F490847

General Info

Members Datasets Scaffolds Average Seq Length
1150 940 430 353

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0037071|Ga0395900_0037071_3394_4461
Length 355
Sequence MARIEVNHIRHSYLPNPQKDADFALKEVHHIFEDGGAYALLGPSGCGKTTLLNIISGLLHPSHGKLLFNGRDVTNLSTQERNIAQVFQFPVIYDTMTVYDNLAFPLRNRRVPEADVDRKVRETLDMIDLAGLARKKARGLTADQKQKISLGRGLVRSDVNAILFDEPLTVIDPHMKWVLRSQLKQLHRRFGYTMVYVTHDQTEALTFADQVVVMYDGGIVQIGTPAELFERPRHTFVGYFIGSPGMNVLPVAIEGRTAMLGAQRIDLPGAPKAEAGAAELGIRPEYVRLGREGMSVSVSKVEDVGRHKVVRASLEGREIAAVIGEDEEVPPDPKVRFDPAGINIYADSWRVEMGA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
25 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
26 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
27 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
28 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
34 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
37 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
38 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
39 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
40 2516143018 Ensifer sp. BR816 Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
47 2519899620 Rhizobium sp. Pop5 Isolate Nodule
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
58 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
59 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
60 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
61 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
70 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
71 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
72 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
73 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
79 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
80 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
81 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
82 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
83 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
84 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
85 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
86 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
87 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
88 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
89 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
90 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
91 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
92 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
93 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
94 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
95 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
96 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
97 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
98 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
99 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
100 2643221557 Ensifer sp. Root558 Isolate Unclassified
101 2643221568 Rhizobium sp. Root564 Isolate Unclassified
102 2643221582 Rhizobium sp. Root651 Isolate Unclassified
103 2643221599 Rhizobium sp. Root708 Isolate Unclassified
104 2643221607 Rhizobium sp. Root73 Isolate Unclassified
105 2643221610 Ensifer sp. Root74 Isolate Unclassified
106 2643221618 Ensifer sp. Root231 Isolate Unclassified
107 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
108 2643221626 Ensifer sp. Root31 Isolate Unclassified
109 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
110 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
111 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
112 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
113 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
114 2643221655 Ensifer sp. Root1252 Isolate Unclassified
115 2643221659 Ensifer sp. Root127 Isolate Unclassified
116 2643221668 Ensifer sp. Root423 Isolate Unclassified
117 2643221675 Ensifer sp. Root1298 Isolate Unclassified
118 2643221680 Ensifer sp. Root1312 Isolate Unclassified
119 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
120 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
121 2643221693 Rhizobium sp. Root491 Isolate Unclassified
122 2643221698 Ensifer sp. Root142 Isolate Unclassified
123 2643221712 Ensifer sp. Root258 Isolate Unclassified
124 2643221718 Rhizobium sp. Root268 Isolate Unclassified
125 2643221719 Rhizobium sp. Root274 Isolate Unclassified
126 2643221723 Ensifer sp. Root278 Isolate Unclassified
127 2643221726 Ensifer sp. Root954 Isolate Unclassified
128 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
129 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
130 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
131 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
132 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
133 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
134 2718217882 Rhizobium sp. N741 Isolate Nodule
135 2718217927 Rhizobium sp. N324 Isolate Nodule
136 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
137 2718218009 Rhizobium sp. N561 Isolate Nodule
138 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
139 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
140 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
141 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
142 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
143 2718218363 Rhizobium sp. N113 Isolate Nodule
144 2718218365 Rhizobium sp. N731 Isolate Nodule
145 2718218366 Rhizobium sp. N621 Isolate Nodule
146 2718218423 Rhizobium sp. N941 Isolate Nodule
147 2721755514 Rhizobium sp. N6212 Isolate Nodule
148 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
149 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
150 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
151 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
152 2721755809 Rhizobium sp. N541 Isolate Nodule
153 2721755810 Rhizobium sp. N871 Isolate Nodule
154 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
155 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
156 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
157 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
158 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
159 2728369365 Rhizobium sp. N1341 Isolate Nodule
160 2728369397 Rhizobium sp. N1314 Isolate Nodule
161 2738541293 Rhizobium sp. GV031 Isolate Unclassified
162 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
163 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
164 2738543024 Aminobacter sp. AP02 Isolate Unclassified
165 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
166 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
167 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
168 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
169 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
170 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
171 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
172 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
173 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
174 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
175 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
176 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
177 2791355256 Rhizobium sp. M10 Isolate Nodule
178 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
179 2791355260 Rhizobium sp. L9 Isolate Nodule
180 2791355261 Rhizobium sp. J15 Isolate Nodule
181 2791355262 Rhizobium sp. M1 Isolate Nodule
182 2791355263 Rhizobium chutanense C5 Isolate Nodule
183 2791355264 Rhizobium sp. S9 Isolate Nodule
184 2791355265 Rhizobium sp. H4 Isolate Nodule
185 2791355266 Rhizobium sp. L43 Isolate Nodule
186 2791355267 Rhizobium sp. L18 Isolate Nodule
187 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
188 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
189 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
190 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
191 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
192 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
193 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
194 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
195 2802429633 Rhizobium anhuiense J3 Isolate Nodule
196 2802429634 Rhizobium anhuiense S10 Isolate Nodule
197 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
198 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
199 2802429637 Rhizobium anhuiense C15 Isolate Nodule
200 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
201 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
202 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
203 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
204 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
205 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
206 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
207 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
208 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
209 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
210 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
211 2838048938 Rhizobium pisi 27/80 Isolate Nodule
212 2838061910 Rhizobium phaseoli L15 Isolate Nodule
213 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
214 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
215 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
216 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
217 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
220 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
221 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
222 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
223 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
224 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
225 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
226 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
227 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
228 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
229 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
230 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
231 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
232 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
233 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
234 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
235 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
236 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
237 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
238 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
239 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
240 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
241 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
242 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
243 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
244 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
245 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
246 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
247 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
248 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
249 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
250 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
251 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
252 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
253 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
254 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
255 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
256 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
257 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
258 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
259 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
260 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
261 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
262 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
263 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
264 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
265 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
266 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
267 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
268 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
269 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
270 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
271 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
272 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
273 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
274 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
275 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
276 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
277 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
278 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
279 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
280 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
281 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
282 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
283 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
284 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
285 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
286 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
287 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
288 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
289 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
290 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
291 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
292 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
293 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
294 2844163670 Ensifer sp. 1H6 Isolate Unclassified
295 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
296 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
297 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
298 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
299 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
300 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
301 2854911287 Brucella lupini LUP21 Isolate Unclassified
302 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
303 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
304 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
305 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
306 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
307 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
308 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
309 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
310 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
311 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
312 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
313 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
314 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
315 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
316 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
317 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
318 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
319 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
320 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
321 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
322 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
323 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
324 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
325 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
326 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
327 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
328 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
329 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
330 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
331 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
332 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
333 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
334 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
335 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
336 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
337 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
338 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
339 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
340 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
341 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
342 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
