_pu_bacteria 2558860100 2558860370 479
406 iso_pu_bacteria 2582581283 2585167985 479
407 iso_pu_bacteria 2582581294 2585202525 479
408 iso_pu_bacteria 2582581299 2585227768 479
409 iso_pu_bacteria 2582581304 2585257758 479
410 iso_pu_bacteria 2582581306 2585265410 479
411 iso_pu_bacteria 2582581307 2585274236 479
412 iso_pu_bacteria 2582581308 2585280351 479
413 iso_pu_bacteria 2582581315 2585322629 479
414 iso_pu_bacteria 2582581316 2585330742 479
415 iso_pu_bacteria 2582581865 2585388509 479
416 iso_pu_bacteria 2582581866 2585392385 479
417 iso_pu_bacteria 2582581867 2585402164 479
418 iso_pu_bacteria 2585427526 2585530223 479
419 iso_pu_bacteria 2585427527 2585532581 479
420 iso_pu_bacteria 2585427528 2585541067 479
421 iso_pu_bacteria 2585427530 2585554403 479
422 iso_pu_bacteria 2585427531 2585560685 479
423 iso_pu_bacteria 2585427590 2585822536 479
424 iso_pu_bacteria 2585427593 2585839829 479
425 iso_pu_bacteria 2585427594 2585845285 479
426 iso_pu_bacteria 2585427608 2585898891 479
427 iso_pu_bacteria 2585427609 2585903517 479
428 iso_pu_bacteria 2585427633 2585997091 479
429 iso_pu_bacteria 2585427634 2586001690 479
430 iso_pu_bacteria 2585428125 2587981364 479
431 iso_pu_bacteria 2599185156 2599334782 479
432 iso_pu_bacteria 2599185170 2599420611 479
433 iso_pu_bacteria 2599185352 2600194594 479
434 iso_pu_bacteria 2615840624 2616295508 479
435 iso_pu_bacteria 2615840626 2616307348 479
436 iso_pu_bacteria 2615840698 2616554892 479
437 iso_pu_bacteria 2617270742 2617383564 479
438 iso_pu_bacteria 2643221557 2643804129 479
439 iso_pu_bacteria 2643221599 2644006349 479
440 iso_pu_bacteria 2643221607 2644051074 479
441 iso_pu_bacteria 2643221610 2644064929 479
442 iso_pu_bacteria 2643221618 2644108528 479
443 iso_pu_bacteria 2643221626 2644145574 479
444 iso_pu_bacteria 2643221634 2644195828 479
445 iso_pu_bacteria 2643221636 2644205554 479
446 iso_pu_bacteria 2643221643 2644241809 479
447 iso_pu_bacteria 2643221655 2644312349 479
448 iso_pu_bacteria 2643221659 2644335977 479
449 iso_pu_bacteria 2643221668 2644376129 479
450 iso_pu_bacteria 2643221675 2644416602 479
451 iso_pu_bacteria 2643221680 2644449642 479
452 iso_pu_bacteria 2643221686 2644483978 479
453 iso_pu_bacteria 2643221688 2644496331 479
454 iso_pu_bacteria 2643221689 2644500240 479
455 iso_pu_bacteria 2643221698 2644546834 479
456 iso_pu_bacteria 2643221712 2644618032 479
457 iso_pu_bacteria 2643221718 2644653462 479
458 iso_pu_bacteria 2643221723 2644676791 479
459 iso_pu_bacteria 2643221726 2644688217 479
460 iso_pu_bacteria 2657244999 2657684027 479
461 iso_pu_bacteria 2667528174 2671112141 479
462 iso_pu_bacteria 2690316117 2692314552 479
463 iso_pu_bacteria 2718217882 2719182551 479
464 iso_pu_bacteria 2718217927 2719387221 479
465 iso_pu_bacteria 2718217997 2719666861 479
466 iso_pu_bacteria 2718218009 2719733270 479
467 iso_pu_bacteria 2718218199 2720493281 479
468 iso_pu_bacteria 2718218232 2720614756 479
469 iso_pu_bacteria 2718218233 2720621529 479
470 iso_pu_bacteria 2718218235 2720632857 479
471 iso_pu_bacteria 2718218269 2720776581 479
472 iso_pu_bacteria 2718218363 2721148664 479
473 iso_pu_bacteria 2718218365 2721160050 479
474 iso_pu_bacteria 2718218366 2721165478 479
475 iso_pu_bacteria 2718218423 2721400856 479
476 iso_pu_bacteria 2721755514 2722841648 479
477 iso_pu_bacteria 2721755556 2723028169 479
478 iso_pu_bacteria 2721755684 2723561800 479
479 iso_pu_bacteria 2721755685 2723568429 479
480 iso_pu_bacteria 2721755809 2724039669 479
481 iso_pu_bacteria 2721755810 2724046026 479
482 iso_pu_bacteria 2721755819 2724091188 479
483 iso_pu_bacteria 2721755822 2724105694 479
484 iso_pu_bacteria 2721755823 2724111523 479
485 iso_pu_bacteria 2724679232 2725947781 479
486 iso_pu_bacteria 2728369352 2730109105 479
487 iso_pu_bacteria 2728369365 2730165786 479
488 iso_pu_bacteria 2728369397 2730299682 479
489 iso_pu_bacteria 2738541293 2738800509 479
490 iso_pu_bacteria 2738541333 2739035620 479
491 iso_pu_bacteria 2751185821 2753458658 479
492 iso_pu_bacteria 2765235942 2766065370 479
493 iso_pu_bacteria 2775507266 2778175958 479
494 iso_pu_bacteria 2791355082 2792582590 479
495 iso_pu_bacteria 2791355091 2792622952 479
496 iso_pu_bacteria 2791355092 2792629206 479
497 iso_pu_bacteria 2791355094 2792640442 479
498 iso_pu_bacteria 2791355256 2793293697 479
499 iso_pu_bacteria 2791355259 2793313120 479
500 iso_pu_bacteria 2791355260 2793319768 479
501 iso_pu_bacteria 2791355261 2793327725 479
502 iso_pu_bacteria 2791355262 2793333318 479
503 iso_pu_bacteria 2791355263 2793344259 479
504 iso_pu_bacteria 2791355264 2793347324 479
505 iso_pu_bacteria 2791355265 2793353648 479
506 iso_pu_bacteria 2791355266 2793359784 479
507 iso_pu_bacteria 2791355267 2793369501 479
508 iso_pu_bacteria 2802428858 2802717951 479
509 iso_pu_bacteria 2802428859 2802725198 479
510 iso_pu_bacteria 2802428860 2802730678 479
511 iso_pu_bacteria 2802428861 2802738025 479
512 iso_pu_bacteria 2802428862 2802744105 479
513 iso_pu_bacteria 2802428863 2802750984 479
514 iso_pu_bacteria 2802429268 2804753283 479
515 iso_pu_bacteria 2802429605 2805930544 479
516 iso_pu_bacteria 2802429606 2805934276 479
