F490847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1150 | 940 | 430 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0037071|Ga0395900_0037071_3394_4461 |
| Length | 355 |
| Sequence | MARIEVNHIRHSYLPNPQKDADFALKEVHHIFEDGGAYALLGPSGCGKTTLLNIISGLLHPSHGKLLFNGRDVTNLSTQERNIAQVFQFPVIYDTMTVYDNLAFPLRNRRVPEADVDRKVRETLDMIDLAGLARKKARGLTADQKQKISLGRGLVRSDVNAILFDEPLTVIDPHMKWVLRSQLKQLHRRFGYTMVYVTHDQTEALTFADQVVVMYDGGIVQIGTPAELFERPRHTFVGYFIGSPGMNVLPVAIEGRTAMLGAQRIDLPGAPKAEAGAAELGIRPEYVRLGREGMSVSVSKVEDVGRHKVVRASLEGREIAAVIGEDEEVPPDPKVRFDPAGINIYADSWRVEMGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 14 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 19 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 22 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 25 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 26 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 27 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 28 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 29 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 30 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 33 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 34 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 35 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 36 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 37 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 38 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 39 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 40 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 41 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 42 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 43 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 44 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 45 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 46 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 47 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 48 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 49 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 50 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 51 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 52 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 53 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 54 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 55 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 56 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 57 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 58 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 59 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 60 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 61 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 62 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 63 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 64 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 65 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 66 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 67 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 68 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 69 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 70 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 71 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 72 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 73 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 74 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 75 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 78 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 79 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 80 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 81 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 82 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 83 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 84 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 85 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 86 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 87 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 88 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 89 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 90 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 91 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 92 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 93 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 94 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 95 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 96 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 97 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 98 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 99 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 100 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 101 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 102 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 103 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 104 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 105 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 106 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 107 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 108 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 109 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 110 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 111 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 112 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 113 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 114 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 115 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 116 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 117 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 118 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 119 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 120 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 121 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 122 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 123 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 124 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 125 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 126 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 127 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 128 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 129 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 130 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 131 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 132 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 133 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 134 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 135 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 136 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 137 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 138 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 139 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 140 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 141 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 142 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 143 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 144 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 145 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 146 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 147 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 148 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 149 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 150 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 151 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 152 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 153 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 154 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 155 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 156 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 157 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 158 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 159 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 160 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 161 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 162 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 163 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 164 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 165 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 166 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 167 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 168 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 169 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 170 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 171 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 172 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 173 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 174 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 175 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 176 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 177 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 178 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 179 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 180 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 181 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 182 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 183 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 184 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 185 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 186 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 187 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 188 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 189 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 190 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 191 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 192 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 193 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 194 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 195 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 196 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 197 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 198 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 199 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 200 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 201 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 202 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 203 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 204 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 205 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 206 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 207 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 208 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 209 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 210 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 211 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 212 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 213 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 214 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 215 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 216 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 217 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 218 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 219 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 220 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 221 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 222 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 223 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 224 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 225 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 226 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 227 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 228 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 229 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 230 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 231 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 232 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 233 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 234 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 235 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 236 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 237 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 238 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 239 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 240 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 241 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 242 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 243 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 244 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 245 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 246 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 247 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 248 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 249 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 250 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 251 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 252 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 253 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 254 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 255 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 256 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 257 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 258 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 259 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 260 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 261 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 262 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 263 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 264 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 265 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 266 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 267 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 268 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 269 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 270 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 271 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 272 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 273 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 274 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 275 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 276 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 277 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 278 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 279 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 280 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 281 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 282 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 283 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 284 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 285 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 286 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 287 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 288 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 289 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 290 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 291 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 292 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 293 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 294 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 295 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 296 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 297 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 298 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 299 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 300 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 301 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 302 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 303 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 304 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 305 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 306 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 307 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 308 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 309 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 310 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 311 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 312 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 313 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 314 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 315 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 316 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 317 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 318 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 319 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 320 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 321 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 322 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 323 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 324 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 325 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 326 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 327 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 328 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 329 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 330 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 331 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 332 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 333 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 334 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 335 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 336 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 337 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 338 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 339 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 340 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 341 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 342 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 343 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 344 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 345 