343 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
344 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
345 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
346 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
347 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
348 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
349 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
350 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
351 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
352 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
353 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
354 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
355 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
356 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
357 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
358 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
359 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
360 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
361 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
362 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
363 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
364 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
365 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
366 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
367 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
368 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
369 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
370 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
371 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
372 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
373 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
374 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
375 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
376 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
377 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
378 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
379 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
380 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
381 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
382 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
383 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
384 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
385 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
386 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
387 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
388 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
389 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
390 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
391 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
392 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
393 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
394 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
395 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
396 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
397 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
398 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
399 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
400 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
401 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
402 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
403 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
404 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
405 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
406 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
407 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
408 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
409 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
410 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
411 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
412 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
413 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
414 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
415 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
416 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
417 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
418 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
419 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
420 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
421 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
422 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
423 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
424 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
425 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
426 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
427 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
428 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
429 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
430 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
431 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
432 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
433 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
434 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
435 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
436 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
437 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
438 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
439 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
440 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
441 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
442 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
443 2933599457 Rhizobium phaseoli M3 Isolate Nodule
444 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
445 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
446 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
447 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
448 2936381700 Rhizobium chutanense C16 Isolate Unclassified
449 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
450 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
451 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
452 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
453 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
454 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
455 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
456 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
457 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
458 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
459 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
460 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
461 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
462 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
463 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
464 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
465 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
466 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
467 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
468 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
469 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
470 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
471 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
472 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
473 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
474 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
475 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
476 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
477 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
478 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
479 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
480 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
481 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
482 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
483 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
484 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
485 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
486 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
487 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
488 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
489 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
490 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
491 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
492 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
493 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
494 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
495 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
496 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
497 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
498 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
499 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
500 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
501 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
502 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
503 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
504 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
505 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
506 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
507 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
508 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
509 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
510 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
511 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
512 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
513 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
514 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
515 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
516 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
517 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
518 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
519 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
520 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
521 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
522 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
523 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
524 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
525 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
526 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
527 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
528 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
529 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
530 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
531 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
532 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
533 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
534 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
535 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
536 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
537 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
538 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
539 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
540 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
541 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
542 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
543 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
544 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
545 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
546 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
547 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
548 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
549 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
550 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
551 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
552 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
553 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
554 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
555 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
556 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
557 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
558 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
559 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
560 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
561 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
562 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
563 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
564 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
565 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
566 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
567 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
568 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
569 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
570 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
571 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
572 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
573 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
574 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
575 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
576 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
577 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
578 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
579 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
580 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
581 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
582 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
583 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
584 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
585 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
586 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
587 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
588 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
589 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
590 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
591 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
592 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
593 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
594 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
595 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
596 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
597 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
598 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
599 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
600 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
601 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
602 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
603 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
604 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
605 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
606 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
607 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
608 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
609 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
610 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
611 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
612 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
613 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
614 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
615 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
616 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
617 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
618 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
619 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
620 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
621 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
622 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
623 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
624 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
625 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
626 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
627 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
628 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
629 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