517 iso_pu_bacteria 2802429633 2806044608 479
518 iso_pu_bacteria 2802429634 2806052808 479
519 iso_pu_bacteria 2802429635 2806059108 479
520 iso_pu_bacteria 2802429636 2806068229 479
521 iso_pu_bacteria 2802429637 2806074349 479
522 iso_pu_bacteria 2818991448 2819609653 479
523 iso_pu_bacteria 2818991453 2819639750 479
524 iso_pu_bacteria 2818991461 2819685620 479
525 iso_pu_bacteria 2837651117 2837653394 479
526 iso_pu_bacteria 2838016132 2838019057 479
527 iso_pu_bacteria 2838022645 2838024347 479
528 iso_pu_bacteria 2838029111 2838033080 479
529 iso_pu_bacteria 2838035591 2838040715 479
530 iso_pu_bacteria 2838042994 2838046304 479
531 iso_pu_bacteria 2838048938 2838051225 479
532 iso_pu_bacteria 2838061910 2838063799 479
533 iso_pu_bacteria 2838068647 2838073282 479
534 iso_pu_bacteria 2838074704 2838077391 479
535 iso_pu_bacteria 2838661181 2838664898 479
536 iso_pu_bacteria 2838668709 2838671192 479
537 iso_pu_bacteria 2838680041 2838685009 479
538 iso_pu_bacteria 2838686498 2838691372 479
539 iso_pu_bacteria 2838694306 2838699154 479
540 iso_pu_bacteria 2838701080 2838703628 479
541 iso_pu_bacteria 2838707686 2838712635 479
542 iso_pu_bacteria 2838729681 2838733331 479
543 iso_pu_bacteria 2838742623 2838746097 479
544 iso_pu_bacteria 2841851746 2841853809 479
545 iso_pu_bacteria 2841864319 2841868222 479
546 iso_pu_bacteria 2842077413 2842082112 479
547 iso_pu_bacteria 2842110456 2842113486 479
548 iso_pu_bacteria 2842118031 2842123034 479
549 iso_pu_bacteria 2842146304 2842149370 479
550 iso_pu_bacteria 2842156927 2842162184 479
551 iso_pu_bacteria 2842163707 2842169739 479
552 iso_pu_bacteria 2842180545 2842185110 479
553 iso_pu_bacteria 2842192696 2842198308 479
554 iso_pu_bacteria 2842198810 2842199890 479
555 iso_pu_bacteria 2842205361 2842208251 479
556 iso_pu_bacteria 2842217011 2842220128 479
557 iso_pu_bacteria 2842229732 2842233548 479
558 iso_pu_bacteria 2842237096 2842242063 479
559 iso_pu_bacteria 2842243621 2842247641 479
560 iso_pu_bacteria 2842250916 2842253992 479
561 iso_pu_bacteria 2842257432 2842262091 479
562 iso_pu_bacteria 2842264693 2842266562 479
563 iso_pu_bacteria 2842271015 2842275846 479
564 iso_pu_bacteria 2842278818 2842281740 479
565 iso_pu_bacteria 2842285085 2842288847 479
566 iso_pu_bacteria 2842291075 2842296112 479
567 iso_pu_bacteria 2842298080 2842298656 479
568 iso_pu_bacteria 2842304105 2842308170 479
569 iso_pu_bacteria 2842311132 2842315547 479
570 iso_pu_bacteria 2842317721 2842321444 479
571 iso_pu_bacteria 2842341865 2842344950 479
572 iso_pu_bacteria 2842357229 2842359477 479
573 iso_pu_bacteria 2842363717 2842369998 479
574 iso_pu_bacteria 2842370503 2842375687 479
575 iso_pu_bacteria 2842377471 2842382511 479
576 iso_pu_bacteria 2842384541 2842389912 479
577 iso_pu_bacteria 2842395702 2842398570 479
578 iso_pu_bacteria 2842402390 2842406486 479
579 iso_pu_bacteria 2842409023 2842413087 479
580 iso_pu_bacteria 2842415677 2842419730 479
581 iso_pu_bacteria 2842422224 2842426916 479
582 iso_pu_bacteria 2842428310 2842429881 479
583 iso_pu_bacteria 2842434925 2842436459 479
584 iso_pu_bacteria 2842441272 2842444162 479
585 iso_pu_bacteria 2842447887 2842450980 479
586 iso_pu_bacteria 2842462802 2842464302 479
587 iso_pu_bacteria 2842469257 2842470788 479
588 iso_pu_bacteria 2842475841 2842479813 479
589 iso_pu_bacteria 2842482326 2842483441 479
590 iso_pu_bacteria 2842489311 2842493222 479
591 iso_pu_bacteria 2842495871 2842499210 479
592 iso_pu_bacteria 2842502639 2842506989 479
593 iso_pu_bacteria 2842509118 2842510684 479
594 iso_pu_bacteria 2842521101 2842523153 479
595 iso_pu_bacteria 2842922631 2842925909 479
596 iso_pu_bacteria 2844454524 2844457546 479
597 iso_pu_bacteria 2847417321 2847420396 479
598 iso_pu_bacteria 2848992105 2848995202 479
599 iso_pu_bacteria 2850079185 2850082268 479
600 iso_pu_bacteria 2852387548 2852391141 479
601 iso_pu_bacteria 2855825444 2855826984 479
602 iso_pu_bacteria 2855839649 2855842380 479
603 iso_pu_bacteria 2855872281 2855878477 479
604 iso_pu_bacteria 2857516855 2857518953 479
605 iso_pu_bacteria 2858800743 2858803196 479
606 iso_pu_bacteria 2891373044 2891377556 479
607 iso_pu_bacteria 2896384573 2896386404 479
608 iso_pu_bacteria 2913295892 2913299801 479
609 iso_pu_bacteria 2915980308 2915980505 479
610 iso_pu_bacteria 2915986958 2915987421 479
611 iso_pu_bacteria 2915993759 2915996699 479
612 iso_pu_bacteria 2916000859 2916005109 479
613 iso_pu_bacteria 2916007675 2916014092 479
614 iso_pu_bacteria 2916014648 2916016965 479
615 iso_pu_bacteria 2916021584 2916026427 479
616 iso_pu_bacteria 2916028427 2916029263 479
617 iso_pu_bacteria 2916035215 2916038361 479
618 iso_pu_bacteria 2916041962 2916044881 479
619 iso_pu_bacteria 2916048683 2916049235 479
620 iso_pu_bacteria 2916055098 2916058200 479
621 iso_pu_bacteria 2916061851 2916067083 479
622 iso_pu_bacteria 2916068649 2916073982 479
623 iso_pu_bacteria 2916076590 2916080368 479
624 iso_pu_bacteria 2919171160 2919173340 479
625 iso_pu_bacteria 2919408235 2919410626 479
626 iso_pu_bacteria 2920760137 2920760820 479
627 iso_pu_bacteria 2920822456 2920828534 479
628 iso_pu_bacteria 2921201388 2921202251 479