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 346 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 347 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 348 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 349 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 350 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 351 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 352 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 353 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 354 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 355 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 356 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 357 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 358 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 359 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 360 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 361 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 362 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 363 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 364 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 365 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 366 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 367 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 368 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 369 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 370 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 371 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 372 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 373 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 374 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 375 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 376 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 377 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 378 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 379 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 380 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 381 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 382 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 383 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 384 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 385 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 386 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 387 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 388 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 389 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 390 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 391 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 392 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 393 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 394 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 395 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 396 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 397 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 398 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 399 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 400 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 401 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 402 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 403 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 404 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 405 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 406 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 407 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 408 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 409 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 410 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 411 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 412 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 413 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 414 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 415 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 416 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 417 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 418 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 419 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 420 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 421 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 422 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 423 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 424 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 425 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 426 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 427 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 428 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 429 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 430 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 431 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 432 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 433 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 434 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 435 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 436 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 437 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 438 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 439 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 440 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 441 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 442 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 443 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 444 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 445 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 446 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 447 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 448 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 449 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 450 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 451 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 452 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 453 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 454 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 455 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 456 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 457 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 458 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 459 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 460 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 461 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 462 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 463 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 464 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 465 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 466 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 467 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 468 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 469 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 470 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 471 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 472 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 473 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 474 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 475 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 476 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 477 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 478 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 479 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 480 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 481 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 482 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 483 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 484 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 485 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 486 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 487 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 488 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 489 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 490 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 491 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 492 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 493 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 494 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 495 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 496 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 497 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 498 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 499 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 500 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 501 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 502 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 503 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 504 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 505 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 506 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 507 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 508 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 509 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 510 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 511 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 512 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 513 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 514 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 515 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 516 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 517 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 518 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 519 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 520 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 521 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 522 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 523 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 524 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 525 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 526 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 527 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 528 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 529 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 530 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 531 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 532 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 533 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 534 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 535 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 536 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 537 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 538 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 539 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 540 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 541 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 542 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 543 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 544 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 545 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 546 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 547 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 548 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 549 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 550 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 551 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 552 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 553 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 554 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 555 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 556 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 557 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 558 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 559 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 560 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 561 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 562 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 563 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 564 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 565 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 566 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 567 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 568 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 569 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 570 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 571 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 572 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 573 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 574 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 575 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 576 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 577 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 578 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 579 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 580 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 581 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 582 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 583 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 584 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 585 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 586 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 587 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 588 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 589 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 590 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 591 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 592 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 593 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 594 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 595 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 596 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 597 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 598 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 599 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 600 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 601 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 602 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 603 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 604 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 605 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 606 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 607 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 608 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 609 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 610 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 611 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 612 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 613 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 614 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 615 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 616 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 617 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 618 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 619 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 620 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 621 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 622 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 623 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 624 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 625 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 626 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 627 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 628 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 629 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 630 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 631 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 632 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 633 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 634 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 635 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 636 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 637 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 638 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 639 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 640 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 641 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 642 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 643 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 644 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 645 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 646 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 647 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 648 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 649 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 650 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 651 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 652 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 653 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 654 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 655 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 656 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 657 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 658 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 659 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 660 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 661 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 662 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 663 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 664 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 665 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 666 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 667 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 668 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 669 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 670 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 671 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 672 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 673 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 