630 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
631 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
632 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
633 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
634 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
635 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
636 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
637 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
638 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
639 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
640 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
641 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
642 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
643 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
644 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
645 2996887358 Rhizobium sp. R711 Isolate Nodule
646 2996893221 Rhizobium sp. R635 Isolate Nodule
647 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
648 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
649 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
650 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
651 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
652 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
653 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
654 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
655 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
656 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
657 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
658 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
659 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
660 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
661 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
662 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
663 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
664 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
665 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
666 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
667 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
668 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
669 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
670 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
671 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
672 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
673 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
674 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
675 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
676 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
677 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
678 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
679 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
680 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
681 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
682 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
683 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
684 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
685 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
686 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
687 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
688 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
689 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
690 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
691 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
692 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
693 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
694 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
695 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
696 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
697 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
698 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
699 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
700 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
701 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
702 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
703 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
704 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
705 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
706 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
707 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
708 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
709 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
710 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
711 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
712 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
713 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
714 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
715 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
716 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
717 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
718 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
719 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
720 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
721 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
722 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
723 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
724 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
725 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
726 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
727 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
728 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
729 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
730 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
731 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
732 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
733 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
734 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
735 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
736 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
737 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
738 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
739 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
740 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
741 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
742 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
743 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
744 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
745 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
746 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
747 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
748 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
749 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
750 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
751 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
752 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
753 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
754 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
755 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
756 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
757 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
758 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
759 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
760 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
761 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
762 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
763 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
764 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
765 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
766 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
767 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
768 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
769 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
770 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
771 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
772 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
773 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
774 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
775 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
776 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
777 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
778 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
779 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
780 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
781 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
782 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
783 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
784 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
785 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
786 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
787 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
788 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
789 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
790 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
791 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
792 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
793 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
794 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
795 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
796 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
797 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
798 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
799 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
800 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
801 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
802 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
803 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
804 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
805 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
806 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
807 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
808 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
809 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
810 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
811 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
812 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
813 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
814 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
815 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
816 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
817 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
818 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
819 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
820 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
821 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
822 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
823 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
824 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
825 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
826 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
827 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
828 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
829 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
830 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
831 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
832 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
833 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
834 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
835 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
836 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
837 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
838 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
839 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
840 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
841 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
842 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
843 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
844 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
845 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
846 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
847 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
848 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
849 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
850 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
851 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
852 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
853 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
854 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
855 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
856 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
857 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
858 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
859 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
860 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
861 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
862 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
863 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
864 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
865 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
866 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
867 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
868 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
869 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
870 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
871 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
872 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
873 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
874 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
875 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
876 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
877 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
878 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
879 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
880 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
881 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
882 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
883 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
884 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
885 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
886 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
887 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
888 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
889 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
890 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
891 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
892 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
893 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
894 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
895 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
896 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
897 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
898 8005258706 Rhizobium sp. R693 Isolate Nodule
899 8005275841 Rhizobium sp. N4311 Isolate Nodule
900 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
901 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
902 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
903 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
904 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
905 8005321885 Rhizobium sp. R72 Isolate Nodule
906 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
907 8005382845 Rhizobium sp. R634 Isolate Nodule
908 8005395548 Rhizobium sp. R339 Isolate Nodule
909 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
910 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
911 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
912 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
913 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
914 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
915 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
916 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
917 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