629 iso_pu_bacteria 2921208531 2921213333 479
630 iso_pu_bacteria 2921237296 2921242334 479
631 iso_pu_bacteria 2921244191 2921247758 479
632 iso_pu_bacteria 2921250672 2921255339 479
633 iso_pu_bacteria 2921257292 2921260138 479
634 iso_pu_bacteria 2921263974 2921266133 479
635 iso_pu_bacteria 2921282425 2921288337 479
636 iso_pu_bacteria 2921289301 2921294715 479
637 iso_pu_bacteria 2921296804 2921298721 479
638 iso_pu_bacteria 2923556063 2923558799 479
639 iso_pu_bacteria 2924144063 2924148251 479
640 iso_pu_bacteria 2924150972 2924152279 479
641 iso_pu_bacteria 2924158325 2924164027 479
642 iso_pu_bacteria 2924165586 2924168665 479
643 iso_pu_bacteria 2924172951 2924176928 479
644 iso_pu_bacteria 2924179722 2924183815 479
645 iso_pu_bacteria 2924186466 2924189984 479
646 iso_pu_bacteria 2924193448 2924193727 479
647 iso_pu_bacteria 2924200457 2924202681 479
648 iso_pu_bacteria 2924207177 2924213451 479
649 iso_pu_bacteria 2924214083 2924220314 479
650 iso_pu_bacteria 2924221636 2924221814 479
651 iso_pu_bacteria 2924228884 2924232446 479
652 iso_pu_bacteria 2933016740 2933020628 479
653 iso_pu_bacteria 2933570622 2933574619 479
654 iso_pu_bacteria 2933586486 2933589224 479
655 iso_pu_bacteria 2933599457 2933603588 479
656 iso_pu_bacteria 2935894831 2935899784 479
657 iso_pu_bacteria 2935901341 2935906948 479
658 iso_pu_bacteria 2936367885 2936374921 479
659 iso_pu_bacteria 2936375103 2936380612 479
660 iso_pu_bacteria 2936381700 2936382213 479
661 iso_pu_bacteria 2936996657 2936999992 479
662 iso_pu_bacteria 2937002841 2937007036 479
663 iso_pu_bacteria 2937009748 2937015505 479
664 iso_pu_bacteria 2937016420 2937018225 479
665 iso_pu_bacteria 2937023124 2937026754 479
666 iso_pu_bacteria 2937029754 2937033053 479
667 iso_pu_bacteria 2937036028 2937042165 479
668 iso_pu_bacteria 2937042894 2937047861 479
669 iso_pu_bacteria 2937049772 2937052392 479
670 iso_pu_bacteria 2937056579 2937062188 479
671 iso_pu_bacteria 2937063883 2937069412 479
672 iso_pu_bacteria 2937071275 2937078279 479
673 iso_pu_bacteria 2937078374 2937078572 479
674 iso_pu_bacteria 2937084907 2937087249 479
675 iso_pu_bacteria 2937091812 2937093444 479
676 iso_pu_bacteria 2937098957 2937102264 479
677 iso_pu_bacteria 2937106411 2937111362 479
678 iso_pu_bacteria 2937113482 2937114890 479
679 iso_pu_bacteria 2937119839 2937123649 479
680 iso_pu_bacteria 2937126314 2937129373 479
681 iso_pu_bacteria 2941499720 2941501741 479
682 iso_pu_bacteria 2957375807 2957377497 479
683 iso_pu_bacteria 2957382221 2957386134 479
684 iso_pu_bacteria 2957388812 2957392113 479
685 iso_pu_bacteria 2957395598 2957398453 479
686 iso_pu_bacteria 2957402308 2957406315 479
687 iso_pu_bacteria 2957408893 2957409068 479
688 iso_pu_bacteria 2957415311 2957419927 479
689 iso_pu_bacteria 2957422303 2957429404 479
690 iso_pu_bacteria 2957430029 2957435006 479
691 iso_pu_bacteria 2957437181 2957437330 479
692 iso_pu_bacteria 2957443900 2957449498 479
693 iso_pu_bacteria 2957450854 2957456287 479
694 iso_pu_bacteria 2957457609 2957459054 479
695 iso_pu_bacteria 2957464669 2957468355 479
696 iso_pu_bacteria 2957471148 2957475155 479
697 iso_pu_bacteria 2957478035 2957481151 479
698 iso_pu_bacteria 2957484790 2957487560 479
699 iso_pu_bacteria 2957491536 2957495323 479
700 iso_pu_bacteria 2957498199 2957503538 479
701 iso_pu_bacteria 2957505466 2957508703 479
702 iso_pu_bacteria 2960584000 2960589192 479
703 iso_pu_bacteria 2960591022 2960591220 479
704 iso_pu_bacteria 2960597568 2960601292 479
705 iso_pu_bacteria 2960603979 2960608318 479
706 iso_pu_bacteria 2960610863 2960616648 479
707 iso_pu_bacteria 2960617483 2960623497 479
708 iso_pu_bacteria 2960624210 2960626583 479
709 iso_pu_bacteria 2960631154 2960635073 479
710 iso_pu_bacteria 2960637947 2960639111 479
711 iso_pu_bacteria 2960645483 2960650106 479
712 iso_pu_bacteria 2960652885 2960656714 479
713 iso_pu_bacteria 2960660292 2960665325 479
714 iso_pu_bacteria 2960667422 2960671547 479
715 iso_pu_bacteria 2960674078 2960678305 479
716 iso_pu_bacteria 2960680706 2960681301 479
717 iso_pu_bacteria 2960687367 2960692406 479
718 iso_pu_bacteria 2960693952 2960696407 479
719 iso_pu_bacteria 2964607997 2964612960 479
720 iso_pu_bacteria 2964615318 2964620452 479
721 iso_pu_bacteria 2964621998 2964628504 479
722 iso_pu_bacteria 2964628898 2964633550 479
723 iso_pu_bacteria 2964636051 2964641266 479
724 iso_pu_bacteria 2964643177 2964647292 479
725 iso_pu_bacteria 2964649959 2964652316 479
726 iso_pu_bacteria 2964656573 2964657749 479
727 iso_pu_bacteria 2964663802 2964670056 479
728 iso_pu_bacteria 2964670856 2964675034 479
729 iso_pu_bacteria 2964678106 2964681842 479
730 iso_pu_bacteria 2964685014 2964688181 479
731 iso_pu_bacteria 2964691889 2964697653 479
732 iso_pu_bacteria 2964698721 2964703009 479
733 iso_pu_bacteria 2964705432 2964712103 479
734 iso_pu_bacteria 2964712639 2964717491 479
735 iso_pu_bacteria 2964719344 2964720496 479
736 iso_pu_bacteria 2967664464 2967665319 479
737 iso_pu_bacteria 2967671571 2967674399 479
738 iso_pu_bacteria 2967678726 2967684098 479
739 iso_pu_bacteria 2967686174 2967689361 479
740 iso_pu_bacteria 2967693043 2967696210 479