674 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 675 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 676 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 677 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 678 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 679 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 680 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 681 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 682 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 683 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 684 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 685 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 686 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 687 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 688 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 689 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 690 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 691 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 692 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 693 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 694 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 695 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 696 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 697 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 698 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 699 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 700 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 701 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 702 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 703 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 704 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 705 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 706 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 707 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 708 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 709 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 710 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 711 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 712 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 713 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 714 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 715 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 716 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 717 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 718 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 719 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 720 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 721 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 722 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 723 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 724 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 725 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 726 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 727 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 728 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 729 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 730 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 731 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 732 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 733 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 734 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 735 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 736 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 737 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 738 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 740 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 741 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 742 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 743 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 744 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 745 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 746 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 747 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 748 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 749 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 750 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 751 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 752 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 753 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 754 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 755 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 756 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 757 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 758 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 759 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 760 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 761 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 762 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 763 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 764 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 765 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 766 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 767 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 768 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 769 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 770 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 771 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 772 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 773 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 774 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 775 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 776 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 777 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 778 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 779 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 780 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 814 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 815 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 816 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 817 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 818 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 819 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 820 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 821 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 822 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 823 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 824 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 825 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 826 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 827 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 828 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 829 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 830 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 831 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 832 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 833 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 834 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 835 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 836 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 837 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 838 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 839 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 840 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 841 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 842 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 843 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 844 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 845 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 846 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 847 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 848 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 849 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 850 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 851 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 852 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 853 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 854 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 855 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 856 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 857 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 858 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 859 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 860 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 861 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 862 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 863 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 864 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 865 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 866 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 867 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 868 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 869 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 870 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 871 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 872 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 873 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 874 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 875 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 876 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 877 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 878 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 879 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 880 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 881 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 882 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 883 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 884 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 885 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 886 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 887 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 888 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 889 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 890 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 891 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 892 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 893 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 894 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 895 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 896 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 897 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 898 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 899 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 900 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 901 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 902 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 903 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 904 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 905 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 906 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 907 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 908 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 909 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 910 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 911 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 912 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 913 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 914 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 915 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 916 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 917 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 918 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 919 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 920 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 921 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 922 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 923 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 924 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 925 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 926 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 927 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 928 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 929 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 930 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 931 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 932 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 933 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 934 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 935 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 936 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 937 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 938 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 939 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 940 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 37.3 |
| Metatranscriptomes | 0.09 |
| Isolates | 62.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 13.22 |
| Nodule | 47.83 |
| Rhizoplane | 1.13 |
| Rhizosphere | 22.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C7977 | 2010549000 | Bacteria | 2394 |
| 2 | JGI24739J22299_10046732 | 3300001989 | Bacteria | 1416 |
| 3 | JGI25162J39368_1001235 | 3300002737 | Bacteria | 14721 |
| 4 | JGI25152J39213_1003333 | 3300002773 | Bacteria | 5530 |
| 5 | JGI25152J39213_1008734 | 3300002773 | Bacteria | 2481 |
| 6 | JGI25150J39212_1000123 | 3300002774 | Bacteria | 43588 |
| 7 | JGI25151J46595_10000083 | 3300003187 | Bacteria | 130658 |
| 8 | JGI25151J46595_10004591 | 3300003187 | Bacteria | 7274 |
| 9 | JGI25151J46595_10005526 | 3300003187 | Bacteria | 6512 |
| 10 | JGI25151J46595_10016186 | 3300003187 | Bacteria | 3266 |
| 11 | JGI25151J46595_10018980 | 3300003187 | Bacteria | 2935 |
| 12 | JGI25165J46597_1000715 | 3300003214 | Bacteria | 26079 |
| 13 | JGI25153J46596_10000210 | 3300003215 | Bacteria | 52714 |
| 14 | JGI25153J46596_10022771 | 3300003215 | Bacteria | 2300 |
| 15 | JGI25153J46596_10022785 | 3300003215 | Bacteria | 2299 |
| 16 | JGI25160J50197_1000097 | 3300003354 | Bacteria | 87619 |
| 17 | JGI25160J50197_1001006 | 3300003354 | Bacteria | 14628 |
| 18 | JGI25161J50226_1001144 | 3300003374 | Bacteria | 8848 |
| 19 | Ga0006562J51391_1020650 | 3300003578 | Bacteria | 2910 |
| 20 | Ga0055542_1001265 | 3300003762 | Bacteria | 13783 |
| 21 | Ga0055526_1003114 | 3300003771 | Bacteria | 10751 |
| 22 | Ga0055526_1008015 | 3300003771 | Bacteria | 5350 |
| 23 | Ga0055526_1016519 | 3300003771 | Bacteria | 2881 |
| 24 | Ga0055524_1005275 | 3300003775 | Bacteria | 5804 |
| 25 | Ga0055524_1020453 | 3300003775 | Bacteria | 2229 |
| 26 | Ga0055524_1034046 | 3300003775 | Bacteria | 1416 |
| 27 | Ga0055536_1001637 | 3300003781 | Bacteria | 13323 |
| 28 | Ga0055528_1003100 | 3300003790 | Bacteria | 8532 |
| 29 | Ga0055528_1012402 | 3300003790 | Bacteria | 3310 |
| 30 | Ga0055540_1000164 | 3300003792 | Bacteria | 66539 |
| 31 | Ga0055531_10012663 | 3300003794 | Bacteria | 3950 |
| 32 | Ga0058692_1001130 | 3300003856 | Bacteria | 10337 |
| 33 | Ga0058692_1002092 | 3300003856 | Bacteria | 6888 |
| 34 | Ga0055543_1000229 | 3300004625 | Bacteria | 44446 |
| 35 | Ga0055543_1000888 | 3300004625 | Bacteria | 14212 |
| 36 | Ga0070685_10009602 | 3300005466 | Bacteria | 5005 |
| 37 | Ga0068853_100151806 | 3300005539 | Bacteria | 2085 |
| 38 | Ga0070665_100077892 | 3300005548 | Bacteria | 3321 |
| 39 | Ga0070665_100107612 | 3300005548 | Bacteria | 2790 |
| 40 | Ga0070665_100173119 | 3300005548 | Bacteria | 2160 |
| 41 | Ga0068856_100026023 | 3300005614 | Bacteria | 5706 |
| 42 | Ga0068852_100062822 | 3300005616 | Bacteria | 3232 |
| 43 | Ga0081540_1101780 | 3300005983 | Bacteria | 1235 |
| 44 | Ga0075365_10000121 | 3300006038 | Bacteria | 23552 |
| 45 | Ga0075365_10003990 | 3300006038 | Bacteria | 7734 |
| 46 | Ga0075365_10016088 | 3300006038 | Bacteria | 4540 |
| 47 | Ga0075368_10004434 | 3300006042 | Bacteria | 4759 |
| 48 | Ga0075368_10007040 | 3300006042 | Bacteria | 3958 |
| 49 | Ga0075363_100005887 | 3300006048 | Bacteria | 5519 |
| 50 | Ga0075363_100119035 | 3300006048 | Bacteria | 1473 |
| 51 | Ga0075364_10021782 | 3300006051 | Bacteria | 4040 |
| 52 | Ga0075364_10100241 | 3300006051 | Bacteria | 1928 |
| 53 | Ga0075362_10001961 | 3300006177 | Bacteria | 6759 |
| 54 | Ga0075362_10007295 | 3300006177 | Bacteria | 4178 |
| 55 | Ga0075362_10019594 | 3300006177 | Bacteria | 2816 |
| 56 | Ga0075362_10029590 | 3300006177 | Bacteria | 2361 |
| 57 | Ga0075362_10036818 | 3300006177 | Bacteria | 2142 |
| 58 | Ga0075367_10005716 | 3300006178 | Bacteria | 6214 |
| 59 | Ga0075367_10102107 | 3300006178 | Bacteria | 1754 |
| 60 | Ga0075367_10134282 | 3300006178 | Bacteria | 1530 |
| 61 | Ga0075369_10028563 | 3300006186 | Bacteria | 2338 |
| 62 | Ga0075369_10050476 | 3300006186 | Bacteria | 1799 |
| 63 | Ga0075366_10002668 | 3300006195 | Bacteria | 9196 |
| 64 | Ga0075366_10006640 | 3300006195 | Bacteria | 6348 |
| 65 | Ga0075370_10002185 | 3300006353 | Bacteria | 8981 |
| 66 | Ga0075370_10005557 | 3300006353 | Bacteria | 6282 |
| 67 | Ga0075370_10059760 | 3300006353 | Bacteria | 2170 |
| 68 | Ga0079104_1002285 | 3300006946 | Bacteria | 10611 |
| 69 | Ga0099826_10000297 | 3300006948 | Bacteria | 22278 |
| 70 | Ga0099826_10055416 | 3300006948 | Bacteria | 2625 |
| 71 | Ga0105251_10022487 | 3300009011 | Bacteria | 3273 |
| 72 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 73 | Ga0105240_10143644 | 3300009093 | Bacteria | 2850 |
| 74 | Ga0105248_10015347 | 3300009177 | Bacteria | 8448 |
| 75 | Ga0105237_10002145 | 3300009545 | Bacteria | 24855 |
| 76 | Ga0105238_10184211 | 3300009551 | Bacteria | 2065 |
| 77 | Ga0123340_1054989 | 3300009763 | Bacteria | 1317 |
| 78 | Ga0123340_1057935 | 3300009763 | Bacteria | 1195 |
| 79 | Ga0123341_1000003 | 3300009765 | Bacteria | 172237 |
| 80 | Ga0123342_1002765 | 3300009766 | Bacteria | 28880 |
| 81 | Ga0105239_10004876 | 3300010375 | Bacteria | 15880 |
| 82 | Ga0157373_10003489 | 3300013100 | Bacteria | 11890 |
| 83 | Ga0157371_10000304 | 3300013102 | Bacteria | 64521 |
| 84 | Ga0157371_10007676 | 3300013102 | Bacteria | 8684 |
| 85 | Ga0157370_10004288 | 3300013104 | Bacteria | 16426 |
| 86 | Ga0157370_10029471 | 3300013104 | Bacteria | 5384 |
| 87 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 88 | Ga0182007_10005973 | 3300015262 | Bacteria | 5281 |
| 89 | Ga0182005_1003820 | 3300015265 | Bacteria | 5004 |