918 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
919 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
920 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
921 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
922 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
923 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
924 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
925 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
926 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
927 8018176218 Rhizobium sp. N122 Isolate Nodule
928 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
929 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
930 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
931 8024501048 Rhizobium sp. H4 Isolate Nodule
932 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
933 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
934 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
935 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
936 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
937 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
938 8056382006 Rhizobium croatiense 13T Isolate Nodule
939 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
940 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.3
Metatranscriptomes 0.09
Isolates 62.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 13.22
Nodule 47.83
Rhizoplane 1.13
Rhizosphere 22.78
Stem 0
Stem Tuber 0
Unclassified 14.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7977 2010549000 Bacteria 2394
2 JGI24739J22299_10046732 3300001989 Bacteria 1416
3 JGI25162J39368_1001235 3300002737 Bacteria 14721
4 JGI25152J39213_1003333 3300002773 Bacteria 5530
5 JGI25152J39213_1008734 3300002773 Bacteria 2481
6 JGI25150J39212_1000123 3300002774 Bacteria 43588
7 JGI25151J46595_10000083 3300003187 Bacteria 130658
8 JGI25151J46595_10004591 3300003187 Bacteria 7274
9 JGI25151J46595_10005526 3300003187 Bacteria 6512
10 JGI25151J46595_10016186 3300003187 Bacteria 3266
11 JGI25151J46595_10018980 3300003187 Bacteria 2935
12 JGI25165J46597_1000715 3300003214 Bacteria 26079
13 JGI25153J46596_10000210 3300003215 Bacteria 52714
14 JGI25153J46596_10022771 3300003215 Bacteria 2300
15 JGI25153J46596_10022785 3300003215 Bacteria 2299
16 JGI25160J50197_1000097 3300003354 Bacteria 87619
17 JGI25160J50197_1001006 3300003354 Bacteria 14628
18 JGI25161J50226_1001144 3300003374 Bacteria 8848
19 Ga0006562J51391_1020650 3300003578 Bacteria 2910
20 Ga0055542_1001265 3300003762 Bacteria 13783
21 Ga0055526_1003114 3300003771 Bacteria 10751
22 Ga0055526_1008015 3300003771 Bacteria 5350
23 Ga0055526_1016519 3300003771 Bacteria 2881
24 Ga0055524_1005275 3300003775 Bacteria 5804
25 Ga0055524_1020453 3300003775 Bacteria 2229
26 Ga0055524_1034046 3300003775 Bacteria 1416
27 Ga0055536_1001637 3300003781 Bacteria 13323
28 Ga0055528_1003100 3300003790 Bacteria 8532
29 Ga0055528_1012402 3300003790 Bacteria 3310
30 Ga0055540_1000164 3300003792 Bacteria 66539
31 Ga0055531_10012663 3300003794 Bacteria 3950
32 Ga0058692_1001130 3300003856 Bacteria 10337
33 Ga0058692_1002092 3300003856 Bacteria 6888
34 Ga0055543_1000229 3300004625 Bacteria 44446
35 Ga0055543_1000888 3300004625 Bacteria 14212
36 Ga0070685_10009602 3300005466 Bacteria 5005
37 Ga0068853_100151806 3300005539 Bacteria 2085
38 Ga0070665_100077892 3300005548 Bacteria 3321
39 Ga0070665_100107612 3300005548 Bacteria 2790
40 Ga0070665_100173119 3300005548 Bacteria 2160
41 Ga0068856_100026023 3300005614 Bacteria 5706
42 Ga0068852_100062822 3300005616 Bacteria 3232
43 Ga0081540_1101780 3300005983 Bacteria 1235
44 Ga0075365_10000121 3300006038 Bacteria 23552
45 Ga0075365_10003990 3300006038 Bacteria 7734
46 Ga0075365_10016088 3300006038 Bacteria 4540
47 Ga0075368_10004434 3300006042 Bacteria 4759
48 Ga0075368_10007040 3300006042 Bacteria 3958
49 Ga0075363_100005887 3300006048 Bacteria 5519
50 Ga0075363_100119035 3300006048 Bacteria 1473
51 Ga0075364_10021782 3300006051 Bacteria 4040
52 Ga0075364_10100241 3300006051 Bacteria 1928
53 Ga0075362_10001961 3300006177 Bacteria 6759
54 Ga0075362_10007295 3300006177 Bacteria 4178
55 Ga0075362_10019594 3300006177 Bacteria 2816
56 Ga0075362_10029590 3300006177 Bacteria 2361
57 Ga0075362_10036818 3300006177 Bacteria 2142
58 Ga0075367_10005716 3300006178 Bacteria 6214
59 Ga0075367_10102107 3300006178 Bacteria 1754
60 Ga0075367_10134282 3300006178 Bacteria 1530
61 Ga0075369_10028563 3300006186 Bacteria 2338
62 Ga0075369_10050476 3300006186 Bacteria 1799
63 Ga0075366_10002668 3300006195 Bacteria 9196
64 Ga0075366_10006640 3300006195 Bacteria 6348
65 Ga0075370_10002185 3300006353 Bacteria 8981
66 Ga0075370_10005557 3300006353 Bacteria 6282
67 Ga0075370_10059760 3300006353 Bacteria 2170
68 Ga0079104_1002285 3300006946 Bacteria 10611
69 Ga0099826_10000297 3300006948 Bacteria 22278
70 Ga0099826_10055416 3300006948 Bacteria 2625
71 Ga0105251_10022487 3300009011 Bacteria 3273
72 Ga0105240_10000013 3300009093 Bacteria 483458
73 Ga0105240_10143644 3300009093 Bacteria 2850
74 Ga0105248_10015347 3300009177 Bacteria 8448
75 Ga0105237_10002145 3300009545 Bacteria 24855
76 Ga0105238_10184211 3300009551 Bacteria 2065
77 Ga0123340_1054989 3300009763 Bacteria 1317
78 Ga0123340_1057935 3300009763 Bacteria 1195
79 Ga0123341_1000003 3300009765 Bacteria 172237
80 Ga0123342_1002765 3300009766 Bacteria 28880
81 Ga0105239_10004876 3300010375 Bacteria 15880
82 Ga0157373_10003489 3300013100 Bacteria 11890
83 Ga0157371_10000304 3300013102 Bacteria 64521
84 Ga0157371_10007676 3300013102 Bacteria 8684
85 Ga0157370_10004288 3300013104 Bacteria 16426
86 Ga0157370_10029471 3300013104 Bacteria 5384
87 Ga0171463_1004 3300013249 Bacteria 437207
88 Ga0182007_10005973 3300015262 Bacteria 5281
89 Ga0182005_1003820 3300015265 Bacteria 5004
90 Ga0183363_1309 3300015690 Bacteria 6613
91 Ga0214543_1000053 3300021327 Bacteria 141797
92 Ga0228711_1000050 3300022739 Bacteria 81399
93 Ga0228710_1000063 3300022740 Bacteria 81399
94 Ga0209436_104609 3300025208 Bacteria 3368
95 Ga0209437_100057 3300025233 Bacteria 362922
96 Ga0207425_1000024 3300025245 Bacteria 328978
97 Ga0207425_1003151 3300025245 Bacteria 5402
98 Ga0207425_1005788 3300025245 Bacteria 3478
99 Ga0207425_1013444 3300025245 Bacteria 1891
100 Ga0209677_101041 3300025253 Bacteria 13212
101 Ga0209148_1000072 3300025254 Bacteria 325292
102 Ga0209148_1003966 3300025254 Bacteria 3802
103 Ga0209129_1000146 3300025258 Bacteria 115180
104 Ga0209129_1000909 3300025258 Bacteria 18120
105 Ga0209129_1001260 3300025258 Bacteria 14525
106 Ga0209129_1007872 3300025258 Bacteria 3072
107 Ga0209233_1000130 3300025261 Bacteria 205687
108 Ga0209233_1000255 3300025261 Bacteria 82230
109 Ga0209455_1000133 3300025272 Bacteria 155670
110 Ga0209673_1000020 3300025273 Bacteria 430653
111 Ga0209673_1000366 3300025273 Bacteria 81215
112 Ga0209673_1002318 3300025273 Bacteria 13497
113 Ga0209673_1010820 3300025273 Bacteria 3813
114 Ga0209673_1031280 3300025273 Bacteria 1659
115 Ga0209130_1000027 3300025284 Bacteria 327700
116 Ga0209130_1014156 3300025284 Bacteria 2014
117 Ga0209130_1016463 3300025284 Bacteria 1789
118 Ga0209676_1002257 3300025292 Bacteria 14191
119 Ga0209025_1000050 3300025294 Bacteria 331531
120 Ga0209025_1000082 3300025294 Bacteria 265613
121 Ga0209025_1000245 3300025294 Bacteria 127801
122 Ga0209025_1000706 3300025294 Bacteria 56897
123 Ga0209025_1000925 3300025294 Bacteria 44920
124 Ga0209025_1001368 3300025294 Bacteria 32734
125 Ga0209025_1007137 3300025294 Bacteria 8441
126 Ga0209025_1009241 3300025294 Bacteria 6908
127 Ga0209025_1034531 3300025294 Bacteria 2305
128 Ga0209564_1000111 3300025295 Bacteria 212210
129 Ga0209564_1001600 3300025295 Bacteria 22075
130 Ga0209564_1005792 3300025295 Bacteria 6898
131 Ga0209564_1009918 3300025295 Bacteria 4459
132 Ga0209758_1000083 3300025297 Bacteria 257283
133 Ga0209758_1000792 3300025297 Bacteria 45045
134 Ga0209758_1001662 3300025297 Bacteria 25159
135 Ga0209758_1016587 3300025297 Bacteria 3730
136 Ga0209758_1033816 3300025297 Bacteria 2045
137 Ga0209758_1039432 3300025297 Bacteria 1797
138 Ga0209050_1002214 3300025298 Bacteria 17440
139 Ga0209256_1000132 3300025299 Bacteria 160806
140 Ga0209256_1000923 3300025299 Bacteria 35888
141 Ga0209256_1001851 3300025299 Bacteria 19603
142 Ga0209256_1002798 3300025299 Bacteria 13359
143 Ga0209256_1010190 3300025299 Bacteria 3978
144 Ga0207426_1000072 3300025302 Bacteria 327700
145 Ga0207426_1000210 3300025302 Bacteria 138932
146 Ga0207426_1001096 3300025302 Bacteria 24971
147 Ga0209051_1000070 3300025303 Bacteria 215616
148 Ga0209051_1009843 3300025303 Bacteria 4890
149 Ga0209051_1011687 3300025303 Bacteria 4312
150 Ga0209051_1041827 3300025303 Bacteria 1626
151 Ga0209257_1002146 3300025304 Bacteria 20536
152 Ga0209257_1009616 3300025304 Bacteria 5124
153 Ga0207656_10031520 3300025321 Bacteria 2197
154 Ga0207695_10000044 3300025913 Bacteria 440819
155 Ga0207671_10000043 3300025914 Bacteria 206915
156 Ga0207694_10198571 3300025924 Bacteria 1631
157 Ga0207694_10208937 3300025924 Bacteria 1590
158 Ga0207709_10003829 3300025935 Bacteria 8830
159 Ga0207667_10107819 3300025949 Bacteria 2874
160 Ga0207639_10100524 3300026041 Bacteria 2336
161 Ga0207639_10150265 3300026041 Bacteria 1950
162 Ga0207702_10011646 3300026078 Bacteria 7326
163 Ga0207648_10057707 3300026089 Bacteria 3387
164 Ga0207674_10156181 3300026116 Bacteria 2237
165 Ga0209281_1000030 3300027111 Bacteria 425931
166 Ga0209281_1000061 3300027111 Bacteria 293814
167 Ga0209281_1000821 3300027111 Bacteria 28054
168 Ga0209371_1000035 3300027312 Bacteria 368979
169 Ga0209371_1001153 3300027312 Bacteria 19333
170 Ga0209371_1003535 3300027312 Bacteria 7513
171 Ga0209282_1000004 3300027666 Bacteria 425931
172 Ga0209282_1049724 3300027666 Bacteria 2416
173 Ga0268266_10008895 3300028379 Bacteria 8890
174 Ga0268266_10108054 3300028379 Bacteria 2461
175 Ga0268266_10136056 3300028379 Bacteria 2201
176 Ga0307515_10003954 3300028794 Bacteria 30921
177 Ga0307515_10034543 3300028794 Bacteria 8270
178 Ga0307515_10091653 3300028794 Bacteria 3794
179 Ga0268256_1000037 3300030500 Bacteria 367024
180 Ga0268256_1001230 3300030500 Bacteria 16198
181 Ga0268256_1004253 3300030500 Bacteria 6024
182 Ga0307513_10014884 3300031456 Bacteria 9459
183 Ga0307405_10010736 3300031731 Bacteria 4761
184 Ga0307410_10102451 3300031852 Bacteria 2054
185 Ga0307406_10018898 3300031901 Bacteria 4036
186 Ga0307406_10029649 3300031901 Bacteria 3315
187 Ga0307412_10002786 3300031911 Bacteria 9713
188 Ga0315914_1000001 3300031967 Bacteria 416633
189 Ga0307414_10010225 3300032004 Bacteria 5433
190 Ga0307414_10327492 3300032004 Bacteria 1306
191 Ga0315913_1000024 3300033430 Bacteria 90863
192 Ga0315915_1000002 3300033464 Bacteria 425854
193 Ga0373927_0000326 3300035695 Bacteria 37493
194 Ga0316584_0078349 3300036712 Bacteria 2475
195 Ga0373925_0031603 3300037068 Bacteria 3891
196 Ga0395899_0068804 3300037312 Bacteria 2595
197 Ga0395900_0000027 3300037418 Bacteria 285957
198 Ga0395900_0037071 3300037418 Bacteria 5028
199 Ga0395900_0045209 3300037418 Bacteria 4535
200 Ga0395898_0000255 3300037466 Bacteria 131017
201 Ga0395905_0000032 3300037471 Bacteria 285932
202 Ga0395905_0299763 3300037471 Bacteria 1495
203 Ga0395901_0000110 3300038443 Bacteria 112682
204 Ga0395901_0016396 3300038443 Bacteria 7544
205 Ga0400490_57059 3300038726 Bacteria 1848
206 Ga0400483_002058 3300039062 Bacteria 1185
207 Ga0400483_209833 3300039062 Bacteria 2084
208 Ga0400487_14362 3300039110 Bacteria 4397
209 Ga0439438_020620 3300041405 Bacteria 1849
210 Ga0439439_0015755 3300041406 Bacteria 1847
211 Ga0439465_0004803 3300041413 Bacteria 4346
212 Ga0451839_0504797 3300041496 Bacteria 3601
213 Ga0451855_0693875 3300041511 Bacteria 2015
214 Ga0451853_0143431 3300041512 Bacteria 1404
215 Ga0439449_0004313 3300042007 Bacteria 5494
216 Ga0439449_0015111 3300042007 Bacteria 2901
217 Ga0450906_002957 3300042145 Bacteria 3692
218 Ga0450910_000972 3300042147 Bacteria 3476
219 Ga0450918_002206 3300042531 Bacteria 3705
220 Ga0466972_0025826 3300044658 Bacteria 2910
221 Ga0466970_0061750 3300044765 Bacteria 2008
222 Ga0466957_0235574 3300044842 Bacteria 1213
223 Ga0466960_0176713 3300044901 Bacteria 1155
224 Ga0495592_0020759 3300046454 Bacteria 4997
225 Ga0495638_0000145 3300046460 Bacteria 112275
226 Ga0495638_0034450 3300046460 Bacteria 3232
227 Ga0495651_0068461 3300046462 Bacteria 2706
228 Ga0495605_0001139 3300046474 Bacteria 17624
229 Ga0495662_0002455 3300046476 Bacteria 9334
230 Ga0495584_0069103 3300046491 Bacteria 1775
231 Ga0495585_0016507 3300046492 Bacteria 4278
232 Ga0495585_0017035 3300046492 Bacteria 4205
233 Ga0495583_0034309 3300046506 Bacteria 2432
234 Ga0495606_0017418 3300046507 Bacteria 5433
235 Ga0495606_0030920 3300046507 Bacteria 3731
236 Ga0495616_0011477 3300046513 Bacteria 5073
237 Ga0495616_0033924 3300046513 Bacteria 2655
238 Ga0495631_0003969 3300046518 Bacteria 7985
239 Ga0495631_0020970 3300046518 Bacteria 3046
240 Ga0495632_0022987 3300046519 Bacteria 3335
241 Ga0495643_0010731 3300046522 Bacteria 5627
242 Ga0495643_0084677 3300046522 Bacteria 1645
243 Ga0495652_0144869 3300046529 Bacteria 1864
244 Ga0495654_0000207 3300046530 Bacteria 55932
245 Ga0495654_0025993 3300046530 Bacteria 3014
246 Ga0495633_0024113 3300046558 Bacteria 3009
247 Ga0495668_0075020 3300046616 Bacteria 1857
248 Ga0495625_0000467 3300046660 Bacteria 60730
249 Ga0495635_0139854 3300046663 Bacteria 1649
250 Ga0495588_0019114 3300046674 Bacteria 3353
251 Ga0495657_0058076 3300046675 Bacteria 2570
252 Ga0495658_0015175 3300046683 Bacteria 3950
253 Ga0495670_0014978 3300046691 Bacteria 3816
254 Ga0495670_0036264 3300046691 Bacteria 2457
255 Ga0495649_0020639 3300046694 Bacteria 3693
256 Ga0495600_0004371 3300046809 Bacteria 8457
257 Ga0495660_0015384 3300046810 Bacteria 4421
258 Ga0495604_0006484 3300047317 Bacteria 9275
259 Ga0495687_037028 3300047443 Bacteria 2177
260 Ga0495685_023240 3300047447 Bacteria 2134
261 Ga0495681_0029723 3300047470 Bacteria 2793
262 Ga0495686_0000090 3300047472 Bacteria 193179
263 Ga0495686_0000104 3300047472 Bacteria 176370
264 Ga0495686_0160124 3300047472 Bacteria 1316
265 Ga0495602_0091657 3300048088 Bacteria 2520
266 Ga0495615_0020746 3300048090 Bacteria 1476
267 Ga0496102_0165517 3300048905 Bacteria 2081
268 Ga0496104_0062677 3300048907 Bacteria 3526
269 Ga0496106_0000201 3300048909 Bacteria 41935
270 Ga0496116_0000061 3300048919 Bacteria 271860
271 Ga0496116_0002679 3300048919 Bacteria 18404
272 Ga0496116_0004501 3300048919 Bacteria 13269
273 Ga0496116_0004648 3300048919 Bacteria 13000
274 Ga0496116_0031988 3300048919 Bacteria 3756
275 Ga0496117_0000052 3300048920 Bacteria 280463
276 Ga0496117_0023170 3300048920 Bacteria 4957
277 Ga0496117_0037272 3300048920 Bacteria 3624
278 Ga0496117_0046827 3300048920 Bacteria 3107
279 Ga0496117_0085888 3300048920 Bacteria 2046
280 Ga0496118_0002033 3300048921 Bacteria 28616
281 Ga0496118_0017654 3300048921 Bacteria 6480
282 Ga0496118_0027725 3300048921 Bacteria 4785
283 Ga0496118_0108238 3300048921 Bacteria 1853
284 Ga0496119_0019076 3300048922 Bacteria 5070
285 Ga0496119_0058919 3300048922 Bacteria 2310
286 Ga0496119_0069758 3300048922 Bacteria 2064
287 Ga0496120_0000019 3300048923 Bacteria 260115
288 Ga0496121_0002933 3300048924 Bacteria 24956
289 Ga0496121_0080991 3300048924 Bacteria 2571
290 Ga0496122_0000053 3300048925 Bacteria 260120
291 Ga0496122_0018212 3300048925 Bacteria 6504
292 Ga0496122_0040218 3300048925 Bacteria 3720
293 Ga0496122_0057615 3300048925 Bacteria 2883
294 Ga0496122_0081348 3300048925 Bacteria 2255
295 Ga0496122_0088970 3300048925 Bacteria 2113
296 Ga0496123_0000038 3300048926 Bacteria 260120
297 Ga0496123_0000519 3300048926 Bacteria 66923
298 Ga0496123_0018674 3300048926 Bacteria 5498
299 Ga0496123_0042802 3300048926 Bacteria 3119
300 Ga0496124_0000483 3300048927 Bacteria 68579
301 Ga0496124_0003526 3300048927 Bacteria 19054
302 Ga0496124_0019573 3300048927 Bacteria 6291
303 Ga0496124_0034429 3300048927 Bacteria 4445
304 Ga0496124_0047109 3300048927 Bacteria 3689
305 Ga0496124_0058885 3300048927 Bacteria 3228
306 Ga0496124_0120775 3300048927 Bacteria 2094
307 Ga0496125_0000790 3300048928 Bacteria 51640
308 Ga0496125_0024340 3300048928 Bacteria 5570
309 Ga0496125_0061220 3300048928 Bacteria 3020
310 Ga0496125_0086139 3300048928 Bacteria 2377
311 Ga0496125_0120740 3300048928 Bacteria 1870
312 Ga0496126_0000397 3300048929 Bacteria 89305
313 Ga0496126_0000466 3300048929 Bacteria 80395
314 Ga0496126_0017014 3300048929 Bacteria 7255
315 Ga0501031_0013226 3300049568 Bacteria 5387
316 Ga0501031_0034233 3300049568 Bacteria 3315
317 Ga0501031_0038882 3300049568 Bacteria 3104