741 iso_pu_bacteria 2967699805 2967700956 479
742 iso_pu_bacteria 2967706974 2967710054 479
743 iso_pu_bacteria 2967714385 2967720028 479
744 iso_pu_bacteria 2967721400 2967724842 479
745 iso_pu_bacteria 2967728569 2967732545 479
746 iso_pu_bacteria 2967735183 2967735336 479
747 iso_pu_bacteria 2967742019 2967747254 479
748 iso_pu_bacteria 2967748971 2967752391 479
749 iso_pu_bacteria 2967755722 2967758889 479
750 iso_pu_bacteria 2967762386 2967768524 479
751 iso_pu_bacteria 2967769361 2967772790 479
752 iso_pu_bacteria 2967775926 2967776408 479
753 iso_pu_bacteria 2970019648 2970022229 479
754 iso_pu_bacteria 2970026789 2970028246 479
755 iso_pu_bacteria 2970033650 2970039590 479
756 iso_pu_bacteria 2970040964 2970043450 479
757 iso_pu_bacteria 2970047711 2970050592 479
758 iso_pu_bacteria 2970054988 2970058424 479
759 iso_pu_bacteria 2970061556 2970066855 479
760 iso_pu_bacteria 2970068827 2970073985 479
761 iso_pu_bacteria 2970076120 2970079168 479
762 iso_pu_bacteria 2970082768 2970083475 479
763 iso_pu_bacteria 2970088815 2970090085 479
764 iso_pu_bacteria 2970095765 2970100404 479
765 iso_pu_bacteria 2970102677 2970108915 479
766 iso_pu_bacteria 2970109326 2970112744 479
767 iso_pu_bacteria 2970116247 2970121297 479
768 iso_pu_bacteria 2970122695 2970126522 479
769 iso_pu_bacteria 2970129317 2970134385 479
770 iso_pu_bacteria 2970136068 2970141260 479
771 iso_pu_bacteria 2970143518 2970146574 479
772 iso_pu_bacteria 2970149975 2970152767 479
773 iso_pu_bacteria 2970156795 2970163621 479
774 iso_pu_bacteria 2970164137 2970166774 479
775 iso_pu_bacteria 2970170962 2970173433 479
776 iso_pu_bacteria 2970177841 2970180727 479
777 iso_pu_bacteria 2970184632 2970187705 479
778 iso_pu_bacteria 2970191845 2970195114 479
779 iso_pu_bacteria 2977516862 2977523701 479
780 iso_pu_bacteria 2977523885 2977528067 479
781 iso_pu_bacteria 2977530762 2977534297 479
782 iso_pu_bacteria 2977537788 2977541055 479
783 iso_pu_bacteria 2977544691 2977548039 479
784 iso_pu_bacteria 2977551784 2977556935 479
785 iso_pu_bacteria 2977558990 2977563989 479
786 iso_pu_bacteria 2977565890 2977567213 479
787 iso_pu_bacteria 2977572785 2977576067 479
788 iso_pu_bacteria 2977579622 2977579798 479
789 iso_pu_bacteria 2989349275 2989354690 479
790 iso_pu_bacteria 2989771324 2989773477 479
791 iso_pu_bacteria 2996887358 2996890605 479
792 iso_pu_bacteria 2996893221 2996896325 479
793 iso_pu_bacteria 3003930520 3003934884 479
794 iso_pu_bacteria 3005409236 3005415545 479
795 iso_pu_bacteria 3005416602 3005418538 479
796 iso_pu_bacteria 3005452660 3005455493 479
797 iso_pu_bacteria 639633055 639649951 479
798 iso_pu_bacteria 643692032 643827039 479
799 iso_pu_bacteria 648276728 648735890 479
800 iso_pu_bacteria 8003992118 8003994920 479
801 iso_pu_bacteria 8003999396 8004002674 479
802 iso_pu_bacteria 8005258706 8005264276 479
803 iso_pu_bacteria 8005275841 8005281950 479
804 iso_pu_bacteria 8005282627 8005288938 479
805 iso_pu_bacteria 8005289223 8005294320 479
806 iso_pu_bacteria 8005301065 8005306726 479
807 iso_pu_bacteria 8005307578 8005311217 479
808 iso_pu_bacteria 8005314921 8005318570 479
809 iso_pu_bacteria 8005321885 8005325132 479
810 iso_pu_bacteria 8005376324 8005378243 479
811 iso_pu_bacteria 8005382845 8005383892 479
812 iso_pu_bacteria 8005395548 8005401218 479
813 iso_pu_bacteria 8005430974 8005434170 479
814 iso_pu_bacteria 8005460587 8005464566 479
815 iso_pu_bacteria 8005484373 8005488547 479
816 iso_pu_bacteria 8005497431 8005501612 479
817 iso_pu_bacteria 8005542996 8005547187 479
818 iso_pu_bacteria 8005556819 8005558433 479
819 iso_pu_bacteria 8005563573 8005566723 479
820 iso_pu_bacteria 8005570704 8005574994 479
821 iso_pu_bacteria 8005619151 8005622969 479
822 iso_pu_bacteria 8005626139 8005631728 479
823 iso_pu_bacteria 8005645114 8005649014 479
824 iso_pu_bacteria 8005668836 8005673033 479
825 iso_pu_bacteria 8005682033 8005682254 479
826 iso_pu_bacteria 8005688590 8005693579 479
827 iso_pu_bacteria 8005695170 8005700806 479
828 iso_pu_bacteria 8018127388 8018133664 479
829 iso_pu_bacteria 8018163183 8018170167 479
830 iso_pu_bacteria 8018176218 8018178516 479
831 iso_pu_bacteria 8023680758 8023687601 479
832 iso_pu_bacteria 8024479707 8024481728 479
833 iso_pu_bacteria 8024486573 8024489304 479
834 iso_pu_bacteria 8024501048 8024505995 479
835 iso_pu_bacteria 8046767195 8046773274 479
836 iso_pu_bacteria 8049293176 8049295896 479
837 iso_pu_bacteria 8054558443 8054558557 479
838 iso_pu_bacteria 8056375014 8056381533 479
839 iso_pu_bacteria 8056382006 8056386966 479
840 iso_pu_bacteria 8057575449 8057580991 479
841 iso_pu_bacteria 8057874678 8057876774 479
842 3300048926 Ga0496123_0040184 Ga0496123_0040184_1007_2449 480
843 3300048929 Ga0496126_0000763 Ga0496126_0000763_34008_35450 480
844 3300002739 JGI25158J39367_1000249 JGI25158J39367_10002493 481
845 3300002773 JGI25152J39213_1005237 JGI25152J39213_10052374 481
846 3300002987 JGI25159J45721_1000470 JGI25159J45721_10004706 481
847 3300003203 JGI25406J46586_10023766 JGI25406J46586_100237661 481
848 3300003214 JGI25165J46597_1000042 JGI25165J46597_1000042135 481
849 3300003354 JGI25160J50197_1000966 JGI25160J50197_100096615 481