| 90 | Ga0183363_1309 | 3300015690 | Bacteria | 6613 |
| 91 | Ga0214543_1000053 | 3300021327 | Bacteria | 141797 |
| 92 | Ga0228711_1000050 | 3300022739 | Bacteria | 81399 |
| 93 | Ga0228710_1000063 | 3300022740 | Bacteria | 81399 |
| 94 | Ga0209436_104609 | 3300025208 | Bacteria | 3368 |
| 95 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 96 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 97 | Ga0207425_1003151 | 3300025245 | Bacteria | 5402 |
| 98 | Ga0207425_1005788 | 3300025245 | Bacteria | 3478 |
| 99 | Ga0207425_1013444 | 3300025245 | Bacteria | 1891 |
| 100 | Ga0209677_101041 | 3300025253 | Bacteria | 13212 |
| 101 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 102 | Ga0209148_1003966 | 3300025254 | Bacteria | 3802 |
| 103 | Ga0209129_1000146 | 3300025258 | Bacteria | 115180 |
| 104 | Ga0209129_1000909 | 3300025258 | Bacteria | 18120 |
| 105 | Ga0209129_1001260 | 3300025258 | Bacteria | 14525 |
| 106 | Ga0209129_1007872 | 3300025258 | Bacteria | 3072 |
| 107 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 108 | Ga0209233_1000255 | 3300025261 | Bacteria | 82230 |
| 109 | Ga0209455_1000133 | 3300025272 | Bacteria | 155670 |
| 110 | Ga0209673_1000020 | 3300025273 | Bacteria | 430653 |
| 111 | Ga0209673_1000366 | 3300025273 | Bacteria | 81215 |
| 112 | Ga0209673_1002318 | 3300025273 | Bacteria | 13497 |
| 113 | Ga0209673_1010820 | 3300025273 | Bacteria | 3813 |
| 114 | Ga0209673_1031280 | 3300025273 | Bacteria | 1659 |
| 115 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 116 | Ga0209130_1014156 | 3300025284 | Bacteria | 2014 |
| 117 | Ga0209130_1016463 | 3300025284 | Bacteria | 1789 |
| 118 | Ga0209676_1002257 | 3300025292 | Bacteria | 14191 |
| 119 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 120 | Ga0209025_1000082 | 3300025294 | Bacteria | 265613 |
| 121 | Ga0209025_1000245 | 3300025294 | Bacteria | 127801 |
| 122 | Ga0209025_1000706 | 3300025294 | Bacteria | 56897 |
| 123 | Ga0209025_1000925 | 3300025294 | Bacteria | 44920 |
| 124 | Ga0209025_1001368 | 3300025294 | Bacteria | 32734 |
| 125 | Ga0209025_1007137 | 3300025294 | Bacteria | 8441 |
| 126 | Ga0209025_1009241 | 3300025294 | Bacteria | 6908 |
| 127 | Ga0209025_1034531 | 3300025294 | Bacteria | 2305 |
| 128 | Ga0209564_1000111 | 3300025295 | Bacteria | 212210 |
| 129 | Ga0209564_1001600 | 3300025295 | Bacteria | 22075 |
| 130 | Ga0209564_1005792 | 3300025295 | Bacteria | 6898 |
| 131 | Ga0209564_1009918 | 3300025295 | Bacteria | 4459 |
| 132 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 133 | Ga0209758_1000792 | 3300025297 | Bacteria | 45045 |
| 134 | Ga0209758_1001662 | 3300025297 | Bacteria | 25159 |
| 135 | Ga0209758_1016587 | 3300025297 | Bacteria | 3730 |
| 136 | Ga0209758_1033816 | 3300025297 | Bacteria | 2045 |
| 137 | Ga0209758_1039432 | 3300025297 | Bacteria | 1797 |
| 138 | Ga0209050_1002214 | 3300025298 | Bacteria | 17440 |
| 139 | Ga0209256_1000132 | 3300025299 | Bacteria | 160806 |
| 140 | Ga0209256_1000923 | 3300025299 | Bacteria | 35888 |
| 141 | Ga0209256_1001851 | 3300025299 | Bacteria | 19603 |
| 142 | Ga0209256_1002798 | 3300025299 | Bacteria | 13359 |
| 143 | Ga0209256_1010190 | 3300025299 | Bacteria | 3978 |
| 144 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 145 | Ga0207426_1000210 | 3300025302 | Bacteria | 138932 |
| 146 | Ga0207426_1001096 | 3300025302 | Bacteria | 24971 |
| 147 | Ga0209051_1000070 | 3300025303 | Bacteria | 215616 |
| 148 | Ga0209051_1009843 | 3300025303 | Bacteria | 4890 |
| 149 | Ga0209051_1011687 | 3300025303 | Bacteria | 4312 |
| 150 | Ga0209051_1041827 | 3300025303 | Bacteria | 1626 |
| 151 | Ga0209257_1002146 | 3300025304 | Bacteria | 20536 |
| 152 | Ga0209257_1009616 | 3300025304 | Bacteria | 5124 |
| 153 | Ga0207656_10031520 | 3300025321 | Bacteria | 2197 |
| 154 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 155 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 156 | Ga0207694_10198571 | 3300025924 | Bacteria | 1631 |
| 157 | Ga0207694_10208937 | 3300025924 | Bacteria | 1590 |
| 158 | Ga0207709_10003829 | 3300025935 | Bacteria | 8830 |
| 159 | Ga0207667_10107819 | 3300025949 | Bacteria | 2874 |
| 160 | Ga0207639_10100524 | 3300026041 | Bacteria | 2336 |
| 161 | Ga0207639_10150265 | 3300026041 | Bacteria | 1950 |
| 162 | Ga0207702_10011646 | 3300026078 | Bacteria | 7326 |
| 163 | Ga0207648_10057707 | 3300026089 | Bacteria | 3387 |
| 164 | Ga0207674_10156181 | 3300026116 | Bacteria | 2237 |
| 165 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 166 | Ga0209281_1000061 | 3300027111 | Bacteria | 293814 |
| 167 | Ga0209281_1000821 | 3300027111 | Bacteria | 28054 |
| 168 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 169 | Ga0209371_1001153 | 3300027312 | Bacteria | 19333 |
| 170 | Ga0209371_1003535 | 3300027312 | Bacteria | 7513 |
| 171 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 172 | Ga0209282_1049724 | 3300027666 | Bacteria | 2416 |
| 173 | Ga0268266_10008895 | 3300028379 | Bacteria | 8890 |
| 174 | Ga0268266_10108054 | 3300028379 | Bacteria | 2461 |
| 175 | Ga0268266_10136056 | 3300028379 | Bacteria | 2201 |
| 176 | Ga0307515_10003954 | 3300028794 | Bacteria | 30921 |
| 177 | Ga0307515_10034543 | 3300028794 | Bacteria | 8270 |
| 178 | Ga0307515_10091653 | 3300028794 | Bacteria | 3794 |
| 179 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 180 | Ga0268256_1001230 | 3300030500 | Bacteria | 16198 |
| 181 | Ga0268256_1004253 | 3300030500 | Bacteria | 6024 |
| 182 | Ga0307513_10014884 | 3300031456 | Bacteria | 9459 |
| 183 | Ga0307405_10010736 | 3300031731 | Bacteria | 4761 |
| 184 | Ga0307410_10102451 | 3300031852 | Bacteria | 2054 |
| 185 | Ga0307406_10018898 | 3300031901 | Bacteria | 4036 |
| 186 | Ga0307406_10029649 | 3300031901 | Bacteria | 3315 |
| 187 | Ga0307412_10002786 | 3300031911 | Bacteria | 9713 |
| 188 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 189 | Ga0307414_10010225 | 3300032004 | Bacteria | 5433 |
| 190 | Ga0307414_10327492 | 3300032004 | Bacteria | 1306 |
| 191 | Ga0315913_1000024 | 3300033430 | Bacteria | 90863 |
| 192 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 193 | Ga0373927_0000326 | 3300035695 | Bacteria | 37493 |
| 194 | Ga0316584_0078349 | 3300036712 | Bacteria | 2475 |
| 195 | Ga0373925_0031603 | 3300037068 | Bacteria | 3891 |
| 196 | Ga0395899_0068804 | 3300037312 | Bacteria | 2595 |
| 197 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 198 | Ga0395900_0037071 | 3300037418 | Bacteria | 5028 |
| 199 | Ga0395900_0045209 | 3300037418 | Bacteria | 4535 |
| 200 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 201 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 202 | Ga0395905_0299763 | 3300037471 | Bacteria | 1495 |
| 203 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 204 | Ga0395901_0016396 | 3300038443 | Bacteria | 7544 |
| 205 | Ga0400490_57059 | 3300038726 | Bacteria | 1848 |
| 206 | Ga0400483_002058 | 3300039062 | Bacteria | 1185 |
| 207 | Ga0400483_209833 | 3300039062 | Bacteria | 2084 |
| 208 | Ga0400487_14362 | 3300039110 | Bacteria | 4397 |
| 209 | Ga0439438_020620 | 3300041405 | Bacteria | 1849 |
| 210 | Ga0439439_0015755 | 3300041406 | Bacteria | 1847 |
| 211 | Ga0439465_0004803 | 3300041413 | Bacteria | 4346 |
| 212 | Ga0451839_0504797 | 3300041496 | Bacteria | 3601 |
| 213 | Ga0451855_0693875 | 3300041511 | Bacteria | 2015 |
| 214 | Ga0451853_0143431 | 3300041512 | Bacteria | 1404 |
| 215 | Ga0439449_0004313 | 3300042007 | Bacteria | 5494 |
| 216 | Ga0439449_0015111 | 3300042007 | Bacteria | 2901 |
| 217 | Ga0450906_002957 | 3300042145 | Bacteria | 3692 |
| 218 | Ga0450910_000972 | 3300042147 | Bacteria | 3476 |
| 219 | Ga0450918_002206 | 3300042531 | Bacteria | 3705 |
| 220 | Ga0466972_0025826 | 3300044658 | Bacteria | 2910 |
| 221 | Ga0466970_0061750 | 3300044765 | Bacteria | 2008 |
| 222 | Ga0466957_0235574 | 3300044842 | Bacteria | 1213 |
| 223 | Ga0466960_0176713 | 3300044901 | Bacteria | 1155 |
| 224 | Ga0495592_0020759 | 3300046454 | Bacteria | 4997 |
| 225 | Ga0495638_0000145 | 3300046460 | Bacteria | 112275 |
| 226 | Ga0495638_0034450 | 3300046460 | Bacteria | 3232 |
| 227 | Ga0495651_0068461 | 3300046462 | Bacteria | 2706 |
| 228 | Ga0495605_0001139 | 3300046474 | Bacteria | 17624 |
| 229 | Ga0495662_0002455 | 3300046476 | Bacteria | 9334 |
| 230 | Ga0495584_0069103 | 3300046491 | Bacteria | 1775 |
| 231 | Ga0495585_0016507 | 3300046492 | Bacteria | 4278 |
| 232 | Ga0495585_0017035 | 3300046492 | Bacteria | 4205 |
| 233 | Ga0495583_0034309 | 3300046506 | Bacteria | 2432 |
| 234 | Ga0495606_0017418 | 3300046507 | Bacteria | 5433 |
| 235 | Ga0495606_0030920 | 3300046507 | Bacteria | 3731 |
| 236 | Ga0495616_0011477 | 3300046513 | Bacteria | 5073 |
| 237 | Ga0495616_0033924 | 3300046513 | Bacteria | 2655 |
| 238 | Ga0495631_0003969 | 3300046518 | Bacteria | 7985 |
| 239 | Ga0495631_0020970 | 3300046518 | Bacteria | 3046 |
| 240 | Ga0495632_0022987 | 3300046519 | Bacteria | 3335 |
| 241 | Ga0495643_0010731 | 3300046522 | Bacteria | 5627 |
| 242 | Ga0495643_0084677 | 3300046522 | Bacteria | 1645 |
| 243 | Ga0495652_0144869 | 3300046529 | Bacteria | 1864 |
| 244 | Ga0495654_0000207 | 3300046530 | Bacteria | 55932 |
| 245 | Ga0495654_0025993 | 3300046530 | Bacteria | 3014 |
| 246 | Ga0495633_0024113 | 3300046558 | Bacteria | 3009 |
| 247 | Ga0495668_0075020 | 3300046616 | Bacteria | 1857 |
| 248 | Ga0495625_0000467 | 3300046660 | Bacteria | 60730 |
| 249 | Ga0495635_0139854 | 3300046663 | Bacteria | 1649 |
| 250 | Ga0495588_0019114 | 3300046674 | Bacteria | 3353 |
| 251 | Ga0495657_0058076 | 3300046675 | Bacteria | 2570 |
| 252 | Ga0495658_0015175 | 3300046683 | Bacteria | 3950 |
| 253 | Ga0495670_0014978 | 3300046691 | Bacteria | 3816 |
| 254 | Ga0495670_0036264 | 3300046691 | Bacteria | 2457 |
| 255 | Ga0495649_0020639 | 3300046694 | Bacteria | 3693 |
| 256 | Ga0495600_0004371 | 3300046809 | Bacteria | 8457 |
| 257 | Ga0495660_0015384 | 3300046810 | Bacteria | 4421 |
| 258 | Ga0495604_0006484 | 3300047317 | Bacteria | 9275 |
| 259 | Ga0495687_037028 | 3300047443 | Bacteria | 2177 |
| 260 | Ga0495685_023240 | 3300047447 | Bacteria | 2134 |
| 261 | Ga0495681_0029723 | 3300047470 | Bacteria | 2793 |
| 262 | Ga0495686_0000090 | 3300047472 | Bacteria | 193179 |
| 263 | Ga0495686_0000104 | 3300047472 | Bacteria | 176370 |
| 264 | Ga0495686_0160124 | 3300047472 | Bacteria | 1316 |
| 265 | Ga0495602_0091657 | 3300048088 | Bacteria | 2520 |
| 266 | Ga0495615_0020746 | 3300048090 | Bacteria | 1476 |
| 267 | Ga0496102_0165517 | 3300048905 | Bacteria | 2081 |
| 268 | Ga0496104_0062677 | 3300048907 | Bacteria | 3526 |
| 269 | Ga0496106_0000201 | 3300048909 | Bacteria | 41935 |
| 270 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 271 | Ga0496116_0002679 | 3300048919 | Bacteria | 18404 |
| 272 | Ga0496116_0004501 | 3300048919 | Bacteria | 13269 |
| 273 | Ga0496116_0004648 | 3300048919 | Bacteria | 13000 |
| 274 | Ga0496116_0031988 | 3300048919 | Bacteria | 3756 |
| 275 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 276 | Ga0496117_0023170 | 3300048920 | Bacteria | 4957 |
| 277 | Ga0496117_0037272 | 3300048920 | Bacteria | 3624 |
| 278 | Ga0496117_0046827 | 3300048920 | Bacteria | 3107 |
| 279 | Ga0496117_0085888 | 3300048920 | Bacteria | 2046 |
| 280 | Ga0496118_0002033 | 3300048921 | Bacteria | 28616 |
| 281 | Ga0496118_0017654 | 3300048921 | Bacteria | 6480 |
| 282 | Ga0496118_0027725 | 3300048921 | Bacteria | 4785 |
| 283 | Ga0496118_0108238 | 3300048921 | Bacteria | 1853 |
| 284 | Ga0496119_0019076 | 3300048922 | Bacteria | 5070 |
| 285 | Ga0496119_0058919 | 3300048922 | Bacteria | 2310 |
| 286 | Ga0496119_0069758 | 3300048922 | Bacteria | 2064 |
| 287 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 288 | Ga0496121_0002933 | 3300048924 | Bacteria | 24956 |
| 289 | Ga0496121_0080991 | 3300048924 | Bacteria | 2571 |
| 290 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 291 | Ga0496122_0018212 | 3300048925 | Bacteria | 6504 |
| 292 | Ga0496122_0040218 | 3300048925 | Bacteria | 3720 |
| 293 | Ga0496122_0057615 | 3300048925 | Bacteria | 2883 |
| 294 | Ga0496122_0081348 | 3300048925 | Bacteria | 2255 |
| 295 | Ga0496122_0088970 | 3300048925 | Bacteria | 2113 |
| 296 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 297 | Ga0496123_0000519 | 3300048926 | Bacteria | 66923 |
| 298 | Ga0496123_0018674 | 3300048926 | Bacteria | 5498 |
| 299 | Ga0496123_0042802 | 3300048926 | Bacteria | 3119 |
| 300 | Ga0496124_0000483 | 3300048927 | Bacteria | 68579 |
| 301 | Ga0496124_0003526 | 3300048927 | Bacteria | 19054 |
| 302 | Ga0496124_0019573 | 3300048927 | Bacteria | 6291 |
| 303 | Ga0496124_0034429 | 3300048927 | Bacteria | 4445 |
| 304 | Ga0496124_0047109 | 3300048927 | Bacteria | 3689 |
| 305 | Ga0496124_0058885 | 3300048927 | Bacteria | 3228 |
| 306 | Ga0496124_0120775 | 3300048927 | Bacteria | 2094 |
| 307 | Ga0496125_0000790 | 3300048928 | Bacteria | 51640 |
| 308 | Ga0496125_0024340 | 3300048928 | Bacteria | 5570 |
| 309 | Ga0496125_0061220 | 3300048928 | Bacteria | 3020 |
| 310 | Ga0496125_0086139 | 3300048928 | Bacteria | 2377 |
| 311 | Ga0496125_0120740 | 3300048928 | Bacteria | 1870 |
| 312 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 313 | Ga0496126_0000466 | 3300048929 | Bacteria | 80395 |
| 314 | Ga0496126_0017014 | 3300048929 | Bacteria | 7255 |
| 315 | Ga0501031_0013226 | 3300049568 | Bacteria | 5387 |
| 316 | Ga0501031_0034233 | 3300049568 | Bacteria | 3315 |
| 317 | Ga0501031_0038882 | 3300049568 | Bacteria | 3104 |
| 318 | Ga0501031_0051048 | 3300049568 | Bacteria | 2694 |
| 319 | Ga0501031_0174430 | 3300049568 | Bacteria | 1405 |
| 320 | Ga0501032_0003253 | 3300049569 | Bacteria | 12494 |
| 321 | Ga0501032_0004273 | 3300049569 | Bacteria | 10788 |
| 322 | Ga0501032_0029214 | 3300049569 | Bacteria | 3786 |
| 323 | Ga0501033_0000380 | 3300049570 | Bacteria | 42699 |
| 324 | Ga0501033_0004740 | 3300049570 | Bacteria | 10881 |
| 325 | Ga0501033_0102586 | 3300049570 | Bacteria | 2087 |
| 326 | Ga0501034_0014864 | 3300049571 | Bacteria | 8008 |
| 327 | Ga0501034_0046250 | 3300049571 | Bacteria | 4398 |
| 328 | Ga0501034_0229199 | 3300049571 | Bacteria | 1807 |
| 329 | Ga0501034_0373417 | 3300049571 | Bacteria | 1352 |
| 330 | Ga0501036_0022339 | 3300049572 | Bacteria | 5321 |
| 331 | Ga0501036_0108528 | 3300049572 | Bacteria | 2346 |
| 332 | Ga0501036_0221455 | 3300049572 | Bacteria | 1589 |
| 333 | Ga0501037_0000242 | 3300049573 | Bacteria | 46822 |
| 334 | Ga0501037_0019020 | 3300049573 | Bacteria | 5063 |
| 335 | Ga0501037_0101320 | 3300049573 | Bacteria | 2078 |
| 336 | Ga0501037_0167086 | 3300049573 | Bacteria | 1566 |
| 337 | Ga0501038_0018096 | 3300049574 | Bacteria | 6365 |
| 338 | Ga0501038_0097541 | 3300049574 | Bacteria | 2452 |
| 339 | Ga0501039_0126077 | 3300049575 | Bacteria | 2008 |
| 340 | Ga0501039_0274852 | 3300049575 | Bacteria | 1324 |
| 341 | Ga0501040_0060831 | 3300049576 | Bacteria | 2596 |
| 342 | Ga0501041_0028924 | 3300049577 | Bacteria | 3343 |
| 343 | Ga0501042_0040551 | 3300049578 | Bacteria | 3310 |
| 344 | Ga0501043_0000440 | 3300049579 | Bacteria | 37461 |
| 345 | Ga0501043_0012356 | 3300049579 | Bacteria | 6677 |
| 346 | Ga0501043_0031568 | 3300049579 | Bacteria | 4164 |
| 347 | Ga0501043_0038036 | 3300049579 | Bacteria | 3784 |
| 348 | Ga0501043_0046035 | 3300049579 | Bacteria | 3430 |
| 349 | Ga0501043_0217837 | 3300049579 | Bacteria | 1478 |
| 350 | Ga0501046_0006017 | 3300049580 | Bacteria | 10790 |
| 351 | Ga0501046_0305484 | 3300049580 | Bacteria | 1161 |
| 352 | Ga0501047_0004948 | 3300049581 | Bacteria | 12512 |
| 353 | Ga0501047_0006003 | 3300049581 | Bacteria | 11415 |
| 354 | Ga0501047_0007000 | 3300049581 | Bacteria | 10590 |
| 355 | Ga0501047_0031398 | 3300049581 | Bacteria | 5123 |
| 356 | Ga0501067_0000134 | 3300049583 | Bacteria | 40540 |
| 357 | Ga0501069_0000017 | 3300049585 | Bacteria | 141492 |
| 358 | Ga0501070_0007767 | 3300049586 | Bacteria | 9093 |
| 359 | Ga0501070_0010286 | 3300049586 | Bacteria | 7911 |
| 360 | Ga0501070_0025357 | 3300049586 | Bacteria | 4973 |
| 361 | Ga0501071_0031427 | 3300049587 | Bacteria | 3763 |
| 362 | Ga0501073_0000003 | 3300049589 | Bacteria | 294975 |
| 363 | Ga0501073_0000405 | 3300049589 | Bacteria | 29429 |
| 364 | Ga0501073_0023070 | 3300049589 | Bacteria | 4473 |
| 365 | Ga0501074_0000610 | 3300049590 | Bacteria | 22218 |
| 366 | Ga0501076_0025403 | 3300049592 | Bacteria | 4583 |
| 367 | Ga0501077_0000001 | 3300049593 | Bacteria | 270489 |
| 368 | Ga0501079_0019150 | 3300049741 | Bacteria | 5229 |
| 369 | Ga0501080_0006075 | 3300049742 | Bacteria | 10826 |
| 370 | Ga0501080_0020832 | 3300049742 | Bacteria | 6069 |
| 371 | Ga0501080_0072609 | 3300049742 | Bacteria | 3202 |
| 372 | Ga0501081_0000483 | 3300049743 | Bacteria | 22159 |
| 373 | Ga0501083_0003168 | 3300049744 | Bacteria | 11450 |
| 374 | Ga0501083_0081265 | 3300049744 | Bacteria | 2149 |
| 375 | Ga0501083_0171561 | 3300049744 | Bacteria | 1418 |
| 376 | Ga0501280_000460 | 3300049776 | Bacteria | 9712 |
| 377 | Ga0501035_0000101 | 3300049822 | Bacteria | 106949 |
| 378 | Ga0501035_0003046 | 3300049822 | Bacteria | 16081 |
| 379 | Ga0501035_0003169 | 3300049822 | Bacteria | 15796 |
| 380 | Ga0501035_0132319 | 3300049822 | Bacteria | 2173 |
| 381 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 382 | Ga0501044_0020484 | 3300049823 | Bacteria | 7062 |
| 383 | Ga0501044_0043139 | 3300049823 | Bacteria | 4687 |
| 384 | Ga0501044_0045301 | 3300049823 | Bacteria | 4558 |
| 385 | Ga0501044_0063871 | 3300049823 | Bacteria | 3759 |
| 386 | Ga0501044_0071701 | 3300049823 | Bacteria | 3522 |
| 387 | Ga0501044_0096823 | 3300049823 | Bacteria | 2972 |
| 388 | Ga0501045_0017054 | 3300049824 | Bacteria | 5157 |
| 389 | Ga0501045_0190459 | 3300049824 | Bacteria | 1529 |
| 390 | nmdc:mga03683_118067_c1 | 3300050489 | Bacteria | 1177 |
| 391 | nmdc:mga03683_1280_c1 | 3300050489 | Bacteria | 7437 |
| 392 | nmdc:mga03683_33530_c1 | 3300050489 | Bacteria | 2073 |
| 393 | nmdc:mga03683_3490_c1 | 3300050489 | Bacteria | 5085 |
| 394 | nmdc:mga00v17_11_c1 | 3300050491 | Bacteria | 135478 |
| 395 | nmdc:mga00v17_5900_c1 | 3300050491 | Bacteria | 6471 |
| 396 | nmdc:mga0yw44_16889_c1 | 3300050492 | Bacteria | 3955 |
| 397 | nmdc:mga0yw44_27031_c1 | 3300050492 | Bacteria | 3283 |
| 398 | nmdc:mga0yw44_4747_c1 | 3300050492 | Bacteria | 6295 |
| 399 | nmdc:mga0yw44_65_c1 | 3300050492 | Bacteria | 38061 |
| 400 | nmdc:mga0yw44_81296_c1 | 3300050492 | Bacteria | 2031 |
| 401 | nmdc:mga0k408_29501_c1 | 3300050493 | Bacteria | 3123 |
| 402 | nmdc:mga04h51_25469_c1 | 3300050495 | Bacteria | 1821 |
| 403 | nmdc:mga0sz30_1795_c1 | 3300050516 | Bacteria | 7627 |
| 404 | nmdc:mga0sz30_55436_c1 | 3300050516 | Bacteria | 1687 |
| 405 | Ga0500578_0016118 | 3300053086 | Bacteria | 4796 |
| 406 | Ga0500643_013426 | 3300053087 | Bacteria | 2891 |
| 407 | Ga0500644_0066779 | 3300053088 | Bacteria | 1284 |
| 408 | Ga0500594_0000508 | 3300053118 | Bacteria | 8435 |
| 409 | Ga0500614_024328 | 3300053123 | Bacteria | 1430 |
| 410 | Ga0500618_000025 | 3300053125 | Bacteria | 150583 |