318 Ga0501031_0051048 3300049568 Bacteria 2694
319 Ga0501031_0174430 3300049568 Bacteria 1405
320 Ga0501032_0003253 3300049569 Bacteria 12494
321 Ga0501032_0004273 3300049569 Bacteria 10788
322 Ga0501032_0029214 3300049569 Bacteria 3786
323 Ga0501033_0000380 3300049570 Bacteria 42699
324 Ga0501033_0004740 3300049570 Bacteria 10881
325 Ga0501033_0102586 3300049570 Bacteria 2087
326 Ga0501034_0014864 3300049571 Bacteria 8008
327 Ga0501034_0046250 3300049571 Bacteria 4398
328 Ga0501034_0229199 3300049571 Bacteria 1807
329 Ga0501034_0373417 3300049571 Bacteria 1352
330 Ga0501036_0022339 3300049572 Bacteria 5321
331 Ga0501036_0108528 3300049572 Bacteria 2346
332 Ga0501036_0221455 3300049572 Bacteria 1589
333 Ga0501037_0000242 3300049573 Bacteria 46822
334 Ga0501037_0019020 3300049573 Bacteria 5063
335 Ga0501037_0101320 3300049573 Bacteria 2078
336 Ga0501037_0167086 3300049573 Bacteria 1566
337 Ga0501038_0018096 3300049574 Bacteria 6365
338 Ga0501038_0097541 3300049574 Bacteria 2452
339 Ga0501039_0126077 3300049575 Bacteria 2008
340 Ga0501039_0274852 3300049575 Bacteria 1324
341 Ga0501040_0060831 3300049576 Bacteria 2596
342 Ga0501041_0028924 3300049577 Bacteria 3343
343 Ga0501042_0040551 3300049578 Bacteria 3310
344 Ga0501043_0000440 3300049579 Bacteria 37461
345 Ga0501043_0012356 3300049579 Bacteria 6677
346 Ga0501043_0031568 3300049579 Bacteria 4164
347 Ga0501043_0038036 3300049579 Bacteria 3784
348 Ga0501043_0046035 3300049579 Bacteria 3430
349 Ga0501043_0217837 3300049579 Bacteria 1478
350 Ga0501046_0006017 3300049580 Bacteria 10790
351 Ga0501046_0305484 3300049580 Bacteria 1161
352 Ga0501047_0004948 3300049581 Bacteria 12512
353 Ga0501047_0006003 3300049581 Bacteria 11415
354 Ga0501047_0007000 3300049581 Bacteria 10590
355 Ga0501047_0031398 3300049581 Bacteria 5123
356 Ga0501067_0000134 3300049583 Bacteria 40540
357 Ga0501069_0000017 3300049585 Bacteria 141492
358 Ga0501070_0007767 3300049586 Bacteria 9093
359 Ga0501070_0010286 3300049586 Bacteria 7911
360 Ga0501070_0025357 3300049586 Bacteria 4973
361 Ga0501071_0031427 3300049587 Bacteria 3763
362 Ga0501073_0000003 3300049589 Bacteria 294975
363 Ga0501073_0000405 3300049589 Bacteria 29429
364 Ga0501073_0023070 3300049589 Bacteria 4473
365 Ga0501074_0000610 3300049590 Bacteria 22218
366 Ga0501076_0025403 3300049592 Bacteria 4583
367 Ga0501077_0000001 3300049593 Bacteria 270489
368 Ga0501079_0019150 3300049741 Bacteria 5229
369 Ga0501080_0006075 3300049742 Bacteria 10826
370 Ga0501080_0020832 3300049742 Bacteria 6069
371 Ga0501080_0072609 3300049742 Bacteria 3202
372 Ga0501081_0000483 3300049743 Bacteria 22159
373 Ga0501083_0003168 3300049744 Bacteria 11450
374 Ga0501083_0081265 3300049744 Bacteria 2149
375 Ga0501083_0171561 3300049744 Bacteria 1418
376 Ga0501280_000460 3300049776 Bacteria 9712
377 Ga0501035_0000101 3300049822 Bacteria 106949
378 Ga0501035_0003046 3300049822 Bacteria 16081
379 Ga0501035_0003169 3300049822 Bacteria 15796
380 Ga0501035_0132319 3300049822 Bacteria 2173
381 Ga0501044_0000010 3300049823 Bacteria 260121
382 Ga0501044_0020484 3300049823 Bacteria 7062
383 Ga0501044_0043139 3300049823 Bacteria 4687
384 Ga0501044_0045301 3300049823 Bacteria 4558
385 Ga0501044_0063871 3300049823 Bacteria 3759
386 Ga0501044_0071701 3300049823 Bacteria 3522
387 Ga0501044_0096823 3300049823 Bacteria 2972
388 Ga0501045_0017054 3300049824 Bacteria 5157
389 Ga0501045_0190459 3300049824 Bacteria 1529
390 nmdc:mga03683_118067_c1 3300050489 Bacteria 1177
391 nmdc:mga03683_1280_c1 3300050489 Bacteria 7437
392 nmdc:mga03683_33530_c1 3300050489 Bacteria 2073
393 nmdc:mga03683_3490_c1 3300050489 Bacteria 5085
394 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
395 nmdc:mga00v17_5900_c1 3300050491 Bacteria 6471
396 nmdc:mga0yw44_16889_c1 3300050492 Bacteria 3955
397 nmdc:mga0yw44_27031_c1 3300050492 Bacteria 3283
398 nmdc:mga0yw44_4747_c1 3300050492 Bacteria 6295
399 nmdc:mga0yw44_65_c1 3300050492 Bacteria 38061
400 nmdc:mga0yw44_81296_c1 3300050492 Bacteria 2031
401 nmdc:mga0k408_29501_c1 3300050493 Bacteria 3123
402 nmdc:mga04h51_25469_c1 3300050495 Bacteria 1821
403 nmdc:mga0sz30_1795_c1 3300050516 Bacteria 7627
404 nmdc:mga0sz30_55436_c1 3300050516 Bacteria 1687
405 Ga0500578_0016118 3300053086 Bacteria 4796
406 Ga0500643_013426 3300053087 Bacteria 2891
407 Ga0500644_0066779 3300053088 Bacteria 1284
408 Ga0500594_0000508 3300053118 Bacteria 8435
409 Ga0500614_024328 3300053123 Bacteria 1430
410 Ga0500618_000025 3300053125 Bacteria 150583
411 Ga0500618_012150 3300053125 Bacteria 2263
412 Ga0500658_0000451 3300053134 Bacteria 17503
413 Ga0500658_0016024 3300053134 Bacteria 2790
414 Ga0500658_0023525 3300053134 Bacteria 2353
415 Ga0500561_0000154 3300053137 Bacteria 13040
416 Ga0500568_0000184 3300053139 Bacteria 55068
417 Ga0500568_0015352 3300053139 Bacteria 3430
418 Ga0500590_000090 3300053148 Bacteria 23712
419 Ga0500616_0002258 3300053153 Bacteria 16380
420 Ga0500616_0008839 3300053153 Bacteria 6194
421 Ga0500616_0055053 3300053153 Bacteria 2082
422 Ga0500622_0000647 3300053156 Bacteria 31120
423 Ga0500622_0001402 3300053156 Bacteria 19418
424 Ga0500624_000584 3300053157 Bacteria 10067
425 Ga0500627_0048421 3300053158 Bacteria 1846
426 Ga0500636_0000009 3300053177 Bacteria 155504
427 Ga0500636_0078327 3300053177 Bacteria 1908
428 Ga0501084_0020656 3300054114 Bacteria 5492
429 Ga0501082_0001434 3300060353 Bacteria 20937
430 Ga0501082_0117029 3300060353 Bacteria 2309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2551306091 2551729462 292
2 iso_pu_bacteria 2551306093 2551746578 293
3 iso_pu_bacteria 2937980651 2937984824 301
4 3300047472 Ga0495686_0160124 Ga0495686_0160124_290_1285 309
5 3300003215 JGI25153J46596_10022771 JGI25153J46596_100227712 311
6 3300025245 Ga0207425_1005788 Ga0207425_10057883 311
7 3300025258 Ga0209129_1001260 Ga0209129_100126015 311
8 3300025294 Ga0209025_1034531 Ga0209025_10345312 311
9 3300025297 Ga0209758_1000792 Ga0209758_100079223 311
10 3300049776 Ga0501280_000460 Ga0501280_000460_1600_2670 313
11 iso_pu_bacteria 2937868953 2937877162 317
12 3300028794 Ga0307515_10091653 Ga0307515_100916533 319
13 3300009093 Ga0105240_10143644 Ga0105240_101436442 322
14 3300009551 Ga0105238_10184211 Ga0105238_101842112 322
15 3300013102 Ga0157371_10007676 Ga0157371_100076763 322
16 3300025924 Ga0207694_10198571 Ga0207694_101985712 322
17 3300026041 Ga0207639_10150265 Ga0207639_101502652 322
18 3300039110 Ga0400487_14362 Ga0400487_14362_724_1842 322
19 3300048905 Ga0496102_0165517 Ga0496102_0165517_374_1471 322
20 3300048919 Ga0496116_0000061 Ga0496116_0000061_118234_119304 322
21 3300048928 Ga0496125_0061220 Ga0496125_0061220_1730_2827 322
22 3300048929 Ga0496126_0000397 Ga0496126_0000397_77714_78784 322
23 3300005539 Ga0068853_100151806 Ga0068853_1001518061 323
24 3300026041 Ga0207639_10100524 Ga0207639_101005242 323
25 3300048090 Ga0495615_0020746 Ga0495615_0020746_398_1444 323
26 iso_pu_bacteria 2898795034 2898795833 323
27 iso_pu_bacteria 2917554339 2917558840 323
28 iso_pu_bacteria 8054563764 8054566313 323
29 iso_pu_bacteria 2837651117 2837652010 324
30 iso_pu_bacteria 2854681122 2854683051 324
31 iso_pu_bacteria 2919679072 2919682998 324
32 iso_pu_bacteria 2919679072 2919683411 324
33 3300003790 Ga0055528_1012402 Ga0055528_10124023 325
34 3300003792 Ga0055540_1000164 Ga0055540_10001642 325
35 3300025273 Ga0209673_1010820 Ga0209673_10108203 325
36 3300025297 Ga0209758_1039432 Ga0209758_10394322 325
37 3300025303 Ga0209051_1000070 Ga0209051_1000070121 325
38 3300025304 Ga0209257_1009616 Ga0209257_10096165 325
39 3300048929 Ga0496126_0017014 Ga0496126_0017014_4015_5085 325
40 iso_pu_bacteria 2937822353 2937827256 325
41 iso_pu_bacteria 2588253730 2588516522 326
42 iso_pu_bacteria 2883291878 2883296293 326
43 iso_pu_bacteria 2894652903 2894653433 326
44 iso_pu_bacteria 2899803654 2899808380 326
45 3300047472 Ga0495686_0000104 Ga0495686_0000104_102363_103421 327
46 iso_pu_bacteria 2511231027 2511392113 327
47 iso_pu_bacteria 2643221550 2643773738 327
48 iso_pu_bacteria 2643221551 2643775555 327
49 iso_pu_bacteria 2643221555 2643794001 327
50 iso_pu_bacteria 2643221623 2644133066 327
51 iso_pu_bacteria 2687453392 2688599389 327
52 iso_pu_bacteria 2693429783 2694632172 327
53 iso_pu_bacteria 2693429784 2694634420 327
54 iso_pu_bacteria 2721755686 2723576341 327
55 iso_pu_bacteria 2738543024 2739306308 327
56 iso_pu_bacteria 2756170246 2756675858 327
57 iso_pu_bacteria 2765235802 2765465975 327
58 iso_pu_bacteria 2767802442 2770196611 327
59 iso_pu_bacteria 2775506902 2776267860 327
60 iso_pu_bacteria 2775506902 2776269279 327
61 iso_pu_bacteria 2775506904 2776281831 327
62 iso_pu_bacteria 2775506904 2776283582 327
63 iso_pu_bacteria 2839993093 2839993608 327
64 iso_pu_bacteria 2840764183 2840766629 327
65 iso_pu_bacteria 2842871566 2842874912 327
66 iso_pu_bacteria 2844002411 2844006477 327
67 iso_pu_bacteria 2856328259 2856328941 327
68 iso_pu_bacteria 2856334872 2856335375 327
69 iso_pu_bacteria 2856349417 2856354519 327
70 iso_pu_bacteria 2856356410 2856362987 327
71 iso_pu_bacteria 2856364286 2856368864 327
72 iso_pu_bacteria 2857349434 2857350164 327
73 iso_pu_bacteria 2857367948 2857369209 327
74 iso_pu_bacteria 2869249662 2869251942 327
75 iso_pu_bacteria 2869264136 2869266586 327
76 iso_pu_bacteria 2869271264 2869273660 327
77 iso_pu_bacteria 2869285874 2869291359 327
78 iso_pu_bacteria 2871429161 2871433639 327
79 iso_pu_bacteria 2871459585 2871459822 327
80 iso_pu_bacteria 2871466892 2871469497 327
81 iso_pu_bacteria 2871488783 2871495745 327
82 iso_pu_bacteria 2874102143 2874104532 327
83 iso_pu_bacteria 2874123672 2874125960 327
84 iso_pu_bacteria 2874131515 2874137590 327
85 iso_pu_bacteria 2874146452 2874153240 327
86 iso_pu_bacteria 2874155637 2874160505 327
87 iso_pu_bacteria 2874162495 2874162718 327
88 iso_pu_bacteria 2876377896 2876383998 327
89 iso_pu_bacteria 2876392853 2876395011 327
90 iso_pu_bacteria 2876399893 2876403105 327
91 iso_pu_bacteria 2876413966 2876419531 327
92 iso_pu_bacteria 2878745973 2878751250 327
93 iso_pu_bacteria 2878753008 2878753456 327
94 iso_pu_bacteria 2878774303 2878778737 327
95 iso_pu_bacteria 2878781027 2878787458 327
96 iso_pu_bacteria 2881155292 2881156319 327
97 iso_pu_bacteria 2881161766 2881168349 327
98 iso_pu_bacteria 2881845957 2881847506 327
99 iso_pu_bacteria 2881853255 2881854443 327
100 iso_pu_bacteria 2881861095 2881864639 327
101 iso_pu_bacteria 2882912400 2882913121 327
102 iso_pu_bacteria 2885305155 2885310348 327
103 iso_pu_bacteria 2885318864 2885323059 327
104 iso_pu_bacteria 2885326080 2885332848 327
105 iso_pu_bacteria 2885334103 2885341354 327
106 iso_pu_bacteria 2888350351 2888356591 327
107 iso_pu_bacteria 2889010040 2889011496 327
108 iso_pu_bacteria 2889016732 2889016774 327
109 iso_pu_bacteria 2903492973 2903495311 327
110 iso_pu_bacteria 2903492973 2903501748 327
111 iso_pu_bacteria 2904578770 2904579694 327
112 iso_pu_bacteria 2904659560 2904661642 327
113 iso_pu_bacteria 2906308376 2906313191 327
114 iso_pu_bacteria 2906321335 2906325902 327
115 iso_pu_bacteria 2906328253 2906335266 327
116 iso_pu_bacteria 2906363423 2906365821 327
117 iso_pu_bacteria 2906370794 2906376515 327
118 iso_pu_bacteria 2906386501 2906392579 327
119 iso_pu_bacteria 2906393657 2906394786 327
120 iso_pu_bacteria 2906408224 2906412679 327
121 iso_pu_bacteria 2919119836 2919120639 327
122 iso_pu_bacteria 2919119836 2919124362 327
123 iso_pu_bacteria 2922130491 2922135521 327
124 iso_pu_bacteria 2922151315 2922151681 327
125 iso_pu_bacteria 2922158528 2922164119 327
126 iso_pu_bacteria 2922172374 2922176415 327
127 iso_pu_bacteria 2922178524 2922180630 327
128 iso_pu_bacteria 2922185730 2922190941 327
129 iso_pu_bacteria 2924726620 2924727394 327
130 iso_pu_bacteria 2924748358 2924752654 327
131 iso_pu_bacteria 2924762789 2924768938 327
132 iso_pu_bacteria 2924784321 2924789629 327
133 iso_pu_bacteria 2928521798 2928522493 327
134 iso_pu_bacteria 2937813078 2937820658 327
135 iso_pu_bacteria 2937891427 2937898092 327
136 iso_pu_bacteria 2954011201 2954014112 327
137 iso_pu_bacteria 2958041894 2958056490 327
138 iso_pu_bacteria 2958100919 2958106721 327
139 iso_pu_bacteria 2958115193 2958122291 327
140 iso_pu_bacteria 2958122699 2958125343 327
141 iso_pu_bacteria 2958130278 2958135759 327
142 iso_pu_bacteria 2958137437 2958139104 327
143 iso_pu_bacteria 2958172287 2958175009 327
144 iso_pu_bacteria 2958179912 2958185250 327
145 iso_pu_bacteria 2961077736 2961083517 327
146 iso_pu_bacteria 2961114664 2961116795 327
147 iso_pu_bacteria 2961136820 2961139048 327
148 iso_pu_bacteria 2961170736 2961177900 327
149 iso_pu_bacteria 2965025482 2965029490 327
150 iso_pu_bacteria 2965032056 2965039647 327
151 iso_pu_bacteria 2965040258 2965042289 327
152 iso_pu_bacteria 2965062239 2965064986 327
153 iso_pu_bacteria 2965089291 2965094053 327
154 iso_pu_bacteria 2965102966 2965110879 327
155 iso_pu_bacteria 2965119406 2965119737 327
156 iso_pu_bacteria 2967996073 2968003167 327
157 iso_pu_bacteria 2968003550 2968003993 327
158 iso_pu_bacteria 2968091066 2968091830 327
159 iso_pu_bacteria 2968097103 2968101619 327
160 iso_pu_bacteria 2968110612 2968112702 327
161 iso_pu_bacteria 2968128360 2968129892 327
162 iso_pu_bacteria 2970489779 2970495859 327
163 iso_pu_bacteria 2970503327 2970510576 327
164 iso_pu_bacteria 2970547951 2970550427 327
165 iso_pu_bacteria 2977821940 2977822604 327
166 iso_pu_bacteria 2977828996 2977831321 327
167 iso_pu_bacteria 2977843712 2977848956 327
168 iso_pu_bacteria 2977858184 2977862322 327
169 iso_pu_bacteria 2977872689 2977872866 327
170 iso_pu_bacteria 2977915119 2977920592 327
171 iso_pu_bacteria 2977935797 2977941441 327
172 iso_pu_bacteria 2977950692 2977951933 327
173 iso_pu_bacteria 2979710463 2979712515 327
174 iso_pu_bacteria 2979742915 2979749868 327
175 iso_pu_bacteria 2979779861 2979779887 327
176 iso_pu_bacteria 2979793036 2979798095 327
177 iso_pu_bacteria 2979808191 2979815450 327
178 iso_pu_bacteria 2987636660 2987637352 327
179 iso_pu_bacteria 2987645492 2987646899 327
180 iso_pu_bacteria 2987652177 2987653965 327
181 iso_pu_bacteria 2987666974 2987670616 327
182 iso_pu_bacteria 2987673487 2987676705 327
183 iso_pu_bacteria 2996341866 2996345225 327
184 iso_pu_bacteria 3000135777 3000138450 327
185 iso_pu_bacteria 3004195979 3004200175 327
186 iso_pu_bacteria 3004203850 3004206251 327
187 iso_pu_bacteria 3004239961 3004243142 327
188 iso_pu_bacteria 649633066 649873893 327
189 iso_pu_bacteria 8002285264 8002287638 327
190 iso_pu_bacteria 8004300914 8004301064 327
191 iso_pu_bacteria 8004361976 8004366346 327
192 iso_pu_bacteria 8004374579 8004375028 327
193 iso_pu_bacteria 8004387939 8004394085 327
194 iso_pu_bacteria 8004703790 8004713725 327
195 iso_pu_bacteria 8004714634 8004719448 327
196 3300039062 Ga0400483_209833 Ga0400483_209833_637_1719 328
197 3300049568 Ga0501031_0038882 Ga0501031_0038882_1323_2387 328
198 3300049572 Ga0501036_0022339 Ga0501036_0022339_2275_3339 328
199 3300049575 Ga0501039_0274852 Ga0501039_0274852_242_1306 328
200 3300049576 Ga0501040_0060831 Ga0501040_0060831_1391_2455 328
201 3300049577 Ga0501041_0028924 Ga0501041_0028924_1558_2622 328
202 3300049578 Ga0501042_0040551 Ga0501042_0040551_814_1878 328
203 3300049579 Ga0501043_0217837 Ga0501043_0217837_44_1108 328
204 3300049580 Ga0501046_0006017 Ga0501046_0006017_622_1686 328
205 3300049592 Ga0501076_0025403 Ga0501076_0025403_2472_3536 328
206 3300049741 Ga0501079_0019150 Ga0501079_0019150_128_1192 328
207 3300049743 Ga0501081_0000483 Ga0501081_0000483_9263_10327 328
208 3300049744 Ga0501083_0081265 Ga0501083_0081265_130_1194 328
209 3300049824 Ga0501045_0017054 Ga0501045_0017054_1767_2831 328
210 3300053125 Ga0500618_012150 Ga0500618_012150_528_1628 328
211 3300054114 Ga0501084_0020656 Ga0501084_0020656_2007_3071 328
212 3300060353 Ga0501082_0001434 Ga0501082_0001434_10560_11624 328
213 iso_pu_bacteria 2508501127 2509140603 328
214 iso_pu_bacteria 2510917022 2511133082 328
215 iso_pu_bacteria 2513237351 2514589949 328
216 iso_pu_bacteria 2582581307 2585271819 328
217 iso_pu_bacteria 2582581308 2585279815 328
218 iso_pu_bacteria 2582581315 2585326643 328
219 iso_pu_bacteria 2585427527 2585531781 328
220 iso_pu_bacteria 2585427530 2585551271 328
221 iso_pu_bacteria 2585427531 2585563815 328
222 iso_pu_bacteria 2585427608 2585896987 328
223 iso_pu_bacteria 2585427609 2585907154 328
224 iso_pu_bacteria 2585428125 2587982852 328
225 iso_pu_bacteria 2597489875 2597814060 328
226 iso_pu_bacteria 2615840626 2616306606 328
227 iso_pu_bacteria 2615840698 2616551242 328
228 iso_pu_bacteria 2667528174 2671113366 328
229 iso_pu_bacteria 2818991448 2819611621 328
230 iso_pu_bacteria 2818991453 2819638702 328