850 3300003374 JGI25161J50226_1000114 JGI25161J50226_100011448 481
851 3300003762 Ga0055542_1000981 Ga0055542_100098113 481
852 3300003763 Ga0055529_1001600 Ga0055529_10016004 481
853 3300003771 Ga0055526_1006122 Ga0055526_10061226 481
854 3300003792 Ga0055540_1006389 Ga0055540_10063892 481
855 3300003856 Ga0058692_1000707 Ga0058692_10007074 481
856 3300004625 Ga0055543_1000077 Ga0055543_100007743 481
857 3300005262 Ga0065165_1004996 Ga0065165_10049964 481
858 3300005353 Ga0070669_100034905 Ga0070669_1000349052 481
859 3300005455 Ga0070663_100042275 Ga0070663_1000422753 481
860 3300005548 Ga0070665_100005334 Ga0070665_1000053349 481
861 3300005985 Ga0081539_10002331 Ga0081539_1000233120 481
862 3300006038 Ga0075365_10044706 Ga0075365_100447062 481
863 3300006038 Ga0075365_10094439 Ga0075365_100944391 481
864 3300006042 Ga0075368_10000376 Ga0075368_100003763 481
865 3300006048 Ga0075363_100000028 Ga0075363_1000000284 481
866 3300006048 Ga0075363_100016943 Ga0075363_1000169432 481
867 3300006051 Ga0075364_10010752 Ga0075364_100107523 481
868 3300006051 Ga0075364_10028420 Ga0075364_100284203 481
869 3300006177 Ga0075362_10002625 Ga0075362_100026253 481
870 3300006178 Ga0075367_10062652 Ga0075367_100626522 481
871 3300006186 Ga0075369_10005611 Ga0075369_100056114 481
872 3300006195 Ga0075366_10016141 Ga0075366_100161415 481
873 3300006948 Ga0099826_10016302 Ga0099826_100163022 481
874 3300009148 Ga0105243_10006006 Ga0105243_100060065 481
875 3300009177 Ga0105248_10215580 Ga0105248_102155802 481
876 3300009551 Ga0105238_10005636 Ga0105238_1000563610 481
877 3300010375 Ga0105239_10157357 Ga0105239_101573572 481
878 3300013100 Ga0157373_10026296 Ga0157373_100262962 481
879 3300013102 Ga0157371_10000002 Ga0157371_1000000264 481
880 3300013104 Ga0157370_10000246 Ga0157370_1000024616 481
881 3300013104 Ga0157370_10047724 Ga0157370_100477243 481
882 3300025208 Ga0209436_100050 Ga0209436_10005048 481
883 3300025245 Ga0207425_1001972 Ga0207425_10019727 481
884 3300025250 Ga0209026_1000029 Ga0209026_1000029160 481
885 3300025254 Ga0209148_1000080 Ga0209148_1000080103 481
886 3300025254 Ga0209148_1005812 Ga0209148_10058122 481
887 3300025256 Ga0209759_1000040 Ga0209759_100004014 481
888 3300025258 Ga0209129_1003444 Ga0209129_10034447 481
889 3300025261 Ga0209233_1000028 Ga0209233_1000028427 481
890 3300025272 Ga0209455_1000171 Ga0209455_100017152 481
891 3300025273 Ga0209673_1004728 Ga0209673_10047284 481
892 3300025284 Ga0209130_1000030 Ga0209130_1000030218 481
893 3300025294 Ga0209025_1000255 Ga0209025_100025584 481
894 3300025294 Ga0209025_1014510 Ga0209025_10145101 481
895 3300025295 Ga0209564_1000281 Ga0209564_10002814 481
896 3300025297 Ga0209758_1000357 Ga0209758_100035716 481
897 3300025297 Ga0209758_1001459 Ga0209758_100145910 481
898 3300025299 Ga0209256_1006950 Ga0209256_10069505 481
899 3300025302 Ga0207426_1000047 Ga0207426_1000047183 481
900 3300025909 Ga0207705_10015368 Ga0207705_100153683 481
901 3300025914 Ga0207671_10007609 Ga0207671_100076093 481
902 3300025924 Ga0207694_10031647 Ga0207694_100316472 481
903 3300025941 Ga0207711_10128597 Ga0207711_101285971 481
904 3300025981 Ga0207640_10039577 Ga0207640_100395772 481
905 3300026067 Ga0207678_10081149 Ga0207678_100811492 481
906 3300027312 Ga0209371_1000003 Ga0209371_1000003799 481
907 3300027312 Ga0209371_1001136 Ga0209371_100113615 481
908 3300027666 Ga0209282_1000870 Ga0209282_100087010 481
909 3300028379 Ga0268266_10024157 Ga0268266_100241573 481
910 3300028379 Ga0268266_10047949 Ga0268266_100479492 481
911 3300028794 Ga0307515_10000386 Ga0307515_100003868 481
912 3300028794 Ga0307515_10049328 Ga0307515_100493286 481
913 3300030500 Ga0268256_1000004 Ga0268256_1000004251 481
914 3300030500 Ga0268256_1004149 Ga0268256_10041492 481
915 3300031730 Ga0307516_10039908 Ga0307516_100399085 481
916 3300035695 Ga0373927_0000095 Ga0373927_0000095_47633_49078 481
917 3300037068 Ga0373925_0001900 Ga0373925_0001900_13976_15421 481
918 3300037471 Ga0395905_0000479 Ga0395905_0000479_51838_53283 481
919 3300037471 Ga0395905_0042590 Ga0395905_0042590_382_1830 481
920 3300044658 Ga0466972_0004602 Ga0466972_0004602_1397_2842 481
921 3300044683 Ga0466965_0032775 Ga0466965_0032775_657_2102 481
922 3300044901 Ga0466960_0009402 Ga0466960_0009402_2049_3494 481
923 3300046558 Ga0495633_0016900 Ga0495633_0016900_1991_3436 481
924 3300047443 Ga0495687_035816 Ga0495687_035816_238_1683 481
925 3300047470 Ga0495681_0014334 Ga0495681_0014334_1321_2766 481
926 3300048919 Ga0496116_0014212 Ga0496116_0014212_1481_2926 481
927 3300048920 Ga0496117_0000052 Ga0496117_0000052_84088_85533 481
928 3300048921 Ga0496118_0000709 Ga0496118_0000709_33973_35418 481
929 3300048921 Ga0496118_0032794 Ga0496118_0032794_194_1639 481
930 3300048922 Ga0496119_0002287 Ga0496119_0002287_5702_7147 481
931 3300048922 Ga0496119_0043664 Ga0496119_0043664_295_1740 481
932 3300048923 Ga0496120_0000019 Ga0496120_0000019_84088_85533 481
933 3300048923 Ga0496120_0001370 Ga0496120_0001370_501_1946 481
934 3300048923 Ga0496120_0048589 Ga0496120_0048589_810_2255 481
935 3300048924 Ga0496121_0021259 Ga0496121_0021259_3537_4982 481