| 411 | Ga0500618_012150 | 3300053125 | Bacteria | 2263 |
| 412 | Ga0500658_0000451 | 3300053134 | Bacteria | 17503 |
| 413 | Ga0500658_0016024 | 3300053134 | Bacteria | 2790 |
| 414 | Ga0500658_0023525 | 3300053134 | Bacteria | 2353 |
| 415 | Ga0500561_0000154 | 3300053137 | Bacteria | 13040 |
| 416 | Ga0500568_0000184 | 3300053139 | Bacteria | 55068 |
| 417 | Ga0500568_0015352 | 3300053139 | Bacteria | 3430 |
| 418 | Ga0500590_000090 | 3300053148 | Bacteria | 23712 |
| 419 | Ga0500616_0002258 | 3300053153 | Bacteria | 16380 |
| 420 | Ga0500616_0008839 | 3300053153 | Bacteria | 6194 |
| 421 | Ga0500616_0055053 | 3300053153 | Bacteria | 2082 |
| 422 | Ga0500622_0000647 | 3300053156 | Bacteria | 31120 |
| 423 | Ga0500622_0001402 | 3300053156 | Bacteria | 19418 |
| 424 | Ga0500624_000584 | 3300053157 | Bacteria | 10067 |
| 425 | Ga0500627_0048421 | 3300053158 | Bacteria | 1846 |
| 426 | Ga0500636_0000009 | 3300053177 | Bacteria | 155504 |
| 427 | Ga0500636_0078327 | 3300053177 | Bacteria | 1908 |
| 428 | Ga0501084_0020656 | 3300054114 | Bacteria | 5492 |
| 429 | Ga0501082_0001434 | 3300060353 | Bacteria | 20937 |
| 430 | Ga0501082_0117029 | 3300060353 | Bacteria | 2309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2551306091 | 2551729462 | 292 |
| 2 | iso_pu_bacteria | 2551306093 | 2551746578 | 293 |
| 3 | iso_pu_bacteria | 2937980651 | 2937984824 | 301 |
| 4 | 3300047472 | Ga0495686_0160124 | Ga0495686_0160124_290_1285 | 309 |
| 5 | 3300003215 | JGI25153J46596_10022771 | JGI25153J46596_100227712 | 311 |
| 6 | 3300025245 | Ga0207425_1005788 | Ga0207425_10057883 | 311 |
| 7 | 3300025258 | Ga0209129_1001260 | Ga0209129_100126015 | 311 |
| 8 | 3300025294 | Ga0209025_1034531 | Ga0209025_10345312 | 311 |
| 9 | 3300025297 | Ga0209758_1000792 | Ga0209758_100079223 | 311 |
| 10 | 3300049776 | Ga0501280_000460 | Ga0501280_000460_1600_2670 | 313 |
| 11 | iso_pu_bacteria | 2937868953 | 2937877162 | 317 |
| 12 | 3300028794 | Ga0307515_10091653 | Ga0307515_100916533 | 319 |
| 13 | 3300009093 | Ga0105240_10143644 | Ga0105240_101436442 | 322 |
| 14 | 3300009551 | Ga0105238_10184211 | Ga0105238_101842112 | 322 |
| 15 | 3300013102 | Ga0157371_10007676 | Ga0157371_100076763 | 322 |
| 16 | 3300025924 | Ga0207694_10198571 | Ga0207694_101985712 | 322 |
| 17 | 3300026041 | Ga0207639_10150265 | Ga0207639_101502652 | 322 |
| 18 | 3300039110 | Ga0400487_14362 | Ga0400487_14362_724_1842 | 322 |
| 19 | 3300048905 | Ga0496102_0165517 | Ga0496102_0165517_374_1471 | 322 |
| 20 | 3300048919 | Ga0496116_0000061 | Ga0496116_0000061_118234_119304 | 322 |
| 21 | 3300048928 | Ga0496125_0061220 | Ga0496125_0061220_1730_2827 | 322 |
| 22 | 3300048929 | Ga0496126_0000397 | Ga0496126_0000397_77714_78784 | 322 |
| 23 | 3300005539 | Ga0068853_100151806 | Ga0068853_1001518061 | 323 |
| 24 | 3300026041 | Ga0207639_10100524 | Ga0207639_101005242 | 323 |
| 25 | 3300048090 | Ga0495615_0020746 | Ga0495615_0020746_398_1444 | 323 |
| 26 | iso_pu_bacteria | 2898795034 | 2898795833 | 323 |
| 27 | iso_pu_bacteria | 2917554339 | 2917558840 | 323 |
| 28 | iso_pu_bacteria | 8054563764 | 8054566313 | 323 |
| 29 | iso_pu_bacteria | 2837651117 | 2837652010 | 324 |
| 30 | iso_pu_bacteria | 2854681122 | 2854683051 | 324 |
| 31 | iso_pu_bacteria | 2919679072 | 2919682998 | 324 |
| 32 | iso_pu_bacteria | 2919679072 | 2919683411 | 324 |
| 33 | 3300003790 | Ga0055528_1012402 | Ga0055528_10124023 | 325 |
| 34 | 3300003792 | Ga0055540_1000164 | Ga0055540_10001642 | 325 |
| 35 | 3300025273 | Ga0209673_1010820 | Ga0209673_10108203 | 325 |
| 36 | 3300025297 | Ga0209758_1039432 | Ga0209758_10394322 | 325 |
| 37 | 3300025303 | Ga0209051_1000070 | Ga0209051_1000070121 | 325 |
| 38 | 3300025304 | Ga0209257_1009616 | Ga0209257_10096165 | 325 |
| 39 | 3300048929 | Ga0496126_0017014 | Ga0496126_0017014_4015_5085 | 325 |
| 40 | iso_pu_bacteria | 2937822353 | 2937827256 | 325 |
| 41 | iso_pu_bacteria | 2588253730 | 2588516522 | 326 |
| 42 | iso_pu_bacteria | 2883291878 | 2883296293 | 326 |
| 43 | iso_pu_bacteria | 2894652903 | 2894653433 | 326 |
| 44 | iso_pu_bacteria | 2899803654 | 2899808380 | 326 |
| 45 | 3300047472 | Ga0495686_0000104 | Ga0495686_0000104_102363_103421 | 327 |
| 46 | iso_pu_bacteria | 2511231027 | 2511392113 | 327 |
| 47 | iso_pu_bacteria | 2643221550 | 2643773738 | 327 |
| 48 | iso_pu_bacteria | 2643221551 | 2643775555 | 327 |
| 49 | iso_pu_bacteria | 2643221555 | 2643794001 | 327 |
| 50 | iso_pu_bacteria | 2643221623 | 2644133066 | 327 |
| 51 | iso_pu_bacteria | 2687453392 | 2688599389 | 327 |
| 52 | iso_pu_bacteria | 2693429783 | 2694632172 | 327 |
| 53 | iso_pu_bacteria | 2693429784 | 2694634420 | 327 |
| 54 | iso_pu_bacteria | 2721755686 | 2723576341 | 327 |
| 55 | iso_pu_bacteria | 2738543024 | 2739306308 | 327 |
| 56 | iso_pu_bacteria | 2756170246 | 2756675858 | 327 |
| 57 | iso_pu_bacteria | 2765235802 | 2765465975 | 327 |
| 58 | iso_pu_bacteria | 2767802442 | 2770196611 | 327 |
| 59 | iso_pu_bacteria | 2775506902 | 2776267860 | 327 |
| 60 | iso_pu_bacteria | 2775506902 | 2776269279 | 327 |
| 61 | iso_pu_bacteria | 2775506904 | 2776281831 | 327 |
| 62 | iso_pu_bacteria | 2775506904 | 2776283582 | 327 |
| 63 | iso_pu_bacteria | 2839993093 | 2839993608 | 327 |
| 64 | iso_pu_bacteria | 2840764183 | 2840766629 | 327 |
| 65 | iso_pu_bacteria | 2842871566 | 2842874912 | 327 |
| 66 | iso_pu_bacteria | 2844002411 | 2844006477 | 327 |
| 67 | iso_pu_bacteria | 2856328259 | 2856328941 | 327 |
| 68 | iso_pu_bacteria | 2856334872 | 2856335375 | 327 |
| 69 | iso_pu_bacteria | 2856349417 | 2856354519 | 327 |
| 70 | iso_pu_bacteria | 2856356410 | 2856362987 | 327 |
| 71 | iso_pu_bacteria | 2856364286 | 2856368864 | 327 |
| 72 | iso_pu_bacteria | 2857349434 | 2857350164 | 327 |
| 73 | iso_pu_bacteria | 2857367948 | 2857369209 | 327 |
| 74 | iso_pu_bacteria | 2869249662 | 2869251942 | 327 |
| 75 | iso_pu_bacteria | 2869264136 | 2869266586 | 327 |
| 76 | iso_pu_bacteria | 2869271264 | 2869273660 | 327 |
| 77 | iso_pu_bacteria | 2869285874 | 2869291359 | 327 |
| 78 | iso_pu_bacteria | 2871429161 | 2871433639 | 327 |
| 79 | iso_pu_bacteria | 2871459585 | 2871459822 | 327 |
| 80 | iso_pu_bacteria | 2871466892 | 2871469497 | 327 |
| 81 | iso_pu_bacteria | 2871488783 | 2871495745 | 327 |
| 82 | iso_pu_bacteria | 2874102143 | 2874104532 | 327 |
| 83 | iso_pu_bacteria | 2874123672 | 2874125960 | 327 |
| 84 | iso_pu_bacteria | 2874131515 | 2874137590 | 327 |
| 85 | iso_pu_bacteria | 2874146452 | 2874153240 | 327 |
| 86 | iso_pu_bacteria | 2874155637 | 2874160505 | 327 |
| 87 | iso_pu_bacteria | 2874162495 | 2874162718 | 327 |
| 88 | iso_pu_bacteria | 2876377896 | 2876383998 | 327 |
| 89 | iso_pu_bacteria | 2876392853 | 2876395011 | 327 |
| 90 | iso_pu_bacteria | 2876399893 | 2876403105 | 327 |
| 91 | iso_pu_bacteria | 2876413966 | 2876419531 | 327 |
| 92 | iso_pu_bacteria | 2878745973 | 2878751250 | 327 |
| 93 | iso_pu_bacteria | 2878753008 | 2878753456 | 327 |
| 94 | iso_pu_bacteria | 2878774303 | 2878778737 | 327 |
| 95 | iso_pu_bacteria | 2878781027 | 2878787458 | 327 |
| 96 | iso_pu_bacteria | 2881155292 | 2881156319 | 327 |
| 97 | iso_pu_bacteria | 2881161766 | 2881168349 | 327 |
| 98 | iso_pu_bacteria | 2881845957 | 2881847506 | 327 |
| 99 | iso_pu_bacteria | 2881853255 | 2881854443 | 327 |
| 100 | iso_pu_bacteria | 2881861095 | 2881864639 | 327 |
| 101 | iso_pu_bacteria | 2882912400 | 2882913121 | 327 |
| 102 | iso_pu_bacteria | 2885305155 | 2885310348 | 327 |
| 103 | iso_pu_bacteria | 2885318864 | 2885323059 | 327 |
| 104 | iso_pu_bacteria | 2885326080 | 2885332848 | 327 |
| 105 | iso_pu_bacteria | 2885334103 | 2885341354 | 327 |
| 106 | iso_pu_bacteria | 2888350351 | 2888356591 | 327 |
| 107 | iso_pu_bacteria | 2889010040 | 2889011496 | 327 |
| 108 | iso_pu_bacteria | 2889016732 | 2889016774 | 327 |
| 109 | iso_pu_bacteria | 2903492973 | 2903495311 | 327 |
| 110 | iso_pu_bacteria | 2903492973 | 2903501748 | 327 |
| 111 | iso_pu_bacteria | 2904578770 | 2904579694 | 327 |
| 112 | iso_pu_bacteria | 2904659560 | 2904661642 | 327 |
| 113 | iso_pu_bacteria | 2906308376 | 2906313191 | 327 |
| 114 | iso_pu_bacteria | 2906321335 | 2906325902 | 327 |
| 115 | iso_pu_bacteria | 2906328253 | 2906335266 | 327 |
| 116 | iso_pu_bacteria | 2906363423 | 2906365821 | 327 |
| 117 | iso_pu_bacteria | 2906370794 | 2906376515 | 327 |
| 118 | iso_pu_bacteria | 2906386501 | 2906392579 | 327 |
| 119 | iso_pu_bacteria | 2906393657 | 2906394786 | 327 |
| 120 | iso_pu_bacteria | 2906408224 | 2906412679 | 327 |
| 121 | iso_pu_bacteria | 2919119836 | 2919120639 | 327 |
| 122 | iso_pu_bacteria | 2919119836 | 2919124362 | 327 |
| 123 | iso_pu_bacteria | 2922130491 | 2922135521 | 327 |
| 124 | iso_pu_bacteria | 2922151315 | 2922151681 | 327 |
| 125 | iso_pu_bacteria | 2922158528 | 2922164119 | 327 |
| 126 | iso_pu_bacteria | 2922172374 | 2922176415 | 327 |
| 127 | iso_pu_bacteria | 2922178524 | 2922180630 | 327 |
| 128 | iso_pu_bacteria | 2922185730 | 2922190941 | 327 |
| 129 | iso_pu_bacteria | 2924726620 | 2924727394 | 327 |
| 130 | iso_pu_bacteria | 2924748358 | 2924752654 | 327 |
| 131 | iso_pu_bacteria | 2924762789 | 2924768938 | 327 |
| 132 | iso_pu_bacteria | 2924784321 | 2924789629 | 327 |
| 133 | iso_pu_bacteria | 2928521798 | 2928522493 | 327 |
| 134 | iso_pu_bacteria | 2937813078 | 2937820658 | 327 |
| 135 | iso_pu_bacteria | 2937891427 | 2937898092 | 327 |
| 136 | iso_pu_bacteria | 2954011201 | 2954014112 | 327 |
| 137 | iso_pu_bacteria | 2958041894 | 2958056490 | 327 |
| 138 | iso_pu_bacteria | 2958100919 | 2958106721 | 327 |
| 139 | iso_pu_bacteria | 2958115193 | 2958122291 | 327 |
| 140 | iso_pu_bacteria | 2958122699 | 2958125343 | 327 |
| 141 | iso_pu_bacteria | 2958130278 | 2958135759 | 327 |
| 142 | iso_pu_bacteria | 2958137437 | 2958139104 | 327 |
| 143 | iso_pu_bacteria | 2958172287 | 2958175009 | 327 |
| 144 | iso_pu_bacteria | 2958179912 | 2958185250 | 327 |
| 145 | iso_pu_bacteria | 2961077736 | 2961083517 | 327 |
| 146 | iso_pu_bacteria | 2961114664 | 2961116795 | 327 |
| 147 | iso_pu_bacteria | 2961136820 | 2961139048 | 327 |
| 148 | iso_pu_bacteria | 2961170736 | 2961177900 | 327 |
| 149 | iso_pu_bacteria | 2965025482 | 2965029490 | 327 |
| 150 | iso_pu_bacteria | 2965032056 | 2965039647 | 327 |
| 151 | iso_pu_bacteria | 2965040258 | 2965042289 | 327 |
| 152 | iso_pu_bacteria | 2965062239 | 2965064986 | 327 |
| 153 | iso_pu_bacteria | 2965089291 | 2965094053 | 327 |
| 154 | iso_pu_bacteria | 2965102966 | 2965110879 | 327 |
| 155 | iso_pu_bacteria | 2965119406 | 2965119737 | 327 |
| 156 | iso_pu_bacteria | 2967996073 | 2968003167 | 327 |
| 157 | iso_pu_bacteria | 2968003550 | 2968003993 | 327 |
| 158 | iso_pu_bacteria | 2968091066 | 2968091830 | 327 |
| 159 | iso_pu_bacteria | 2968097103 | 2968101619 | 327 |
| 160 | iso_pu_bacteria | 2968110612 | 2968112702 | 327 |
| 161 | iso_pu_bacteria | 2968128360 | 2968129892 | 327 |
| 162 | iso_pu_bacteria | 2970489779 | 2970495859 | 327 |
| 163 | iso_pu_bacteria | 2970503327 | 2970510576 | 327 |
| 164 | iso_pu_bacteria | 2970547951 | 2970550427 | 327 |
| 165 | iso_pu_bacteria | 2977821940 | 2977822604 | 327 |
| 166 | iso_pu_bacteria | 2977828996 | 2977831321 | 327 |
| 167 | iso_pu_bacteria | 2977843712 | 2977848956 | 327 |
| 168 | iso_pu_bacteria | 2977858184 | 2977862322 | 327 |
| 169 | iso_pu_bacteria | 2977872689 | 2977872866 | 327 |
| 170 | iso_pu_bacteria | 2977915119 | 2977920592 | 327 |
| 171 | iso_pu_bacteria | 2977935797 | 2977941441 | 327 |
| 172 | iso_pu_bacteria | 2977950692 | 2977951933 | 327 |
| 173 | iso_pu_bacteria | 2979710463 | 2979712515 | 327 |
| 174 | iso_pu_bacteria | 2979742915 | 2979749868 | 327 |
| 175 | iso_pu_bacteria | 2979779861 | 2979779887 | 327 |
| 176 | iso_pu_bacteria | 2979793036 | 2979798095 | 327 |
| 177 | iso_pu_bacteria | 2979808191 | 2979815450 | 327 |
| 178 | iso_pu_bacteria | 2987636660 | 2987637352 | 327 |
| 179 | iso_pu_bacteria | 2987645492 | 2987646899 | 327 |
| 180 | iso_pu_bacteria | 2987652177 | 2987653965 | 327 |
| 181 | iso_pu_bacteria | 2987666974 | 2987670616 | 327 |
| 182 | iso_pu_bacteria | 2987673487 | 2987676705 | 327 |
| 183 | iso_pu_bacteria | 2996341866 | 2996345225 | 327 |
| 184 | iso_pu_bacteria | 3000135777 | 3000138450 | 327 |
| 185 | iso_pu_bacteria | 3004195979 | 3004200175 | 327 |
| 186 | iso_pu_bacteria | 3004203850 | 3004206251 | 327 |
| 187 | iso_pu_bacteria | 3004239961 | 3004243142 | 327 |
| 188 | iso_pu_bacteria | 649633066 | 649873893 | 327 |
| 189 | iso_pu_bacteria | 8002285264 | 8002287638 | 327 |
| 190 | iso_pu_bacteria | 8004300914 | 8004301064 | 327 |
| 191 | iso_pu_bacteria | 8004361976 | 8004366346 | 327 |
| 192 | iso_pu_bacteria | 8004374579 | 8004375028 | 327 |
| 193 | iso_pu_bacteria | 8004387939 | 8004394085 | 327 |
| 194 | iso_pu_bacteria | 8004703790 | 8004713725 | 327 |
| 195 | iso_pu_bacteria | 8004714634 | 8004719448 | 327 |
| 196 | 3300039062 | Ga0400483_209833 | Ga0400483_209833_637_1719 | 328 |
| 197 | 3300049568 | Ga0501031_0038882 | Ga0501031_0038882_1323_2387 | 328 |
| 198 | 3300049572 | Ga0501036_0022339 | Ga0501036_0022339_2275_3339 | 328 |
| 199 | 3300049575 | Ga0501039_0274852 | Ga0501039_0274852_242_1306 | 328 |
| 200 | 3300049576 | Ga0501040_0060831 | Ga0501040_0060831_1391_2455 | 328 |
| 201 | 3300049577 | Ga0501041_0028924 | Ga0501041_0028924_1558_2622 | 328 |
| 202 | 3300049578 | Ga0501042_0040551 | Ga0501042_0040551_814_1878 | 328 |
| 203 | 3300049579 | Ga0501043_0217837 | Ga0501043_0217837_44_1108 | 328 |
| 204 | 3300049580 | Ga0501046_0006017 | Ga0501046_0006017_622_1686 | 328 |
| 205 | 3300049592 | Ga0501076_0025403 | Ga0501076_0025403_2472_3536 | 328 |
| 206 | 3300049741 | Ga0501079_0019150 | Ga0501079_0019150_128_1192 | 328 |
| 207 | 3300049743 | Ga0501081_0000483 | Ga0501081_0000483_9263_10327 | 328 |
| 208 | 3300049744 | Ga0501083_0081265 | Ga0501083_0081265_130_1194 | 328 |
| 209 | 3300049824 | Ga0501045_0017054 | Ga0501045_0017054_1767_2831 | 328 |
| 210 | 3300053125 | Ga0500618_012150 | Ga0500618_012150_528_1628 | 328 |
| 211 | 3300054114 | Ga0501084_0020656 | Ga0501084_0020656_2007_3071 | 328 |
| 212 | 3300060353 | Ga0501082_0001434 | Ga0501082_0001434_10560_11624 | 328 |
| 213 | iso_pu_bacteria | 2508501127 | 2509140603 | 328 |
| 214 | iso_pu_bacteria | 2510917022 | 2511133082 | 328 |
| 215 | iso_pu_bacteria | 2513237351 | 2514589949 | 328 |
| 216 | iso_pu_bacteria | 2582581307 | 2585271819 | 328 |
| 217 | iso_pu_bacteria | 2582581308 | 2585279815 | 328 |
| 218 | iso_pu_bacteria | 2582581315 | 2585326643 | 328 |
| 219 | iso_pu_bacteria | 2585427527 | 2585531781 | 328 |
| 220 | iso_pu_bacteria | 2585427530 | 2585551271 | 328 |
| 221 | iso_pu_bacteria | 2585427531 | 2585563815 | 328 |
| 222 | iso_pu_bacteria | 2585427608 | 2585896987 | 328 |
| 223 | iso_pu_bacteria | 2585427609 | 2585907154 | 328 |
| 224 | iso_pu_bacteria | 2585428125 | 2587982852 | 328 |
| 225 | iso_pu_bacteria | 2597489875 | 2597814060 | 328 |
| 226 | iso_pu_bacteria | 2615840626 | 2616306606 | 328 |
| 227 | iso_pu_bacteria | 2615840698 | 2616551242 | 328 |
| 228 | iso_pu_bacteria | 2667528174 | 2671113366 | 328 |
| 229 | iso_pu_bacteria | 2818991448 | 2819611621 | 328 |
| 230 | iso_pu_bacteria | 2818991453 | 2819638702 | 328 |
| 231 | iso_pu_bacteria | 2838029111 | 2838031048 | 328 |
| 232 | iso_pu_bacteria | 2841734538 | 2841740051 | 328 |
| 233 | iso_pu_bacteria | 2842475841 | 2842477780 | 328 |
| 234 | iso_pu_bacteria | 2842502639 | 2842504348 | 328 |
| 235 | iso_pu_bacteria | 2856342000 | 2856343733 | 328 |
| 236 | iso_pu_bacteria | 2871474448 | 2871475344 | 328 |
| 237 | iso_pu_bacteria | 2878788777 | 2878791526 | 328 |
| 238 | iso_pu_bacteria | 2885312484 | 2885317152 | 328 |
| 239 | iso_pu_bacteria | 2888343758 | 2888347498 | 328 |
| 240 | iso_pu_bacteria | 2894817345 | 2894817493 | 328 |
| 241 | iso_pu_bacteria | 2919408235 | 2919411179 | 328 |
| 242 | iso_pu_bacteria | 2937836603 | 2937837807 | 328 |
| 243 | iso_pu_bacteria | 2958071322 | 2958077545 | 328 |
| 244 | iso_pu_bacteria | 2970524798 | 2970531747 | 328 |
| 245 | iso_pu_bacteria | 2996310559 | 2996313230 | 328 |
| 246 | iso_pu_bacteria | 2996336353 | 2996337776 | 328 |
| 247 | iso_pu_bacteria | 3002141150 | 3002141987 | 328 |
| 248 | iso_pu_bacteria | 3005416602 | 3005421506 | 328 |
| 249 | iso_pu_bacteria | 8004395343 | 8004403515 | 328 |
| 250 | iso_pu_bacteria | 8004633249 | 8004639358 | 328 |
| 251 | iso_pu_bacteria | 8005314921 | 8005319791 | 328 |
| 252 | iso_pu_bacteria | 8005484373 | 8005490417 | 328 |
| 253 | iso_pu_bacteria | 8005645114 | 8005647060 | 328 |
| 254 | iso_pu_bacteria | 8005682033 | 8005686990 | 328 |
| 255 | iso_pu_bacteria | 8018150411 | 8018154129 | 328 |
| 256 | iso_pu_bacteria | 8055617313 | 8055621568 | 328 |
| 257 | iso_pu_bacteria | 2558860983 | 2561467803 | 329 |
| 258 | iso_pu_bacteria | 2889790730 | 2889793572 | 329 |
| 259 | iso_pu_bacteria | 2889914905 | 2889918711 | 329 |
| 260 | iso_pu_bacteria | 8056875544 | 8056876432 | 329 |
| 261 | 3300003762 | Ga0055542_1001265 | Ga0055542_10012654 | 330 |
| 262 | 3300025254 | Ga0209148_1000072 | Ga0209148_1000072223 | 330 |
| 263 | 3300025272 | Ga0209455_1000133 | Ga0209455_100013362 | 330 |
| 264 | 3300028794 | Ga0307515_10034543 | Ga0307515_100345436 | 330 |
| 265 | 3300036712 | Ga0316584_0078349 | Ga0316584_0078349_833_1954 | 330 |
| 266 | 3300038726 | Ga0400490_57059 | Ga0400490_57059_361_1440 | 330 |
| 267 | 3300039062 | Ga0400483_002058 | Ga0400483_002058_80_1153 | 330 |
| 268 | 3300050492 | nmdc:mga0yw44_81296_c1 | nmdc:mga0yw44_81296_c1_656_1720 | 330 |
| 269 | iso_pu_bacteria | 2508501122 | 2509109435 | 330 |
| 270 | iso_pu_bacteria | 2509276019 | 2509378255 | 330 |
| 271 | iso_pu_bacteria | 2509276021 | 2509386322 | 330 |
| 272 | iso_pu_bacteria | 2509276033 | 2509441606 | 330 |
| 273 | iso_pu_bacteria | 2510065019 | 2510137688 | 330 |
| 274 | iso_pu_bacteria | 2510065057 | 2510306928 | 330 |
| 275 | iso_pu_bacteria | 2510461069 | 2510840822 | 330 |
| 276 | iso_pu_bacteria | 2510461076 | 2510893478 | 330 |
| 277 | iso_pu_bacteria | 2510917028 | 2511181721 | 330 |
| 278 | iso_pu_bacteria | 2510917030 | 2511193496 | 330 |
| 279 | iso_pu_bacteria | 2511231052 | 2511503166 | 330 |
| 280 | iso_pu_bacteria | 2512047086 | 2512534444 | 330 |
| 281 | iso_pu_bacteria | 2512875026 | 2512973751 | 330 |
| 282 | iso_pu_bacteria | 2513237084 | 2513571741 | 330 |
| 283 | iso_pu_bacteria | 2513237085 | 2513575756 | 330 |
| 284 | iso_pu_bacteria | 2513237086 | 2513585224 | 330 |
| 285 | iso_pu_bacteria | 2513237088 | 2513598621 | 330 |
| 286 | iso_pu_bacteria | 2513237089 | 2513601732 | 330 |
| 287 | iso_pu_bacteria | 2513237091 | 2513616917 | 330 |
| 288 | iso_pu_bacteria | 2513237093 | 2513635367 | 330 |
| 289 | iso_pu_bacteria | 2513237103 | 2513712606 | 330 |
| 290 | iso_pu_bacteria | 2513237138 | 2513866074 | 330 |
| 291 | iso_pu_bacteria | 2513237140 | 2513884131 | 330 |
| 292 | iso_pu_bacteria | 2513237143 | 2513903460 | 330 |
| 293 | iso_pu_bacteria | 2513237156 | 2513984005 | 330 |
| 294 | iso_pu_bacteria | 2513237159 | 2513998598 | 330 |
| 295 | iso_pu_bacteria | 2513237160 | 2514003685 | 330 |