231 iso_pu_bacteria 2838029111 2838031048 328
232 iso_pu_bacteria 2841734538 2841740051 328
233 iso_pu_bacteria 2842475841 2842477780 328
234 iso_pu_bacteria 2842502639 2842504348 328
235 iso_pu_bacteria 2856342000 2856343733 328
236 iso_pu_bacteria 2871474448 2871475344 328
237 iso_pu_bacteria 2878788777 2878791526 328
238 iso_pu_bacteria 2885312484 2885317152 328
239 iso_pu_bacteria 2888343758 2888347498 328
240 iso_pu_bacteria 2894817345 2894817493 328
241 iso_pu_bacteria 2919408235 2919411179 328
242 iso_pu_bacteria 2937836603 2937837807 328
243 iso_pu_bacteria 2958071322 2958077545 328
244 iso_pu_bacteria 2970524798 2970531747 328
245 iso_pu_bacteria 2996310559 2996313230 328
246 iso_pu_bacteria 2996336353 2996337776 328
247 iso_pu_bacteria 3002141150 3002141987 328
248 iso_pu_bacteria 3005416602 3005421506 328
249 iso_pu_bacteria 8004395343 8004403515 328
250 iso_pu_bacteria 8004633249 8004639358 328
251 iso_pu_bacteria 8005314921 8005319791 328
252 iso_pu_bacteria 8005484373 8005490417 328
253 iso_pu_bacteria 8005645114 8005647060 328
254 iso_pu_bacteria 8005682033 8005686990 328
255 iso_pu_bacteria 8018150411 8018154129 328
256 iso_pu_bacteria 8055617313 8055621568 328
257 iso_pu_bacteria 2558860983 2561467803 329
258 iso_pu_bacteria 2889790730 2889793572 329
259 iso_pu_bacteria 2889914905 2889918711 329
260 iso_pu_bacteria 8056875544 8056876432 329
261 3300003762 Ga0055542_1001265 Ga0055542_10012654 330
262 3300025254 Ga0209148_1000072 Ga0209148_1000072223 330
263 3300025272 Ga0209455_1000133 Ga0209455_100013362 330
264 3300028794 Ga0307515_10034543 Ga0307515_100345436 330
265 3300036712 Ga0316584_0078349 Ga0316584_0078349_833_1954 330
266 3300038726 Ga0400490_57059 Ga0400490_57059_361_1440 330
267 3300039062 Ga0400483_002058 Ga0400483_002058_80_1153 330
268 3300050492 nmdc:mga0yw44_81296_c1 nmdc:mga0yw44_81296_c1_656_1720 330
269 iso_pu_bacteria 2508501122 2509109435 330
270 iso_pu_bacteria 2509276019 2509378255 330
271 iso_pu_bacteria 2509276021 2509386322 330
272 iso_pu_bacteria 2509276033 2509441606 330
273 iso_pu_bacteria 2510065019 2510137688 330
274 iso_pu_bacteria 2510065057 2510306928 330
275 iso_pu_bacteria 2510461069 2510840822 330
276 iso_pu_bacteria 2510461076 2510893478 330
277 iso_pu_bacteria 2510917028 2511181721 330
278 iso_pu_bacteria 2510917030 2511193496 330
279 iso_pu_bacteria 2511231052 2511503166 330
280 iso_pu_bacteria 2512047086 2512534444 330
281 iso_pu_bacteria 2512875026 2512973751 330
282 iso_pu_bacteria 2513237084 2513571741 330
283 iso_pu_bacteria 2513237085 2513575756 330
284 iso_pu_bacteria 2513237086 2513585224 330
285 iso_pu_bacteria 2513237088 2513598621 330
286 iso_pu_bacteria 2513237089 2513601732 330
287 iso_pu_bacteria 2513237091 2513616917 330
288 iso_pu_bacteria 2513237093 2513635367 330
289 iso_pu_bacteria 2513237103 2513712606 330
290 iso_pu_bacteria 2513237138 2513866074 330
291 iso_pu_bacteria 2513237140 2513884131 330
292 iso_pu_bacteria 2513237143 2513903460 330
293 iso_pu_bacteria 2513237156 2513984005 330
294 iso_pu_bacteria 2513237159 2513998598 330
295 iso_pu_bacteria 2513237160 2514003685 330
296 iso_pu_bacteria 2513237162 2514019071 330
297 iso_pu_bacteria 2515075009 2515109263 330
298 iso_pu_bacteria 2515154107 2515610908 330
299 iso_pu_bacteria 2515154113 2515633418 330
300 iso_pu_bacteria 2515154114 2515641701 330
301 iso_pu_bacteria 2515154116 2515659027 330
302 iso_pu_bacteria 2515154134 2515743855 330
303 iso_pu_bacteria 2516143018 2516204772 330
304 iso_pu_bacteria 2516653046 2516894599 330
305 iso_pu_bacteria 2516653077 2517042398 330
306 iso_pu_bacteria 2516653085 2517081213 330
307 iso_pu_bacteria 2517093000 2517099423 330
308 iso_pu_bacteria 2517287029 2517411910 330
309 iso_pu_bacteria 2517487022 2517571247 330
310 iso_pu_bacteria 2519899620 2520378218 330
311 iso_pu_bacteria 2524023207 2524453299 330
312 iso_pu_bacteria 2529292951 2530649957 330
313 iso_pu_bacteria 2534681796 2535516710 330
314 iso_pu_bacteria 2537561587 2537873075 330
315 iso_pu_bacteria 2551306084 2551682806 330
316 iso_pu_bacteria 2551306085 2551687418 330
317 iso_pu_bacteria 2551306086 2551692737 330
318 iso_pu_bacteria 2551306087 2551703558 330
319 iso_pu_bacteria 2554235003 2554245078 330
320 iso_pu_bacteria 2558860100 2558867261 330
321 iso_pu_bacteria 2558860242 2559297091 330
322 iso_pu_bacteria 2582581283 2585166838 330
323 iso_pu_bacteria 2582581294 2585200362 330
324 iso_pu_bacteria 2582581298 2585226805 330
325 iso_pu_bacteria 2582581299 2585229824 330
326 iso_pu_bacteria 2582581304 2585254936 330
327 iso_pu_bacteria 2582581306 2585266811 330
328 iso_pu_bacteria 2582581865 2585387853 330
329 iso_pu_bacteria 2582581866 2585395953 330
330 iso_pu_bacteria 2582581867 2585404329 330
331 iso_pu_bacteria 2585427526 2585526305 330
332 iso_pu_bacteria 2585427528 2585539445 330
333 iso_pu_bacteria 2585427529 2585550220 330
334 iso_pu_bacteria 2585427590 2585821971 330
335 iso_pu_bacteria 2585427593 2585837399 330
336 iso_pu_bacteria 2585427594 2585843032 330
337 iso_pu_bacteria 2599185156 2599334046 330
338 iso_pu_bacteria 2599185210 2599604944 330
339 iso_pu_bacteria 2599185352 2600193517 330
340 iso_pu_bacteria 2600254933 2600376971 330
341 iso_pu_bacteria 2600255279 2601611068 330
342 iso_pu_bacteria 2600255308 2601747841 330
343 iso_pu_bacteria 2615840624 2616294545 330
344 iso_pu_bacteria 2643221557 2643808208 330
345 iso_pu_bacteria 2643221568 2643854371 330
346 iso_pu_bacteria 2643221582 2643916746 330
347 iso_pu_bacteria 2643221599 2644005498 330
348 iso_pu_bacteria 2643221607 2644051926 330
349 iso_pu_bacteria 2643221610 2644068603 330
350 iso_pu_bacteria 2643221618 2644110006 330
351 iso_pu_bacteria 2643221626 2644150282 330
352 iso_pu_bacteria 2643221634 2644192538 330
353 iso_pu_bacteria 2643221636 2644201518 330
354 iso_pu_bacteria 2643221637 2644209369 330
355 iso_pu_bacteria 2643221643 2644238488 330
356 iso_pu_bacteria 2643221653 2644298162 330
357 iso_pu_bacteria 2643221655 2644312886 330
358 iso_pu_bacteria 2643221659 2644336432 330
359 iso_pu_bacteria 2643221668 2644379642 330
360 iso_pu_bacteria 2643221675 2644419672 330
361 iso_pu_bacteria 2643221680 2644453029 330
362 iso_pu_bacteria 2643221686 2644484378 330
363 iso_pu_bacteria 2643221689 2644499893 330
364 iso_pu_bacteria 2643221693 2644521334 330
365 iso_pu_bacteria 2643221698 2644546080 330
366 iso_pu_bacteria 2643221712 2644618616 330
367 iso_pu_bacteria 2643221718 2644652897 330
368 iso_pu_bacteria 2643221719 2644656414 330
369 iso_pu_bacteria 2643221723 2644677234 330
370 iso_pu_bacteria 2643221726 2644688942 330
371 iso_pu_bacteria 2657244999 2657682556 330
372 iso_pu_bacteria 2690316117 2692320170 330
373 iso_pu_bacteria 2718217882 2719184532 330
374 iso_pu_bacteria 2718217927 2719388760 330
375 iso_pu_bacteria 2718217997 2719668613 330
376 iso_pu_bacteria 2718218009 2719728552 330
377 iso_pu_bacteria 2718218199 2720489306 330
378 iso_pu_bacteria 2718218232 2720609987 330
379 iso_pu_bacteria 2718218233 2720617411 330
380 iso_pu_bacteria 2718218235 2720628557 330
381 iso_pu_bacteria 2718218269 2720772507 330
382 iso_pu_bacteria 2718218363 2721144243 330
383 iso_pu_bacteria 2718218365 2721161038 330
384 iso_pu_bacteria 2718218366 2721161613 330
385 iso_pu_bacteria 2718218423 2721402541 330
386 iso_pu_bacteria 2721755514 2722842758 330
387 iso_pu_bacteria 2721755556 2723029942 330
388 iso_pu_bacteria 2721755684 2723564351 330
389 iso_pu_bacteria 2721755685 2723570007 330
390 iso_pu_bacteria 2721755809 2724034607 330
391 iso_pu_bacteria 2721755810 2724041577 330
392 iso_pu_bacteria 2721755819 2724092536 330
393 iso_pu_bacteria 2721755822 2724101554 330
394 iso_pu_bacteria 2721755823 2724112912 330
395 iso_pu_bacteria 2724679232 2725948080 330
396 iso_pu_bacteria 2728369352 2730110475 330
397 iso_pu_bacteria 2728369365 2730160647 330
398 iso_pu_bacteria 2728369397 2730301146 330
399 iso_pu_bacteria 2738541293 2738804156 330
400 iso_pu_bacteria 2738541317 2738944631 330
401 iso_pu_bacteria 2738541333 2739033904 330
402 iso_pu_bacteria 2751185821 2753459083 330
403 iso_pu_bacteria 2765235942 2766064802 330
404 iso_pu_bacteria 2775507049 2776915832 330
405 iso_pu_bacteria 2791355082 2792582089 330
406 iso_pu_bacteria 2791355091 2792622049 330
407 iso_pu_bacteria 2791355092 2792628694 330
408 iso_pu_bacteria 2791355094 2792641375 330
409 iso_pu_bacteria 2791355256 2793297634 330
410 iso_pu_bacteria 2791355259 2793317848 330
411 iso_pu_bacteria 2791355260 2793322656 330
412 iso_pu_bacteria 2791355261 2793328557 330
413 iso_pu_bacteria 2791355262 2793337137 330
414 iso_pu_bacteria 2791355263 2793343318 330
415 iso_pu_bacteria 2791355264 2793345421 330
416 iso_pu_bacteria 2791355265 2793356558 330
417 iso_pu_bacteria 2791355266 2793360006 330
418 iso_pu_bacteria 2791355267 2793368388 330
419 iso_pu_bacteria 2802428858 2802717387 330
420 iso_pu_bacteria 2802428859 2802724625 330
421 iso_pu_bacteria 2802428860 2802729376 330
422 iso_pu_bacteria 2802428861 2802736722 330
423 iso_pu_bacteria 2802428862 2802743127 330
424 iso_pu_bacteria 2802428863 2802749747 330
425 iso_pu_bacteria 2802429268 2804753553 330
426 iso_pu_bacteria 2802429605 2805928625 330
427 iso_pu_bacteria 2802429633 2806045765 330
428 iso_pu_bacteria 2802429634 2806053333 330
429 iso_pu_bacteria 2802429635 2806062374 330
430 iso_pu_bacteria 2802429636 2806066294 330
431 iso_pu_bacteria 2802429637 2806073126 330
432 iso_pu_bacteria 2808606387 2808988948 330
433 iso_pu_bacteria 2818991272 2819244244 330
434 iso_pu_bacteria 2818991439 2819561190 330
435 iso_pu_bacteria 2821123053 2821126666 330
436 iso_pu_bacteria 2838016132 2838016182 330
437 iso_pu_bacteria 2838022645 2838024636 330
438 iso_pu_bacteria 2838042994 2838046986 330
439 iso_pu_bacteria 2838048938 2838049729 330
440 iso_pu_bacteria 2838061910 2838061996 330
441 iso_pu_bacteria 2838068647 2838068714 330
442 iso_pu_bacteria 2838074704 2838078319 330
443 iso_pu_bacteria 2838668709 2838668777 330
444 iso_pu_bacteria 2838675328 2838678439 330
445 iso_pu_bacteria 2838680041 2838685700 330
446 iso_pu_bacteria 2838686498 2838688232 330
447 iso_pu_bacteria 2838694306 2838700282 330
448 iso_pu_bacteria 2838701080 2838701563 330
449 iso_pu_bacteria 2838707686 2838713537 330
450 iso_pu_bacteria 2838714209 2838716653 330
451 iso_pu_bacteria 2838719591 2838722735 330
452 iso_pu_bacteria 2838724970 2838727404 330
453 iso_pu_bacteria 2838729681 2838732411 330
454 iso_pu_bacteria 2838736955 2838740273 330
455 iso_pu_bacteria 2838742623 2838745171 330
456 iso_pu_bacteria 2841840854 2841843602 330
457 iso_pu_bacteria 2841846520 2841849022 330
458 iso_pu_bacteria 2841851746 2841851972 330
459 iso_pu_bacteria 2841859092 2841861957 330
460 iso_pu_bacteria 2841864319 2841869508 330
461 iso_pu_bacteria 2842077413 2842082912 330
462 iso_pu_bacteria 2842110456 2842117333 330
463 iso_pu_bacteria 2842118031 2842124030 330
464 iso_pu_bacteria 2842124991 2842128229 330
465 iso_pu_bacteria 2842130223 2842133332 330
466 iso_pu_bacteria 2842140634 2842143322 330
467 iso_pu_bacteria 2842146304 2842146372 330
468 iso_pu_bacteria 2842152218 2842155325 330
469 iso_pu_bacteria 2842156927 2842158952 330
470 iso_pu_bacteria 2842163707 2842166384 330
471 iso_pu_bacteria 2842170452 2842173825 330
472 iso_pu_bacteria 2842175837 2842178946 330
473 iso_pu_bacteria 2842180545 2842182566 330
474 iso_pu_bacteria 2842187318 2842189761 330
475 iso_pu_bacteria 2842192696 2842198376 330
476 iso_pu_bacteria 2842198810 2842200258 330
477 iso_pu_bacteria 2842205361 2842210734 330
478 iso_pu_bacteria 2842211629 2842214075 330
479 iso_pu_bacteria 2842217011 2842223465 330
480 iso_pu_bacteria 2842224351 2842226795 330
481 iso_pu_bacteria 2842229732 2842232929 330
482 iso_pu_bacteria 2842237096 2842242940 330
483 iso_pu_bacteria 2842243621 2842247345 330
484 iso_pu_bacteria 2842250916 2842251398 330
485 iso_pu_bacteria 2842257432 2842261564 330
486 iso_pu_bacteria 2842264693 2842265051 330
487 iso_pu_bacteria 2842271015 2842272818 330
488 iso_pu_bacteria 2842278818 2842284106 330
489 iso_pu_bacteria 2842285085 2842288236 330
490 iso_pu_bacteria 2842291075 2842297023 330
491 iso_pu_bacteria 2842304105 2842307738 330
492 iso_pu_bacteria 2842311132 2842315670 330
493 iso_pu_bacteria 2842317721 2842319645 330
494 iso_pu_bacteria 2842341865 2842346217 330
495 iso_pu_bacteria 2842363717 2842368041 330
496 iso_pu_bacteria 2842370503 2842377109 330
497 iso_pu_bacteria 2842377471 2842383524 330
498 iso_pu_bacteria 2842384541 2842390583 330
499 iso_pu_bacteria 2842395702 2842399282 330
500 iso_pu_bacteria 2842402390 2842405502 330
501 iso_pu_bacteria 2842409023 2842411741 330
502 iso_pu_bacteria 2842415677 2842418732 330
503 iso_pu_bacteria 2842422224 2842422860 330
504 iso_pu_bacteria 2842428310 2842428895 330
505 iso_pu_bacteria 2842434925 2842435508 330
506 iso_pu_bacteria 2842441272 2842441629 330
507 iso_pu_bacteria 2842447887 2842448329 330
508 iso_pu_bacteria 2842462802 2842463319 330
509 iso_pu_bacteria 2842469257 2842469839 330
510 iso_pu_bacteria 2842489311 2842490516 330
511 iso_pu_bacteria 2842495871 2842501547 330
512 iso_pu_bacteria 2842515876 2842517777 330
513 iso_pu_bacteria 2842521101 2842524371 330
514 iso_pu_bacteria 2842922631 2842925673 330
515 iso_pu_bacteria 2844163670 2844164201 330
516 iso_pu_bacteria 2844454524 2844461716 330
517 iso_pu_bacteria 2847417321 2847420685 330
518 iso_pu_bacteria 2848992105 2848995516 330
519 iso_pu_bacteria 2850079185 2850082495 330
520 iso_pu_bacteria 2854896431 2854899717 330
521 iso_pu_bacteria 2854911287 2854916194 330
522 iso_pu_bacteria 2854916844 2854921058 330
523 iso_pu_bacteria 2855825444 2855827222 330
524 iso_pu_bacteria 2855839649 2855842607 330
525 iso_pu_bacteria 2855872281 2855878043 330
526 iso_pu_bacteria 2857516855 2857523790 330
527 iso_pu_bacteria 2857531043 2857536758 330
528 iso_pu_bacteria 2858800743 2858803418 330
529 iso_pu_bacteria 2891373044 2891376159 330
530 iso_pu_bacteria 2899792073 2899794740 330
531 iso_pu_bacteria 2899845264 2899845307 330
532 iso_pu_bacteria 2913308742 2913309252 330
533 iso_pu_bacteria 2915650412 2915652278 330
534 iso_pu_bacteria 2915980308 2915982603 330
535 iso_pu_bacteria 2915986958 2915993209 330
536 iso_pu_bacteria 2915993759 2915999597 330
537 iso_pu_bacteria 2916000859 2916004032 330
538 iso_pu_bacteria 2916007675 2916012323 330
539 iso_pu_bacteria 2916014648 2916021107 330
540 iso_pu_bacteria 2916021584 2916027838 330
541 iso_pu_bacteria 2916028427 2916033581 330
542 iso_pu_bacteria 2916035215 2916039566 330
543 iso_pu_bacteria 2916041962 2916045517 330
544 iso_pu_bacteria 2916048683 2916051186 330
545 iso_pu_bacteria 2916055098 2916057503 330
546 iso_pu_bacteria 2916061851 2916065110 330
547 iso_pu_bacteria 2916076590 2916079690 330
548 iso_pu_bacteria 2919100787 2919102116 330
549 iso_pu_bacteria 2919114240 2919116870 330
550 iso_pu_bacteria 2919166419 2919168760 330
551 iso_pu_bacteria 2920822456 2920825792 330
552 iso_pu_bacteria 2921201388 2921207311 330
553 iso_pu_bacteria 2921208531 2921212450 330
554 iso_pu_bacteria 2921237296 2921241095 330
555 iso_pu_bacteria 2921244191 2921249918 330
556 iso_pu_bacteria 2921250672 2921254636 330
557 iso_pu_bacteria 2921257292 2921262083 330
558 iso_pu_bacteria 2921263974 2921270631 330
559 iso_pu_bacteria 2921282425 2921288937 330
560 iso_pu_bacteria 2921289301 2921295527 330
561 iso_pu_bacteria 2921296804 2921300684 330
562 iso_pu_bacteria 2923556063 2923558379 330
563 iso_pu_bacteria 2924144063 2924150689 330
564 iso_pu_bacteria 2924150972 2924154149 330
565 iso_pu_bacteria 2924158325 2924160228 330
566 iso_pu_bacteria 2924165586 2924172451 330
567 iso_pu_bacteria 2924172951 2924178372 330
568 iso_pu_bacteria 2924179722 2924181635 330
569 iso_pu_bacteria 2924186466 2924192902 330
570 iso_pu_bacteria 2924193448 2924195283 330
571 iso_pu_bacteria 2924200457 2924205939 330
572 iso_pu_bacteria 2924207177 2924209400 330
573 iso_pu_bacteria 2924214083 2924220264 330
574 iso_pu_bacteria 2924221636 2924228644 330
575 iso_pu_bacteria 2924228884 2924233135 330
576 iso_pu_bacteria 2926754445 2926758383 330
577 iso_pu_bacteria 2926760298 2926764058 330
578 iso_pu_bacteria 2933006813 2933009296 330
579 iso_pu_bacteria 2933011516 2933013406 330
580 iso_pu_bacteria 2933570622 2933574189 330
581 iso_pu_bacteria 2933586486 2933593431 330
582 iso_pu_bacteria 2933594066 2933598257 330
583 iso_pu_bacteria 2933599457 2933600332 330
584 iso_pu_bacteria 2935894831 2935900146 330
585 iso_pu_bacteria 2935901341 2935906286 330
586 iso_pu_bacteria 2936367885 2936373749 330
587 iso_pu_bacteria 2936375103 2936377273 330
588 iso_pu_bacteria 2936381700 2936386438 330
589 iso_pu_bacteria 2936996657 2936997614 330
590 iso_pu_bacteria 2937002841 2937008881 330
591 iso_pu_bacteria 2937009748 2937013425 330
592 iso_pu_bacteria 2937016420 2937020291 330
593 iso_pu_bacteria 2937023124 2937024722 330
594 iso_pu_bacteria 2937029754 2937033348 330
595 iso_pu_bacteria 2937036028 2937036039 330
596 iso_pu_bacteria 2937042894 2937049323 330
597 iso_pu_bacteria 2937049772 2937054351 330
598 iso_pu_bacteria 2937056579 2937061485 330
599 iso_pu_bacteria 2937063883 2937067888 330
600 iso_pu_bacteria 2937071275 2937075635 330
601 iso_pu_bacteria 2937078374 2937082400 330
602 iso_pu_bacteria 2937084907 2937085836 330
603 iso_pu_bacteria 2937091812 2937097807 330
604 iso_pu_bacteria 2937098957 2937103264 330
605 iso_pu_bacteria 2937106411 2937107744 330
606 iso_pu_bacteria 2937113482 2937116454 330
607 iso_pu_bacteria 2937119839 2937121787 330
608 iso_pu_bacteria 2937126314 2937127882 330
609 iso_pu_bacteria 2937843397 2937845938 330
610 iso_pu_bacteria 2941499720 2941501198 330
611 iso_pu_bacteria 2957375807 2957378845 330
612 iso_pu_bacteria 2957382221 2957383808 330
613 iso_pu_bacteria 2957388812 2957391524 330
614 iso_pu_bacteria 2957395598 2957398211 330
615 iso_pu_bacteria 2957402308 2957403989 330
616 iso_pu_bacteria 2957408893 2957409898 330
617 iso_pu_bacteria 2957415311 2957417959 330
618 iso_pu_bacteria 2957422303 2957423252 330
619 iso_pu_bacteria 2957430029 2957431570 330
620 iso_pu_bacteria 2957437181 2957438698 330
621 iso_pu_bacteria 2957443900 2957447524 330
622 iso_pu_bacteria 2957450854 2957455427 330
623 iso_pu_bacteria 2957457609 2957464143 330
624 iso_pu_bacteria 2957464669 2957467545 330
625 iso_pu_bacteria 2957471148 2957476603 330
626 iso_pu_bacteria 2957478035 2957480090 330
627 iso_pu_bacteria 2957484790 2957485628 330
628 iso_pu_bacteria 2957491536 2957493685 330
629 iso_pu_bacteria 2957498199 2957502124 330
630 iso_pu_bacteria 2957505466 2957512578 330
631 iso_pu_bacteria 2960584000 2960586821 330
632 iso_pu_bacteria 2960591022 2960594923 330
633 iso_pu_bacteria 2960597568 2960599344 330
634 iso_pu_bacteria 2960603979 2960608040 330
635 iso_pu_bacteria 2960610863 2960612125 330
636 iso_pu_bacteria 2960617483 2960618221 330
637 iso_pu_bacteria 2960624210 2960627424 330
638 iso_pu_bacteria 2960631154 2960634709 330
639 iso_pu_bacteria 2960637947 2960643316 330
640 iso_pu_bacteria 2960645483 2960649580 330
641 iso_pu_bacteria 2960652885 2960655446 330
642 iso_pu_bacteria 2960660292 2960663542 330
643 iso_pu_bacteria 2960667422 2960671853 330
644 iso_pu_bacteria 2960674078 2960678953 330
645 iso_pu_bacteria 2960680706 2960684331 330
646 iso_pu_bacteria 2960687367 2960693727 330
647 iso_pu_bacteria 2960693952 2960696635 330
648 iso_pu_bacteria 2964607997 2964609683 330
649 iso_pu_bacteria 2964615318 2964619442 330
650 iso_pu_bacteria 2964621998 2964628400 330
651 iso_pu_bacteria 2964628898 2964630504 330
652 iso_pu_bacteria 2964636051 2964641141 330
653 iso_pu_bacteria 2964643177 2964645298 330
654 iso_pu_bacteria 2964649959 2964652739 330
655 iso_pu_bacteria 2964656573 2964657231 330
656 iso_pu_bacteria 2964663802 2964667918 330
657 iso_pu_bacteria 2964670856 2964671050 330
658 iso_pu_bacteria 2964678106 2964678307 330
659 iso_pu_bacteria 2964685014 2964691321 330
660 iso_pu_bacteria 2964691889 2964695337 330
661 iso_pu_bacteria 2964698721 2964702545 330
662 iso_pu_bacteria 2964705432 2964709309 330
663 iso_pu_bacteria 2964712639 2964717914 330
664 iso_pu_bacteria 2964719344 2964725520 330
665 iso_pu_bacteria 2967664464 2967668923 330
666 iso_pu_bacteria 2967671571 2967673581 330
667 iso_pu_bacteria 2967678726 2967682752 330
668 iso_pu_bacteria 2967686174 2967689117 330
669 iso_pu_bacteria 2967693043 2967695533 330
670 iso_pu_bacteria 2967699805 2967703078 330
671 iso_pu_bacteria 2967706974 2967713843 330
672 iso_pu_bacteria 2967714385 2967718242 330
673 iso_pu_bacteria 2967721400 2967725364 330
674 iso_pu_bacteria 2967728569 2967731984 330
675 iso_pu_bacteria 2967735183 2967736753 330
676 iso_pu_bacteria 2967742019 2967748936 330
677 iso_pu_bacteria 2967748971 2967749931 330
678 iso_pu_bacteria 2967755722 2967757943 330
679 iso_pu_bacteria 2967762386 2967768163 330
680 iso_pu_bacteria 2967769361 2967774713 330
681 iso_pu_bacteria 2967775926 2967778486 330
682 iso_pu_bacteria 2970019648 2970023445 330
683 iso_pu_bacteria 2970026789 2970029980 330
684 iso_pu_bacteria 2970033650 2970038300 330
685 iso_pu_bacteria 2970040964 2970045917 330
686 iso_pu_bacteria 2970047711 2970048565 330
687 iso_pu_bacteria 2970054988 2970059878 330
688 iso_pu_bacteria 2970061556 2970064894 330
689 iso_pu_bacteria 2970068827 2970073103 330
690 iso_pu_bacteria 2970076120 2970079736 330
691 iso_pu_bacteria 2970082768 2970086428 330
692 iso_pu_bacteria 2970088815 2970091272 330
693 iso_pu_bacteria 2970095765 2970099466 330
694 iso_pu_bacteria 2970102677 2970106829 330
695 iso_pu_bacteria 2970109326 2970111488 330
696 iso_pu_bacteria 2970116247 2970120938 330
697 iso_pu_bacteria 2970122695 2970125910 330
698 iso_pu_bacteria 2970129317 2970131942 330
699 iso_pu_bacteria 2970136068 2970141632 330
700 iso_pu_bacteria 2970143518 2970143775 330
701 iso_pu_bacteria 2970149975 2970155011 330
702 iso_pu_bacteria 2970156795 2970157098 330
703 iso_pu_bacteria 2970164137 2970167952 330
704 iso_pu_bacteria 2970170962 2970176796 330
705 iso_pu_bacteria 2970177841 2970180174 330
706 iso_pu_bacteria 2970184632 2970185740 330
707 iso_pu_bacteria 2970191845 2970197792 330
708 iso_pu_bacteria 2977516862 2977520282 330
709 iso_pu_bacteria 2977523885 2977524559 330
710 iso_pu_bacteria 2977530762 2977534622 330
711 iso_pu_bacteria 2977537788 2977541482 330
712 iso_pu_bacteria 2977544691 2977549117 330
713 iso_pu_bacteria 2977551784 2977553355 330
714 iso_pu_bacteria 2977558990 2977564906 330
715 iso_pu_bacteria 2977565890 2977569250 330
716 iso_pu_bacteria 2977572785 2977576493 330
717 iso_pu_bacteria 2977579622 2977585433 330
718 iso_pu_bacteria 2979089926 2979090844 330
719 iso_pu_bacteria 2979095461 2979096369 330
720 iso_pu_bacteria 2979100975 2979101914 330
721 iso_pu_bacteria 2984509177 2984510148 330
722 iso_pu_bacteria 2984518228 2984519148 330
723 iso_pu_bacteria 2984601300 2984605211 330
724 iso_pu_bacteria 2989349275 2989350745 330
725 iso_pu_bacteria 2989771324 2989771451 330
726 iso_pu_bacteria 2989776772 2989776883 330
727 iso_pu_bacteria 2996887358 2996891887 330
728 iso_pu_bacteria 2996893221 2996895414 330
729 iso_pu_bacteria 3003930520 3003930773 330
730 iso_pu_bacteria 3005445848 3005450538 330
731 iso_pu_bacteria 3005452660 3005457717 330
732 iso_pu_bacteria 639633055 639645623 330
733 iso_pu_bacteria 643692032 643827284 330
734 iso_pu_bacteria 648276728 648737047 330
735 iso_pu_bacteria 650716007 650843519 330
736 iso_pu_bacteria 8003570095 8003573193 330
737 iso_pu_bacteria 8003992118 8003995189 330
738 iso_pu_bacteria 8003999396 8004002906 330
739 iso_pu_bacteria 8005246636 8005247839 330
740 iso_pu_bacteria 8005258706 8005263299 330
741 iso_pu_bacteria 8005275841 8005276170 330
742 iso_pu_bacteria 8005282627 8005288556 330
743 iso_pu_bacteria 8005289223 8005290044 330
744 iso_pu_bacteria 8005301065 8005301609 330
745 iso_pu_bacteria 8005307578 8005311812 330
746 iso_pu_bacteria 8005321885 8005326414 330
747 iso_pu_bacteria 8005376324 8005382327 330
748 iso_pu_bacteria 8005382845 8005384377 330
749 iso_pu_bacteria 8005395548 8005401427 330
750 iso_pu_bacteria 8005430974 8005431476 330
751 iso_pu_bacteria 8005497431 8005502861 330
752 iso_pu_bacteria 8005542996 8005545381 330
753 iso_pu_bacteria 8005556819 8005559659 330
754 iso_pu_bacteria 8005563573 8005563862 330
755 iso_pu_bacteria 8005570704 8005576574 330
756 iso_pu_bacteria 8005619151 8005624011 330
757 iso_pu_bacteria 8005626139 8005629276 330
758 iso_pu_bacteria 8005658619 8005662524 330
759 iso_pu_bacteria 8005668836 8005674291 330
760 iso_pu_bacteria 8005688590 8005693298 330
761 iso_pu_bacteria 8005695170 8005700377 330
762 iso_pu_bacteria 8018127388 8018129052 330
763 iso_pu_bacteria 8018163183 8018163973 330
764 iso_pu_bacteria 8018176218 8018179388 330
765 iso_pu_bacteria 8023680758 8023685813 330
766 iso_pu_bacteria 8024479707 8024486349 330
767 iso_pu_bacteria 8024486573 8024493120 330
768 iso_pu_bacteria 8024501048 8024501930 330
769 iso_pu_bacteria 8049293176 8049296117 330
770 iso_pu_bacteria 8054460903 8054465433 330
771 iso_pu_bacteria 8054558443 8054558836 330
772 iso_pu_bacteria 8056375014 8056376459 330
773 iso_pu_bacteria 8056382006 8056383813 330
774 iso_pu_bacteria 8057874678 8057878245 330
775 3300001989 JGI24739J22299_10046732 JGI24739J22299_100467321 331
776 3300005548 Ga0070665_100077892 Ga0070665_1000778922 331
777 3300005548 Ga0070665_100107612 Ga0070665_1001076122 331
778 3300005983 Ga0081540_1101780 Ga0081540_11017802 331
779 3300006048 Ga0075363_100119035 Ga0075363_1001190352 331
780 3300006177 Ga0075362_10007295 Ga0075362_100072952 331
781 3300006177 Ga0075362_10036818 Ga0075362_100368183 331
782 3300006178 Ga0075367_10134282 Ga0075367_101342822 331
783 3300025924 Ga0207694_10208937 Ga0207694_102089372 331
784 3300026089 Ga0207648_10057707 Ga0207648_100577072 331
785 3300026116 Ga0207674_10156181 Ga0207674_101561812 331
786 3300028379 Ga0268266_10136056 Ga0268266_101360562 331
787 3300032004 Ga0307414_10010225 Ga0307414_100102253 331
788 3300032004 Ga0307414_10327492 Ga0307414_103274922 331
789 3300037312 Ga0395899_0068804 Ga0395899_0068804_1303_2370 331
790 3300037418 Ga0395900_0000027 Ga0395900_0000027_210038_211165 331
791 3300037418 Ga0395900_0037071 Ga0395900_0037071_3394_4461 331
792 3300037418 Ga0395900_0045209 Ga0395900_0045209_317_1384 331
793 3300037466 Ga0395898_0000255 Ga0395898_0000255_55098_56225 331
794 3300037471 Ga0395905_0000032 Ga0395905_0000032_74768_75895 331
795 3300037471 Ga0395905_0299763 Ga0395905_0299763_187_1254 331
796 3300038443 Ga0395901_0000110 Ga0395901_0000110_74793_75920 331
797 3300038443 Ga0395901_0016396 Ga0395901_0016396_1348_2415 331
798 3300044658 Ga0466972_0025826 Ga0466972_0025826_1408_2475 331
799 3300046460 Ga0495638_0034450 Ga0495638_0034450_789_1859 331
800 3300047443 Ga0495687_037028 Ga0495687_037028_740_1822 331
801 3300049568 Ga0501031_0051048 Ga0501031_0051048_162_1232 331
802 3300049569 Ga0501032_0004273 Ga0501032_0004273_8155_9225 331
803 3300049570 Ga0501033_0004740 Ga0501033_0004740_8275_9345 331
804 3300049570 Ga0501033_0102586 Ga0501033_0102586_363_1433 331
805 3300049571 Ga0501034_0014864 Ga0501034_0014864_2063_3139 331
806 3300049571 Ga0501034_0046250 Ga0501034_0046250_1388_2455 331
807 3300049571 Ga0501034_0229199 Ga0501034_0229199_435_1505 331
808 3300049572 Ga0501036_0221455 Ga0501036_0221455_113_1189 331
809 3300049573 Ga0501037_0000242 Ga0501037_0000242_33736_34806 331
810 3300049573 Ga0501037_0019020 Ga0501037_0019020_277_1353 331
811 3300049574 Ga0501038_0018096 Ga0501038_0018096_570_1646 331
812 3300049575 Ga0501039_0126077 Ga0501039_0126077_658_1734 331
813 3300049579 Ga0501043_0000440 Ga0501043_0000440_2317_3387 331
814 3300049579 Ga0501043_0012356 Ga0501043_0012356_1347_2423 331
815 3300049579 Ga0501043_0031568 Ga0501043_0031568_46_1116 331
816 3300049579 Ga0501043_0046035 Ga0501043_0046035_2313_3383 331
817 3300049580 Ga0501046_0305484 Ga0501046_0305484_58_1134 331
818 3300049581 Ga0501047_0006003 Ga0501047_0006003_5153_6229 331
819 3300049581 Ga0501047_0007000 Ga0501047_0007000_9191_10261 331
820 3300049581 Ga0501047_0031398 Ga0501047_0031398_2847_3917 331
821 3300049585 Ga0501069_0000017 Ga0501069_0000017_20948_22018 331
822 3300049586 Ga0501070_0007767 Ga0501070_0007767_5099_6169 331
823 3300049586 Ga0501070_0010286 Ga0501070_0010286_2104_3174 331
824 3300049586 Ga0501070_0025357 Ga0501070_0025357_1344_2414 331
825 3300049587 Ga0501071_0031427 Ga0501071_0031427_913_1983 331
826 3300049589 Ga0501073_0000405 Ga0501073_0000405_15182_16258 331
827 3300049589 Ga0501073_0023070 Ga0501073_0023070_2530_3600 331
828 3300049590 Ga0501074_0000610 Ga0501074_0000610_9136_10206 331
829 3300049742 Ga0501080_0006075 Ga0501080_0006075_8446_9516 331
830 3300049742 Ga0501080_0020832 Ga0501080_0020832_3675_4751 331
831 3300049744 Ga0501083_0003168 Ga0501083_0003168_5473_6543 331
832 3300049822 Ga0501035_0000101 Ga0501035_0000101_34078_35148 331
833 3300049822 Ga0501035_0003169 Ga0501035_0003169_13145_14215 331
834 3300049822 Ga0501035_0132319 Ga0501035_0132319_600_1670 331
835 3300049823 Ga0501044_0000010 Ga0501044_0000010_167672_168742 331
836 3300049823 Ga0501044_0043139 Ga0501044_0043139_2112_3188 331
837 3300049823 Ga0501044_0063871 Ga0501044_0063871_1044_2114 331
838 3300049823 Ga0501044_0071701 Ga0501044_0071701_1853_2923 331
839 3300049823 Ga0501044_0096823 Ga0501044_0096823_310_1380 331
840 3300050489 nmdc:mga03683_118067_c1 nmdc:mga03683_118067_c1_27_1109 331
841 3300050489 nmdc:mga03683_1280_c1 nmdc:mga03683_1280_c1_4505_5578 331
842 3300050492 nmdc:mga0yw44_27031_c1 nmdc:mga0yw44_27031_c1_436_1518 331
843 3300053153 Ga0500616_0055053 Ga0500616_0055053_329_1396 331
844 3300002737 JGI25162J39368_1001235 JGI25162J39368_10012357 332
845 3300003187 JGI25151J46595_10018980 JGI25151J46595_100189802 332
846 3300003214 JGI25165J46597_1000715 JGI25165J46597_100071510 332
847 3300005614 Ga0068856_100026023 Ga0068856_1000260234 332
848 3300005616 Ga0068852_100062822 Ga0068852_1000628223 332
849 3300006038 Ga0075365_10016088 Ga0075365_100160883 332
850 3300006051 Ga0075364_10021782 Ga0075364_100217825 332
851 3300006177 Ga0075362_10029590 Ga0075362_100295902 332
852 3300006353 Ga0075370_10005557 Ga0075370_100055575 332
853 3300009093 Ga0105240_10000013 Ga0105240_10000013344 332
854 3300009545 Ga0105237_10002145 Ga0105237_1000214518 332
855 3300010375 Ga0105239_10004876 Ga0105239_100048762 332
856 3300013104 Ga0157370_10029471 Ga0157370_100294714 332
857 3300015262 Ga0182007_10005973 Ga0182007_100059732 332
858 3300015265 Ga0182005_1003820 Ga0182005_10038204 332
859 3300025233 Ga0209437_100057 Ga0209437_100057325 332
860 3300025253 Ga0209677_101041 Ga0209677_1010416 332
861 3300025254 Ga0209148_1003966 Ga0209148_10039665 332
862 3300025261 Ga0209233_1000130 Ga0209233_1000130127 332
863 3300025261 Ga0209233_1000255 Ga0209233_10002557 332
864 3300025294 Ga0209025_1007137 Ga0209025_10071373 332
865 3300025321 Ga0207656_10031520 Ga0207656_100315203 332
866 3300025913 Ga0207695_10000044 Ga0207695_10000044301 332
867 3300025914 Ga0207671_10000043 Ga0207671_10000043187 332
868 3300025949 Ga0207667_10107819 Ga0207667_101078192 332
869 3300026078 Ga0207702_10011646 Ga0207702_100116467 332
870 3300027312 Ga0209371_1001153 Ga0209371_100115313 332
871 3300030500 Ga0268256_1001230 Ga0268256_10012307 332
872 3300035695 Ga0373927_0000326 Ga0373927_0000326_31423_32493 332
873 3300037068 Ga0373925_0031603 Ga0373925_0031603_2741_3811 332
874 3300044765 Ga0466970_0061750 Ga0466970_0061750_106_1176 332
875 3300044842 Ga0466957_0235574 Ga0466957_0235574_33_1103 332
876 3300048920 Ga0496117_0023170 Ga0496117_0023170_249_1319 332
877 3300048921 Ga0496118_0108238 Ga0496118_0108238_249_1319 332
878 3300048922 Ga0496119_0069758 Ga0496119_0069758_866_1936 332
879 3300048926 Ga0496123_0042802 Ga0496123_0042802_1911_2981 332
880 3300048927 Ga0496124_0058885 Ga0496124_0058885_2052_3122 332
881 3300049571 Ga0501034_0373417 Ga0501034_0373417_125_1195 332
882 3300049581 Ga0501047_0004948 Ga0501047_0004948_9920_10996 332
883 3300050491 nmdc:mga00v17_5900_c1 nmdc:mga00v17_5900_c1_326_1408 332
884 3300050492 nmdc:mga0yw44_16889_c1 nmdc:mga0yw44_16889_c1_761_1831 332
885 3300053087 Ga0500643_013426 Ga0500643_013426_1625_2695 332
886 3300005548 Ga0070665_100173119 Ga0070665_1001731192 333
887 3300028379 Ga0268266_10108054 Ga0268266_101080542 333
888 3300031901 Ga0307406_10018898 Ga0307406_100188983 333
889 3300048919 Ga0496116_0004648 Ga0496116_0004648_9739_10809 333
890 3300048920 Ga0496117_0037272 Ga0496117_0037272_1857_2927 333
891 3300048921 Ga0496118_0027725 Ga0496118_0027725_28_1098 333
892 3300048925 Ga0496122_0040218 Ga0496122_0040218_202_1272 333
893 3300048927 Ga0496124_0003526 Ga0496124_0003526_511_1581 333
894 3300049568 Ga0501031_0013226 Ga0501031_0013226_470_1546 333
895 2010549000 RicEn_C7977 RicEn_140510 334
896 3300002773 JGI25152J39213_1003333 JGI25152J39213_10033335 334
897 3300002773 JGI25152J39213_1008734 JGI25152J39213_10087342 334
898 3300002774 JGI25150J39212_1000123 JGI25150J39212_100012324 334
899 3300003187 JGI25151J46595_10000083 JGI25151J46595_1000008322 334
900 3300003187 JGI25151J46595_10004591 JGI25151J46595_100045913 334
901 3300003187 JGI25151J46595_10005526 JGI25151J46595_100055262 334
902 3300003187 JGI25151J46595_10016186 JGI25151J46595_100161862 334
903 3300003215 JGI25153J46596_10000210 JGI25153J46596_1000021042 334
904 3300003215 JGI25153J46596_10022785 JGI25153J46596_100227852 334
905 3300003354 JGI25160J50197_1000097 JGI25160J50197_100009757 334
906 3300003354 JGI25160J50197_1001006 JGI25160J50197_10010069 334
907 3300003374 JGI25161J50226_1001144 JGI25161J50226_10011443 334
908 3300003578 Ga0006562J51391_1020650 Ga0006562J51391_10206503 334
909 3300003771 Ga0055526_1003114 Ga0055526_10031145 334
910 3300003771 Ga0055526_1008015 Ga0055526_10080152 334
911 3300003771 Ga0055526_1016519 Ga0055526_10165193 334
912 3300003775 Ga0055524_1005275 Ga0055524_10052754 334
913 3300003775 Ga0055524_1020453 Ga0055524_10204532 334
914 3300003775 Ga0055524_1034046 Ga0055524_10340462 334
915 3300003781 Ga0055536_1001637 Ga0055536_100163713 334
916 3300003790 Ga0055528_1003100 Ga0055528_10031005 334
917 3300003794 Ga0055531_10012663 Ga0055531_100126635 334
918 3300003856 Ga0058692_1001130 Ga0058692_10011303 334
919 3300003856 Ga0058692_1002092 Ga0058692_10020922 334
920 3300004625 Ga0055543_1000229 Ga0055543_100022941 334
921 3300004625 Ga0055543_1000888 Ga0055543_10008885 334
922 3300005466 Ga0070685_10009602 Ga0070685_100096022 334
923 3300006038 Ga0075365_10000121 Ga0075365_1000012113 334
924 3300006038 Ga0075365_10003990 Ga0075365_100039906 334
925 3300006042 Ga0075368_10004434 Ga0075368_100044342 334
926 3300006042 Ga0075368_10007040 Ga0075368_100070405 334
927 3300006048 Ga0075363_100005887 Ga0075363_1000058872 334
928 3300006051 Ga0075364_10100241 Ga0075364_101002412 334
929 3300006177 Ga0075362_10001961 Ga0075362_100019616 334
930 3300006177 Ga0075362_10019594 Ga0075362_100195942 334
931 3300006178 Ga0075367_10005716 Ga0075367_100057166 334
932 3300006178 Ga0075367_10102107 Ga0075367_101021072 334
933 3300006186 Ga0075369_10028563 Ga0075369_100285632 334
934 3300006186 Ga0075369_10050476 Ga0075369_100504762 334
935 3300006195 Ga0075366_10002668 Ga0075366_100026682 334
936 3300006195 Ga0075366_10006640 Ga0075366_100066402 334
937 3300006353 Ga0075370_10002185 Ga0075370_100021855 334
938 3300006353 Ga0075370_10059760 Ga0075370_100597601 334
939 3300006946 Ga0079104_1002285 Ga0079104_10022857 334
940 3300006948 Ga0099826_10000297 Ga0099826_1000029716 334
941 3300006948 Ga0099826_10055416 Ga0099826_100554162 334
942 3300009011 Ga0105251_10022487 Ga0105251_100224873 334
943 3300009177 Ga0105248_10015347 Ga0105248_100153475 334
944 3300009763 Ga0123340_1054989 Ga0123340_10549892 334
945 3300009763 Ga0123340_1057935 Ga0123340_10579351 334
946 3300009765 Ga0123341_1000003 Ga0123341_100000316 334
947 3300009766 Ga0123342_1002765 Ga0123342_100276514 334
948 3300013100 Ga0157373_10003489 Ga0157373_100034896 334
949 3300013102 Ga0157371_10000304 Ga0157371_1000030415 334
950 3300013104 Ga0157370_10004288 Ga0157370_1000428811 334
951 3300013249 Ga0171463_1004 Ga0171463_100457 334
952 3300015690 Ga0183363_1309 Ga0183363_13092 334
953 3300021327 Ga0214543_1000053 Ga0214543_100005344 334
954 3300022739 Ga0228711_1000050 Ga0228711_100005070 334
955 3300022740 Ga0228710_1000063 Ga0228710_100006370 334
956 3300025208 Ga0209436_104609 Ga0209436_1046093 334
957 3300025245 Ga0207425_1000024 Ga0207425_1000024226 334
958 3300025245 Ga0207425_1003151 Ga0207425_10031515 334
959 3300025245 Ga0207425_1013444 Ga0207425_10134442 334
960 3300025258 Ga0209129_1000146 Ga0209129_100014622 334
961 3300025258 Ga0209129_1000909 Ga0209129_100090917 334
962 3300025258 Ga0209129_1007872 Ga0209129_10078722 334
963 3300025273 Ga0209673_1000020 Ga0209673_10000202 334
964 3300025273 Ga0209673_1000366 Ga0209673_100036634 334
965 3300025273 Ga0209673_1002318 Ga0209673_100231810 334
966 3300025273 Ga0209673_1031280 Ga0209673_10312802 334
967 3300025284 Ga0209130_1000027 Ga0209130_100002756 334
968 3300025284 Ga0209130_1014156 Ga0209130_10141562 334
969 3300025284 Ga0209130_1016463 Ga0209130_10164632 334
970 3300025292 Ga0209676_1002257 Ga0209676_10022573 334
971 3300025294 Ga0209025_1000050 Ga0209025_1000050101 334
972 3300025294 Ga0209025_1000082 Ga0209025_1000082200 334
973 3300025294 Ga0209025_1000245 Ga0209025_10002455 334
974 3300025294 Ga0209025_1000706 Ga0209025_100070622 334
975 3300025294 Ga0209025_1000925 Ga0209025_10009253 334
976 3300025294 Ga0209025_1001368 Ga0209025_10013689 334
977 3300025294 Ga0209025_1009241 Ga0209025_10092415 334
978 3300025295 Ga0209564_1000111 Ga0209564_100011157 334
979 3300025295 Ga0209564_1001600 Ga0209564_10016002 334
980 3300025295 Ga0209564_1005792 Ga0209564_10057922 334
981 3300025295 Ga0209564_1009918 Ga0209564_10099184 334
982 3300025297 Ga0209758_1000083 Ga0209758_1000083156 334
983 3300025297 Ga0209758_1001662 Ga0209758_100166219 334
984 3300025297 Ga0209758_1016587 Ga0209758_10165873 334
985 3300025297 Ga0209758_1033816 Ga0209758_10338162 334
986 3300025298 Ga0209050_1002214 Ga0209050_100221412 334
987 3300025299 Ga0209256_1000132 Ga0209256_100013298 334
988 3300025299 Ga0209256_1000923 Ga0209256_100092335 334
989 3300025299 Ga0209256_1001851 Ga0209256_100185123 334
990 3300025299 Ga0209256_1002798 Ga0209256_10027982 334
991 3300025299 Ga0209256_1010190 Ga0209256_10101903 334
992 3300025302 Ga0207426_1000072 Ga0207426_1000072259 334
993 3300025302 Ga0207426_1000210 Ga0207426_100021029 334
994 3300025302 Ga0207426_1001096 Ga0207426_100109611 334
995 3300025303 Ga0209051_1009843 Ga0209051_10098431 334
996 3300025303 Ga0209051_1011687 Ga0209051_10116873 334
997 3300025303 Ga0209051_1041827 Ga0209051_10418272 334
998 3300025304 Ga0209257_1002146 Ga0209257_100214615 334
999 3300025935 Ga0207709_10003829 Ga0207709_100038298 334
1000 3300027111 Ga0209281_1000030 Ga0209281_1000030380 334
1001 3300027111 Ga0209281_1000061 Ga0209281_1000061197 334
1002 3300027111 Ga0209281_1000821 Ga0209281_100082118 334
1003 3300027312 Ga0209371_1000035 Ga0209371_1000035293 334
1004 3300027312 Ga0209371_1003535 Ga0209371_10035353 334
1005 3300027666 Ga0209282_1000004 Ga0209282_1000004380 334
1006 3300027666 Ga0209282_1049724 Ga0209282_10497242 334
1007 3300028379 Ga0268266_10008895 Ga0268266_100088955 334
1008 3300028794 Ga0307515_10003954 Ga0307515_100039549 334
1009 3300030500 Ga0268256_1000037 Ga0268256_1000037292 334
1010 3300030500 Ga0268256_1004253 Ga0268256_10042534 334
1011 3300031456 Ga0307513_10014884 Ga0307513_100148846 334
1012 3300031731 Ga0307405_10010736 Ga0307405_100107363 334
1013 3300031852 Ga0307410_10102451 Ga0307410_101024512 334
1014 3300031901 Ga0307406_10029649 Ga0307406_100296493 334
1015 3300031911 Ga0307412_10002786 Ga0307412_100027865 334
1016 3300031967 Ga0315914_1000001 Ga0315914_10000013 334
1017 3300033430 Ga0315913_1000024 Ga0315913_100002489 334
1018 3300033464 Ga0315915_1000002 Ga0315915_1000002381 334
1019 3300041405 Ga0439438_020620 Ga0439438_020620_167_1297 334
1020 3300041406 Ga0439439_0015755 Ga0439439_0015755_108_1238 334
1021 3300041413 Ga0439465_0004803 Ga0439465_0004803_2561_3691 334
1022 3300041496 Ga0451839_0504797 Ga0451839_0504797_2503_3573 334
1023 3300041511 Ga0451855_0693875 Ga0451855_0693875_34_1104 334
1024 3300041512 Ga0451853_0143431 Ga0451853_0143431_251_1321 334
1025 3300042007 Ga0439449_0004313 Ga0439449_0004313_1621_2691 334
1026 3300042007 Ga0439449_0015111 Ga0439449_0015111_1620_2750 334
1027 3300042145 Ga0450906_002957 Ga0450906_002957_559_1689 334
1028 3300042147 Ga0450910_000972 Ga0450910_000972_2130_3260 334
1029 3300042531 Ga0450918_002206 Ga0450918_002206_2487_3617 334
1030 3300044901 Ga0466960_0176713 Ga0466960_0176713_23_1093 334
1031 3300046454 Ga0495592_0020759 Ga0495592_0020759_382_1452 334
1032 3300046460 Ga0495638_0000145 Ga0495638_0000145_46119_47189 334
1033 3300046462 Ga0495651_0068461 Ga0495651_0068461_1542_2612 334
1034 3300046474 Ga0495605_0001139 Ga0495605_0001139_13587_14657 334
1035 3300046476 Ga0495662_0002455 Ga0495662_0002455_3488_4558 334
1036 3300046491 Ga0495584_0069103 Ga0495584_0069103_330_1400 334
1037 3300046492 Ga0495585_0016507 Ga0495585_0016507_2278_3348 334
1038 3300046492 Ga0495585_0017035 Ga0495585_0017035_630_1700 334
1039 3300046506 Ga0495583_0034309 Ga0495583_0034309_423_1493 334
1040 3300046507 Ga0495606_0017418 Ga0495606_0017418_2294_3364 334
1041 3300046507 Ga0495606_0030920 Ga0495606_0030920_245_1315 334
1042 3300046513 Ga0495616_0011477 Ga0495616_0011477_2854_3924 334
1043 3300046513 Ga0495616_0033924 Ga0495616_0033924_412_1482 334
1044 3300046518 Ga0495631_0003969 Ga0495631_0003969_347_1417 334
1045 3300046518 Ga0495631_0020970 Ga0495631_0020970_638_1708 334
1046 3300046519 Ga0495632_0022987 Ga0495632_0022987_1774_2844 334
1047 3300046522 Ga0495643_0010731 Ga0495643_0010731_131_1201 334
1048 3300046522 Ga0495643_0084677 Ga0495643_0084677_468_1538 334
1049 3300046529 Ga0495652_0144869 Ga0495652_0144869_566_1636 334
1050 3300046530 Ga0495654_0000207 Ga0495654_0000207_30056_31141 334
1051 3300046530 Ga0495654_0025993 Ga0495654_0025993_690_1760 334
1052 3300046558 Ga0495633_0024113 Ga0495633_0024113_140_1210 334
1053 3300046616 Ga0495668_0075020 Ga0495668_0075020_468_1538 334
1054 3300046660 Ga0495625_0000467 Ga0495625_0000467_33785_34855 334
1055 3300046663 Ga0495635_0139854 Ga0495635_0139854_330_1400 334
1056 3300046674 Ga0495588_0019114 Ga0495588_0019114_529_1599 334
1057 3300046675 Ga0495657_0058076 Ga0495657_0058076_286_1356 334
1058 3300046683 Ga0495658_0015175 Ga0495658_0015175_874_1944 334
1059 3300046691 Ga0495670_0014978 Ga0495670_0014978_1224_2294 334
1060 3300046691 Ga0495670_0036264 Ga0495670_0036264_20_1090 334
1061 3300046694 Ga0495649_0020639 Ga0495649_0020639_124_1194 334
1062 3300046809 Ga0495600_0004371 Ga0495600_0004371_11_1129 334
1063 3300046810 Ga0495660_0015384 Ga0495660_0015384_810_1880 334
1064 3300047317 Ga0495604_0006484 Ga0495604_0006484_4113_5183 334
1065 3300047447 Ga0495685_023240 Ga0495685_023240_20_1090 334
1066 3300047470 Ga0495681_0029723 Ga0495681_0029723_1367_2437 334
1067 3300047472 Ga0495686_0000090 Ga0495686_0000090_144450_145520 334
1068 3300048088 Ga0495602_0091657 Ga0495602_0091657_369_1439 334
1069 3300048907 Ga0496104_0062677 Ga0496104_0062677_1312_2382 334
1070 3300048909 Ga0496106_0000201 Ga0496106_0000201_37648_38718 334
1071 3300048919 Ga0496116_0002679 Ga0496116_0002679_15194_16264 334
1072 3300048919 Ga0496116_0004501 Ga0496116_0004501_1993_3063 334
1073 3300048919 Ga0496116_0031988 Ga0496116_0031988_2625_3695 334
1074 3300048920 Ga0496117_0000052 Ga0496117_0000052_229095_230165 334
1075 3300048920 Ga0496117_0046827 Ga0496117_0046827_654_1724 334
1076 3300048920 Ga0496117_0085888 Ga0496117_0085888_384_1454 334
1077 3300048921 Ga0496118_0002033 Ga0496118_0002033_15557_16627 334
1078 3300048921 Ga0496118_0017654 Ga0496118_0017654_4542_5612 334
1079 3300048922 Ga0496119_0019076 Ga0496119_0019076_1508_2578 334
1080 3300048922 Ga0496119_0058919 Ga0496119_0058919_884_1954 334
1081 3300048923 Ga0496120_0000019 Ga0496120_0000019_208830_209900 334
1082 3300048924 Ga0496121_0002933 Ga0496121_0002933_19579_20664 334
1083 3300048924 Ga0496121_0080991 Ga0496121_0080991_598_1668 334
1084 3300048925 Ga0496122_0000053 Ga0496122_0000053_208830_209900 334
1085 3300048925 Ga0496122_0018212 Ga0496122_0018212_32_1102 334
1086 3300048925 Ga0496122_0057615 Ga0496122_0057615_1153_2223 334
1087 3300048925 Ga0496122_0081348 Ga0496122_0081348_1154_2224 334
1088 3300048925 Ga0496122_0088970 Ga0496122_0088970_149_1219 334
1089 3300048926 Ga0496123_0000038 Ga0496123_0000038_208830_209900 334
1090 3300048926 Ga0496123_0000519 Ga0496123_0000519_63235_64305 334
1091 3300048926 Ga0496123_0018674 Ga0496123_0018674_3259_4329 334
1092 3300048927 Ga0496124_0000483 Ga0496124_0000483_58225_59295 334
1093 3300048927 Ga0496124_0019573 Ga0496124_0019573_4131_5201 334
1094 3300048927 Ga0496124_0034429 Ga0496124_0034429_3328_4398 334
1095 3300048927 Ga0496124_0047109 Ga0496124_0047109_1788_2858 334
1096 3300048927 Ga0496124_0120775 Ga0496124_0120775_809_1879 334
1097 3300048928 Ga0496125_0000790 Ga0496125_0000790_49254_50324 334
1098 3300048928 Ga0496125_0024340 Ga0496125_0024340_636_1706 334
1099 3300048928 Ga0496125_0086139 Ga0496125_0086139_418_1488 334
1100 3300048928 Ga0496125_0120740 Ga0496125_0120740_25_1095 334
1101 3300048929 Ga0496126_0000466 Ga0496126_0000466_77938_79008 334
1102 3300049568 Ga0501031_0034233 Ga0501031_0034233_514_1584 334
1103 3300049568 Ga0501031_0174430 Ga0501031_0174430_84_1154 334
1104 3300049569 Ga0501032_0003253 Ga0501032_0003253_8325_9407 334
1105 3300049569 Ga0501032_0029214 Ga0501032_0029214_1340_2410 334
1106 3300049570 Ga0501033_0000380 Ga0501033_0000380_11324_12394 334
1107 3300049572 Ga0501036_0108528 Ga0501036_0108528_464_1534 334
1108 3300049573 Ga0501037_0101320 Ga0501037_0101320_393_1463 334
1109 3300049573 Ga0501037_0167086 Ga0501037_0167086_223_1293 334
1110 3300049574 Ga0501038_0097541 Ga0501038_0097541_605_1675 334
1111 3300049579 Ga0501043_0038036 Ga0501043_0038036_1525_2607 334
1112 3300049583 Ga0501067_0000134 Ga0501067_0000134_27535_28617 334
1113 3300049589 Ga0501073_0000003 Ga0501073_0000003_244184_245266 334
1114 3300049593 Ga0501077_0000001 Ga0501077_0000001_211036_212118 334
1115 3300049742 Ga0501080_0072609 Ga0501080_0072609_271_1353 334
1116 3300049744 Ga0501083_0171561 Ga0501083_0171561_83_1165 334
1117 3300049822 Ga0501035_0003046 Ga0501035_0003046_3570_4640 334
1118 3300049823 Ga0501044_0020484 Ga0501044_0020484_4628_5698 334
1119 3300049823 Ga0501044_0045301 Ga0501044_0045301_2463_3545 334
1120 3300049824 Ga0501045_0190459 Ga0501045_0190459_223_1293 334
1121 3300050489 nmdc:mga03683_33530_c1 nmdc:mga03683_33530_c1_222_1292 334
1122 3300050489 nmdc:mga03683_3490_c1 nmdc:mga03683_3490_c1_863_1933 334
1123 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_94752_95822 334
1124 3300050492 nmdc:mga0yw44_4747_c1 nmdc:mga0yw44_4747_c1_60_1130 334
1125 3300050492 nmdc:mga0yw44_65_c1 nmdc:mga0yw44_65_c1_6534_7604 334
1126 3300050493 nmdc:mga0k408_29501_c1 nmdc:mga0k408_29501_c1_870_1940 334
1127 3300050495 nmdc:mga04h51_25469_c1 nmdc:mga04h51_25469_c1_82_1152 334
1128 3300050516 nmdc:mga0sz30_1795_c1 nmdc:mga0sz30_1795_c1_5335_6405 334
1129 3300050516 nmdc:mga0sz30_55436_c1 nmdc:mga0sz30_55436_c1_527_1597 334
1130 3300053086 Ga0500578_0016118 Ga0500578_0016118_1892_2962 334
1131 3300053088 Ga0500644_0066779 Ga0500644_0066779_180_1253 334
1132 3300053118 Ga0500594_0000508 Ga0500594_0000508_4216_5286 334
1133 3300053123 Ga0500614_024328 Ga0500614_024328_255_1325 334
1134 3300053125 Ga0500618_000025 Ga0500618_000025_63530_64615 334
1135 3300053134 Ga0500658_0000451 Ga0500658_0000451_3929_4999 334
1136 3300053134 Ga0500658_0016024 Ga0500658_0016024_392_1462 334
1137 3300053134 Ga0500658_0023525 Ga0500658_0023525_854_1924 334
1138 3300053137 Ga0500561_0000154 Ga0500561_0000154_9200_10270 334
1139 3300053139 Ga0500568_0000184 Ga0500568_0000184_7685_8755 334
1140 3300053139 Ga0500568_0015352 Ga0500568_0015352_652_1722 334
1141 3300053148 Ga0500590_000090 Ga0500590_000090_678_1748 334
1142 3300053153 Ga0500616_0002258 Ga0500616_0002258_14133_15203 334
1143 3300053153 Ga0500616_0008839 Ga0500616_0008839_1383_2453 334
1144 3300053156 Ga0500622_0000647 Ga0500622_0000647_28412_29482 334
1145 3300053156 Ga0500622_0001402 Ga0500622_0001402_7692_8765 334
1146 3300053157 Ga0500624_000584 Ga0500624_000584_1554_2624 334
1147 3300053158 Ga0500627_0048421 Ga0500627_0048421_464_1534 334
1148 3300053177 Ga0500636_0000009 Ga0500636_0000009_134352_135422 334
1149 3300053177 Ga0500636_0078327 Ga0500636_0078327_27_1097 334
1150 3300060353 Ga0501082_0117029 Ga0501082_0117029_846_1928 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

25

169

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9093 4 231
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9073 4 232
8g3l-assembly1.cif.gz_B bceab-s nucleotide free bces state 2 0.9038 4 224
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9035 4 240
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9003 3 241
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 3 223 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9533 3 223 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9405 24 240 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 32 228 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9319 4 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A530ND77-F1-model_v4 deleted 0.9658 4 136
AF-A0A530ND77-F1-model_v4 deleted 0.9512 4 136
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.935 1 153 GO:0005524
GO:0016887
GO:0055052
AF-A0A3D0PSJ0-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9344 1 147 GO:0005524
GO:0016887
GO:0055052
AF-A0A418QIC2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9335 4 135 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.54 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map