936 3300048925 Ga0496122_0000053 Ga0496122_0000053_84088_85533 481
937 3300048925 Ga0496122_0008551 Ga0496122_0008551_5293_6741 481
938 3300048926 Ga0496123_0000038 Ga0496123_0000038_84088_85533 481
939 3300048927 Ga0496124_0000139 Ga0496124_0000139_80_1525 481
940 3300048928 Ga0496125_0020651 Ga0496125_0020651_31_1476 481
941 3300048929 Ga0496126_0109258 Ga0496126_0109258_91_1536 481
942 3300049568 Ga0501031_0008039 Ga0501031_0008039_3212_4657 481
943 3300049569 Ga0501032_0000007 Ga0501032_0000007_146405_147850 481
944 3300049569 Ga0501032_0000248 Ga0501032_0000248_26571_28016 481
945 3300049569 Ga0501032_0011413 Ga0501032_0011413_4432_5877 481
946 3300049570 Ga0501033_0000051 Ga0501033_0000051_3829_5274 481
947 3300049570 Ga0501033_0001374 Ga0501033_0001374_4988_6433 481
948 3300049570 Ga0501033_0004047 Ga0501033_0004047_1149_2594 481
949 3300049570 Ga0501033_0016361 Ga0501033_0016361_925_2370 481
950 3300049571 Ga0501034_0000029 Ga0501034_0000029_106032_107477 481
951 3300049571 Ga0501034_0000507 Ga0501034_0000507_20852_22297 481
952 3300049571 Ga0501034_0007241 Ga0501034_0007241_9247_10692 481
953 3300049572 Ga0501036_0000004 Ga0501036_0000004_106032_107477 481
954 3300049572 Ga0501036_0078483 Ga0501036_0078483_841_2286 481
955 3300049573 Ga0501037_0000004 Ga0501037_0000004_146405_147850 481
956 3300049573 Ga0501037_0052678 Ga0501037_0052678_841_2286 481
957 3300049574 Ga0501038_0000005 Ga0501038_0000005_106032_107477 481
958 3300049574 Ga0501038_0000238 Ga0501038_0000238_17041_18486 481
959 3300049574 Ga0501038_0090618 Ga0501038_0090618_841_2286 481
960 3300049575 Ga0501039_0000009 Ga0501039_0000009_106032_107477 481
961 3300049575 Ga0501039_0000073 Ga0501039_0000073_33681_35126 481
962 3300049575 Ga0501039_0083683 Ga0501039_0083683_533_1978 481
963 3300049578 Ga0501042_0007394 Ga0501042_0007394_4284_5729 481
964 3300049579 Ga0501043_0000214 Ga0501043_0000214_10567_12012 481
965 3300049579 Ga0501043_0001215 Ga0501043_0001215_3728_5173 481
966 3300049580 Ga0501046_0021719 Ga0501046_0021719_3194_4639 481
967 3300049581 Ga0501047_0040490 Ga0501047_0040490_2529_3974 481
968 3300049582 Ga0501048_0006373 Ga0501048_0006373_836_2281 481
969 3300049584 Ga0501068_0052683 Ga0501068_0052683_277_1722 481
970 3300049585 Ga0501069_0004063 Ga0501069_0004063_2086_3531 481
971 3300049586 Ga0501070_0003212 Ga0501070_0003212_2047_3492 481
972 3300049586 Ga0501070_0023667 Ga0501070_0023667_2267_3712 481
973 3300049586 Ga0501070_0058097 Ga0501070_0058097_856_2301 481
974 3300049586 Ga0501070_0072673 Ga0501070_0072673_68_1513 481
975 3300049588 Ga0501072_0028309 Ga0501072_0028309_2513_3958 481
976 3300049589 Ga0501073_0095743 Ga0501073_0095743_248_1693 481
977 3300049742 Ga0501080_0017096 Ga0501080_0017096_4431_5876 481
978 3300049822 Ga0501035_0000014 Ga0501035_0000014_106032_107477 481
979 3300049822 Ga0501035_0000189 Ga0501035_0000189_33699_35144 481
980 3300049822 Ga0501035_0001928 Ga0501035_0001928_9247_10692 481
981 3300049822 Ga0501035_0013614 Ga0501035_0013614_4284_5729 481
982 3300049823 Ga0501044_0000012 Ga0501044_0000012_146405_147850 481
983 3300049823 Ga0501044_0010493 Ga0501044_0010493_3748_5193 481
984 3300049823 Ga0501044_0027624 Ga0501044_0027624_2283_3728 481
985 3300049823 Ga0501044_0058787 Ga0501044_0058787_65_1510 481
986 3300049823 Ga0501044_0111683 Ga0501044_0111683_1150_2595 481
987 3300049823 Ga0501044_0132916 Ga0501044_0132916_485_1930 481
988 3300049823 Ga0501044_0240757 Ga0501044_0240757_12_1457 481
989 3300049824 Ga0501045_0009505 Ga0501045_0009505_1167_2612 481
990 3300050489 nmdc:mga03683_124_c1 nmdc:mga03683_124_c1_3490_4935 481
991 3300050490 nmdc:mga03n38_17317_c1 nmdc:mga03n38_17317_c1_433_1878 481
992 3300050491 nmdc:mga00v17_141469_c1 nmdc:mga00v17_141469_c1_25_1470 481
993 3300050491 nmdc:mga00v17_55_c1 nmdc:mga00v17_55_c1_16273_17718 481
994 3300050492 nmdc:mga0yw44_11225_c1 nmdc:mga0yw44_11225_c1_1994_3439 481
995 3300050493 nmdc:mga0k408_3360_c1 nmdc:mga0k408_3360_c1_4546_5991 481
996 3300050494 nmdc:mga06z11_33873_c1 nmdc:mga06z11_33873_c1_565_2010 481
997 3300050496 nmdc:mga07m45_50944_c1 nmdc:mga07m45_50944_c1_474_1919 481
998 3300050516 nmdc:mga0sz30_586_c1 nmdc:mga0sz30_586_c1_7162_8607 481
999 3300053137 Ga0500561_0000105 Ga0500561_0000105_2525_3970 481
1000 3300053139 Ga0500568_0000177 Ga0500568_0000177_26909_28354 481
1001 3300053157 Ga0500624_000343 Ga0500624_000343_1269_2714 481
1002 3300053161 Ga0500634_0074198 Ga0500634_0074198_66_1511 481
1003 3300053177 Ga0500636_0000005 Ga0500636_0000005_60000_61448 481
1004 3300053177 Ga0500636_0001535 Ga0500636_0001535_1361_2809 481
1005 iso_pu_bacteria 2996341866 2996344242 481
1006 iso_pu_bacteria 8004445564 8004449135 481
1007 3300002705 JGI25156J39149_1000215 JGI25156J39149_100021522 483
1008 3300002738 JGI25154J39366_1000169 JGI25154J39366_100016931 483
1009 3300002741 JGI25157J39369_1000226 JGI25157J39369_100022618 483
1010 3300002773 JGI25152J39213_1001612 JGI25152J39213_10016127 483
1011 3300002773 JGI25152J39213_1002985 JGI25152J39213_10029853 483
1012 3300002773 JGI25152J39213_1010984 JGI25152J39213_10109842 483
1013 3300002774 JGI25150J39212_1000142 JGI25150J39212_10001427 483
1014 3300002987 JGI25159J45721_1000018 JGI25159J45721_1000018104 483
1015 3300002987 JGI25159J45721_1006331 JGI25159J45721_10063312 483
1016 3300003187 JGI25151J46595_10000031 JGI25151J46595_10000031115 483
1017 3300003187 JGI25151J46595_10001034 JGI25151J46595_1000103413 483
1018 3300003187 JGI25151J46595_10009744 JGI25151J46595_100097444 483
1019 3300003187 JGI25151J46595_10027348 JGI25151J46595_100273482 483
1020 3300003214 JGI25165J46597_1000443 JGI25165J46597_100044330 483
1021 3300003214 JGI25165J46597_1001071 JGI25165J46597_10010716 483
1022 3300003215 JGI25153J46596_10002913 JGI25153J46596_100029134 483
1023 3300003354 JGI25160J50197_1000009 JGI25160J50197_1000009104 483
1024 3300003354 JGI25160J50197_1000114 JGI25160J50197_100011440 483
1025 3300003354 JGI25160J50197_1011262 JGI25160J50197_10112622 483
1026 3300003374 JGI25161J50226_1000089 JGI25161J50226_100008943 483
1027 3300003374 JGI25161J50226_1000913 JGI25161J50226_10009136 483
1028 3300003771 Ga0055526_1004043 Ga0055526_10040433 483
1029 3300003775 Ga0055524_1001259 Ga0055524_10012598 483
1030 3300003775 Ga0055524_1001626 Ga0055524_10016268 483
1031 3300003775 Ga0055524_1006998 Ga0055524_10069982 483
1032 3300003781 Ga0055536_1002677 Ga0055536_10026778 483
1033 3300003781 Ga0055536_1012610 Ga0055536_10126103 483
1034 3300003790 Ga0055528_1010323 Ga0055528_10103231 483
1035 3300003791 Ga0055530_10011658 Ga0055530_100116582 483
1036 3300003794 Ga0055531_10007080 Ga0055531_100070806 483
1037 3300003794 Ga0055531_10034399 Ga0055531_100343991 483
1038 3300004625 Ga0055543_1000002 Ga0055543_1000002373 483
1039 3300004625 Ga0055543_1000379 Ga0055543_10003792 483
1040 3300004625 Ga0055543_1002703 Ga0055543_10027034 483
1041 3300005262 Ga0065165_1000020 Ga0065165_1000020166 483
1042 3300005262 Ga0065165_1000537 Ga0065165_10005372 483
1043 3300005331 Ga0070670_100002407 Ga0070670_1000024076 483
1044 3300005355 Ga0070671_100036933 Ga0070671_1000369333 483
1045 3300005578 Ga0068854_100071940 Ga0068854_1000719403 483
1046 3300006038 Ga0075365_10000532 Ga0075365_100005327 483
1047 3300006038 Ga0075365_10027524 Ga0075365_100275242 483
1048 3300006353 Ga0075370_10001799 Ga0075370_100017996 483
1049 3300006353 Ga0075370_10032952 Ga0075370_100329524 483
1050 3300006946 Ga0079104_1002954 Ga0079104_10029544 483
1051 3300006946 Ga0079104_1003793 Ga0079104_10037934 483
1052 3300009093 Ga0105240_10000019 Ga0105240_10000019211 483
1053 3300009766 Ga0123342_1007669 Ga0123342_10076697 483
1054 3300010375 Ga0105239_10006306 Ga0105239_1000630612 483
1055 3300013249 Ga0171463_1006 Ga0171463_1006218 483
1056 3300015690 Ga0183363_1018 Ga0183363_101813 483
1057 3300021320 Ga0214544_1001241 Ga0214544_100124141 483
1058 3300021321 Ga0214542_1000115 Ga0214542_100011510 483
1059 3300021327 Ga0214543_1000008 Ga0214543_1000008185 483
1060 3300021327 Ga0214543_1000098 Ga0214543_100009810 483
1061 3300022739 Ga0228711_1000003 Ga0228711_100000392 483
1062 3300022740 Ga0228710_1000003 Ga0228710_100000398 483
1063 3300025206 Ga0209435_100005 Ga0209435_100005206 483
1064 3300025233 Ga0209437_100078 Ga0209437_100078230 483
1065 3300025233 Ga0209437_100291 Ga0209437_1002916 483
1066 3300025245 Ga0207425_1000070 Ga0207425_1000070104 483
1067 3300025246 Ga0209646_1000011 Ga0209646_1000011206 483
1068 3300025250 Ga0209026_1000008 Ga0209026_1000008206 483
1069 3300025253 Ga0209677_100524 Ga0209677_10052410 483
1070 3300025256 Ga0209759_1000004 Ga0209759_1000004206 483
1071 3300025258 Ga0209129_1000080 Ga0209129_1000080100 483
1072 3300025261 Ga0209233_1000157 Ga0209233_100015754 483
1073 3300025261 Ga0209233_1000192 Ga0209233_100019272 483
1074 3300025261 Ga0209233_1000194 Ga0209233_100019469 483
1075 3300025273 Ga0209673_1000037 Ga0209673_1000037203 483
1076 3300025273 Ga0209673_1000060 Ga0209673_1000060161 483
1077 3300025273 Ga0209673_1000312 Ga0209673_100031245 483
1078 3300025273 Ga0209673_1000439 Ga0209673_100043931 483
1079 3300025284 Ga0209130_1000037 Ga0209130_1000037166 483
1080 3300025284 Ga0209130_1000083 Ga0209130_1000083126 483
1081 3300025292 Ga0209676_1000239 Ga0209676_10002393 483
1082 3300025292 Ga0209676_1010437 Ga0209676_10104371 483
1083 3300025294 Ga0209025_1000052 Ga0209025_1000052122 483
1084 3300025294 Ga0209025_1000083 Ga0209025_1000083159 483
1085 3300025294 Ga0209025_1000196 Ga0209025_100019647 483
1086 3300025294 Ga0209025_1000389 Ga0209025_100038955 483
1087 3300025294 Ga0209025_1003226 Ga0209025_100322611 483
1088 3300025294 Ga0209025_1007724 Ga0209025_10077247 483
1089 3300025294 Ga0209025_1021093 Ga0209025_10210932 483
1090 3300025295 Ga0209564_1000086 Ga0209564_1000086104 483
1091 3300025295 Ga0209564_1000116 Ga0209564_1000116161 483
1092 3300025295 Ga0209564_1000125 Ga0209564_100012541 483
1093 3300025297 Ga0209758_1000090 Ga0209758_1000090104 483
1094 3300025297 Ga0209758_1000621 Ga0209758_100062110 483
1095 3300025297 Ga0209758_1000657 Ga0209758_100065718 483
1096 3300025297 Ga0209758_1017627 Ga0209758_10176272 483
1097 3300025298 Ga0209050_1005669 Ga0209050_10056694 483
1098 3300025298 Ga0209050_1008097 Ga0209050_10080973 483
1099 3300025299 Ga0209256_1000276 Ga0209256_10002764 483
1100 3300025299 Ga0209256_1002576 Ga0209256_100257611 483
1101 3300025299 Ga0209256_1002625 Ga0209256_100262510 483
1102 3300025299 Ga0209256_1004253 Ga0209256_10042536 483
1103 3300025299 Ga0209256_1008128 Ga0209256_10081281 483
1104 3300025302 Ga0207426_1000048 Ga0207426_1000048206 483
1105 3300025302 Ga0207426_1000173 Ga0207426_1000173126 483
1106 3300025302 Ga0207426_1000268 Ga0207426_100026886 483
1107 3300025302 Ga0207426_1000984 Ga0207426_10009847 483
1108 3300025303 Ga0209051_1000874 Ga0209051_10008747 483
1109 3300025303 Ga0209051_1003034 Ga0209051_10030348 483
1110 3300025303 Ga0209051_1005608 Ga0209051_10056081 483
1111 3300025303 Ga0209051_1008583 Ga0209051_10085836 483
1112 3300025304 Ga0209257_1001192 Ga0209257_100119233 483
1113 3300025304 Ga0209257_1005971 Ga0209257_10059715 483
1114 3300025913 Ga0207695_10000049 Ga0207695_10000049213 483
1115 3300025914 Ga0207671_10000860 Ga0207671_1000086014 483
1116 3300025925 Ga0207650_10009773 Ga0207650_100097735 483
1117 3300025931 Ga0207644_10021552 Ga0207644_100215523 483
1118 3300025981 Ga0207640_10152046 Ga0207640_101520461 483
1119 3300027111 Ga0209281_1000081 Ga0209281_100008192 483
1120 3300027111 Ga0209281_1000269 Ga0209281_10002694 483
1121 3300027312 Ga0209371_1005797 Ga0209371_10057974 483
1122 3300027666 Ga0209282_1000040 Ga0209282_100004024 483
1123 3300028794 Ga0307515_10000263 Ga0307515_1000026331 483
1124 3300030500 Ga0268256_1007306 Ga0268256_10073063 483
1125 3300031456 Ga0307513_10015647 Ga0307513_100156474 483
1126 3300031456 Ga0307513_10022547 Ga0307513_100225475 483
1127 3300031548 Ga0307408_100093977 Ga0307408_1000939772 483
1128 3300031901 Ga0307406_10005532 Ga0307406_100055327 483
1129 3300031911 Ga0307412_10003898 Ga0307412_100038985 483
1130 3300031967 Ga0315914_1000002 Ga0315914_1000002198 483
1131 3300033430 Ga0315913_1000016 Ga0315913_100001611 483
1132 3300033464 Ga0315915_1000005 Ga0315915_1000005198 483
1133 3300041498 Ga0451841_0811656 Ga0451841_0811656_246_1697 483
1134 3300041501 Ga0451845_0612574 Ga0451845_0612574_407_1858 483
1135 3300041503 Ga0451847_0787006 Ga0451847_0787006_2932_4383 483
1136 3300041507 Ga0451851_0687044 Ga0451851_0687044_78_1529 483
1137 3300046460 Ga0495638_0000377 Ga0495638_0000377_39267_40718 483
1138 3300046507 Ga0495606_0001835 Ga0495606_0001835_12689_14140 483
1139 3300046660 Ga0495625_0025060 Ga0495625_0025060_97_1548 483
1140 3300047317 Ga0495604_0021754 Ga0495604_0021754_695_2146 483
1141 3300048919 Ga0496116_0009050 Ga0496116_0009050_4287_5738 483
1142 3300048925 Ga0496122_0000024 Ga0496122_0000024_253896_255347 483
1143 3300048925 Ga0496122_0002990 Ga0496122_0002990_3772_5223 483
1144 3300048925 Ga0496122_0008795 Ga0496122_0008795_6547_7998 483
1145 3300048926 Ga0496123_0000063 Ga0496123_0000063_210850_212301 483
1146 3300048926 Ga0496123_0000086 Ga0496123_0000086_177495_178946 483
1147 3300048926 Ga0496123_0007881 Ga0496123_0007881_1901_3352 483
1148 3300048927 Ga0496124_0015328 Ga0496124_0015328_850_2301 483
1149 3300053086 Ga0500578_0089628 Ga0500578_0089628_363_1814 483
1150 3300053134 Ga0500658_0000067 Ga0500658_0000067_6390_7841 483
1151 3300053153 Ga0500616_0000526 Ga0500616_0000526_46471_47922 483
1152 3300053153 Ga0500616_0022183 Ga0500616_0022183_1141_2592 483
1153 3300059645 Ga0587076_006715 Ga0587076_006715_11_1462 483

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

12

156

0.99

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

160

385

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xr4-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) from blastochloris viridis in complex with nad and agmatine 0.9558 6 479
4xq9-assembly1.cif.gz_A crystal structure of the homospermidine synthase (hss) from blastochloris viridis in complex with nad 0.9547 6 479
6s65-assembly1.cif.gz_A crystal structure of the homospermidine synthase (hss) variant n135f from blastochloris viridis in complex with nad 0.9545 6 479
6s72-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) variant w229a from blastochloris viridis in complex with nad and put 0.9543 6 479
6sep-assembly1.cif.gz_B crystal structure of the homospermidine synthase (hss) variant w229e from blastochloris viridis in complex with nad 0.9542 6 479
ID Description Score Start End Superfamily
4tvbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 6 161 3.40.50.720
4tvbB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;homospermidine synthase like 0.9191 164 479 3.30.360.30
4tvbB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;homospermidine synthase like 0.901 164 479 3.30.360.30
2ph5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8907 11 161 3.40.50.720
4tvbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8281 6 161 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X6EJ82-F1-model_v4 deleted 0.9897 1 92
AF-A0A8B3P1N7-F1-model_v4 Homospermidine synthase 0.983 1 147
AF-A0A436HBG5-F1-model_v4 Homospermidine synthase 0.9811 1 115
AF-A0A3S1Q426-F1-model_v4 Homospermidine synthase 0.9806 1 122
AF-A0A2P5M1B1-F1-model_v4 Homospermidine synthase 0.9774 6 229

Feature Viewer

pLDDT pTM Quality
86.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map