| 296 | iso_pu_bacteria | 2513237162 | 2514019071 | 330 |
| 297 | iso_pu_bacteria | 2515075009 | 2515109263 | 330 |
| 298 | iso_pu_bacteria | 2515154107 | 2515610908 | 330 |
| 299 | iso_pu_bacteria | 2515154113 | 2515633418 | 330 |
| 300 | iso_pu_bacteria | 2515154114 | 2515641701 | 330 |
| 301 | iso_pu_bacteria | 2515154116 | 2515659027 | 330 |
| 302 | iso_pu_bacteria | 2515154134 | 2515743855 | 330 |
| 303 | iso_pu_bacteria | 2516143018 | 2516204772 | 330 |
| 304 | iso_pu_bacteria | 2516653046 | 2516894599 | 330 |
| 305 | iso_pu_bacteria | 2516653077 | 2517042398 | 330 |
| 306 | iso_pu_bacteria | 2516653085 | 2517081213 | 330 |
| 307 | iso_pu_bacteria | 2517093000 | 2517099423 | 330 |
| 308 | iso_pu_bacteria | 2517287029 | 2517411910 | 330 |
| 309 | iso_pu_bacteria | 2517487022 | 2517571247 | 330 |
| 310 | iso_pu_bacteria | 2519899620 | 2520378218 | 330 |
| 311 | iso_pu_bacteria | 2524023207 | 2524453299 | 330 |
| 312 | iso_pu_bacteria | 2529292951 | 2530649957 | 330 |
| 313 | iso_pu_bacteria | 2534681796 | 2535516710 | 330 |
| 314 | iso_pu_bacteria | 2537561587 | 2537873075 | 330 |
| 315 | iso_pu_bacteria | 2551306084 | 2551682806 | 330 |
| 316 | iso_pu_bacteria | 2551306085 | 2551687418 | 330 |
| 317 | iso_pu_bacteria | 2551306086 | 2551692737 | 330 |
| 318 | iso_pu_bacteria | 2551306087 | 2551703558 | 330 |
| 319 | iso_pu_bacteria | 2554235003 | 2554245078 | 330 |
| 320 | iso_pu_bacteria | 2558860100 | 2558867261 | 330 |
| 321 | iso_pu_bacteria | 2558860242 | 2559297091 | 330 |
| 322 | iso_pu_bacteria | 2582581283 | 2585166838 | 330 |
| 323 | iso_pu_bacteria | 2582581294 | 2585200362 | 330 |
| 324 | iso_pu_bacteria | 2582581298 | 2585226805 | 330 |
| 325 | iso_pu_bacteria | 2582581299 | 2585229824 | 330 |
| 326 | iso_pu_bacteria | 2582581304 | 2585254936 | 330 |
| 327 | iso_pu_bacteria | 2582581306 | 2585266811 | 330 |
| 328 | iso_pu_bacteria | 2582581865 | 2585387853 | 330 |
| 329 | iso_pu_bacteria | 2582581866 | 2585395953 | 330 |
| 330 | iso_pu_bacteria | 2582581867 | 2585404329 | 330 |
| 331 | iso_pu_bacteria | 2585427526 | 2585526305 | 330 |
| 332 | iso_pu_bacteria | 2585427528 | 2585539445 | 330 |
| 333 | iso_pu_bacteria | 2585427529 | 2585550220 | 330 |
| 334 | iso_pu_bacteria | 2585427590 | 2585821971 | 330 |
| 335 | iso_pu_bacteria | 2585427593 | 2585837399 | 330 |
| 336 | iso_pu_bacteria | 2585427594 | 2585843032 | 330 |
| 337 | iso_pu_bacteria | 2599185156 | 2599334046 | 330 |
| 338 | iso_pu_bacteria | 2599185210 | 2599604944 | 330 |
| 339 | iso_pu_bacteria | 2599185352 | 2600193517 | 330 |
| 340 | iso_pu_bacteria | 2600254933 | 2600376971 | 330 |
| 341 | iso_pu_bacteria | 2600255279 | 2601611068 | 330 |
| 342 | iso_pu_bacteria | 2600255308 | 2601747841 | 330 |
| 343 | iso_pu_bacteria | 2615840624 | 2616294545 | 330 |
| 344 | iso_pu_bacteria | 2643221557 | 2643808208 | 330 |
| 345 | iso_pu_bacteria | 2643221568 | 2643854371 | 330 |
| 346 | iso_pu_bacteria | 2643221582 | 2643916746 | 330 |
| 347 | iso_pu_bacteria | 2643221599 | 2644005498 | 330 |
| 348 | iso_pu_bacteria | 2643221607 | 2644051926 | 330 |
| 349 | iso_pu_bacteria | 2643221610 | 2644068603 | 330 |
| 350 | iso_pu_bacteria | 2643221618 | 2644110006 | 330 |
| 351 | iso_pu_bacteria | 2643221626 | 2644150282 | 330 |
| 352 | iso_pu_bacteria | 2643221634 | 2644192538 | 330 |
| 353 | iso_pu_bacteria | 2643221636 | 2644201518 | 330 |
| 354 | iso_pu_bacteria | 2643221637 | 2644209369 | 330 |
| 355 | iso_pu_bacteria | 2643221643 | 2644238488 | 330 |
| 356 | iso_pu_bacteria | 2643221653 | 2644298162 | 330 |
| 357 | iso_pu_bacteria | 2643221655 | 2644312886 | 330 |
| 358 | iso_pu_bacteria | 2643221659 | 2644336432 | 330 |
| 359 | iso_pu_bacteria | 2643221668 | 2644379642 | 330 |
| 360 | iso_pu_bacteria | 2643221675 | 2644419672 | 330 |
| 361 | iso_pu_bacteria | 2643221680 | 2644453029 | 330 |
| 362 | iso_pu_bacteria | 2643221686 | 2644484378 | 330 |
| 363 | iso_pu_bacteria | 2643221689 | 2644499893 | 330 |
| 364 | iso_pu_bacteria | 2643221693 | 2644521334 | 330 |
| 365 | iso_pu_bacteria | 2643221698 | 2644546080 | 330 |
| 366 | iso_pu_bacteria | 2643221712 | 2644618616 | 330 |
| 367 | iso_pu_bacteria | 2643221718 | 2644652897 | 330 |
| 368 | iso_pu_bacteria | 2643221719 | 2644656414 | 330 |
| 369 | iso_pu_bacteria | 2643221723 | 2644677234 | 330 |
| 370 | iso_pu_bacteria | 2643221726 | 2644688942 | 330 |
| 371 | iso_pu_bacteria | 2657244999 | 2657682556 | 330 |
| 372 | iso_pu_bacteria | 2690316117 | 2692320170 | 330 |
| 373 | iso_pu_bacteria | 2718217882 | 2719184532 | 330 |
| 374 | iso_pu_bacteria | 2718217927 | 2719388760 | 330 |
| 375 | iso_pu_bacteria | 2718217997 | 2719668613 | 330 |
| 376 | iso_pu_bacteria | 2718218009 | 2719728552 | 330 |
| 377 | iso_pu_bacteria | 2718218199 | 2720489306 | 330 |
| 378 | iso_pu_bacteria | 2718218232 | 2720609987 | 330 |
| 379 | iso_pu_bacteria | 2718218233 | 2720617411 | 330 |
| 380 | iso_pu_bacteria | 2718218235 | 2720628557 | 330 |
| 381 | iso_pu_bacteria | 2718218269 | 2720772507 | 330 |
| 382 | iso_pu_bacteria | 2718218363 | 2721144243 | 330 |
| 383 | iso_pu_bacteria | 2718218365 | 2721161038 | 330 |
| 384 | iso_pu_bacteria | 2718218366 | 2721161613 | 330 |
| 385 | iso_pu_bacteria | 2718218423 | 2721402541 | 330 |
| 386 | iso_pu_bacteria | 2721755514 | 2722842758 | 330 |
| 387 | iso_pu_bacteria | 2721755556 | 2723029942 | 330 |
| 388 | iso_pu_bacteria | 2721755684 | 2723564351 | 330 |
| 389 | iso_pu_bacteria | 2721755685 | 2723570007 | 330 |
| 390 | iso_pu_bacteria | 2721755809 | 2724034607 | 330 |
| 391 | iso_pu_bacteria | 2721755810 | 2724041577 | 330 |
| 392 | iso_pu_bacteria | 2721755819 | 2724092536 | 330 |
| 393 | iso_pu_bacteria | 2721755822 | 2724101554 | 330 |
| 394 | iso_pu_bacteria | 2721755823 | 2724112912 | 330 |
| 395 | iso_pu_bacteria | 2724679232 | 2725948080 | 330 |
| 396 | iso_pu_bacteria | 2728369352 | 2730110475 | 330 |
| 397 | iso_pu_bacteria | 2728369365 | 2730160647 | 330 |
| 398 | iso_pu_bacteria | 2728369397 | 2730301146 | 330 |
| 399 | iso_pu_bacteria | 2738541293 | 2738804156 | 330 |
| 400 | iso_pu_bacteria | 2738541317 | 2738944631 | 330 |
| 401 | iso_pu_bacteria | 2738541333 | 2739033904 | 330 |
| 402 | iso_pu_bacteria | 2751185821 | 2753459083 | 330 |
| 403 | iso_pu_bacteria | 2765235942 | 2766064802 | 330 |
| 404 | iso_pu_bacteria | 2775507049 | 2776915832 | 330 |
| 405 | iso_pu_bacteria | 2791355082 | 2792582089 | 330 |
| 406 | iso_pu_bacteria | 2791355091 | 2792622049 | 330 |
| 407 | iso_pu_bacteria | 2791355092 | 2792628694 | 330 |
| 408 | iso_pu_bacteria | 2791355094 | 2792641375 | 330 |
| 409 | iso_pu_bacteria | 2791355256 | 2793297634 | 330 |
| 410 | iso_pu_bacteria | 2791355259 | 2793317848 | 330 |
| 411 | iso_pu_bacteria | 2791355260 | 2793322656 | 330 |
| 412 | iso_pu_bacteria | 2791355261 | 2793328557 | 330 |
| 413 | iso_pu_bacteria | 2791355262 | 2793337137 | 330 |
| 414 | iso_pu_bacteria | 2791355263 | 2793343318 | 330 |
| 415 | iso_pu_bacteria | 2791355264 | 2793345421 | 330 |
| 416 | iso_pu_bacteria | 2791355265 | 2793356558 | 330 |
| 417 | iso_pu_bacteria | 2791355266 | 2793360006 | 330 |
| 418 | iso_pu_bacteria | 2791355267 | 2793368388 | 330 |
| 419 | iso_pu_bacteria | 2802428858 | 2802717387 | 330 |
| 420 | iso_pu_bacteria | 2802428859 | 2802724625 | 330 |
| 421 | iso_pu_bacteria | 2802428860 | 2802729376 | 330 |
| 422 | iso_pu_bacteria | 2802428861 | 2802736722 | 330 |
| 423 | iso_pu_bacteria | 2802428862 | 2802743127 | 330 |
| 424 | iso_pu_bacteria | 2802428863 | 2802749747 | 330 |
| 425 | iso_pu_bacteria | 2802429268 | 2804753553 | 330 |
| 426 | iso_pu_bacteria | 2802429605 | 2805928625 | 330 |
| 427 | iso_pu_bacteria | 2802429633 | 2806045765 | 330 |
| 428 | iso_pu_bacteria | 2802429634 | 2806053333 | 330 |
| 429 | iso_pu_bacteria | 2802429635 | 2806062374 | 330 |
| 430 | iso_pu_bacteria | 2802429636 | 2806066294 | 330 |
| 431 | iso_pu_bacteria | 2802429637 | 2806073126 | 330 |
| 432 | iso_pu_bacteria | 2808606387 | 2808988948 | 330 |
| 433 | iso_pu_bacteria | 2818991272 | 2819244244 | 330 |
| 434 | iso_pu_bacteria | 2818991439 | 2819561190 | 330 |
| 435 | iso_pu_bacteria | 2821123053 | 2821126666 | 330 |
| 436 | iso_pu_bacteria | 2838016132 | 2838016182 | 330 |
| 437 | iso_pu_bacteria | 2838022645 | 2838024636 | 330 |
| 438 | iso_pu_bacteria | 2838042994 | 2838046986 | 330 |
| 439 | iso_pu_bacteria | 2838048938 | 2838049729 | 330 |
| 440 | iso_pu_bacteria | 2838061910 | 2838061996 | 330 |
| 441 | iso_pu_bacteria | 2838068647 | 2838068714 | 330 |
| 442 | iso_pu_bacteria | 2838074704 | 2838078319 | 330 |
| 443 | iso_pu_bacteria | 2838668709 | 2838668777 | 330 |
| 444 | iso_pu_bacteria | 2838675328 | 2838678439 | 330 |
| 445 | iso_pu_bacteria | 2838680041 | 2838685700 | 330 |
| 446 | iso_pu_bacteria | 2838686498 | 2838688232 | 330 |
| 447 | iso_pu_bacteria | 2838694306 | 2838700282 | 330 |
| 448 | iso_pu_bacteria | 2838701080 | 2838701563 | 330 |
| 449 | iso_pu_bacteria | 2838707686 | 2838713537 | 330 |
| 450 | iso_pu_bacteria | 2838714209 | 2838716653 | 330 |
| 451 | iso_pu_bacteria | 2838719591 | 2838722735 | 330 |
| 452 | iso_pu_bacteria | 2838724970 | 2838727404 | 330 |
| 453 | iso_pu_bacteria | 2838729681 | 2838732411 | 330 |
| 454 | iso_pu_bacteria | 2838736955 | 2838740273 | 330 |
| 455 | iso_pu_bacteria | 2838742623 | 2838745171 | 330 |
| 456 | iso_pu_bacteria | 2841840854 | 2841843602 | 330 |
| 457 | iso_pu_bacteria | 2841846520 | 2841849022 | 330 |
| 458 | iso_pu_bacteria | 2841851746 | 2841851972 | 330 |
| 459 | iso_pu_bacteria | 2841859092 | 2841861957 | 330 |
| 460 | iso_pu_bacteria | 2841864319 | 2841869508 | 330 |
| 461 | iso_pu_bacteria | 2842077413 | 2842082912 | 330 |
| 462 | iso_pu_bacteria | 2842110456 | 2842117333 | 330 |
| 463 | iso_pu_bacteria | 2842118031 | 2842124030 | 330 |
| 464 | iso_pu_bacteria | 2842124991 | 2842128229 | 330 |
| 465 | iso_pu_bacteria | 2842130223 | 2842133332 | 330 |
| 466 | iso_pu_bacteria | 2842140634 | 2842143322 | 330 |
| 467 | iso_pu_bacteria | 2842146304 | 2842146372 | 330 |
| 468 | iso_pu_bacteria | 2842152218 | 2842155325 | 330 |
| 469 | iso_pu_bacteria | 2842156927 | 2842158952 | 330 |
| 470 | iso_pu_bacteria | 2842163707 | 2842166384 | 330 |
| 471 | iso_pu_bacteria | 2842170452 | 2842173825 | 330 |
| 472 | iso_pu_bacteria | 2842175837 | 2842178946 | 330 |
| 473 | iso_pu_bacteria | 2842180545 | 2842182566 | 330 |
| 474 | iso_pu_bacteria | 2842187318 | 2842189761 | 330 |
| 475 | iso_pu_bacteria | 2842192696 | 2842198376 | 330 |
| 476 | iso_pu_bacteria | 2842198810 | 2842200258 | 330 |
| 477 | iso_pu_bacteria | 2842205361 | 2842210734 | 330 |
| 478 | iso_pu_bacteria | 2842211629 | 2842214075 | 330 |
| 479 | iso_pu_bacteria | 2842217011 | 2842223465 | 330 |
| 480 | iso_pu_bacteria | 2842224351 | 2842226795 | 330 |
| 481 | iso_pu_bacteria | 2842229732 | 2842232929 | 330 |
| 482 | iso_pu_bacteria | 2842237096 | 2842242940 | 330 |
| 483 | iso_pu_bacteria | 2842243621 | 2842247345 | 330 |
| 484 | iso_pu_bacteria | 2842250916 | 2842251398 | 330 |
| 485 | iso_pu_bacteria | 2842257432 | 2842261564 | 330 |
| 486 | iso_pu_bacteria | 2842264693 | 2842265051 | 330 |
| 487 | iso_pu_bacteria | 2842271015 | 2842272818 | 330 |
| 488 | iso_pu_bacteria | 2842278818 | 2842284106 | 330 |
| 489 | iso_pu_bacteria | 2842285085 | 2842288236 | 330 |
| 490 | iso_pu_bacteria | 2842291075 | 2842297023 | 330 |
| 491 | iso_pu_bacteria | 2842304105 | 2842307738 | 330 |
| 492 | iso_pu_bacteria | 2842311132 | 2842315670 | 330 |
| 493 | iso_pu_bacteria | 2842317721 | 2842319645 | 330 |
| 494 | iso_pu_bacteria | 2842341865 | 2842346217 | 330 |
| 495 | iso_pu_bacteria | 2842363717 | 2842368041 | 330 |
| 496 | iso_pu_bacteria | 2842370503 | 2842377109 | 330 |
| 497 | iso_pu_bacteria | 2842377471 | 2842383524 | 330 |
| 498 | iso_pu_bacteria | 2842384541 | 2842390583 | 330 |
| 499 | iso_pu_bacteria | 2842395702 | 2842399282 | 330 |
| 500 | iso_pu_bacteria | 2842402390 | 2842405502 | 330 |
| 501 | iso_pu_bacteria | 2842409023 | 2842411741 | 330 |
| 502 | iso_pu_bacteria | 2842415677 | 2842418732 | 330 |
| 503 | iso_pu_bacteria | 2842422224 | 2842422860 | 330 |
| 504 | iso_pu_bacteria | 2842428310 | 2842428895 | 330 |
| 505 | iso_pu_bacteria | 2842434925 | 2842435508 | 330 |
| 506 | iso_pu_bacteria | 2842441272 | 2842441629 | 330 |
| 507 | iso_pu_bacteria | 2842447887 | 2842448329 | 330 |
| 508 | iso_pu_bacteria | 2842462802 | 2842463319 | 330 |
| 509 | iso_pu_bacteria | 2842469257 | 2842469839 | 330 |
| 510 | iso_pu_bacteria | 2842489311 | 2842490516 | 330 |
| 511 | iso_pu_bacteria | 2842495871 | 2842501547 | 330 |
| 512 | iso_pu_bacteria | 2842515876 | 2842517777 | 330 |
| 513 | iso_pu_bacteria | 2842521101 | 2842524371 | 330 |
| 514 | iso_pu_bacteria | 2842922631 | 2842925673 | 330 |
| 515 | iso_pu_bacteria | 2844163670 | 2844164201 | 330 |
| 516 | iso_pu_bacteria | 2844454524 | 2844461716 | 330 |
| 517 | iso_pu_bacteria | 2847417321 | 2847420685 | 330 |
| 518 | iso_pu_bacteria | 2848992105 | 2848995516 | 330 |
| 519 | iso_pu_bacteria | 2850079185 | 2850082495 | 330 |
| 520 | iso_pu_bacteria | 2854896431 | 2854899717 | 330 |
| 521 | iso_pu_bacteria | 2854911287 | 2854916194 | 330 |
| 522 | iso_pu_bacteria | 2854916844 | 2854921058 | 330 |
| 523 | iso_pu_bacteria | 2855825444 | 2855827222 | 330 |
| 524 | iso_pu_bacteria | 2855839649 | 2855842607 | 330 |
| 525 | iso_pu_bacteria | 2855872281 | 2855878043 | 330 |
| 526 | iso_pu_bacteria | 2857516855 | 2857523790 | 330 |
| 527 | iso_pu_bacteria | 2857531043 | 2857536758 | 330 |
| 528 | iso_pu_bacteria | 2858800743 | 2858803418 | 330 |
| 529 | iso_pu_bacteria | 2891373044 | 2891376159 | 330 |
| 530 | iso_pu_bacteria | 2899792073 | 2899794740 | 330 |
| 531 | iso_pu_bacteria | 2899845264 | 2899845307 | 330 |
| 532 | iso_pu_bacteria | 2913308742 | 2913309252 | 330 |
| 533 | iso_pu_bacteria | 2915650412 | 2915652278 | 330 |
| 534 | iso_pu_bacteria | 2915980308 | 2915982603 | 330 |
| 535 | iso_pu_bacteria | 2915986958 | 2915993209 | 330 |
| 536 | iso_pu_bacteria | 2915993759 | 2915999597 | 330 |
| 537 | iso_pu_bacteria | 2916000859 | 2916004032 | 330 |
| 538 | iso_pu_bacteria | 2916007675 | 2916012323 | 330 |
| 539 | iso_pu_bacteria | 2916014648 | 2916021107 | 330 |
| 540 | iso_pu_bacteria | 2916021584 | 2916027838 | 330 |
| 541 | iso_pu_bacteria | 2916028427 | 2916033581 | 330 |
| 542 | iso_pu_bacteria | 2916035215 | 2916039566 | 330 |
| 543 | iso_pu_bacteria | 2916041962 | 2916045517 | 330 |
| 544 | iso_pu_bacteria | 2916048683 | 2916051186 | 330 |
| 545 | iso_pu_bacteria | 2916055098 | 2916057503 | 330 |
| 546 | iso_pu_bacteria | 2916061851 | 2916065110 | 330 |
| 547 | iso_pu_bacteria | 2916076590 | 2916079690 | 330 |
| 548 | iso_pu_bacteria | 2919100787 | 2919102116 | 330 |
| 549 | iso_pu_bacteria | 2919114240 | 2919116870 | 330 |
| 550 | iso_pu_bacteria | 2919166419 | 2919168760 | 330 |
| 551 | iso_pu_bacteria | 2920822456 | 2920825792 | 330 |
| 552 | iso_pu_bacteria | 2921201388 | 2921207311 | 330 |
| 553 | iso_pu_bacteria | 2921208531 | 2921212450 | 330 |
| 554 | iso_pu_bacteria | 2921237296 | 2921241095 | 330 |
| 555 | iso_pu_bacteria | 2921244191 | 2921249918 | 330 |
| 556 | iso_pu_bacteria | 2921250672 | 2921254636 | 330 |
| 557 | iso_pu_bacteria | 2921257292 | 2921262083 | 330 |
| 558 | iso_pu_bacteria | 2921263974 | 2921270631 | 330 |
| 559 | iso_pu_bacteria | 2921282425 | 2921288937 | 330 |
| 560 | iso_pu_bacteria | 2921289301 | 2921295527 | 330 |
| 561 | iso_pu_bacteria | 2921296804 | 2921300684 | 330 |
| 562 | iso_pu_bacteria | 2923556063 | 2923558379 | 330 |
| 563 | iso_pu_bacteria | 2924144063 | 2924150689 | 330 |
| 564 | iso_pu_bacteria | 2924150972 | 2924154149 | 330 |
| 565 | iso_pu_bacteria | 2924158325 | 2924160228 | 330 |
| 566 | iso_pu_bacteria | 2924165586 | 2924172451 | 330 |
| 567 | iso_pu_bacteria | 2924172951 | 2924178372 | 330 |
| 568 | iso_pu_bacteria | 2924179722 | 2924181635 | 330 |
| 569 | iso_pu_bacteria | 2924186466 | 2924192902 | 330 |
| 570 | iso_pu_bacteria | 2924193448 | 2924195283 | 330 |
| 571 | iso_pu_bacteria | 2924200457 | 2924205939 | 330 |
| 572 | iso_pu_bacteria | 2924207177 | 2924209400 | 330 |
| 573 | iso_pu_bacteria | 2924214083 | 2924220264 | 330 |
| 574 | iso_pu_bacteria | 2924221636 | 2924228644 | 330 |
| 575 | iso_pu_bacteria | 2924228884 | 2924233135 | 330 |
| 576 | iso_pu_bacteria | 2926754445 | 2926758383 | 330 |
| 577 | iso_pu_bacteria | 2926760298 | 2926764058 | 330 |
| 578 | iso_pu_bacteria | 2933006813 | 2933009296 | 330 |
| 579 | iso_pu_bacteria | 2933011516 | 2933013406 | 330 |
| 580 | iso_pu_bacteria | 2933570622 | 2933574189 | 330 |
| 581 | iso_pu_bacteria | 2933586486 | 2933593431 | 330 |
| 582 | iso_pu_bacteria | 2933594066 | 2933598257 | 330 |
| 583 | iso_pu_bacteria | 2933599457 | 2933600332 | 330 |
| 584 | iso_pu_bacteria | 2935894831 | 2935900146 | 330 |
| 585 | iso_pu_bacteria | 2935901341 | 2935906286 | 330 |
| 586 | iso_pu_bacteria | 2936367885 | 2936373749 | 330 |
| 587 | iso_pu_bacteria | 2936375103 | 2936377273 | 330 |
| 588 | iso_pu_bacteria | 2936381700 | 2936386438 | 330 |
| 589 | iso_pu_bacteria | 2936996657 | 2936997614 | 330 |
| 590 | iso_pu_bacteria | 2937002841 | 2937008881 | 330 |
| 591 | iso_pu_bacteria | 2937009748 | 2937013425 | 330 |
| 592 | iso_pu_bacteria | 2937016420 | 2937020291 | 330 |
| 593 | iso_pu_bacteria | 2937023124 | 2937024722 | 330 |
| 594 | iso_pu_bacteria | 2937029754 | 2937033348 | 330 |
| 595 | iso_pu_bacteria | 2937036028 | 2937036039 | 330 |
| 596 | iso_pu_bacteria | 2937042894 | 2937049323 | 330 |
| 597 | iso_pu_bacteria | 2937049772 | 2937054351 | 330 |
| 598 | iso_pu_bacteria | 2937056579 | 2937061485 | 330 |
| 599 | iso_pu_bacteria | 2937063883 | 2937067888 | 330 |
| 600 | iso_pu_bacteria | 2937071275 | 2937075635 | 330 |
| 601 | iso_pu_bacteria | 2937078374 | 2937082400 | 330 |
| 602 | iso_pu_bacteria | 2937084907 | 2937085836 | 330 |
| 603 | iso_pu_bacteria | 2937091812 | 2937097807 | 330 |
| 604 | iso_pu_bacteria | 2937098957 | 2937103264 | 330 |
| 605 | iso_pu_bacteria | 2937106411 | 2937107744 | 330 |
| 606 | iso_pu_bacteria | 2937113482 | 2937116454 | 330 |
| 607 | iso_pu_bacteria | 2937119839 | 2937121787 | 330 |
| 608 | iso_pu_bacteria | 2937126314 | 2937127882 | 330 |
| 609 | iso_pu_bacteria | 2937843397 | 2937845938 | 330 |
| 610 | iso_pu_bacteria | 2941499720 | 2941501198 | 330 |
| 611 | iso_pu_bacteria | 2957375807 | 2957378845 | 330 |
| 612 | iso_pu_bacteria | 2957382221 | 2957383808 | 330 |
| 613 | iso_pu_bacteria | 2957388812 | 2957391524 | 330 |
| 614 | iso_pu_bacteria | 2957395598 | 2957398211 | 330 |
| 615 | iso_pu_bacteria | 2957402308 | 2957403989 | 330 |
| 616 | iso_pu_bacteria | 2957408893 | 2957409898 | 330 |
| 617 | iso_pu_bacteria | 2957415311 | 2957417959 | 330 |
| 618 | iso_pu_bacteria | 2957422303 | 2957423252 | 330 |
| 619 | iso_pu_bacteria | 2957430029 | 2957431570 | 330 |
| 620 | iso_pu_bacteria | 2957437181 | 2957438698 | 330 |
| 621 | iso_pu_bacteria | 2957443900 | 2957447524 | 330 |
| 622 | iso_pu_bacteria | 2957450854 | 2957455427 | 330 |
| 623 | iso_pu_bacteria | 2957457609 | 2957464143 | 330 |
| 624 | iso_pu_bacteria | 2957464669 | 2957467545 | 330 |
| 625 | iso_pu_bacteria | 2957471148 | 2957476603 | 330 |
| 626 | iso_pu_bacteria | 2957478035 | 2957480090 | 330 |
| 627 | iso_pu_bacteria | 2957484790 | 2957485628 | 330 |
| 628 | iso_pu_bacteria | 2957491536 | 2957493685 | 330 |
| 629 | iso_pu_bacteria | 2957498199 | 2957502124 | 330 |
| 630 | iso_pu_bacteria | 2957505466 | 2957512578 | 330 |
| 631 | iso_pu_bacteria | 2960584000 | 2960586821 | 330 |
| 632 | iso_pu_bacteria | 2960591022 | 2960594923 | 330 |
| 633 | iso_pu_bacteria | 2960597568 | 2960599344 | 330 |
| 634 | iso_pu_bacteria | 2960603979 | 2960608040 | 330 |
| 635 | iso_pu_bacteria | 2960610863 | 2960612125 | 330 |
| 636 | iso_pu_bacteria | 2960617483 | 2960618221 | 330 |
| 637 | iso_pu_bacteria | 2960624210 | 2960627424 | 330 |
| 638 | iso_pu_bacteria | 2960631154 | 2960634709 | 330 |
| 639 | iso_pu_bacteria | 2960637947 | 2960643316 | 330 |
| 640 | iso_pu_bacteria | 2960645483 | 2960649580 | 330 |
| 641 | iso_pu_bacteria | 2960652885 | 2960655446 | 330 |
| 642 | iso_pu_bacteria | 2960660292 | 2960663542 | 330 |
| 643 | iso_pu_bacteria | 2960667422 | 2960671853 | 330 |
| 644 | iso_pu_bacteria | 2960674078 | 2960678953 | 330 |
| 645 | iso_pu_bacteria | 2960680706 | 2960684331 | 330 |
| 646 | iso_pu_bacteria | 2960687367 | 2960693727 | 330 |
| 647 | iso_pu_bacteria | 2960693952 | 2960696635 | 330 |
| 648 | iso_pu_bacteria | 2964607997 | 2964609683 | 330 |
| 649 | iso_pu_bacteria | 2964615318 | 2964619442 | 330 |
| 650 | iso_pu_bacteria | 2964621998 | 2964628400 | 330 |
| 651 | iso_pu_bacteria | 2964628898 | 2964630504 | 330 |
| 652 | iso_pu_bacteria | 2964636051 | 2964641141 | 330 |
| 653 | iso_pu_bacteria | 2964643177 | 2964645298 | 330 |
| 654 | iso_pu_bacteria | 2964649959 | 2964652739 | 330 |
| 655 | iso_pu_bacteria | 2964656573 | 2964657231 | 330 |
| 656 | iso_pu_bacteria | 2964663802 | 2964667918 | 330 |
| 657 | iso_pu_bacteria | 2964670856 | 2964671050 | 330 |
| 658 | iso_pu_bacteria | 2964678106 | 2964678307 | 330 |
| 659 | iso_pu_bacteria | 2964685014 | 2964691321 | 330 |
| 660 | iso_pu_bacteria | 2964691889 | 2964695337 | 330 |
| 661 | iso_pu_bacteria | 2964698721 | 2964702545 | 330 |
| 662 | iso_pu_bacteria | 2964705432 | 2964709309 | 330 |
| 663 | iso_pu_bacteria | 2964712639 | 2964717914 | 330 |
| 664 | iso_pu_bacteria | 2964719344 | 2964725520 | 330 |
| 665 | iso_pu_bacteria | 2967664464 | 2967668923 | 330 |
| 666 | iso_pu_bacteria | 2967671571 | 2967673581 | 330 |
| 667 | iso_pu_bacteria | 2967678726 | 2967682752 | 330 |
| 668 | iso_pu_bacteria | 2967686174 | 2967689117 | 330 |
| 669 | iso_pu_bacteria | 2967693043 | 2967695533 | 330 |
| 670 | iso_pu_bacteria | 2967699805 | 2967703078 | 330 |
| 671 | iso_pu_bacteria | 2967706974 | 2967713843 | 330 |
| 672 | iso_pu_bacteria | 2967714385 | 2967718242 | 330 |
| 673 | iso_pu_bacteria | 2967721400 | 2967725364 | 330 |
| 674 | iso_pu_bacteria | 2967728569 | 2967731984 | 330 |
| 675 | iso_pu_bacteria | 2967735183 | 2967736753 | 330 |
| 676 | iso_pu_bacteria | 2967742019 | 2967748936 | 330 |
| 677 | iso_pu_bacteria | 2967748971 | 2967749931 | 330 |
| 678 | iso_pu_bacteria | 2967755722 | 2967757943 | 330 |
| 679 | iso_pu_bacteria | 2967762386 | 2967768163 | 330 |
| 680 | iso_pu_bacteria | 2967769361 | 2967774713 | 330 |
| 681 | iso_pu_bacteria | 2967775926 | 2967778486 | 330 |
| 682 | iso_pu_bacteria | 2970019648 | 2970023445 | 330 |
| 683 | iso_pu_bacteria | 2970026789 | 2970029980 | 330 |
| 684 | iso_pu_bacteria | 2970033650 | 2970038300 | 330 |
| 685 | iso_pu_bacteria | 2970040964 | 2970045917 | 330 |
| 686 | iso_pu_bacteria | 2970047711 | 2970048565 | 330 |
| 687 | iso_pu_bacteria | 2970054988 | 2970059878 | 330 |
| 688 | iso_pu_bacteria | 2970061556 | 2970064894 | 330 |
| 689 | iso_pu_bacteria | 2970068827 | 2970073103 | 330 |
| 690 | iso_pu_bacteria | 2970076120 | 2970079736 | 330 |
| 691 | iso_pu_bacteria | 2970082768 | 2970086428 | 330 |
| 692 | iso_pu_bacteria | 2970088815 | 2970091272 | 330 |
| 693 | iso_pu_bacteria | 2970095765 | 2970099466 | 330 |
| 694 | iso_pu_bacteria | 2970102677 | 2970106829 | 330 |
| 695 | iso_pu_bacteria | 2970109326 | 2970111488 | 330 |
| 696 | iso_pu_bacteria | 2970116247 | 2970120938 | 330 |
| 697 | iso_pu_bacteria | 2970122695 | 2970125910 | 330 |
| 698 | iso_pu_bacteria | 2970129317 | 2970131942 | 330 |
| 699 | iso_pu_bacteria | 2970136068 | 2970141632 | 330 |
| 700 | iso_pu_bacteria | 2970143518 | 2970143775 | 330 |
| 701 | iso_pu_bacteria | 2970149975 | 2970155011 | 330 |
| 702 | iso_pu_bacteria | 2970156795 | 2970157098 | 330 |
| 703 | iso_pu_bacteria | 2970164137 | 2970167952 | 330 |
| 704 | iso_pu_bacteria | 2970170962 | 2970176796 | 330 |
| 705 | iso_pu_bacteria | 2970177841 | 2970180174 | 330 |
| 706 | iso_pu_bacteria | 2970184632 | 2970185740 | 330 |
| 707 | iso_pu_bacteria | 2970191845 | 2970197792 | 330 |
| 708 | iso_pu_bacteria | 2977516862 | 2977520282 | 330 |
| 709 | iso_pu_bacteria | 2977523885 | 2977524559 | 330 |
| 710 | iso_pu_bacteria | 2977530762 | 2977534622 | 330 |
| 711 | iso_pu_bacteria | 2977537788 | 2977541482 | 330 |
| 712 | iso_pu_bacteria | 2977544691 | 2977549117 | 330 |
| 713 | iso_pu_bacteria | 2977551784 | 2977553355 | 330 |
| 714 | iso_pu_bacteria | 2977558990 | 2977564906 | 330 |
| 715 | iso_pu_bacteria | 2977565890 | 2977569250 | 330 |
| 716 | iso_pu_bacteria | 2977572785 | 2977576493 | 330 |
| 717 | iso_pu_bacteria | 2977579622 | 2977585433 | 330 |
| 718 | iso_pu_bacteria | 2979089926 | 2979090844 | 330 |
| 719 | iso_pu_bacteria | 2979095461 | 2979096369 | 330 |
| 720 | iso_pu_bacteria | 2979100975 | 2979101914 | 330 |
| 721 | iso_pu_bacteria | 2984509177 | 2984510148 | 330 |
| 722 | iso_pu_bacteria | 2984518228 | 2984519148 | 330 |
| 723 | iso_pu_bacteria | 2984601300 | 2984605211 | 330 |
| 724 | iso_pu_bacteria | 2989349275 | 2989350745 | 330 |
| 725 | iso_pu_bacteria | 2989771324 | 2989771451 | 330 |
| 726 | iso_pu_bacteria | 2989776772 | 2989776883 | 330 |
| 727 | iso_pu_bacteria | 2996887358 | 2996891887 | 330 |
| 728 | iso_pu_bacteria | 2996893221 | 2996895414 | 330 |
| 729 | iso_pu_bacteria | 3003930520 | 3003930773 | 330 |
| 730 | iso_pu_bacteria | 3005445848 | 3005450538 | 330 |
| 731 | iso_pu_bacteria | 3005452660 | 3005457717 | 330 |
| 732 | iso_pu_bacteria | 639633055 | 639645623 | 330 |
| 733 | iso_pu_bacteria | 643692032 | 643827284 | 330 |
| 734 | iso_pu_bacteria | 648276728 | 648737047 | 330 |
| 735 | iso_pu_bacteria | 650716007 | 650843519 | 330 |
| 736 | iso_pu_bacteria | 8003570095 | 8003573193 | 330 |
| 737 | iso_pu_bacteria | 8003992118 | 8003995189 | 330 |
| 738 | iso_pu_bacteria | 8003999396 | 8004002906 | 330 |
| 739 | iso_pu_bacteria | 8005246636 | 8005247839 | 330 |
| 740 | iso_pu_bacteria | 8005258706 | 8005263299 | 330 |
| 741 | iso_pu_bacteria | 8005275841 | 8005276170 | 330 |
| 742 | iso_pu_bacteria | 8005282627 | 8005288556 | 330 |
| 743 | iso_pu_bacteria | 8005289223 | 8005290044 | 330 |
| 744 | iso_pu_bacteria | 8005301065 | 8005301609 | 330 |
| 745 | iso_pu_bacteria | 8005307578 | 8005311812 | 330 |
| 746 | iso_pu_bacteria | 8005321885 | 8005326414 | 330 |
| 747 | iso_pu_bacteria | 8005376324 | 8005382327 | 330 |
| 748 | iso_pu_bacteria | 8005382845 | 8005384377 | 330 |
| 749 | iso_pu_bacteria | 8005395548 | 8005401427 | 330 |
| 750 | iso_pu_bacteria | 8005430974 | 8005431476 | 330 |
| 751 | iso_pu_bacteria | 8005497431 | 8005502861 | 330 |
| 752 | iso_pu_bacteria | 8005542996 | 8005545381 | 330 |
| 753 | iso_pu_bacteria | 8005556819 | 8005559659 | 330 |
| 754 | iso_pu_bacteria | 8005563573 | 8005563862 | 330 |
| 755 | iso_pu_bacteria | 8005570704 | 8005576574 | 330 |
| 756 | iso_pu_bacteria | 8005619151 | 8005624011 | 330 |
| 757 | iso_pu_bacteria | 8005626139 | 8005629276 | 330 |
| 758 | iso_pu_bacteria | 8005658619 | 8005662524 | 330 |
| 759 | iso_pu_bacteria | 8005668836 | 8005674291 | 330 |
| 760 | iso_pu_bacteria | 8005688590 | 8005693298 | 330 |
| 761 | iso_pu_bacteria | 8005695170 | 8005700377 | 330 |
| 762 | iso_pu_bacteria | 8018127388 | 8018129052 | 330 |
| 763 | iso_pu_bacteria | 8018163183 | 8018163973 | 330 |
| 764 | iso_pu_bacteria | 8018176218 | 8018179388 | 330 |
| 765 | iso_pu_bacteria | 8023680758 | 8023685813 | 330 |
| 766 | iso_pu_bacteria | 8024479707 | 8024486349 | 330 |
| 767 | iso_pu_bacteria | 8024486573 | 8024493120 | 330 |
| 768 | iso_pu_bacteria | 8024501048 | 8024501930 | 330 |
| 769 | iso_pu_bacteria | 8049293176 | 8049296117 | 330 |
| 770 | iso_pu_bacteria | 8054460903 | 8054465433 | 330 |
| 771 | iso_pu_bacteria | 8054558443 | 8054558836 | 330 |
| 772 | iso_pu_bacteria | 8056375014 | 8056376459 | 330 |
| 773 | iso_pu_bacteria | 8056382006 | 8056383813 | 330 |
| 774 | iso_pu_bacteria | 8057874678 | 8057878245 | 330 |
| 775 | 3300001989 | JGI24739J22299_10046732 | JGI24739J22299_100467321 | 331 |
| 776 | 3300005548 | Ga0070665_100077892 | Ga0070665_1000778922 | 331 |
| 777 | 3300005548 | Ga0070665_100107612 | Ga0070665_1001076122 | 331 |
| 778 | 3300005983 | Ga0081540_1101780 | Ga0081540_11017802 | 331 |
| 779 | 3300006048 | Ga0075363_100119035 | Ga0075363_1001190352 | 331 |
| 780 | 3300006177 | Ga0075362_10007295 | Ga0075362_100072952 | 331 |
| 781 | 3300006177 | Ga0075362_10036818 | Ga0075362_100368183 | 331 |
| 782 | 3300006178 | Ga0075367_10134282 | Ga0075367_101342822 | 331 |
| 783 | 3300025924 | Ga0207694_10208937 | Ga0207694_102089372 | 331 |
| 784 | 3300026089 | Ga0207648_10057707 | Ga0207648_100577072 | 331 |
| 785 | 3300026116 | Ga0207674_10156181 | Ga0207674_101561812 | 331 |
| 786 | 3300028379 | Ga0268266_10136056 | Ga0268266_101360562 | 331 |
| 787 | 3300032004 | Ga0307414_10010225 | Ga0307414_100102253 | 331 |
| 788 | 3300032004 | Ga0307414_10327492 | Ga0307414_103274922 | 331 |
| 789 | 3300037312 | Ga0395899_0068804 | Ga0395899_0068804_1303_2370 | 331 |
| 790 | 3300037418 | Ga0395900_0000027 | Ga0395900_0000027_210038_211165 | 331 |
| 791 | 3300037418 | Ga0395900_0037071 | Ga0395900_0037071_3394_4461 | 331 |
| 792 | 3300037418 | Ga0395900_0045209 | Ga0395900_0045209_317_1384 | 331 |
| 793 | 3300037466 | Ga0395898_0000255 | Ga0395898_0000255_55098_56225 | 331 |
| 794 | 3300037471 | Ga0395905_0000032 | Ga0395905_0000032_74768_75895 | 331 |
| 795 | 3300037471 | Ga0395905_0299763 | Ga0395905_0299763_187_1254 | 331 |
| 796 | 3300038443 | Ga0395901_0000110 | Ga0395901_0000110_74793_75920 | 331 |
| 797 | 3300038443 | Ga0395901_0016396 | Ga0395901_0016396_1348_2415 | 331 |
| 798 | 3300044658 | Ga0466972_0025826 | Ga0466972_0025826_1408_2475 | 331 |
| 799 | 3300046460 | Ga0495638_0034450 | Ga0495638_0034450_789_1859 | 331 |
| 800 | 3300047443 | Ga0495687_037028 | Ga0495687_037028_740_1822 | 331 |
| 801 | 3300049568 | Ga0501031_0051048 | Ga0501031_0051048_162_1232 | 331 |
| 802 | 3300049569 | Ga0501032_0004273 | Ga0501032_0004273_8155_9225 | 331 |
| 803 | 3300049570 | Ga0501033_0004740 | Ga0501033_0004740_8275_9345 | 331 |
| 804 | 3300049570 | Ga0501033_0102586 | Ga0501033_0102586_363_1433 | 331 |
| 805 | 3300049571 | Ga0501034_0014864 | Ga0501034_0014864_2063_3139 | 331 |
| 806 | 3300049571 | Ga0501034_0046250 | Ga0501034_0046250_1388_2455 | 331 |
| 807 | 3300049571 | Ga0501034_0229199 | Ga0501034_0229199_435_1505 | 331 |
| 808 | 3300049572 | Ga0501036_0221455 | Ga0501036_0221455_113_1189 | 331 |
| 809 | 3300049573 | Ga0501037_0000242 | Ga0501037_0000242_33736_34806 | 331 |
| 810 | 3300049573 | Ga0501037_0019020 | Ga0501037_0019020_277_1353 | 331 |
| 811 | 3300049574 | Ga0501038_0018096 | Ga0501038_0018096_570_1646 | 331 |
| 812 | 3300049575 | Ga0501039_0126077 | Ga0501039_0126077_658_1734 | 331 |
| 813 | 3300049579 | Ga0501043_0000440 | Ga0501043_0000440_2317_3387 | 331 |
| 814 | 3300049579 | Ga0501043_0012356 | Ga0501043_0012356_1347_2423 | 331 |
| 815 | 3300049579 | Ga0501043_0031568 | Ga0501043_0031568_46_1116 | 331 |
| 816 | 3300049579 | Ga0501043_0046035 | Ga0501043_0046035_2313_3383 | 331 |
| 817 | 3300049580 | Ga0501046_0305484 | Ga0501046_0305484_58_1134 | 331 |
| 818 | 3300049581 | Ga0501047_0006003 | Ga0501047_0006003_5153_6229 | 331 |
| 819 | 3300049581 | Ga0501047_0007000 | Ga0501047_0007000_9191_10261 | 331 |
| 820 | 3300049581 | Ga0501047_0031398 | Ga0501047_0031398_2847_3917 | 331 |
| 821 | 3300049585 | Ga0501069_0000017 | Ga0501069_0000017_20948_22018 | 331 |
| 822 | 3300049586 | Ga0501070_0007767 | Ga0501070_0007767_5099_6169 | 331 |
| 823 | 3300049586 | Ga0501070_0010286 | Ga0501070_0010286_2104_3174 | 331 |
| 824 | 3300049586 | Ga0501070_0025357 | Ga0501070_0025357_1344_2414 | 331 |
| 825 | 3300049587 | Ga0501071_0031427 | Ga0501071_0031427_913_1983 | 331 |
| 826 | 3300049589 | Ga0501073_0000405 | Ga0501073_0000405_15182_16258 | 331 |
| 827 | 3300049589 | Ga0501073_0023070 | Ga0501073_0023070_2530_3600 | 331 |
| 828 | 3300049590 | Ga0501074_0000610 | Ga0501074_0000610_9136_10206 | 331 |
| 829 | 3300049742 | Ga0501080_0006075 | Ga0501080_0006075_8446_9516 | 331 |
| 830 | 3300049742 | Ga0501080_0020832 | Ga0501080_0020832_3675_4751 | 331 |
| 831 | 3300049744 | Ga0501083_0003168 | Ga0501083_0003168_5473_6543 | 331 |
| 832 | 3300049822 | Ga0501035_0000101 | Ga0501035_0000101_34078_35148 | 331 |
| 833 | 3300049822 | Ga0501035_0003169 | Ga0501035_0003169_13145_14215 | 331 |
| 834 | 3300049822 | Ga0501035_0132319 | Ga0501035_0132319_600_1670 | 331 |
| 835 | 3300049823 | Ga0501044_0000010 | Ga0501044_0000010_167672_168742 | 331 |
| 836 | 3300049823 | Ga0501044_0043139 | Ga0501044_0043139_2112_3188 | 331 |
| 837 | 3300049823 | Ga0501044_0063871 | Ga0501044_0063871_1044_2114 | 331 |
| 838 | 3300049823 | Ga0501044_0071701 | Ga0501044_0071701_1853_2923 | 331 |
| 839 | 3300049823 | Ga0501044_0096823 | Ga0501044_0096823_310_1380 | 331 |
| 840 | 3300050489 | nmdc:mga03683_118067_c1 | nmdc:mga03683_118067_c1_27_1109 | 331 |
| 841 | 3300050489 | nmdc:mga03683_1280_c1 | nmdc:mga03683_1280_c1_4505_5578 | 331 |
| 842 | 3300050492 | nmdc:mga0yw44_27031_c1 | nmdc:mga0yw44_27031_c1_436_1518 | 331 |
| 843 | 3300053153 | Ga0500616_0055053 | Ga0500616_0055053_329_1396 | 331 |
| 844 | 3300002737 | JGI25162J39368_1001235 | JGI25162J39368_10012357 | 332 |
| 845 | 3300003187 | JGI25151J46595_10018980 | JGI25151J46595_100189802 | 332 |
| 846 | 3300003214 | JGI25165J46597_1000715 | JGI25165J46597_100071510 | 332 |
| 847 | 3300005614 | Ga0068856_100026023 | Ga0068856_1000260234 | 332 |
| 848 | 3300005616 | Ga0068852_100062822 | Ga0068852_1000628223 | 332 |
| 849 | 3300006038 | Ga0075365_10016088 | Ga0075365_100160883 | 332 |
| 850 | 3300006051 | Ga0075364_10021782 | Ga0075364_100217825 | 332 |
| 851 | 3300006177 | Ga0075362_10029590 | Ga0075362_100295902 | 332 |
| 852 | 3300006353 | Ga0075370_10005557 | Ga0075370_100055575 | 332 |
| 853 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013344 | 332 |
| 854 | 3300009545 | Ga0105237_10002145 | Ga0105237_1000214518 | 332 |
| 855 | 3300010375 | Ga0105239_10004876 | Ga0105239_100048762 | 332 |
| 856 | 3300013104 | Ga0157370_10029471 | Ga0157370_100294714 | 332 |
| 857 | 3300015262 | Ga0182007_10005973 | Ga0182007_100059732 | 332 |
| 858 | 3300015265 | Ga0182005_1003820 | Ga0182005_10038204 | 332 |
| 859 | 3300025233 | Ga0209437_100057 | Ga0209437_100057325 | 332 |
| 860 | 3300025253 | Ga0209677_101041 | Ga0209677_1010416 | 332 |
| 861 | 3300025254 | Ga0209148_1003966 | Ga0209148_10039665 | 332 |
| 862 | 3300025261 | Ga0209233_1000130 | Ga0209233_1000130127 | 332 |
| 863 | 3300025261 | Ga0209233_1000255 | Ga0209233_10002557 | 332 |
| 864 | 3300025294 | Ga0209025_1007137 | Ga0209025_10071373 | 332 |
| 865 | 3300025321 | Ga0207656_10031520 | Ga0207656_100315203 | 332 |
| 866 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044301 | 332 |
| 867 | 3300025914 | Ga0207671_10000043 | Ga0207671_10000043187 | 332 |
| 868 | 3300025949 | Ga0207667_10107819 | Ga0207667_101078192 | 332 |
| 869 | 3300026078 | Ga0207702_10011646 | Ga0207702_100116467 | 332 |
| 870 | 3300027312 | Ga0209371_1001153 | Ga0209371_100115313 | 332 |
| 871 | 3300030500 | Ga0268256_1001230 | Ga0268256_10012307 | 332 |
| 872 | 3300035695 | Ga0373927_0000326 | Ga0373927_0000326_31423_32493 | 332 |
| 873 | 3300037068 | Ga0373925_0031603 | Ga0373925_0031603_2741_3811 | 332 |
| 874 | 3300044765 | Ga0466970_0061750 | Ga0466970_0061750_106_1176 | 332 |
| 875 | 3300044842 | Ga0466957_0235574 | Ga0466957_0235574_33_1103 | 332 |
| 876 | 3300048920 | Ga0496117_0023170 | Ga0496117_0023170_249_1319 | 332 |
| 877 | 3300048921 | Ga0496118_0108238 | Ga0496118_0108238_249_1319 | 332 |
| 878 | 3300048922 | Ga0496119_0069758 | Ga0496119_0069758_866_1936 | 332 |
| 879 | 3300048926 | Ga0496123_0042802 | Ga0496123_0042802_1911_2981 | 332 |
| 880 | 3300048927 | Ga0496124_0058885 | Ga0496124_0058885_2052_3122 | 332 |
| 881 | 3300049571 | Ga0501034_0373417 | Ga0501034_0373417_125_1195 | 332 |
| 882 | 3300049581 | Ga0501047_0004948 | Ga0501047_0004948_9920_10996 | 332 |
| 883 | 3300050491 | nmdc:mga00v17_5900_c1 | nmdc:mga00v17_5900_c1_326_1408 | 332 |
| 884 | 3300050492 | nmdc:mga0yw44_16889_c1 | nmdc:mga0yw44_16889_c1_761_1831 | 332 |
| 885 | 3300053087 | Ga0500643_013426 | Ga0500643_013426_1625_2695 | 332 |
| 886 | 3300005548 | Ga0070665_100173119 | Ga0070665_1001731192 | 333 |
| 887 | 3300028379 | Ga0268266_10108054 | Ga0268266_101080542 | 333 |
| 888 | 3300031901 | Ga0307406_10018898 | Ga0307406_100188983 | 333 |
| 889 | 3300048919 | Ga0496116_0004648 | Ga0496116_0004648_9739_10809 | 333 |
| 890 | 3300048920 | Ga0496117_0037272 | Ga0496117_0037272_1857_2927 | 333 |
| 891 | 3300048921 | Ga0496118_0027725 | Ga0496118_0027725_28_1098 | 333 |
| 892 | 3300048925 | Ga0496122_0040218 | Ga0496122_0040218_202_1272 | 333 |
| 893 | 3300048927 | Ga0496124_0003526 | Ga0496124_0003526_511_1581 | 333 |
| 894 | 3300049568 | Ga0501031_0013226 | Ga0501031_0013226_470_1546 | 333 |
| 895 | 2010549000 | RicEn_C7977 | RicEn_140510 | 334 |
| 896 | 3300002773 | JGI25152J39213_1003333 | JGI25152J39213_10033335 | 334 |
| 897 | 3300002773 | JGI25152J39213_1008734 | JGI25152J39213_10087342 | 334 |
| 898 | 3300002774 | JGI25150J39212_1000123 | JGI25150J39212_100012324 | 334 |
| 899 | 3300003187 | JGI25151J46595_10000083 | JGI25151J46595_1000008322 | 334 |
| 900 | 3300003187 | JGI25151J46595_10004591 | JGI25151J46595_100045913 | 334 |
| 901 | 3300003187 | JGI25151J46595_10005526 | JGI25151J46595_100055262 | 334 |
| 902 | 3300003187 | JGI25151J46595_10016186 | JGI25151J46595_100161862 | 334 |
| 903 | 3300003215 | JGI25153J46596_10000210 | JGI25153J46596_1000021042 | 334 |
| 904 | 3300003215 | JGI25153J46596_10022785 | JGI25153J46596_100227852 | 334 |
| 905 | 3300003354 | JGI25160J50197_1000097 | JGI25160J50197_100009757 | 334 |
| 906 | 3300003354 | JGI25160J50197_1001006 | JGI25160J50197_10010069 | 334 |
| 907 | 3300003374 | JGI25161J50226_1001144 | JGI25161J50226_10011443 | 334 |
| 908 | 3300003578 | Ga0006562J51391_1020650 | Ga0006562J51391_10206503 | 334 |
| 909 | 3300003771 | Ga0055526_1003114 | Ga0055526_10031145 | 334 |
| 910 | 3300003771 | Ga0055526_1008015 | Ga0055526_10080152 | 334 |
| 911 | 3300003771 | Ga0055526_1016519 | Ga0055526_10165193 | 334 |
| 912 | 3300003775 | Ga0055524_1005275 | Ga0055524_10052754 | 334 |
| 913 | 3300003775 | Ga0055524_1020453 | Ga0055524_10204532 | 334 |
| 914 | 3300003775 | Ga0055524_1034046 | Ga0055524_10340462 | 334 |
| 915 | 3300003781 | Ga0055536_1001637 | Ga0055536_100163713 | 334 |
| 916 | 3300003790 | Ga0055528_1003100 | Ga0055528_10031005 | 334 |
| 917 | 3300003794 | Ga0055531_10012663 | Ga0055531_100126635 | 334 |
| 918 | 3300003856 | Ga0058692_1001130 | Ga0058692_10011303 | 334 |
| 919 | 3300003856 | Ga0058692_1002092 | Ga0058692_10020922 | 334 |
| 920 | 3300004625 | Ga0055543_1000229 | Ga0055543_100022941 | 334 |
| 921 | 3300004625 | Ga0055543_1000888 | Ga0055543_10008885 | 334 |
| 922 | 3300005466 | Ga0070685_10009602 | Ga0070685_100096022 | 334 |
| 923 | 3300006038 | Ga0075365_10000121 | Ga0075365_1000012113 | 334 |
| 924 | 3300006038 | Ga0075365_10003990 | Ga0075365_100039906 | 334 |
| 925 | 3300006042 | Ga0075368_10004434 | Ga0075368_100044342 | 334 |
| 926 | 3300006042 | Ga0075368_10007040 | Ga0075368_100070405 | 334 |
| 927 | 3300006048 | Ga0075363_100005887 | Ga0075363_1000058872 | 334 |
| 928 | 3300006051 | Ga0075364_10100241 | Ga0075364_101002412 | 334 |
| 929 | 3300006177 | Ga0075362_10001961 | Ga0075362_100019616 | 334 |
| 930 | 3300006177 | Ga0075362_10019594 | Ga0075362_100195942 | 334 |
| 931 | 3300006178 | Ga0075367_10005716 | Ga0075367_100057166 | 334 |
| 932 | 3300006178 | Ga0075367_10102107 | Ga0075367_101021072 | 334 |
| 933 | 3300006186 | Ga0075369_10028563 | Ga0075369_100285632 | 334 |
| 934 | 3300006186 | Ga0075369_10050476 | Ga0075369_100504762 | 334 |
| 935 | 3300006195 | Ga0075366_10002668 | Ga0075366_100026682 | 334 |
| 936 | 3300006195 | Ga0075366_10006640 | Ga0075366_100066402 | 334 |
| 937 | 3300006353 | Ga0075370_10002185 | Ga0075370_100021855 | 334 |
| 938 | 3300006353 | Ga0075370_10059760 | Ga0075370_100597601 | 334 |
| 939 | 3300006946 | Ga0079104_1002285 | Ga0079104_10022857 | 334 |
| 940 | 3300006948 | Ga0099826_10000297 | Ga0099826_1000029716 | 334 |
| 941 | 3300006948 | Ga0099826_10055416 | Ga0099826_100554162 | 334 |
| 942 | 3300009011 | Ga0105251_10022487 | Ga0105251_100224873 | 334 |
| 943 | 3300009177 | Ga0105248_10015347 | Ga0105248_100153475 | 334 |
| 944 | 3300009763 | Ga0123340_1054989 | Ga0123340_10549892 | 334 |
| 945 | 3300009763 | Ga0123340_1057935 | Ga0123340_10579351 | 334 |
| 946 | 3300009765 | Ga0123341_1000003 | Ga0123341_100000316 | 334 |
| 947 | 3300009766 | Ga0123342_1002765 | Ga0123342_100276514 | 334 |
| 948 | 3300013100 | Ga0157373_10003489 | Ga0157373_100034896 | 334 |
| 949 | 3300013102 | Ga0157371_10000304 | Ga0157371_1000030415 | 334 |
| 950 | 3300013104 | Ga0157370_10004288 | Ga0157370_1000428811 | 334 |
| 951 | 3300013249 | Ga0171463_1004 | Ga0171463_100457 | 334 |
| 952 | 3300015690 | Ga0183363_1309 | Ga0183363_13092 | 334 |
| 953 | 3300021327 | Ga0214543_1000053 | Ga0214543_100005344 | 334 |
| 954 | 3300022739 | Ga0228711_1000050 | Ga0228711_100005070 | 334 |
| 955 | 3300022740 | Ga0228710_1000063 | Ga0228710_100006370 | 334 |
| 956 | 3300025208 | Ga0209436_104609 | Ga0209436_1046093 | 334 |
| 957 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024226 | 334 |
| 958 | 3300025245 | Ga0207425_1003151 | Ga0207425_10031515 | 334 |
| 959 | 3300025245 | Ga0207425_1013444 | Ga0207425_10134442 | 334 |
| 960 | 3300025258 | Ga0209129_1000146 | Ga0209129_100014622 | 334 |
| 961 | 3300025258 | Ga0209129_1000909 | Ga0209129_100090917 | 334 |
| 962 | 3300025258 | Ga0209129_1007872 | Ga0209129_10078722 | 334 |
| 963 | 3300025273 | Ga0209673_1000020 | Ga0209673_10000202 | 334 |
| 964 | 3300025273 | Ga0209673_1000366 | Ga0209673_100036634 | 334 |
| 965 | 3300025273 | Ga0209673_1002318 | Ga0209673_100231810 | 334 |
| 966 | 3300025273 | Ga0209673_1031280 | Ga0209673_10312802 | 334 |
| 967 | 3300025284 | Ga0209130_1000027 | Ga0209130_100002756 | 334 |
| 968 | 3300025284 | Ga0209130_1014156 | Ga0209130_10141562 | 334 |
| 969 | 3300025284 | Ga0209130_1016463 | Ga0209130_10164632 | 334 |
| 970 | 3300025292 | Ga0209676_1002257 | Ga0209676_10022573 | 334 |
| 971 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050101 | 334 |
| 972 | 3300025294 | Ga0209025_1000082 | Ga0209025_1000082200 | 334 |
| 973 | 3300025294 | Ga0209025_1000245 | Ga0209025_10002455 | 334 |
| 974 | 3300025294 | Ga0209025_1000706 | Ga0209025_100070622 | 334 |
| 975 | 3300025294 | Ga0209025_1000925 | Ga0209025_10009253 | 334 |
| 976 | 3300025294 | Ga0209025_1001368 | Ga0209025_10013689 | 334 |
| 977 | 3300025294 | Ga0209025_1009241 | Ga0209025_10092415 | 334 |
| 978 | 3300025295 | Ga0209564_1000111 | Ga0209564_100011157 | 334 |
| 979 | 3300025295 | Ga0209564_1001600 | Ga0209564_10016002 | 334 |
| 980 | 3300025295 | Ga0209564_1005792 | Ga0209564_10057922 | 334 |
| 981 | 3300025295 | Ga0209564_1009918 | Ga0209564_10099184 | 334 |
| 982 | 3300025297 | Ga0209758_1000083 | Ga0209758_1000083156 | 334 |
| 983 | 3300025297 | Ga0209758_1001662 | Ga0209758_100166219 | 334 |
| 984 | 3300025297 | Ga0209758_1016587 | Ga0209758_10165873 | 334 |
| 985 | 3300025297 | Ga0209758_1033816 | Ga0209758_10338162 | 334 |
| 986 | 3300025298 | Ga0209050_1002214 | Ga0209050_100221412 | 334 |
| 987 | 3300025299 | Ga0209256_1000132 | Ga0209256_100013298 | 334 |
| 988 | 3300025299 | Ga0209256_1000923 | Ga0209256_100092335 | 334 |
| 989 | 3300025299 | Ga0209256_1001851 | Ga0209256_100185123 | 334 |
| 990 | 3300025299 | Ga0209256_1002798 | Ga0209256_10027982 | 334 |
| 991 | 3300025299 | Ga0209256_1010190 | Ga0209256_10101903 | 334 |
| 992 | 3300025302 | Ga0207426_1000072 | Ga0207426_1000072259 | 334 |
| 993 | 3300025302 | Ga0207426_1000210 | Ga0207426_100021029 | 334 |
| 994 | 3300025302 | Ga0207426_1001096 | Ga0207426_100109611 | 334 |
| 995 | 3300025303 | Ga0209051_1009843 | Ga0209051_10098431 | 334 |
| 996 | 3300025303 | Ga0209051_1011687 | Ga0209051_10116873 | 334 |
| 997 | 3300025303 | Ga0209051_1041827 | Ga0209051_10418272 | 334 |
| 998 | 3300025304 | Ga0209257_1002146 | Ga0209257_100214615 | 334 |
| 999 | 3300025935 | Ga0207709_10003829 | Ga0207709_100038298 | 334 |
| 1000 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030380 | 334 |
| 1001 | 3300027111 | Ga0209281_1000061 | Ga0209281_1000061197 | 334 |
| 1002 | 3300027111 | Ga0209281_1000821 | Ga0209281_100082118 | 334 |
| 1003 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035293 | 334 |
| 1004 | 3300027312 | Ga0209371_1003535 | Ga0209371_10035353 | 334 |
| 1005 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004380 | 334 |
| 1006 | 3300027666 | Ga0209282_1049724 | Ga0209282_10497242 | 334 |
| 1007 | 3300028379 | Ga0268266_10008895 | Ga0268266_100088955 | 334 |
| 1008 | 3300028794 | Ga0307515_10003954 | Ga0307515_100039549 | 334 |
| 1009 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037292 | 334 |
| 1010 | 3300030500 | Ga0268256_1004253 | Ga0268256_10042534 | 334 |
| 1011 | 3300031456 | Ga0307513_10014884 | Ga0307513_100148846 | 334 |
| 1012 | 3300031731 | Ga0307405_10010736 | Ga0307405_100107363 | 334 |
| 1013 | 3300031852 | Ga0307410_10102451 | Ga0307410_101024512 | 334 |
| 1014 | 3300031901 | Ga0307406_10029649 | Ga0307406_100296493 | 334 |
| 1015 | 3300031911 | Ga0307412_10002786 | Ga0307412_100027865 | 334 |
| 1016 | 3300031967 | Ga0315914_1000001 | Ga0315914_10000013 | 334 |
| 1017 | 3300033430 | Ga0315913_1000024 | Ga0315913_100002489 | 334 |
| 1018 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002381 | 334 |
| 1019 | 3300041405 | Ga0439438_020620 | Ga0439438_020620_167_1297 | 334 |
| 1020 | 3300041406 | Ga0439439_0015755 | Ga0439439_0015755_108_1238 | 334 |
| 1021 | 3300041413 | Ga0439465_0004803 | Ga0439465_0004803_2561_3691 | 334 |
| 1022 | 3300041496 | Ga0451839_0504797 | Ga0451839_0504797_2503_3573 | 334 |
| 1023 | 3300041511 | Ga0451855_0693875 | Ga0451855_0693875_34_1104 | 334 |
| 1024 | 3300041512 | Ga0451853_0143431 | Ga0451853_0143431_251_1321 | 334 |
| 1025 | 3300042007 | Ga0439449_0004313 | Ga0439449_0004313_1621_2691 | 334 |
| 1026 | 3300042007 | Ga0439449_0015111 | Ga0439449_0015111_1620_2750 | 334 |
| 1027 | 3300042145 | Ga0450906_002957 | Ga0450906_002957_559_1689 | 334 |
| 1028 | 3300042147 | Ga0450910_000972 | Ga0450910_000972_2130_3260 | 334 |
| 1029 | 3300042531 | Ga0450918_002206 | Ga0450918_002206_2487_3617 | 334 |
| 1030 | 3300044901 | Ga0466960_0176713 | Ga0466960_0176713_23_1093 | 334 |
| 1031 | 3300046454 | Ga0495592_0020759 | Ga0495592_0020759_382_1452 | 334 |
| 1032 | 3300046460 | Ga0495638_0000145 | Ga0495638_0000145_46119_47189 | 334 |
| 1033 | 3300046462 | Ga0495651_0068461 | Ga0495651_0068461_1542_2612 | 334 |
| 1034 | 3300046474 | Ga0495605_0001139 | Ga0495605_0001139_13587_14657 | 334 |
| 1035 | 3300046476 | Ga0495662_0002455 | Ga0495662_0002455_3488_4558 | 334 |
| 1036 | 3300046491 | Ga0495584_0069103 | Ga0495584_0069103_330_1400 | 334 |
| 1037 | 3300046492 | Ga0495585_0016507 | Ga0495585_0016507_2278_3348 | 334 |
| 1038 | 3300046492 | Ga0495585_0017035 | Ga0495585_0017035_630_1700 | 334 |
| 1039 | 3300046506 | Ga0495583_0034309 | Ga0495583_0034309_423_1493 | 334 |
| 1040 | 3300046507 | Ga0495606_0017418 | Ga0495606_0017418_2294_3364 | 334 |
| 1041 | 3300046507 | Ga0495606_0030920 | Ga0495606_0030920_245_1315 | 334 |
| 1042 | 3300046513 | Ga0495616_0011477 | Ga0495616_0011477_2854_3924 | 334 |
| 1043 | 3300046513 | Ga0495616_0033924 | Ga0495616_0033924_412_1482 | 334 |
| 1044 | 3300046518 | Ga0495631_0003969 | Ga0495631_0003969_347_1417 | 334 |
| 1045 | 3300046518 | Ga0495631_0020970 | Ga0495631_0020970_638_1708 | 334 |
| 1046 | 3300046519 | Ga0495632_0022987 | Ga0495632_0022987_1774_2844 | 334 |
| 1047 | 3300046522 | Ga0495643_0010731 | Ga0495643_0010731_131_1201 | 334 |
| 1048 | 3300046522 | Ga0495643_0084677 | Ga0495643_0084677_468_1538 | 334 |
| 1049 | 3300046529 | Ga0495652_0144869 | Ga0495652_0144869_566_1636 | 334 |
| 1050 | 3300046530 | Ga0495654_0000207 | Ga0495654_0000207_30056_31141 | 334 |
| 1051 | 3300046530 | Ga0495654_0025993 | Ga0495654_0025993_690_1760 | 334 |
| 1052 | 3300046558 | Ga0495633_0024113 | Ga0495633_0024113_140_1210 | 334 |
| 1053 | 3300046616 | Ga0495668_0075020 | Ga0495668_0075020_468_1538 | 334 |
| 1054 | 3300046660 | Ga0495625_0000467 | Ga0495625_0000467_33785_34855 | 334 |
| 1055 | 3300046663 | Ga0495635_0139854 | Ga0495635_0139854_330_1400 | 334 |
| 1056 | 3300046674 | Ga0495588_0019114 | Ga0495588_0019114_529_1599 | 334 |
| 1057 | 3300046675 | Ga0495657_0058076 | Ga0495657_0058076_286_1356 | 334 |
| 1058 | 3300046683 | Ga0495658_0015175 | Ga0495658_0015175_874_1944 | 334 |
| 1059 | 3300046691 | Ga0495670_0014978 | Ga0495670_0014978_1224_2294 | 334 |
| 1060 | 3300046691 | Ga0495670_0036264 | Ga0495670_0036264_20_1090 | 334 |
| 1061 | 3300046694 | Ga0495649_0020639 | Ga0495649_0020639_124_1194 | 334 |
| 1062 | 3300046809 | Ga0495600_0004371 | Ga0495600_0004371_11_1129 | 334 |
| 1063 | 3300046810 | Ga0495660_0015384 | Ga0495660_0015384_810_1880 | 334 |
| 1064 | 3300047317 | Ga0495604_0006484 | Ga0495604_0006484_4113_5183 | 334 |
| 1065 | 3300047447 | Ga0495685_023240 | Ga0495685_023240_20_1090 | 334 |
| 1066 | 3300047470 | Ga0495681_0029723 | Ga0495681_0029723_1367_2437 | 334 |
| 1067 | 3300047472 | Ga0495686_0000090 | Ga0495686_0000090_144450_145520 | 334 |
| 1068 | 3300048088 | Ga0495602_0091657 | Ga0495602_0091657_369_1439 | 334 |
| 1069 | 3300048907 | Ga0496104_0062677 | Ga0496104_0062677_1312_2382 | 334 |
| 1070 | 3300048909 | Ga0496106_0000201 | Ga0496106_0000201_37648_38718 | 334 |
| 1071 | 3300048919 | Ga0496116_0002679 | Ga0496116_0002679_15194_16264 | 334 |
| 1072 | 3300048919 | Ga0496116_0004501 | Ga0496116_0004501_1993_3063 | 334 |
| 1073 | 3300048919 | Ga0496116_0031988 | Ga0496116_0031988_2625_3695 | 334 |
| 1074 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_229095_230165 | 334 |
| 1075 | 3300048920 | Ga0496117_0046827 | Ga0496117_0046827_654_1724 | 334 |
| 1076 | 3300048920 | Ga0496117_0085888 | Ga0496117_0085888_384_1454 | 334 |
| 1077 | 3300048921 | Ga0496118_0002033 | Ga0496118_0002033_15557_16627 | 334 |
| 1078 | 3300048921 | Ga0496118_0017654 | Ga0496118_0017654_4542_5612 | 334 |
| 1079 | 3300048922 | Ga0496119_0019076 | Ga0496119_0019076_1508_2578 | 334 |
| 1080 | 3300048922 | Ga0496119_0058919 | Ga0496119_0058919_884_1954 | 334 |
| 1081 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_208830_209900 | 334 |
| 1082 | 3300048924 | Ga0496121_0002933 | Ga0496121_0002933_19579_20664 | 334 |
| 1083 | 3300048924 | Ga0496121_0080991 | Ga0496121_0080991_598_1668 | 334 |
| 1084 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_208830_209900 | 334 |
| 1085 | 3300048925 | Ga0496122_0018212 | Ga0496122_0018212_32_1102 | 334 |
| 1086 | 3300048925 | Ga0496122_0057615 | Ga0496122_0057615_1153_2223 | 334 |
| 1087 | 3300048925 | Ga0496122_0081348 | Ga0496122_0081348_1154_2224 | 334 |
| 1088 | 3300048925 | Ga0496122_0088970 | Ga0496122_0088970_149_1219 | 334 |
| 1089 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_208830_209900 | 334 |
| 1090 | 3300048926 | Ga0496123_0000519 | Ga0496123_0000519_63235_64305 | 334 |
| 1091 | 3300048926 | Ga0496123_0018674 | Ga0496123_0018674_3259_4329 | 334 |
| 1092 | 3300048927 | Ga0496124_0000483 | Ga0496124_0000483_58225_59295 | 334 |
| 1093 | 3300048927 | Ga0496124_0019573 | Ga0496124_0019573_4131_5201 | 334 |
| 1094 | 3300048927 | Ga0496124_0034429 | Ga0496124_0034429_3328_4398 | 334 |
| 1095 | 3300048927 | Ga0496124_0047109 | Ga0496124_0047109_1788_2858 | 334 |
| 1096 | 3300048927 | Ga0496124_0120775 | Ga0496124_0120775_809_1879 | 334 |
| 1097 | 3300048928 | Ga0496125_0000790 | Ga0496125_0000790_49254_50324 | 334 |
| 1098 | 3300048928 | Ga0496125_0024340 | Ga0496125_0024340_636_1706 | 334 |
| 1099 | 3300048928 | Ga0496125_0086139 | Ga0496125_0086139_418_1488 | 334 |
| 1100 | 3300048928 | Ga0496125_0120740 | Ga0496125_0120740_25_1095 | 334 |
| 1101 | 3300048929 | Ga0496126_0000466 | Ga0496126_0000466_77938_79008 | 334 |
| 1102 | 3300049568 | Ga0501031_0034233 | Ga0501031_0034233_514_1584 | 334 |
| 1103 | 3300049568 | Ga0501031_0174430 | Ga0501031_0174430_84_1154 | 334 |
| 1104 | 3300049569 | Ga0501032_0003253 | Ga0501032_0003253_8325_9407 | 334 |
| 1105 | 3300049569 | Ga0501032_0029214 | Ga0501032_0029214_1340_2410 | 334 |
| 1106 | 3300049570 | Ga0501033_0000380 | Ga0501033_0000380_11324_12394 | 334 |
| 1107 | 3300049572 | Ga0501036_0108528 | Ga0501036_0108528_464_1534 | 334 |
| 1108 | 3300049573 | Ga0501037_0101320 | Ga0501037_0101320_393_1463 | 334 |
| 1109 | 3300049573 | Ga0501037_0167086 | Ga0501037_0167086_223_1293 | 334 |
| 1110 | 3300049574 | Ga0501038_0097541 | Ga0501038_0097541_605_1675 | 334 |
| 1111 | 3300049579 | Ga0501043_0038036 | Ga0501043_0038036_1525_2607 | 334 |
| 1112 | 3300049583 | Ga0501067_0000134 | Ga0501067_0000134_27535_28617 | 334 |
| 1113 | 3300049589 | Ga0501073_0000003 | Ga0501073_0000003_244184_245266 | 334 |
| 1114 | 3300049593 | Ga0501077_0000001 | Ga0501077_0000001_211036_212118 | 334 |
| 1115 | 3300049742 | Ga0501080_0072609 | Ga0501080_0072609_271_1353 | 334 |
| 1116 | 3300049744 | Ga0501083_0171561 | Ga0501083_0171561_83_1165 | 334 |
| 1117 | 3300049822 | Ga0501035_0003046 | Ga0501035_0003046_3570_4640 | 334 |
| 1118 | 3300049823 | Ga0501044_0020484 | Ga0501044_0020484_4628_5698 | 334 |
| 1119 | 3300049823 | Ga0501044_0045301 | Ga0501044_0045301_2463_3545 | 334 |
| 1120 | 3300049824 | Ga0501045_0190459 | Ga0501045_0190459_223_1293 | 334 |
| 1121 | 3300050489 | nmdc:mga03683_33530_c1 | nmdc:mga03683_33530_c1_222_1292 | 334 |
| 1122 | 3300050489 | nmdc:mga03683_3490_c1 | nmdc:mga03683_3490_c1_863_1933 | 334 |
| 1123 | 3300050491 | nmdc:mga00v17_11_c1 | nmdc:mga00v17_11_c1_94752_95822 | 334 |
| 1124 | 3300050492 | nmdc:mga0yw44_4747_c1 | nmdc:mga0yw44_4747_c1_60_1130 | 334 |
| 1125 | 3300050492 | nmdc:mga0yw44_65_c1 | nmdc:mga0yw44_65_c1_6534_7604 | 334 |
| 1126 | 3300050493 | nmdc:mga0k408_29501_c1 | nmdc:mga0k408_29501_c1_870_1940 | 334 |
| 1127 | 3300050495 | nmdc:mga04h51_25469_c1 | nmdc:mga04h51_25469_c1_82_1152 | 334 |
| 1128 | 3300050516 | nmdc:mga0sz30_1795_c1 | nmdc:mga0sz30_1795_c1_5335_6405 | 334 |
| 1129 | 3300050516 | nmdc:mga0sz30_55436_c1 | nmdc:mga0sz30_55436_c1_527_1597 | 334 |
| 1130 | 3300053086 | Ga0500578_0016118 | Ga0500578_0016118_1892_2962 | 334 |
| 1131 | 3300053088 | Ga0500644_0066779 | Ga0500644_0066779_180_1253 | 334 |
| 1132 | 3300053118 | Ga0500594_0000508 | Ga0500594_0000508_4216_5286 | 334 |
| 1133 | 3300053123 | Ga0500614_024328 | Ga0500614_024328_255_1325 | 334 |
| 1134 | 3300053125 | Ga0500618_000025 | Ga0500618_000025_63530_64615 | 334 |
| 1135 | 3300053134 | Ga0500658_0000451 | Ga0500658_0000451_3929_4999 | 334 |
| 1136 | 3300053134 | Ga0500658_0016024 | Ga0500658_0016024_392_1462 | 334 |
| 1137 | 3300053134 | Ga0500658_0023525 | Ga0500658_0023525_854_1924 | 334 |
| 1138 | 3300053137 | Ga0500561_0000154 | Ga0500561_0000154_9200_10270 | 334 |
| 1139 | 3300053139 | Ga0500568_0000184 | Ga0500568_0000184_7685_8755 | 334 |
| 1140 | 3300053139 | Ga0500568_0015352 | Ga0500568_0015352_652_1722 | 334 |
| 1141 | 3300053148 | Ga0500590_000090 | Ga0500590_000090_678_1748 | 334 |
| 1142 | 3300053153 | Ga0500616_0002258 | Ga0500616_0002258_14133_15203 | 334 |
| 1143 | 3300053153 | Ga0500616_0008839 | Ga0500616_0008839_1383_2453 | 334 |
| 1144 | 3300053156 | Ga0500622_0000647 | Ga0500622_0000647_28412_29482 | 334 |
| 1145 | 3300053156 | Ga0500622_0001402 | Ga0500622_0001402_7692_8765 | 334 |
| 1146 | 3300053157 | Ga0500624_000584 | Ga0500624_000584_1554_2624 | 334 |
| 1147 | 3300053158 | Ga0500627_0048421 | Ga0500627_0048421_464_1534 | 334 |
| 1148 | 3300053177 | Ga0500636_0000009 | Ga0500636_0000009_134352_135422 | 334 |
| 1149 | 3300053177 | Ga0500636_0078327 | Ga0500636_0078327_27_1097 | 334 |
| 1150 | 3300060353 | Ga0501082_0117029 | Ga0501082_0117029_846_1928 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9093 | 4 | 231 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9073 | 4 | 232 |
| 8g3l-assembly1.cif.gz_B | bceab-s nucleotide free bces state 2 | 0.9038 | 4 | 224 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9035 | 4 | 240 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9003 | 3 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9665 | 3 | 223 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9533 | 3 | 223 | 3.40.50.300 |
| af_P14175_33_289_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9405 | 24 | 240 | 3.40.50.300 |
| af_P31548_12_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9354 | 32 | 228 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9319 | 4 | 242 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530ND77-F1-model_v4 | deleted | 0.9658 | 4 | 136 |
|
| AF-A0A530ND77-F1-model_v4 | deleted | 0.9512 | 4 | 136 |
|
| AF-A0A1V4RJG8-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.935 | 1 | 153 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A3D0PSJ0-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9344 | 1 | 147 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A418QIC2-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9335 | 4 | 135 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar