F490752

General Info

Members Datasets Scaffolds Average Seq Length
1144 590 883 246

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10076055|Ga0105244_100760552
Length 272
Sequence MRLDAGASPIPLKGKHMEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPRTRIFGLALAMVTRIMLLLSITWVMRLTDDLFVVLGQGISGRDLILFFGGLFLLWKSSQEIYHGLEGEEENADEPKGSGGKFLYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIIVAVLVMMACAGTIADFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFAMAFSLAVEAINIRMRTSLARKAGKEHEAVKLRKDVPGQ

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231024 Pseudomonas sp. GM84 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
64 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
65 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
66 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
67 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
68 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
69 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
70 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
71 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
72 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
73 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
74 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
75 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
76 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
77 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
78 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
79 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
80 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
81 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
82 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
83 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
84 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
85 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
86 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
87 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
88 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
89 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
90 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
91 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
92 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
93 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
94 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
95 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
96 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
97 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
98 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
99 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
100 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
101 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
102 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
103 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
104 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
105 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
106 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
107 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
108 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
109 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
110 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
111 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
112 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
113 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
114 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
115 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
116 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
117 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
118 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
119 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
120 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
121 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
122 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
123 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
124 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
125 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
126 2765235841 Pseudomonas putida AA7 Isolate Unclassified
127 2773857670 Pseudomonas sp. 478 Isolate Unclassified
128 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
129 2773857673 Pseudomonas sp. 443 Isolate Unclassified
130 2784132063 Pseudomonas sp. 424 Isolate Unclassified
131 2784132072 Pseudomonas sp. 460 Isolate Unclassified
132 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
133 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
134 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
135 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
136 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
137 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
138 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
139 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
140 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
141 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
142 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
143 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
144 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
145 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
146 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
147 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
148 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
149 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
150 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
151 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
152 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
153 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
154 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
155 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
156 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
157 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
158 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
159 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
160 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
161 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
162 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
163 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
164 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
165 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
166 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
167 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
168 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
169 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
170 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
171 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
172 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
173 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
174 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
175 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
176 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
177 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
178 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
179 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
180 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
181 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
182 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
183 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
184 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
185 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
186 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
187 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
188 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
189 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
190 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
191 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
192 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
193 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
194 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
195 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
196 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
197 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
198 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
199 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
200 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
201 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
202 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
203 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
204 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
205 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
206 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
207 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
208 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
209 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
210 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
211 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
212 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
213 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
214 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
215 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
216 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
217 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
218 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
219 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
220 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
221 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
222 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
223 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
224 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
225 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
226 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
227 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
228 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
229 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
230 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
231 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
232 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
233 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
234 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
235 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
236 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
237 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
238 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
239 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
240 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
241 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
242 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
243 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
244 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
245 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
246 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
247 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
248 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
249 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
250 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
251 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
252 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
253 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
254 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
255 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
256 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
257 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
258 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
259 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
260 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
261 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
262 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
263 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
264 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
265 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
266 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
267 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
268 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
269 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
270 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
271 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
272 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
273 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
274 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
275 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
276 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
277 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
278 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
279 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
280 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
281 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
282 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
283 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
284 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
285 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
286 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
287 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
288 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
289 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
290 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
291 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
292 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
293 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
294 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
295 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
296 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
297 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
298 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
299 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
300 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
301 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
302 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
303 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
304 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
305 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
306 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
307 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
308 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
309 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
310 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
311 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
312 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
313 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
314 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
315 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
316 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
317 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
318 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
319 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
320 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
321 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
322 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
323 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
324 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
325 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
326 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
327 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
328 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
335 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
337 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
338 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
340 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
341 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
342 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
381 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
382 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
383 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
389 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
391 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
395 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
396 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
397 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
398 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
399 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
400 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
401 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
402 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
403 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
404 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
405 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
406 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
407 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
408 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
409 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
410 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
411 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
412 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
413 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
414 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
415 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
416 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
417 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
418 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
419 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
420 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
421 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
422 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
423 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
424 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
425 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
426 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
427 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
428 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
429 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
430 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
431 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
432 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
433 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
434 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
435 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
436 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
437 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
438 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
439 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
440 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
441 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
442 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
443 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
444 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
445 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
446 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
447 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
448 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
449 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
450 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
451 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
452 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
453 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
454 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
455 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
456 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
457 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
458 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
459 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
460 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
461 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
462 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
465 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
466 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
467 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
468 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
472 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
473 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
474 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
475 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
476 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
477 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
478 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
479 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
480 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
481 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
482 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
483 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
484 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
485 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
486 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
487 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
488 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
489 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
490 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
491 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
492 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
493 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
494 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
495 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
496 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
497 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
498 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
499 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
500 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
501 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
502 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
503 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
504 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
505 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
506 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
507 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
508 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
509 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
510 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
511 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
512 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
513 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
514 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
515 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
516 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
517 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
518 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
519 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
520 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
521 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
522 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
523 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
524 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
525 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
526 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
527 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
528 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
529 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
530 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
531 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
532 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
533 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
534 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
535 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
536 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
537 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
538 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
539 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
540 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
541 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
542 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
543 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
544 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
545 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
547 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
549 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
553 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
555 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
556 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
557 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
558 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
559 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
560 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
561 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
562 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
563 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
564 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
565 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
566 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
567 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
568 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
569 8052494512 Pseudomonas putida LD6 Isolate Unclassified
570 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
571 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
572 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
573 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
574 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
575 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
576 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
577 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
578 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
579 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
580 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
581 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
582 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
583 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
584 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
585 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
586 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
587 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
588 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
589 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
590 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.19
Metatranscriptomes 0
Isolates 22.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 6.47
Nodule 2.62
Rhizoplane 6.73
Rhizosphere 70.89
Stem 0
Stem Tuber 0
Unclassified 13.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6737 2124908027 Bacteria 2198
2 MRS2a_Contig_799 2124908027 Bacteria 11033
3 SwRhRL2b_contig_803191 2162886007 Bacteria 11283
4 JGI24741J21665_1000755 3300001915 Bacteria 9721
5 JGI24750J21931_1025787 3300002070 Bacteria 844
6 JGI25155J39150_1000041 3300002704 Bacteria 88843
7 JGI25156J39149_1000031 3300002705 Bacteria 124983
8 JGI25162J39368_1000208 3300002737 Bacteria 62041
9 JGI25162J39368_1000459 3300002737 Bacteria 31876
10 JGI25154J39366_1000049 3300002738 Bacteria 124995
11 JGI25157J39369_1000041 3300002741 Bacteria 124982
12 JGI25163J39215_1000407 3300002771 Bacteria 13526
13 JGI25163J39215_1000589 3300002771 Bacteria 10199
14 JGI25164J39214_1000297 3300002772 Bacteria 34174
15 JGI25164J39214_1000314 3300002772 Bacteria 31880
16 JGI25165J46597_1000175 3300003214 Bacteria 100117
17 JGI25165J46597_1000193 3300003214 Bacteria 91069
18 rootH1_10017529 3300003316 Bacteria 6372
19 rootH2_10016165 3300003320 Bacteria 8851
20 rootL2_10030466 3300003322 Bacteria 6394
21 rootL2_10110202 3300003322 Bacteria 2659
22 Ga0055538_1000012 3300003751 Bacteria 353826
23 Ga0055539_1000017 3300003752 Bacteria 353873
24 Ga0055533_1000021 3300003756 Bacteria 353826
25 Ga0055532_1000020 3300003758 Bacteria 270853
26 Ga0055525_1000117 3300003759 Bacteria 120690
27 Ga0055535_1004800 3300003761 Bacteria 3160
28 Ga0055536_1000272 3300003781 Bacteria 39323
29 Ga0055536_1003957 3300003781 Bacteria 7765
30 Ga0055536_1008918 3300003781 Bacteria 4233
31 Ga0055536_1029466 3300003781 Bacteria 1474
32 Ga0055530_10000081 3300003791 Bacteria 82192
33 Ga0055530_10000548 3300003791 Bacteria 32545
34 Ga0055530_10002934 3300003791 Bacteria 10326
35 Ga0055530_10009440 3300003791 Bacteria 3748
36 Ga0055540_1000121 3300003792 Bacteria 82192
37 Ga0055540_1000242 3300003792 Bacteria 49989
38 Ga0055540_1001116 3300003792 Bacteria 16913
39 Ga0055540_1032823 3300003792 Bacteria 1181
40 Ga0055531_10001033 3300003794 Bacteria 22056
41 Ga0055541_1000012 3300003841 Bacteria 353826
42 Ga0058692_1008307 3300003856 Bacteria 2683
43 Ga0065714_10002860 3300005288 Bacteria 11454
44 Ga0065714_10003342 3300005288 Bacteria 7781
45 Ga0065714_10005964 3300005288 Bacteria 4038
46 Ga0065714_10021354 3300005288 Bacteria 2008
47 Ga0065714_10064636 3300005288 Bacteria 26785
48 Ga0065714_10107372 3300005288 Bacteria 1532
49 Ga0065704_10001959 3300005289 Bacteria 9751
50 Ga0065704_10009110 3300005289 Bacteria 5158
51 Ga0065704_10070543 3300005289 Bacteria 21104
52 Ga0065704_10071119 3300005289 Bacteria 13035
53 Ga0065704_10121284 3300005289 Bacteria 1768
54 Ga0065712_10001109 3300005290 Bacteria 11350
55 Ga0065712_10068500 3300005290 Bacteria 10228
56 Ga0065712_10074016 3300005290 Bacteria 4210
57 Ga0065715_10013766 3300005293 Bacteria 3460
58 Ga0070670_100000010 3300005331 Bacteria 277365
59 Ga0070670_100003035 3300005331 Bacteria 13890
60 Ga0068869_100084556 3300005334 Bacteria 2375
61 Ga0070691_10142847 3300005341 Bacteria 1221
62 Ga0070661_100000237 3300005344 Bacteria 45515
63 Ga0070661_100293685 3300005344 Bacteria 1264
64 Ga0070669_100000158 3300005353 Bacteria 61318
65 Ga0070669_100000277 3300005353 Bacteria 41213
66 Ga0070669_100002451 3300005353 Bacteria 13426
67 Ga0070669_100035538 3300005353 Bacteria 3611
68 Ga0070675_100017974 3300005354 Bacteria 5627
69 Ga0070671_100000012 3300005355 Bacteria 196420
70 Ga0070674_100037246 3300005356 Bacteria 3270
71 Ga0070688_100002333 3300005365 Bacteria 9573
72 Ga0070659_100407812 3300005366 Bacteria 1148
73 Ga0070667_100000097 3300005367 Bacteria 108709
74 Ga0070700_100014372 3300005441 Bacteria 4469
75 Ga0070700_100062768 3300005441 Bacteria 2348
76 Ga0070662_100000063 3300005457 Bacteria 57210
77 Ga0070662_100087854 3300005457 Bacteria 2328
78 Ga0068867_100000146 3300005459 Bacteria 45501
79 Ga0070685_10000077 3300005466 Bacteria 58856
80 Ga0070697_100147240 3300005536 Bacteria 1983
81 Ga0068853_100000143 3300005539 Bacteria 48815
82 Ga0070672_100398226 3300005543 Bacteria 1180
83 Ga0070686_100158990 3300005544 Bacteria 1590
84 Ga0070665_100078702 3300005548 Bacteria 3303
85 Ga0070665_100089367 3300005548 Bacteria 3086
86 Ga0070665_100509061 3300005548 Bacteria 1215
87 Ga0068857_100627854 3300005577 Bacteria 1017
88 Ga0068854_100004725 3300005578 Bacteria 8585
89 Ga0068852_100187387 3300005616 Bacteria 1949
90 Ga0068859_100014469 3300005617 Bacteria 7920
91 Ga0068859_100404284 3300005617 Bacteria 1461
92 Ga0068864_100000018 3300005618 Bacteria 277365
93 Ga0068861_100001394 3300005719 Bacteria 15177
94 Ga0068861_100059167 3300005719 Bacteria 2932
95 Ga0068861_100188902 3300005719 Bacteria 1721
96 Ga0068851_10000018 3300005834 Bacteria 137425
97 Ga0068863_100162161 3300005841 Bacteria 2142
98 Ga0068863_100263895 3300005841 Bacteria 1665
99 Ga0068858_100024458 3300005842 Bacteria 5627
100 Ga0068858_100155276 3300005842 Bacteria 2153
101 Ga0068860_100000532 3300005843 Bacteria 46509
102 Ga0068862_100000522 3300005844 Bacteria 40581
103 Ga0068862_100136925 3300005844 Bacteria 2171
104 Ga0075364_10031476 3300006051 Bacteria 3409
105 Ga0075364_10113138 3300006051 Bacteria 1812
106 Ga0075432_10000648 3300006058 Bacteria 10657
107 Ga0070712_100201381 3300006175 Bacteria 1564
108 Ga0075362_10066213 3300006177 Bacteria 1641
109 Ga0075362_10072007 3300006177 Bacteria 1580
110 Ga0075369_10045588 3300006186 Bacteria 1885
111 Ga0097621_100081003 3300006237 Bacteria 2701
112 Ga0068871_100141867 3300006358 Bacteria 2043
113 Ga0075428_100214665 3300006844 Bacteria 2079
114 Ga0068865_100003939 3300006881 Bacteria 8916
115 Ga0075436_100050318 3300006914 Bacteria 2875
116 Ga0097620_100014468 3300006931 Bacteria 7920
117 Ga0097620_100404267 3300006931 Bacteria 1461
118 Ga0099823_1000217 3300006944 Bacteria 32286
119 Ga0079104_1000291 3300006946 Bacteria 63569
120 Ga0079104_1000306 3300006946 Bacteria 62131
121 Ga0099826_10012980 3300006948 Bacteria 6281
122 Ga0105251_10000068 3300009011 Bacteria 98955
123 Ga0105251_10000881 3300009011 Bacteria 26861
124 Ga0105251_10002062 3300009011 Bacteria 16229
125 Ga0105251_10004312 3300009011 Bacteria 9752
126 Ga0105251_10007262 3300009011 Bacteria 6870
127 Ga0105251_10071828 3300009011 Bacteria 1610
128 Ga0105244_10000726 3300009036 Bacteria 28455
129 Ga0105244_10001163 3300009036 Bacteria 21788
130 Ga0105244_10001870 3300009036 Bacteria 16359
131 Ga0105244_10004378 3300009036 Bacteria 9736
132 Ga0105244_10005309 3300009036 Bacteria 8578
133 Ga0105244_10007469 3300009036 Bacteria 6945
134 Ga0105244_10011847 3300009036 Bacteria 5197
135 Ga0105244_10030106 3300009036 Bacteria 2891
136 Ga0105244_10030745 3300009036 Bacteria 2854
137 Ga0105244_10072164 3300009036 Bacteria 1720
138 Ga0105244_10076055 3300009036 Bacteria 1668
139 Ga0105244_10132417 3300009036 Bacteria 1203
140 Ga0105250_10000825 3300009092 Bacteria 18449
141 Ga0105250_10022663 3300009092 Bacteria 2530
142 Ga0105250_10023442 3300009092 Bacteria 2486
143 Ga0105250_10031572 3300009092 Bacteria 2126
144 Ga0105250_10037205 3300009092 Bacteria 1953
145 Ga0105250_10038529 3300009092 Bacteria 1916
146 Ga0105250_10056987 3300009092 Bacteria 1568
147 Ga0111539_10096618 3300009094 Bacteria 3470
148 Ga0111539_10935004 3300009094 Bacteria 1008
149 Ga0114129_10289749 3300009147 Bacteria 2185
150 Ga0105243_10000075 3300009148 Bacteria 112098
151 Ga0105243_10000867 3300009148 Bacteria 28621
152 Ga0105243_10001447 3300009148 Bacteria 20865
153 Ga0105243_10010141 3300009148 Bacteria 7164
154 Ga0105243_10097512 3300009148 Bacteria 2433
155 Ga0105241_10398380 3300009174 Bacteria 1207
156 Ga0105242_10000358 3300009176 Bacteria 36515
157 Ga0105242_10090188 3300009176 Bacteria 2578
158 Ga0105242_10214496 3300009176 Bacteria 1717
159 Ga0105248_10019408 3300009177 Bacteria 7522
160 Ga0105248_10123998 3300009177 Bacteria 2914
161 Ga0105249_10093807 3300009553 Bacteria 2812
162 Ga0105249_10152357 3300009553 Bacteria 2227
163 Ga0105239_10087107 3300010375 Bacteria 3442
164 Ga0105246_10000002 3300011119 Bacteria 103711
165 Ga0105246_10000504 3300011119 Bacteria 21247
166 Ga0105246_10010894 3300011119 Bacteria 5636
167 Ga0157373_10003814 3300013100 Bacteria 11399
168 Ga0157373_10006597 3300013100 Bacteria 8656
169 Ga0157373_10023762 3300013100 Bacteria 4441
170 Ga0157373_10051866 3300013100 Bacteria 2920
171 Ga0157373_10094446 3300013100 Bacteria 2106
172 Ga0157371_10000935 3300013102 Bacteria 32661
173 Ga0157371_10000953 3300013102 Bacteria 32196
174 Ga0157371_10002539 3300013102 Bacteria 17337
175 Ga0157371_10076619 3300013102 Bacteria 2368
176 Ga0157370_10000698 3300013104 Bacteria 41998
177 Ga0157370_10000954 3300013104 Bacteria 36668
178 Ga0157370_10002312 3300013104 Bacteria 23072
179 Ga0157370_10186706 3300013104 Bacteria 1924
180 Ga0157369_10023081 3300013105 Bacteria 6932
181 Ga0157369_10521216 3300013105 Bacteria 1229
182 Ga0157378_10002415 3300013297 Bacteria 16605
183 Ga0157378_10024025 3300013297 Bacteria 5362
184 Ga0163162_10017052 3300013306 Bacteria 7106
185 Ga0163162_10079724 3300013306 Bacteria 3340
186 Ga0163162_10224194 3300013306 Bacteria 2009
187 Ga0157372_10013753 3300013307 Bacteria 8648
188 Ga0157372_10052807 3300013307 Bacteria 4527
189 Ga0163163_10001112 3300014325 Bacteria 22859
190 Ga0163163_10101543 3300014325 Bacteria 2899
191 Ga0157380_10272904 3300014326 Bacteria 1543
192 Ga0182008_10001337 3300014497 Bacteria 16791
193 Ga0182008_10003405 3300014497 Bacteria 9609
194 Ga0157379_10054053 3300014968 Bacteria 3588
195 Ga0157376_10100048 3300014969 Bacteria 2531
196 Ga0157376_10136874 3300014969 Bacteria 2193
197 Ga0182006_1001380 3300015261 Bacteria 14787
198 Ga0182006_1002154 3300015261 Bacteria 10922
199 Ga0182006_1003537 3300015261 Bacteria 7969
200 Ga0182006_1008824 3300015261 Bacteria 4554
201 Ga0182007_10000228 3300015262 Bacteria 37784
202 Ga0182005_1000375 3300015265 Bacteria 24704
203 Ga0182005_1000663 3300015265 Bacteria 16296
204 Ga0182005_1018031 3300015265 Bacteria 1952
205 Ga0163161_10050909 3300017792 Bacteria 2998
206 Ga0163161_10097813 3300017792 Bacteria 2180
207 Ga0163161_10173254 3300017792 Bacteria 1651
208 Ga0163161_10287792 3300017792 Bacteria 1291
209 Ga0163161_10339170 3300017792 Bacteria 1192
210 Ga0213876_10008910 3300021384 Bacteria 5412
211 Ga0209435_100014 3300025206 Bacteria 322129
212 Ga0209435_100533 3300025206 Bacteria 7315
213 Ga0209760_100082 3300025207 Bacteria 76168
214 Ga0209760_100230 3300025207 Bacteria 23968
215 Ga0209784_100007 3300025224 Bacteria 747715
216 Ga0209566_100009 3300025225 Bacteria 554018
217 Ga0209674_100021 3300025226 Bacteria 629811
218 Ga0209147_100009 3300025229 Bacteria 747409
219 Ga0209563_100018 3300025230 Bacteria 747850
220 Ga0209563_101660 3300025230 Bacteria 5677
221 Ga0207427_100005 3300025231 Bacteria 797999
222 Ga0207427_100006 3300025231 Bacteria 785415
223 Ga0209437_100013 3300025233 Bacteria 785457
224 Ga0209437_100018 3300025233 Bacteria 694400
225 Ga0209437_109161 3300025233 Bacteria 1556
226 Ga0209258_100237 3300025242 Bacteria 102220
227 Ga0209646_1000001 3300025246 Bacteria 3092932
228 Ga0209646_1000277 3300025246 Bacteria 45368
229 Ga0209026_1000073 3300025250 Bacteria 205399
230 Ga0209677_100012 3300025253 Bacteria 554018
231 Ga0209759_1000013 3300025256 Bacteria 399300
232 Ga0209759_1007431 3300025256 Bacteria 3523
233 Ga0209759_1018453 3300025256 Bacteria 1684
234 Ga0209233_1000021 3300025261 Bacteria 798078
235 Ga0209233_1000022 3300025261 Bacteria 785415
236 Ga0209676_1000015 3300025292 Bacteria 784458
237 Ga0209676_1000157 3300025292 Bacteria 163094
238 Ga0209676_1000222 3300025292 Bacteria 124695
239 Ga0209676_1000583 3300025292 Bacteria 54696
240 Ga0209676_1002274 3300025292 Bacteria 14109
241 Ga0209676_1002823 3300025292 Bacteria 11488
242 Ga0209676_1004012 3300025292 Bacteria 8476
243 Ga0209050_1000030 3300025298 Bacteria 463381
244 Ga0209050_1000061 3300025298 Bacteria 321435
245 Ga0209050_1000296 3300025298 Bacteria 104732
246 Ga0209050_1000318 3300025298 Bacteria 97317
247 Ga0209050_1001114 3300025298 Bacteria 32494
248 Ga0209051_1000088 3300025303 Bacteria 180480
249 Ga0209051_1000143 3300025303 Bacteria 135182
250 Ga0209051_1000295 3300025303 Bacteria 79621
251 Ga0209051_1004120 3300025303 Bacteria 9105
252 Ga0209051_1005691 3300025303 Bacteria 7196
253 Ga0209257_1000143 3300025304 Bacteria 199975
254 Ga0209257_1011914 3300025304 Bacteria 4103
255 Ga0207656_10000009 3300025321 Bacteria 245637
256 Ga0207696_1000055 3300025711 Bacteria 258289
257 Ga0207696_1000151 3300025711 Bacteria 120171
258 Ga0207696_1000165 3300025711 Bacteria 104683
259 Ga0207696_1003300 3300025711 Bacteria 7439
260 Ga0207696_1007367 3300025711 Bacteria 4315
261 Ga0207696_1015831 3300025711 Bacteria 2543
262 Ga0207696_1024677 3300025711 Bacteria 1882
263 Ga0207696_1028968 3300025711 Bacteria 1694
264 Ga0207655_1000135 3300025728 Bacteria 143597
265 Ga0207655_1000548 3300025728 Bacteria 47302
266 Ga0207655_1000667 3300025728 Bacteria 40487
267 Ga0207655_1000754 3300025728 Bacteria 36294
268 Ga0207655_1001254 3300025728 Bacteria 24214
269 Ga0207655_1001422 3300025728 Bacteria 22200
270 Ga0207655_1001733 3300025728 Bacteria 19145
271 Ga0207655_1002247 3300025728 Bacteria 15981
272 Ga0207655_1004181 3300025728 Bacteria 10359
273 Ga0207655_1004957 3300025728 Bacteria 9227
274 Ga0207655_1006266 3300025728 Bacteria 7910
275 Ga0207655_1008704 3300025728 Bacteria 6400
276 Ga0207655_1008902 3300025728 Bacteria 6305
277 Ga0207655_1009242 3300025728 Bacteria 6146
278 Ga0207655_1018736 3300025728 Bacteria 3655
279 Ga0207655_1026577 3300025728 Bacteria 2777
280 Ga0207655_1036871 3300025728 Bacteria 2162
281 Ga0207655_1038021 3300025728 Bacteria 2110
282 Ga0207655_1087014 3300025728 Bacteria 1110
283 Ga0207713_1000103 3300025735 Bacteria 138415
284 Ga0207713_1000325 3300025735 Bacteria 53895
285 Ga0207713_1003599 3300025735 Bacteria 10444
286 Ga0207713_1003772 3300025735 Bacteria 10160
287 Ga0207713_1004686 3300025735 Bacteria 8816
288 Ga0207713_1006272 3300025735 Bacteria 7272
289 Ga0207713_1006916 3300025735 Bacteria 6813
290 Ga0207713_1010743 3300025735 Bacteria 5043
291 Ga0207713_1016458 3300025735 Bacteria 3751
292 Ga0207713_1020322 3300025735 Bacteria 3221
293 Ga0207713_1022973 3300025735 Bacteria 2947
294 Ga0207713_1041073 3300025735 Bacteria 1933
295 Ga0207713_1048900 3300025735 Bacteria 1700
296 Ga0207713_1050375 3300025735 Bacteria 1663
297 Ga0207710_10008242 3300025900 Bacteria 4400
298 Ga0207671_10000876 3300025914 Bacteria 38121
299 Ga0207693_10121721 3300025915 Bacteria 2049
300 Ga0207662_10236760 3300025918 Bacteria 1194
301 Ga0207649_10000007 3300025920 Bacteria 334217
302 Ga0207681_10000291 3300025923 Bacteria 37201
303 Ga0207681_10006732 3300025923 Bacteria 7052
304 Ga0207650_10000003 3300025925 Bacteria 1123235
305 Ga0207650_10000308 3300025925 Bacteria 48275
306 Ga0207650_10000407 3300025925 Bacteria 38580
307 Ga0207659_10033931 3300025926 Bacteria 3516
308 Ga0207644_10001111 3300025931 Bacteria 17279
309 Ga0207690_10391921 3300025932 Bacteria 1106
310 Ga0207706_10000050 3300025933 Bacteria 116811
311 Ga0207706_10011123 3300025933 Bacteria 8201
312 Ga0207686_10001347 3300025934 Bacteria 13985
313 Ga0207686_10388387 3300025934 Bacteria 1060
314 Ga0207709_10000107 3300025935 Bacteria 129240
315 Ga0207709_10001047 3300025935 Bacteria 20429
316 Ga0207709_10002479 3300025935 Bacteria 11568
317 Ga0207709_10009947 3300025935 Bacteria 5238
318 Ga0207709_10066438 3300025935 Bacteria 2271
319 Ga0207709_10136564 3300025935 Bacteria 1680
320 Ga0207709_10544924 3300025935 Bacteria 912
321 Ga0207670_10171133 3300025936 Bacteria 1629
322 Ga0207670_10507585 3300025936 Bacteria 980
323 Ga0207669_10062361 3300025937 Bacteria 2296
324 Ga0207704_10066450 3300025938 Bacteria 2263
325 Ga0207691_10114481 3300025940 Bacteria 2396
326 Ga0207711_10002049 3300025941 Bacteria 18226
327 Ga0207711_10013160 3300025941 Bacteria 6872
328 Ga0207711_10391003 3300025941 Bacteria 1291
329 Ga0207689_10150576 3300025942 Bacteria 1918
330 Ga0207679_10000013 3300025945 Bacteria 334197
331 Ga0207712_10009817 3300025961 Bacteria 6065
332 Ga0207712_10025348 3300025961 Bacteria 3939
333 Ga0207712_10033258 3300025961 Bacteria 3484
334 Ga0207640_10008153 3300025981 Bacteria 5804
335 Ga0207658_10000007 3300025986 Bacteria 329651
336 Ga0207639_10000079 3300026041 Bacteria 83859
337 Ga0207678_10710562 3300026067 Bacteria 885
338 Ga0207708_10006713 3300026075 Bacteria 8513
339 Ga0207708_10023107 3300026075 Bacteria 4697
340 Ga0207641_10094982 3300026088 Bacteria 2615
341 Ga0207648_10000425 3300026089 Bacteria 46432
342 Ga0207648_10045457 3300026089 Bacteria 3851
343 Ga0207676_10000003 3300026095 Bacteria 1123235
344 Ga0207676_10186858 3300026095 Bacteria 1820
345 Ga0207675_100007239 3300026118 Bacteria 10486
346 Ga0207675_100117779 3300026118 Bacteria 2511
347 Ga0207675_100267215 3300026118 Bacteria 1659
348 Ga0207698_10387053 3300026142 Bacteria 1332
349 Ga0209281_1000091 3300027111 Bacteria 242588
350 Ga0209281_1000237 3300027111 Bacteria 112688
351 Ga0209281_1020632 3300027111 Bacteria 1285
352 Ga0209389_1000065 3300027296 Bacteria 102064
353 Ga0209371_1000176 3300027312 Bacteria 95739
354 Ga0209371_1000929 3300027312 Bacteria 22972
355 Ga0209371_1010153 3300027312 Bacteria 2924
356 Ga0209996_1002016 3300027395 Bacteria 2504
357 Ga0209995_1004740 3300027471 Bacteria 2184
358 Ga0209968_1004678 3300027526 Bacteria 2052
359 Ga0210002_1006695 3300027617 Bacteria 1740
360 Ga0209983_1001053 3300027665 Bacteria 6080
361 Ga0209282_1042131 3300027666 Bacteria 2697
362 Ga0209974_10007890 3300027876 Bacteria 3653
363 Ga0209974_10026535 3300027876 Bacteria 1917
364 Ga0209974_10057638 3300027876 Bacteria 1312
365 Ga0207428_10042514 3300027907 Bacteria 3675
366 Ga0207428_10051774 3300027907 Bacteria 3281
367 Ga0207428_10238084 3300027907 Bacteria 1361
368 Ga0207428_10299703 3300027907 Bacteria 1190
369 Ga0268266_10002796 3300028379 Bacteria 18197
370 Ga0268266_10041478 3300028379 Bacteria 3927
371 Ga0268266_10136768 3300028379 Bacteria 2195
372 Ga0268265_10000234 3300028380 Bacteria 63478
373 Ga0268264_10000009 3300028381 Bacteria 724972
374 Ga0268256_1000146 3300030500 Bacteria 95753
375 Ga0268256_1000782 3300030500 Bacteria 22972
376 Ga0268256_1009906 3300030500 Bacteria 3124
377 Ga0307511_10008829 3300030521 Bacteria 10062
378 Ga0314311_1174000 3300030733 Bacteria 8214
379 Ga0316183_1099209 3300030742 Bacteria 952
380 Ga0316183_1101138 3300030742 Bacteria 1106
381 Ga0316181_1016487 3300030744 Bacteria 1345
382 Ga0316181_1111959 3300030744 Bacteria 4733
383 Ga0307513_10007959 3300031456 Bacteria 13638
384 Ga0307509_10107120 3300031507 Bacteria 2812
385 Ga0307509_10114588 3300031507 Bacteria 2690
386 Ga0307516_10345550 3300031730 Bacteria 1154
387 Ga0307416_101118720 3300032002 Bacteria 892
388 Ga0307414_10197381 3300032004 Bacteria 1634
389 Ga0307414_10422723 3300032004 Bacteria 1162
390 Ga0395899_0000478 3300037312 Bacteria 44762
391 Ga0395905_0006602 3300037471 Bacteria 11641
392 Ga0436365_1689934 3300039437 Bacteria 6213
393 Ga0439436_0002017 3300041404 Bacteria 6034
394 Ga0439436_0008011 3300041404 Bacteria 3245
395 Ga0439438_000775 3300041405 Bacteria 14291
396 Ga0439438_005624 3300041405 Bacteria 4572
397 Ga0439438_012464 3300041405 Bacteria 2606
398 Ga0439439_0002322 3300041406 Bacteria 4021
399 Ga0439447_002739 3300041407 Bacteria 6366
400 Ga0439447_013680 3300041407 Bacteria 2296
401 Ga0439447_019637 3300041407 Bacteria 1799
402 Ga0439447_029111 3300041407 Bacteria 1400
403 Ga0439466_0000289 3300041411 Bacteria 19586
404 Ga0439466_0001121 3300041411 Bacteria 10407
405 Ga0439466_0001334 3300041411 Bacteria 9623
406 Ga0439466_0002385 3300041411 Bacteria 7367
407 Ga0439466_0004035 3300041411 Bacteria 5667
408 Ga0439466_0021199 3300041411 Bacteria 2307
409 Ga0439466_0025436 3300041411 Bacteria 2066
410 Ga0439437_000536 3300042000 Bacteria 3771
411 Ga0439442_008500 3300042002 Bacteria 2073
412 Ga0439432_001586 3300042006 Bacteria 8503
413 Ga0439432_001810 3300042006 Bacteria 8017
414 Ga0439432_002251 3300042006 Bacteria 7284
415 Ga0439432_014726 3300042006 Bacteria 2645
416 Ga0439432_031069 3300042006 Bacteria 1728
417 Ga0439432_066039 3300042006 Bacteria 1108
418 Ga0439449_0010779 3300042007 Bacteria 3449
419 Ga0439451_000786 3300042009 Bacteria 6047
420 Ga0439451_002140 3300042009 Bacteria 3965
421 Ga0439452_000190 3300042010 Bacteria 45505
422 Ga0439452_000443 3300042010 Bacteria 23463
423 Ga0439452_001993 3300042010 Bacteria 7819
424 Ga0439452_001995 3300042010 Bacteria 7813
425 Ga0439452_003249 3300042010 Bacteria 5743
426 Ga0439452_008676 3300042010 Bacteria 3041
427 Ga0439452_010013 3300042010 Bacteria 2773
428 Ga0439456_000036 3300042013 Bacteria 49413
429 Ga0439456_000406 3300042013 Bacteria 9644
430 Ga0439456_000462 3300042013 Bacteria 8887
431 Ga0439456_005910 3300042013 Bacteria 2490
432 Ga0439462_0007982 3300042015 Bacteria 2661
433 Ga0439463_000120 3300042016 Bacteria 19571
434 Ga0439463_000491 3300042016 Bacteria 11038
435 Ga0439463_001245 3300042016 Bacteria 6807
436 Ga0450911_000011 3300042115 Bacteria 130739
437 Ga0450911_000019 3300042115 Bacteria 103441
438 Ga0450911_000211 3300042115 Bacteria 22807
439 Ga0450911_000509 3300042115 Bacteria 12334
440 Ga0450911_004119 3300042115 Bacteria 2428
441 Ga0450914_000201 3300042118 Bacteria 2259
442 Ga0450919_003455 3300042121 Bacteria 1976
443 Ga0450922_001769 3300042124 Bacteria 2087
444 Ga0450890_000131 3300042127 Bacteria 11737
445 Ga0450894_003690 3300042131 Bacteria 2001
446 Ga0450902_001841 3300042137 Bacteria 2943
447 Ga0450903_000620 3300042138 Bacteria 7178
448 Ga0450904_000097 3300042139 Bacteria 19742
449 Ga0450905_000157 3300042142 Bacteria 7279
450 Ga0450906_006046 3300042145 Bacteria 2458
451 Ga0450907_000110 3300042146 Bacteria 31083
452 Ga0450907_003387 3300042146 Bacteria 2851
453 Ga0450910_002043 3300042147 Bacteria 2623
454 Ga0439446_0000463 3300042156 Bacteria 8050
455 Ga0439446_0002388 3300042156 Bacteria 4501
456 Ga0439446_0002934 3300042156 Bacteria 4165
457 Ga0439446_0003376 3300042156 Bacteria 3955
458 Ga0439446_0004933 3300042156 Bacteria 3410
459 Ga0450908_005890 3300042184 Bacteria 2341
460 Ga0450909_004626 3300042185 Bacteria 1967
461 Ga0450909_011498 3300042185 Bacteria 1297
462 Ga0439434_0000092 3300042435 Bacteria 22644
463 Ga0439434_0000184 3300042435 Bacteria 17025
464 Ga0439464_0040131 3300042439 Bacteria 1332
465 Ga0439460_0000002 3300042461 Bacteria 48212
466 Ga0439460_0001270 3300042461 Bacteria 5936
467 Ga0439460_0009852 3300042461 Bacteria 2434
468 Ga0439460_0018324 3300042461 Bacteria 1884
469 Ga0450916_000505 3300042530 Bacteria 3421
470 Ga0450918_008576 3300042531 Bacteria 1796
471 Ga0450901_000463 3300042533 Bacteria 4831
472 Ga0451577_0277040 3300042876 Bacteria 1519
473 Ga0439440_0005351 3300042993 Bacteria 2548
474 Ga0466965_0064128 3300044683 Bacteria 1839
475 Ga0466964_0008174 3300044706 Bacteria 3927
476 Ga0453684_0014934 3300044712 Bacteria 12346
477 Ga0453684_0017471 3300044712 Bacteria 11109
478 Ga0453684_0040463 3300044712 Bacteria 6328
479 Ga0466968_0005006 3300044735 Bacteria 4964
480 Ga0451576_0059657 3300045051 Bacteria 3982
481 Ga0495617_001787 3300046452 Bacteria 9175
482 Ga0495617_012651 3300046452 Bacteria 2877
483 Ga0495617_024999 3300046452 Bacteria 2014
484 Ga0495627_000095 3300046453 Bacteria 108094
485 Ga0495627_000646 3300046453 Bacteria 27194
486 Ga0495627_000869 3300046453 Bacteria 21472
487 Ga0495627_010851 3300046453 Bacteria 3293
488 Ga0495627_039198 3300046453 Bacteria 1462
489 Ga0495603_0001944 3300046455 Bacteria 12181
490 Ga0495603_0161761 3300046455 Bacteria 1298
491 Ga0495590_0002659 3300046457 Bacteria 7383
492 Ga0495590_0007106 3300046457 Bacteria 4333
493 Ga0495591_000198 3300046458 Bacteria 61546
494 Ga0495591_000334 3300046458 Bacteria 42109
495 Ga0495591_000628 3300046458 Bacteria 26285
496 Ga0495591_002016 3300046458 Bacteria 11817
497 Ga0495591_002668 3300046458 Bacteria 9711
498 Ga0495591_010984 3300046458 Bacteria 3459
499 Ga0495591_017440 3300046458 Bacteria 2465
500 Ga0495591_020022 3300046458 Bacteria 2223
501 Ga0495591_020266 3300046458 Bacteria 2201
502 Ga0495591_025531 3300046458 Bacteria 1851
503 Ga0495591_027139 3300046458 Bacteria 1769
504 Ga0495629_0083415 3300046459 Bacteria 2230
505 Ga0495638_0011328 3300046460 Bacteria 6145
506 Ga0495638_0011519 3300046460 Bacteria 6090
507 Ga0495638_0019536 3300046460 Bacteria 4483
508 Ga0495638_0057233 3300046460 Bacteria 2418
509 Ga0495638_0060978 3300046460 Bacteria 2331
510 Ga0495653_0005962 3300046463 Bacteria 9975
511 Ga0495653_0006872 3300046463 Bacteria 9349
512 Ga0495653_0147285 3300046463 Bacteria 1648
513 Ga0495650_0001617 3300046471 Bacteria 21024
514 Ga0495650_0003976 3300046471 Bacteria 10390
515 Ga0495650_0004680 3300046471 Bacteria 9239
516 Ga0495650_0008792 3300046471 Bacteria 5838
517 Ga0495650_0048726 3300046471 Bacteria 1763
518 Ga0495650_0076954 3300046471 Bacteria 1295
519 Ga0495582_0000456 3300046473 Bacteria 22343
520 Ga0495605_0000019 3300046474 Bacteria 270010
521 Ga0495605_0000376 3300046474 Bacteria 42124
522 Ga0495605_0000387 3300046474 Bacteria 40707
523 Ga0495605_0000664 3300046474 Bacteria 26130
524 Ga0495605_0001221 3300046474 Bacteria 17091
525 Ga0495605_0002242 3300046474 Bacteria 12068
526 Ga0495605_0007209 3300046474 Bacteria 6323
527 Ga0495605_0171991 3300046474 Bacteria 956
528 Ga0495639_0000295 3300046475 Bacteria 24407
529 Ga0495584_0000408 3300046491 Bacteria 29754
530 Ga0495584_0002026 3300046491 Bacteria 11641
531 Ga0495584_0002140 3300046491 Bacteria 11289
532 Ga0495584_0006909 3300046491 Bacteria 5929
533 Ga0495584_0007040 3300046491 Bacteria 5875
534 Ga0495584_0009992 3300046491 Bacteria 4871
535 Ga0495584_0046053 3300046491 Bacteria 2200
536 Ga0495585_0000895 3300046492 Bacteria 25250
537 Ga0495585_0005030 3300046492 Bacteria 8434
538 Ga0495585_0010265 3300046492 Bacteria 5584
539 Ga0495585_0010423 3300046492 Bacteria 5532
540 Ga0495585_0035713 3300046492 Bacteria 2807
541 Ga0495585_0037229 3300046492 Bacteria 2740
542 Ga0495594_0011120 3300046499 Bacteria 4673
543 Ga0495596_0000175 3300046500 Bacteria 44764
544 Ga0495596_0015961 3300046500 Bacteria 3127
545 Ga0495607_0000024 3300046501 Bacteria 159904
546 Ga0495607_0000306 3300046501 Bacteria 51378
547 Ga0495607_0000531 3300046501 Bacteria 37437
548 Ga0495607_0000751 3300046501 Bacteria 31037
549 Ga0495607_0001123 3300046501 Bacteria 24276
550 Ga0495607_0003423 3300046501 Bacteria 12155
551 Ga0495607_0008096 3300046501 Bacteria 7216
552 Ga0495607_0012685 3300046501 Bacteria 5551
553 Ga0495607_0014244 3300046501 Bacteria 5185
554 Ga0495607_0020047 3300046501 Bacteria 4233
555 Ga0495607_0046946 3300046501 Bacteria 2532
556 Ga0495607_0065376 3300046501 Bacteria 2051
557 Ga0495607_0095448 3300046501 Bacteria 1602
558 Ga0495607_0117861 3300046501 Bacteria 1398
559 Ga0495607_0171456 3300046501 Bacteria 1095
560 Ga0495583_0000146 3300046506 Bacteria 119793
561 Ga0495583_0000452 3300046506 Bacteria 61394
562 Ga0495583_0001254 3300046506 Bacteria 26768
563 Ga0495583_0002206 3300046506 Bacteria 17249
564 Ga0495583_0005888 3300046506 Bacteria 8166
565 Ga0495583_0015935 3300046506 Bacteria 4064
566 Ga0495606_0000115 3300046507 Bacteria 135589
567 Ga0495606_0000246 3300046507 Bacteria 95318
568 Ga0495606_0000454 3300046507 Bacteria 67097
569 Ga0495606_0000477 3300046507 Bacteria 65883
570 Ga0495606_0001164 3300046507 Bacteria 37202
571 Ga0495606_0002670 3300046507 Bacteria 20254
572 Ga0495606_0007824 3300046507 Bacteria 9438
573 Ga0495606_0009157 3300046507 Bacteria 8423
574 Ga0495606_0038528 3300046507 Bacteria 3233
575 Ga0495610_0003687 3300046512 Bacteria 11763
576 Ga0495610_0008413 3300046512 Bacteria 6688
577 Ga0495610_0014124 3300046512 Bacteria 4709
578 Ga0495610_0054587 3300046512 Bacteria 1929
579 Ga0495616_0000852 3300046513 Bacteria 22250
580 Ga0495616_0035228 3300046513 Bacteria 2591
581 Ga0495616_0051050 3300046513 Bacteria 2064
582 Ga0495616_0088639 3300046513 Bacteria 1468
583 Ga0495620_0000023 3300046515 Bacteria 131512
584 Ga0495620_0000108 3300046515 Bacteria 66218
585 Ga0495620_0001611 3300046515 Bacteria 13368
586 Ga0495620_0001719 3300046515 Bacteria 12933
587 Ga0495620_0002090 3300046515 Bacteria 11609
588 Ga0495620_0003034 3300046515 Bacteria 9654
589 Ga0495620_0003388 3300046515 Bacteria 9121
590 Ga0495620_0089078 3300046515 Bacteria 1239
591 Ga0495631_0001318 3300046518 Bacteria 15202
592 Ga0495631_0004094 3300046518 Bacteria 7830
593 Ga0495631_0006065 3300046518 Bacteria 6278
594 Ga0495632_0001735 3300046519 Bacteria 17682
595 Ga0495632_0001795 3300046519 Bacteria 17318
596 Ga0495632_0003309 3300046519 Bacteria 11492
597 Ga0495632_0005231 3300046519 Bacteria 8647
598 Ga0495632_0015933 3300046519 Bacteria 4195
599 Ga0495632_0182428 3300046519 Bacteria 961
600 Ga0495637_0000054 3300046520 Bacteria 99531
601 Ga0495637_0000194 3300046520 Bacteria 47572
602 Ga0495637_0000269 3300046520 Bacteria 41036
603 Ga0495637_0000466 3300046520 Bacteria 29566
604 Ga0495637_0004473 3300046520 Bacteria 7235
605 Ga0495637_0006747 3300046520 Bacteria 5745
606 Ga0495637_0015104 3300046520 Bacteria 3628
607 Ga0495637_0020194 3300046520 Bacteria 3068
608 Ga0495637_0026282 3300046520 Bacteria 2615
609 Ga0495637_0041970 3300046520 Bacteria 1959
610 Ga0495637_0052122 3300046520 Bacteria 1709
611 Ga0495643_0000402 3300046522 Bacteria 56542
612 Ga0495643_0000730 3300046522 Bacteria 37461
613 Ga0495643_0001170 3300046522 Bacteria 25602
614 Ga0495643_0001604 3300046522 Bacteria 20016
615 Ga0495643_0001680 3300046522 Bacteria 19333
616 Ga0495643_0002170 3300046522 Bacteria 16064
617 Ga0495643_0002454 3300046522 Bacteria 14677
618 Ga0495643_0009905 3300046522 Bacteria 5892
619 Ga0495643_0010294 3300046522 Bacteria 5759
620 Ga0495643_0019663 3300046522 Bacteria 3903
621 Ga0495643_0087473 3300046522 Bacteria 1612
622 Ga0495648_0000783 3300046524 Bacteria 33886
623 Ga0495648_0001858 3300046524 Bacteria 20225
624 Ga0495648_0002460 3300046524 Bacteria 17056
625 Ga0495648_0002748 3300046524 Bacteria 15885
626 Ga0495648_0012345 3300046524 Bacteria 6380
627 Ga0495648_0017798 3300046524 Bacteria 5065
628 Ga0495648_0183970 3300046524 Bacteria 1059
629 Ga0495666_0005396 3300046526 Bacteria 6436
630 Ga0495666_0042994 3300046526 Bacteria 2183
631 Ga0495666_0058971 3300046526 Bacteria 1836
632 Ga0495666_0107903 3300046526 Bacteria 1309
633 Ga0495642_0000536 3300046528 Bacteria 19246
634 Ga0495642_0000555 3300046528 Bacteria 18832
635 Ga0495642_0015291 3300046528 Bacteria 2981
636 Ga0495654_0000210 3300046530 Bacteria 55201
637 Ga0495654_0001010 3300046530 Bacteria 20620
638 Ga0495654_0002438 3300046530 Bacteria 11969
639 Ga0495654_0003497 3300046530 Bacteria 9591
640 Ga0495654_0009898 3300046530 Bacteria 5211
641 Ga0495654_0015931 3300046530 Bacteria 3983
642 Ga0495654_0023317 3300046530 Bacteria 3205
643 Ga0495654_0090195 3300046530 Bacteria 1423
644 Ga0495586_0022525 3300046535 Bacteria 3362
645 Ga0495587_0003520 3300046536 Bacteria 10428
646 Ga0495587_0057179 3300046536 Bacteria 2294
647 Ga0495609_0000061 3300046538 Bacteria 139848
648 Ga0495609_0000101 3300046538 Bacteria 100818
649 Ga0495609_0000696 3300046538 Bacteria 25895
650 Ga0495609_0001338 3300046538 Bacteria 16696
651 Ga0495609_0011057 3300046538 Bacteria 4309
652 Ga0495609_0022196 3300046538 Bacteria 2924
653 Ga0495597_0000676 3300046542 Bacteria 27672
654 Ga0495597_0004012 3300046542 Bacteria 8264
655 Ga0495597_0005112 3300046542 Bacteria 7001
656 Ga0495597_0005967 3300046542 Bacteria 6357
657 Ga0495597_0021813 3300046542 Bacteria 2975
658 Ga0495597_0135952 3300046542 Bacteria 1016
659 Ga0495622_0005884 3300046557 Bacteria 5693
660 Ga0495622_0006049 3300046557 Bacteria 5623
661 Ga0495622_0020035 3300046557 Bacteria 3113
662 Ga0495633_0000129 3300046558 Bacteria 100833
663 Ga0495633_0003624 3300046558 Bacteria 10211
664 Ga0495656_0004240 3300046615 Bacteria 4895
665 Ga0495668_0001708 3300046616 Bacteria 20267
666 Ga0495668_0003520 3300046616 Bacteria 11662
667 Ga0495668_0029435 3300046616 Bacteria 3102
668 Ga0495668_0093913 3300046616 Bacteria 1642
669 Ga0495668_0225844 3300046616 Bacteria 1025
670 Ga0495634_0015246 3300046642 Bacteria 5526
671 Ga0495634_0311913 3300046642 Bacteria 949
672 Ga0495611_0000525 3300046648 Bacteria 22782
673 Ga0495611_0000571 3300046648 Bacteria 21238
674 Ga0495611_0001821 3300046648 Bacteria 10218
675 Ga0495625_0000147 3300046660 Bacteria 107983
676 Ga0495625_0011548 3300046660 Bacteria 7195
677 Ga0495625_0135001 3300046660 Bacteria 1668
678 Ga0495625_0159038 3300046660 Bacteria 1514
679 Ga0495635_0000583 3300046663 Bacteria 23456
680 Ga0495635_0000604 3300046663 Bacteria 23105
681 Ga0495659_0001461 3300046664 Bacteria 8015
682 Ga0495659_0006759 3300046664 Bacteria 3624
683 Ga0495661_0000153 3300046665 Bacteria 81096
684 Ga0495661_0000196 3300046665 Bacteria 69840
685 Ga0495661_0000431 3300046665 Bacteria 44303
686 Ga0495661_0000484 3300046665 Bacteria 41967
687 Ga0495661_0001727 3300046665 Bacteria 17684
688 Ga0495661_0058509 3300046665 Bacteria 2297
689 Ga0495661_0063649 3300046665 Bacteria 2179
690 Ga0495661_0074274 3300046665 Bacteria 1979
691 Ga0495661_0082777 3300046665 Bacteria 1846
692 Ga0495661_0252256 3300046665 Bacteria 900
693 Ga0495588_0005506 3300046674 Bacteria 5638
694 Ga0495623_0050832 3300046679 Bacteria 2624
695 Ga0495646_0039441 3300046680 Bacteria 2911
696 Ga0495669_0160323 3300046684 Bacteria 1067
697 Ga0495613_0054929 3300046689 Bacteria 2927
698 Ga0495670_0000388 3300046691 Bacteria 21005
699 Ga0495670_0001599 3300046691 Bacteria 11079
700 Ga0495670_0003795 3300046691 Bacteria 7424
701 Ga0495670_0005439 3300046691 Bacteria 6252
702 Ga0495670_0007272 3300046691 Bacteria 5444
703 Ga0495671_0000471 3300046692 Bacteria 31523
704 Ga0495671_0001192 3300046692 Bacteria 17802
705 Ga0495671_0001895 3300046692 Bacteria 13430
706 Ga0495671_0001900 3300046692 Bacteria 13409
707 Ga0495671_0002856 3300046692 Bacteria 10806
708 Ga0495671_0003042 3300046692 Bacteria 10421
709 Ga0495671_0037684 3300046692 Bacteria 2444
710 Ga0495671_0042708 3300046692 Bacteria 2277
711 Ga0495671_0086214 3300046692 Bacteria 1538
712 Ga0495649_0000711 3300046694 Bacteria 27137
713 Ga0495649_0000968 3300046694 Bacteria 22667
714 Ga0495649_0002156 3300046694 Bacteria 14079
715 Ga0495649_0003441 3300046694 Bacteria 10676
716 Ga0495649_0007937 3300046694 Bacteria 6419
717 Ga0495649_0009797 3300046694 Bacteria 5672
718 Ga0495649_0013458 3300046694 Bacteria 4719
719 Ga0495649_0077864 3300046694 Bacteria 1774
720 Ga0495589_0002719 3300046794 Bacteria 9775
721 Ga0495589_0007109 3300046794 Bacteria 5866
722 Ga0495589_0014900 3300046794 Bacteria 4000
723 Ga0495589_0026339 3300046794 Bacteria 2946
724 Ga0495589_0055325 3300046794 Bacteria 1955
725 Ga0495600_0000547 3300046809 Bacteria 19473
726 Ga0495660_0000431 3300046810 Bacteria 35256
727 Ga0495660_0004060 3300046810 Bacteria 8938
728 Ga0495660_0014906 3300046810 Bacteria 4495
729 Ga0495660_0020968 3300046810 Bacteria 3744
730 Ga0495660_0036778 3300046810 Bacteria 2729
731 Ga0495660_0055822 3300046810 Bacteria 2136
732 Ga0495660_0083874 3300046810 Bacteria 1667
733 Ga0495581_0107187 3300047315 Bacteria 1624
734 Ga0495604_0012043 3300047317 Bacteria 6875
735 Ga0495604_0016005 3300047317 Bacteria 5988
736 Ga0495636_0008819 3300047318 Bacteria 3972
737 Ga0495674_0034797 3300047319 Bacteria 4551
738 Ga0495672_0003079 3300047320 Bacteria 14595
739 Ga0495672_0003447 3300047320 Bacteria 13529
740 Ga0495672_0004295 3300047320 Bacteria 11749
741 Ga0495672_0005642 3300047320 Bacteria 9876
742 Ga0495672_0006899 3300047320 Bacteria 8659
743 Ga0495672_0012746 3300047320 Bacteria 5844
744 Ga0495676_0000027 3300047321 Bacteria 141955
745 Ga0495676_0021111 3300047321 Bacteria 5698
746 Ga0495676_0049708 3300047321 Bacteria 3368
747 Ga0495680_0005758 3300047322 Bacteria 11601
748 Ga0495683_0000038 3300047323 Bacteria 139494
749 Ga0495683_0000075 3300047323 Bacteria 100715
750 Ga0495683_0001303 3300047323 Bacteria 16785
751 Ga0495683_0001374 3300047323 Bacteria 16151
752 Ga0495683_0052279 3300047323 Bacteria 2040
753 Ga0495683_0071627 3300047323 Bacteria 1700
754 Ga0495683_0165052 3300047323 Bacteria 1021
755 Ga0495687_003446 3300047443 Bacteria 11443
756 Ga0495687_004754 3300047443 Bacteria 8978
757 Ga0495687_010017 3300047443 Bacteria 5237
758 Ga0495675_0156627 3300047444 Bacteria 1404
759 Ga0495677_0001006 3300047445 Bacteria 11356
760 Ga0495679_000237 3300047446 Bacteria 45847
761 Ga0495679_000495 3300047446 Bacteria 27885
762 Ga0495679_013833 3300047446 Bacteria 3011
763 Ga0495685_066872 3300047447 Bacteria 1207
764 Ga0495673_0000389 3300047469 Bacteria 51664
765 Ga0495673_0001628 3300047469 Bacteria 17374
766 Ga0495673_0001807 3300047469 Bacteria 16191
767 Ga0495673_0005394 3300047469 Bacteria 7744
768 Ga0495673_0008202 3300047469 Bacteria 5899
769 Ga0495673_0012990 3300047469 Bacteria 4388
770 Ga0495673_0019427 3300047469 Bacteria 3403
771 Ga0495673_0041012 3300047469 Bacteria 2086
772 Ga0495673_0095900 3300047469 Bacteria 1205
773 Ga0495681_0003081 3300047470 Bacteria 11691
774 Ga0495681_0003215 3300047470 Bacteria 11403
775 Ga0495681_0004777 3300047470 Bacteria 9177
776 Ga0495681_0012244 3300047470 Bacteria 5053
777 Ga0495681_0022208 3300047470 Bacteria 3402
778 Ga0495681_0031756 3300047470 Bacteria 2667
779 Ga0495686_0007608 3300047472 Bacteria 8091
780 Ga0495686_0125865 3300047472 Bacteria 1523
781 Ga0495686_0127672 3300047472 Bacteria 1510
782 Ga0495593_0038639 3300047673 Bacteria 2577
783 Ga0495593_0071064 3300047673 Bacteria 1807
784 Ga0495593_0106202 3300047673 Bacteria 1436
785 Ga0495626_0000067 3300048091 Bacteria 139969
786 Ga0495626_0000507 3300048091 Bacteria 38997
787 Ga0495626_0000684 3300048091 Bacteria 32479
788 Ga0495626_0000996 3300048091 Bacteria 24344
789 Ga0495626_0001171 3300048091 Bacteria 21808
790 Ga0495626_0001627 3300048091 Bacteria 17443
791 Ga0495626_0012837 3300048091 Bacteria 4372
792 Ga0495626_0013045 3300048091 Bacteria 4333
793 Ga0495626_0027693 3300048091 Bacteria 2753
794 Ga0495626_0033525 3300048091 Bacteria 2460
795 Ga0496102_0034338 3300048905 Bacteria 4561
796 Ga0496103_0014973 3300048906 Bacteria 4610
797 Ga0496106_0484204 3300048909 Bacteria 994
798 Ga0496109_0091764 3300048912 Bacteria 2809
799 Ga0496110_0069750 3300048913 Bacteria 3113
800 Ga0496110_0146071 3300048913 Bacteria 2139
801 Ga0496111_0049816 3300048914 Bacteria 3020
802 Ga0496111_0055581 3300048914 Bacteria 2863
803 Ga0496112_0228484 3300048915 Bacteria 1816
804 Ga0496113_0214562 3300048916 Bacteria 1533
805 Ga0496114_0024637 3300048917 Bacteria 4912
806 Ga0496116_0000242 3300048919 Bacteria 99455
807 Ga0496116_0001670 3300048919 Bacteria 24375
808 Ga0496116_0002076 3300048919 Bacteria 21440
809 Ga0496116_0023569 3300048919 Bacteria 4581
810 Ga0496117_0000270 3300048920 Bacteria 97077
811 Ga0496117_0000932 3300048920 Bacteria 44792
812 Ga0496117_0002067 3300048920 Bacteria 26545
813 Ga0496118_0042191 3300048921 Bacteria 3601
814 Ga0496118_0068266 3300048921 Bacteria 2583
815 Ga0496118_0069267 3300048921 Bacteria 2556
816 Ga0496119_0000704 3300048922 Bacteria 44799
817 Ga0496120_0001473 3300048923 Bacteria 28054
818 Ga0496120_0004336 3300048923 Bacteria 11991
819 Ga0496121_0000318 3300048924 Bacteria 100833
820 Ga0496121_0003788 3300048924 Bacteria 21104
821 Ga0496121_0004345 3300048924 Bacteria 19161
822 Ga0496121_0149535 3300048924 Bacteria 1720
823 Ga0496121_0268043 3300048924 Bacteria 1175
824 Ga0496122_0000517 3300048925 Bacteria 79890
825 Ga0496122_0002629 3300048925 Bacteria 25113
826 Ga0496122_0007631 3300048925 Bacteria 11947
827 Ga0496122_0138317 3300048925 Bacteria 1529
828 Ga0496122_0141719 3300048925 Bacteria 1502
829 Ga0496123_0000243 3300048926 Bacteria 109767
830 Ga0496123_0007055 3300048926 Bacteria 10690
831 Ga0496123_0040963 3300048926 Bacteria 3217
832 Ga0496124_0000511 3300048927 Bacteria 66830
833 Ga0496124_0001467 3300048927 Bacteria 34796
834 Ga0496124_0002260 3300048927 Bacteria 25562
835 Ga0496124_0002328 3300048927 Bacteria 25081
836 Ga0496124_0007063 3300048927 Bacteria 12030
837 Ga0496124_0015657 3300048927 Bacteria 7256
838 Ga0496124_0023005 3300048927 Bacteria 5701
839 Ga0496124_0028667 3300048927 Bacteria 4977
840 Ga0496124_0087458 3300048927 Bacteria 2548
841 Ga0496124_0107378 3300048927 Bacteria 2252
842 Ga0496124_0172950 3300048927 Bacteria 1670
843 Ga0496124_0216254 3300048927 Bacteria 1445
844 Ga0496125_0000971 3300048928 Bacteria 44877
845 Ga0496125_0002177 3300048928 Bacteria 26150
846 Ga0496125_0006705 3300048928 Bacteria 12379
847 Ga0496125_0021605 3300048928 Bacteria 5998
848 Ga0496125_0045763 3300048928 Bacteria 3678
849 Ga0496125_0113892 3300048928 Bacteria 1949
850 Ga0496126_0055003 3300048929 Bacteria 3602
851 Ga0496126_0099192 3300048929 Bacteria 2551
852 Ga0496126_0698856 3300048929 Bacteria 788
853 Ga0495678_000106 3300049459 Bacteria 100780
854 Ga0495678_000499 3300049459 Bacteria 38715
855 Ga0495678_000694 3300049459 Bacteria 30590
856 Ga0495678_002365 3300049459 Bacteria 12945
857 Ga0495678_008447 3300049459 Bacteria 5191
858 Ga0495678_008793 3300049459 Bacteria 5058
859 Ga0495678_090731 3300049459 Bacteria 1077
860 Ga0495682_0000069 3300049460 Bacteria 94250
861 Ga0495682_0000804 3300049460 Bacteria 19829
862 Ga0495682_0021349 3300049460 Bacteria 2426
863 Ga0501031_0079268 3300049568 Bacteria 2140
864 Ga0501032_0010649 3300049569 Bacteria 6621
865 Ga0501034_0000164 3300049571 Bacteria 125152
866 Ga0501034_0042054 3300049571 Bacteria 4625
867 Ga0501034_0060143 3300049571 Bacteria 3817
868 Ga0501034_0086454 3300049571 Bacteria 3136
869 Ga0501037_0071136 3300049573 Bacteria 2531
870 Ga0501038_0165610 3300049574 Bacteria 1793
871 Ga0501043_0055575 3300049579 Bacteria 3110
872 Ga0501047_0530647 3300049581 Bacteria 1002
873 Ga0501243_004728 3300049675 Bacteria 2046
874 Ga0501044_0317260 3300049823 Bacteria 1484
875 Ga0501226_000034 3300049853 Bacteria 71598
876 Ga0501226_000117 3300049853 Bacteria 17509
877 nmdc:mga00v17_119646_c1 3300050491 Bacteria 1676
878 nmdc:mga05p37_250708_c1 3300050507 Bacteria 2123
879 nmdc:mga08y16_396816_c1 3300050511 Bacteria 1412
880 nmdc:mga0sz30_7760_c1 3300050516 Bacteria 4032
881 Ga0500593_000476 3300053117 Bacteria 15884
882 Ga0500628_067781 3300053129 Bacteria 887
883 Ga0500659_0002369 3300053135 Bacteria 11369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10110202 rootL2_101102022 201
2 3300005353 Ga0070669_100035538 Ga0070669_1000355382 203
3 3300005441 Ga0070700_100014372 Ga0070700_1000143723 203
4 3300005459 Ga0068867_100000146 Ga0068867_10000014627 203
5 3300005616 Ga0068852_100187387 Ga0068852_1001873872 203
6 3300005719 Ga0068861_100001394 Ga0068861_1000013948 203
7 3300006881 Ga0068865_100003939 Ga0068865_1000039396 203
8 3300013297 Ga0157378_10002415 Ga0157378_100024154 203
9 3300013306 Ga0163162_10017052 Ga0163162_100170522 203
10 3300025961 Ga0207712_10033258 Ga0207712_100332584 203
11 3300026075 Ga0207708_10023107 Ga0207708_100231073 203
12 3300026089 Ga0207648_10000425 Ga0207648_1000042530 203
13 3300026118 Ga0207675_100007239 Ga0207675_1000072392 203
14 3300026142 Ga0207698_10387053 Ga0207698_103870532 203
15 3300005841 Ga0068863_100263895 Ga0068863_1002638951 204
16 3300006358 Ga0068871_100141867 Ga0068871_1001418672 204
17 3300014969 Ga0157376_10136874 Ga0157376_101368743 204
18 3300017792 Ga0163161_10097813 Ga0163161_100978133 204
19 3300025941 Ga0207711_10391003 Ga0207711_103910031 204
20 3300002704 JGI25155J39150_1000041 JGI25155J39150_10000411 207
21 3300002705 JGI25156J39149_1000031 JGI25156J39149_100003181 207
22 3300002738 JGI25154J39366_1000049 JGI25154J39366_100004932 207
23 3300002741 JGI25157J39369_1000041 JGI25157J39369_100004132 207
24 3300005719 Ga0068861_100188902 Ga0068861_1001889022 207
25 3300009094 Ga0111539_10935004 Ga0111539_109350041 207
26 3300025206 Ga0209435_100014 Ga0209435_10001432 207
27 3300025246 Ga0209646_1000001 Ga0209646_100000133 207
28 3300025250 Ga0209026_1000073 Ga0209026_100007332 207
29 3300025256 Ga0209759_1000013 Ga0209759_100001333 207
30 3300026118 Ga0207675_100267215 Ga0207675_1002672153 207
31 3300037471 Ga0395905_0006602 Ga0395905_0006602_138_863 211
32 3300005544 Ga0070686_100158990 Ga0070686_1001589902 212
33 3300025936 Ga0207670_10507585 Ga0207670_105075852 212
34 3300005334 Ga0068869_100084556 Ga0068869_1000845562 213
35 3300005719 Ga0068861_100059167 Ga0068861_1000591672 213
36 3300005841 Ga0068863_100162161 Ga0068863_1001621612 213
37 3300006237 Ga0097621_100081003 Ga0097621_1000810033 213
38 3300009176 Ga0105242_10090188 Ga0105242_100901882 213
39 3300014969 Ga0157376_10100048 Ga0157376_101000483 213
40 3300025938 Ga0207704_10066450 Ga0207704_100664503 213
41 3300025942 Ga0207689_10150576 Ga0207689_101505762 213
42 3300026118 Ga0207675_100117779 Ga0207675_1001177792 213
43 3300053129 Ga0500628_067781 Ga0500628_067781_60_815 213
44 3300005341 Ga0070691_10142847 Ga0070691_101428472 214
45 3300005344 Ga0070661_100293685 Ga0070661_1002936852 214
46 3300005354 Ga0070675_100017974 Ga0070675_1000179742 214
47 3300005356 Ga0070674_100037246 Ga0070674_1000372463 214
48 3300005441 Ga0070700_100062768 Ga0070700_1000627682 214
49 3300005543 Ga0070672_100398226 Ga0070672_1003982262 214
50 3300005842 Ga0068858_100155276 Ga0068858_1001552762 214
51 3300014326 Ga0157380_10272904 Ga0157380_102729042 214
52 3300025926 Ga0207659_10033931 Ga0207659_100339313 214
53 3300025937 Ga0207669_10062361 Ga0207669_100623612 214
54 3300026075 Ga0207708_10006713 Ga0207708_100067134 214
55 3300026089 Ga0207648_10045457 Ga0207648_100454572 214
56 3300044712 Ga0453684_0014934 Ga0453684_0014934_2758_3492 215
57 3300006844 Ga0075428_100214665 Ga0075428_1002146652 216
58 3300032002 Ga0307416_101118720 Ga0307416_1011187201 216
59 3300041404 Ga0439436_0008011 Ga0439436_0008011_2472_3221 216
60 3300041406 Ga0439439_0002322 Ga0439439_0002322_632_1381 216
61 3300041407 Ga0439447_029111 Ga0439447_029111_227_976 216
62 3300041411 Ga0439466_0021199 Ga0439466_0021199_946_1695 216
63 3300042002 Ga0439442_008500 Ga0439442_008500_36_785 216
64 3300042006 Ga0439432_002251 Ga0439432_002251_3156_3905 216
65 3300042007 Ga0439449_0010779 Ga0439449_0010779_2472_3221 216
66 3300042010 Ga0439452_003249 Ga0439452_003249_462_1211 216
67 3300042015 Ga0439462_0007982 Ga0439462_0007982_1065_1814 216
68 3300042131 Ga0450894_003690 Ga0450894_003690_976_1725 216
69 3300042185 Ga0450909_004626 Ga0450909_004626_632_1381 216
70 3300031456 Ga0307513_10007959 Ga0307513_100079595 217
71 3300045051 Ga0451576_0059657 Ga0451576_0059657_411_1163 217
72 3300005288 Ga0065714_10003342 Ga0065714_100033428 219
73 3300010375 Ga0105239_10087107 Ga0105239_100871074 219
74 3300031507 Ga0307509_10114588 Ga0307509_101145882 219
75 3300042009 Ga0439451_000786 Ga0439451_000786_4771_5487 219
76 3300042013 Ga0439456_000462 Ga0439456_000462_1942_2658 219
77 3300046665 Ga0495661_0252256 Ga0495661_0252256_164_880 219
78 3300031507 Ga0307509_10107120 Ga0307509_101071203 220
79 3300046530 Ga0495654_0023317 Ga0495654_0023317_2458_3159 220
80 3300003316 rootH1_10017529 rootH1_100175297 221
81 3300003322 rootL2_10030466 rootL2_100304667 221
82 3300049459 Ga0495678_090731 Ga0495678_090731_309_1055 221
83 3300044706 Ga0466964_0008174 Ga0466964_0008174_685_1422 223
84 3300013297 Ga0157378_10024025 Ga0157378_100240255 224
85 3300015265 Ga0182005_1000663 Ga0182005_100066312 224
86 3300041411 Ga0439466_0025436 Ga0439466_0025436_578_1294 224
87 3300042006 Ga0439432_001810 Ga0439432_001810_6878_7594 224
88 3300042010 Ga0439452_001995 Ga0439452_001995_1695_2411 224
89 3300042013 Ga0439456_000406 Ga0439456_000406_6307_7023 224
90 3300042138 Ga0450903_000620 Ga0450903_000620_2725_3441 224
91 3300042461 Ga0439460_0000002 Ga0439460_0000002_13936_14652 224
92 3300046452 Ga0495617_001787 Ga0495617_001787_4656_5372 224
93 3300046458 Ga0495591_010984 Ga0495591_010984_482_1198 224
94 3300046474 Ga0495605_0000387 Ga0495605_0000387_4858_5574 224
95 3300046500 Ga0495596_0015961 Ga0495596_0015961_1023_1727 224
96 3300046507 Ga0495606_0000477 Ga0495606_0000477_19931_20647 224
97 3300046530 Ga0495654_0000210 Ga0495654_0000210_52085_52801 224
98 3300003781 Ga0055536_1029466 Ga0055536_10294662 225
99 3300003791 Ga0055530_10009440 Ga0055530_100094403 225
100 3300003792 Ga0055540_1032823 Ga0055540_10328231 225
101 3300011119 Ga0105246_10000002 Ga0105246_1000000279 225
102 3300013104 Ga0157370_10002312 Ga0157370_100023129 225
103 3300025292 Ga0209676_1002274 Ga0209676_100227410 225
104 3300025298 Ga0209050_1000318 Ga0209050_100031835 225
105 3300025303 Ga0209051_1004120 Ga0209051_10041202 225
106 3300025728 Ga0207655_1036871 Ga0207655_10368711 226
107 3300027907 Ga0207428_10238084 Ga0207428_102380841 226
108 3300044735 Ga0466968_0005006 Ga0466968_0005006_3521_4282 226
109 3300046515 Ga0495620_0089078 Ga0495620_0089078_528_1208 226
110 3300046520 Ga0495637_0052122 Ga0495637_0052122_25_705 226
111 3300049823 Ga0501044_0317260 Ga0501044_0317260_657_1400 226
112 3300025940 Ga0207691_10114481 Ga0207691_101144812 227
113 3300046616 Ga0495668_0225844 Ga0495668_0225844_321_1010 227
114 3300005288 Ga0065714_10005964 Ga0065714_100059643 228
115 3300046463 Ga0495653_0005962 Ga0495653_0005962_953_1684 228
116 3300046492 Ga0495585_0005030 Ga0495585_0005030_72_803 228
117 3300046507 Ga0495606_0009157 Ga0495606_0009157_7139_7870 228
118 3300046665 Ga0495661_0000431 Ga0495661_0000431_28753_29484 228
119 3300049675 Ga0501243_004728 Ga0501243_004728_758_1507 229
120 3300046520 Ga0495637_0004473 Ga0495637_0004473_338_1060 230
121 3300025936 Ga0207670_10171133 Ga0207670_101711332 231
122 3300041405 Ga0439438_000775 Ga0439438_000775_6768_7535 231
123 3300013102 Ga0157371_10000953 Ga0157371_1000095314 232
124 3300047321 Ga0495676_0049708 Ga0495676_0049708_1604_2335 232
125 3300009147 Ga0114129_10289749 Ga0114129_102897492 233
126 3300046515 Ga0495620_0002090 Ga0495620_0002090_9897_10664 233
127 3300046520 Ga0495637_0015104 Ga0495637_0015104_745_1512 233
128 3300046694 Ga0495649_0002156 Ga0495649_0002156_7706_8437 233
129 3300050511 nmdc:mga08y16_396816_c1 nmdc:mga08y16_396816_c1_283_1038 233
130 3300006175 Ga0070712_100201381 Ga0070712_1002013812 234
131 3300025915 Ga0207693_10121721 Ga0207693_101217212 234
132 3300046471 Ga0495650_0003976 Ga0495650_0003976_8166_8933 234
133 3300046474 Ga0495605_0001221 Ga0495605_0001221_1318_2085 234
134 3300046501 Ga0495607_0046946 Ga0495607_0046946_912_1679 234
135 3300046506 Ga0495583_0000452 Ga0495583_0000452_12671_13438 234
136 3300046506 Ga0495583_0005888 Ga0495583_0005888_4455_5222 234
137 3300046520 Ga0495637_0026282 Ga0495637_0026282_565_1332 234
138 3300046538 Ga0495609_0000696 Ga0495609_0000696_10017_10784 234
139 3300046665 Ga0495661_0000484 Ga0495661_0000484_25809_26576 234
140 iso_pu_bacteria 2511231008 2511278470 234
141 iso_pu_bacteria 2511231012 2511304203 234
142 iso_pu_bacteria 2511231017 2511331101 234
143 iso_pu_bacteria 2643221565 2643843784 234
144 3300046501 Ga0495607_0117861 Ga0495607_0117861_522_1262 235
145 3300047323 Ga0495683_0000038 Ga0495683_0000038_124259_124990 235
146 3300047470 Ga0495681_0012244 Ga0495681_0012244_806_1552 235
147 3300025728 Ga0207655_1006266 Ga0207655_10062662 236
148 3300046501 Ga0495607_0008096 Ga0495607_0008096_975_1706 236
149 3300002737 JGI25162J39368_1000459 JGI25162J39368_100045922 237
150 3300002771 JGI25163J39215_1000407 JGI25163J39215_10004072 237
151 3300002772 JGI25164J39214_1000314 JGI25164J39214_100031422 237
152 3300003214 JGI25165J46597_1000193 JGI25165J46597_100019310 237
153 3300009011 Ga0105251_10004312 Ga0105251_100043122 237
154 3300009036 Ga0105244_10132417 Ga0105244_101324172 237
155 3300013100 Ga0157373_10094446 Ga0157373_100944462 237
156 3300013102 Ga0157371_10002539 Ga0157371_1000253917 237
157 3300013102 Ga0157371_10076619 Ga0157371_100766192 237
158 3300013105 Ga0157369_10023081 Ga0157369_100230814 237
159 3300025207 Ga0209760_100230 Ga0209760_1002308 237
160 3300025231 Ga0207427_100006 Ga0207427_10000615 237
161 3300025233 Ga0209437_100013 Ga0209437_10001315 237
162 3300025261 Ga0209233_1000022 Ga0209233_100002215 237
163 3300027312 Ga0209371_1010153 Ga0209371_10101532 237
164 3300030500 Ga0268256_1009906 Ga0268256_10099062 237
165 3300037312 Ga0395899_0000478 Ga0395899_0000478_24627_25343 237
166 3300027876 Ga0209974_10007890 Ga0209974_100078904 238
167 3300050507 nmdc:mga05p37_250708_c1 nmdc:mga05p37_250708_c1_272_1018 238
168 2162886007 SwRhRL2b_contig_803191 SwRhRL2b_0112.00006580 239
169 3300005289 Ga0065704_10070543 Ga0065704_100705437 239
170 3300005548 Ga0070665_100509061 Ga0070665_1005090612 239
171 3300046522 Ga0495643_0001604 Ga0495643_0001604_18339_19067 239
172 3300046528 Ga0495642_0015291 Ga0495642_0015291_65_793 239
173 3300046542 Ga0495597_0005112 Ga0495597_0005112_6213_6941 239
174 3300009011 Ga0105251_10002062 Ga0105251_100020628 240
175 3300025735 Ga0207713_1006272 Ga0207713_10062728 240
176 3300027876 Ga0209974_10026535 Ga0209974_100265352 240
177 3300042156 Ga0439446_0000463 Ga0439446_0000463_6765_7523 240
178 3300046453 Ga0495627_000869 Ga0495627_000869_6393_7148 240
179 3300046460 Ga0495638_0019536 Ga0495638_0019536_1181_1936 240
180 3300046501 Ga0495607_0000531 Ga0495607_0000531_8124_8891 240
181 3300046519 Ga0495632_0005231 Ga0495632_0005231_6930_7685 240
182 3300046519 Ga0495632_0182428 Ga0495632_0182428_149_916 240
183 3300046692 Ga0495671_0037684 Ga0495671_0037684_925_1680 240
184 3300047320 Ga0495672_0003079 Ga0495672_0003079_8511_9266 240
185 3300048912 Ga0496109_0091764 Ga0496109_0091764_1759_2547 240
186 3300048913 Ga0496110_0069750 Ga0496110_0069750_1257_2045 240
187 3300048914 Ga0496111_0055581 Ga0496111_0055581_391_1179 240
188 3300048920 Ga0496117_0000932 Ga0496117_0000932_1207_1974 240
189 3300048921 Ga0496118_0068266 Ga0496118_0068266_892_1659 240
190 3300048923 Ga0496120_0004336 Ga0496120_0004336_1147_1914 240
191 3300048927 Ga0496124_0007063 Ga0496124_0007063_1175_1942 240
192 3300048928 Ga0496125_0000971 Ga0496125_0000971_42815_43582 240
193 3300048928 Ga0496125_0006705 Ga0496125_0006705_1041_1802 240
194 iso_pu_bacteria 3007872151 3007874921 240
195 3300041404 Ga0439436_0002017 Ga0439436_0002017_1327_2085 241
196 3300041407 Ga0439447_019637 Ga0439447_019637_633_1391 241
197 3300042000 Ga0439437_000536 Ga0439437_000536_407_1165 241
198 3300042006 Ga0439432_066039 Ga0439432_066039_101_859 241
199 3300042010 Ga0439452_010013 Ga0439452_010013_921_1679 241
200 3300042115 Ga0450911_000019 Ga0450911_000019_39557_40315 241
201 3300042156 Ga0439446_0002388 Ga0439446_0002388_1865_2623 241
202 3300042156 Ga0439446_0003376 Ga0439446_0003376_1048_1806 241
203 3300042185 Ga0450909_011498 Ga0450909_011498_342_1100 241
204 3300049569 Ga0501032_0010649 Ga0501032_0010649_2112_2870 241
205 3300049571 Ga0501034_0060143 Ga0501034_0060143_3005_3763 241
206 3300049571 Ga0501034_0086454 Ga0501034_0086454_749_1510 241
207 3300049573 Ga0501037_0071136 Ga0501037_0071136_1043_1801 241
208 3300049853 Ga0501226_000117 Ga0501226_000117_11709_12470 241
209 3300001915 JGI24741J21665_1000755 JGI24741J21665_10007552 242
210 3300003751 Ga0055538_1000012 Ga0055538_100001214 242
211 3300003752 Ga0055539_1000017 Ga0055539_100001714 242
212 3300003756 Ga0055533_1000021 Ga0055533_100002114 242
213 3300003758 Ga0055532_1000020 Ga0055532_1000020228 242
214 3300003759 Ga0055525_1000117 Ga0055525_1000117102 242
215 3300003761 Ga0055535_1004800 Ga0055535_10048002 242
216 3300003841 Ga0055541_1000012 Ga0055541_100001214 242
217 3300005289 Ga0065704_10121284 Ga0065704_101212842 242
218 3300005331 Ga0070670_100003035 Ga0070670_1000030351 242
219 3300005353 Ga0070669_100000277 Ga0070669_10000027715 242
220 3300005457 Ga0070662_100000063 Ga0070662_10000006312 242
221 3300005539 Ga0068853_100000143 Ga0068853_10000014332 242
222 3300005578 Ga0068854_100004725 Ga0068854_1000047252 242
223 3300005834 Ga0068851_10000018 Ga0068851_1000001815 242
224 3300006051 Ga0075364_10031476 Ga0075364_100314762 242
225 3300009036 Ga0105244_10001870 Ga0105244_100018707 242
226 3300009148 Ga0105243_10097512 Ga0105243_100975123 242
227 3300009177 Ga0105248_10019408 Ga0105248_100194085 242
228 3300013104 Ga0157370_10000954 Ga0157370_1000095418 242
229 3300025206 Ga0209435_100533 Ga0209435_1005332 242
230 3300025224 Ga0209784_100007 Ga0209784_10000714 242
231 3300025225 Ga0209566_100009 Ga0209566_10000914 242
232 3300025226 Ga0209674_100021 Ga0209674_10002114 242
233 3300025229 Ga0209147_100009 Ga0209147_10000914 242
234 3300025230 Ga0209563_100018 Ga0209563_10001814 242
235 3300025233 Ga0209437_109161 Ga0209437_1091612 242
236 3300025242 Ga0209258_100237 Ga0209258_10023714 242
237 3300025246 Ga0209646_1000277 Ga0209646_100027715 242
238 3300025253 Ga0209677_100012 Ga0209677_10001214 242
239 3300025256 Ga0209759_1018453 Ga0209759_10184532 242
240 3300025321 Ga0207656_10000009 Ga0207656_1000000915 242
241 3300025728 Ga0207655_1002247 Ga0207655_10022477 242
242 3300025923 Ga0207681_10000291 Ga0207681_1000029115 242
243 3300025925 Ga0207650_10000308 Ga0207650_1000030814 242
244 3300025925 Ga0207650_10000407 Ga0207650_1000040722 242
245 3300025933 Ga0207706_10000050 Ga0207706_1000005015 242
246 3300025935 Ga0207709_10066438 Ga0207709_100664381 242
247 3300025941 Ga0207711_10013160 Ga0207711_100131602 242
248 3300025981 Ga0207640_10008153 Ga0207640_100081533 242
249 3300026041 Ga0207639_10000079 Ga0207639_1000007915 242
250 3300030733 Ga0314311_1174000 Ga0314311_11740002 242
251 3300030742 Ga0316183_1099209 Ga0316183_10992091 242
252 3300046492 Ga0495585_0000895 Ga0495585_0000895_23408_24175 242
253 3300046492 Ga0495585_0010423 Ga0495585_0010423_981_1748 242
254 3300046506 Ga0495583_0015935 Ga0495583_0015935_1358_2125 242
255 3300046520 Ga0495637_0020194 Ga0495637_0020194_1040_1807 242
256 3300046524 Ga0495648_0001858 Ga0495648_0001858_9279_10046 242
257 3300046538 Ga0495609_0001338 Ga0495609_0001338_9469_10224 242
258 3300046810 Ga0495660_0083874 Ga0495660_0083874_849_1616 242
259 3300047320 Ga0495672_0012746 Ga0495672_0012746_585_1352 242
260 3300047446 Ga0495679_013833 Ga0495679_013833_1132_1899 242
261 3300050491 nmdc:mga00v17_119646_c1 nmdc:mga00v17_119646_c1_228_995 242
262 3300003791 Ga0055530_10000081 Ga0055530_1000008151 243
263 3300003792 Ga0055540_1000121 Ga0055540_100012151 243
264 3300005288 Ga0065714_10064636 Ga0065714_100646363 243
265 3300005289 Ga0065704_10071119 Ga0065704_100711195 243
266 3300005617 Ga0068859_100404284 Ga0068859_1004042842 243
267 3300005844 Ga0068862_100136925 Ga0068862_1001369252 243
268 3300006931 Ga0097620_100404267 Ga0097620_1004042672 243
269 3300009036 Ga0105244_10004378 Ga0105244_100043787 243
270 3300009094 Ga0111539_10096618 Ga0111539_100966184 243
271 3300009174 Ga0105241_10398380 Ga0105241_103983801 243
272 3300014325 Ga0163163_10101543 Ga0163163_101015432 243
273 3300015261 Ga0182006_1008824 Ga0182006_10088243 243
274 3300017792 Ga0163161_10173254 Ga0163161_101732542 243
275 3300025256 Ga0209759_1007431 Ga0209759_10074312 243
276 3300025292 Ga0209676_1000583 Ga0209676_100058333 243
277 3300025298 Ga0209050_1000061 Ga0209050_1000061132 243
278 3300025303 Ga0209051_1000088 Ga0209051_100008886 243
279 3300025304 Ga0209257_1011914 Ga0209257_10119142 243
280 3300025728 Ga0207655_1008704 Ga0207655_10087045 243
281 3300025918 Ga0207662_10236760 Ga0207662_102367601 243
282 3300026095 Ga0207676_10186858 Ga0207676_101868582 243
283 3300032004 Ga0307414_10197381 Ga0307414_101973812 243
284 3300046507 Ga0495606_0000454 Ga0495606_0000454_57861_58622 243
285 3300046522 Ga0495643_0000402 Ga0495643_0000402_45929_46690 243
286 3300046522 Ga0495643_0002170 Ga0495643_0002170_5957_6718 243
287 3300046692 Ga0495671_0001895 Ga0495671_0001895_5501_6262 243
288 3300046694 Ga0495649_0003441 Ga0495649_0003441_2105_2866 243
289 3300048927 Ga0496124_0172950 Ga0496124_0172950_770_1537 243
290 3300002737 JGI25162J39368_1000208 JGI25162J39368_100020812 244
291 3300002771 JGI25163J39215_1000589 JGI25163J39215_10005898 244
292 3300002772 JGI25164J39214_1000297 JGI25164J39214_100029712 244
293 3300003214 JGI25165J46597_1000175 JGI25165J46597_100017512 244
294 3300003320 rootH2_10016165 rootH2_100161657 244
295 3300005290 Ga0065712_10068500 Ga0065712_100685002 244
296 3300005344 Ga0070661_100000237 Ga0070661_10000023729 244
297 3300005548 Ga0070665_100089367 Ga0070665_1000893672 244
298 3300005577 Ga0068857_100627854 Ga0068857_1006278541 244
299 3300006051 Ga0075364_10113138 Ga0075364_101131382 244
300 3300006914 Ga0075436_100050318 Ga0075436_1000503181 244
301 3300006946 Ga0079104_1000306 Ga0079104_100030618 244
302 3300006948 Ga0099826_10012980 Ga0099826_100129802 244
303 3300009011 Ga0105251_10007262 Ga0105251_100072625 244
304 3300009036 Ga0105244_10000726 Ga0105244_1000072611 244
305 3300009092 Ga0105250_10000825 Ga0105250_1000082512 244
306 3300009148 Ga0105243_10000075 Ga0105243_10000075105 244
307 3300009176 Ga0105242_10000358 Ga0105242_1000035811 244
308 3300009553 Ga0105249_10152357 Ga0105249_101523572 244
309 3300013102 Ga0157371_10000935 Ga0157371_1000093511 244
310 3300014497 Ga0182008_10001337 Ga0182008_1000133710 244
311 3300021384 Ga0213876_10008910 Ga0213876_100089103 244
312 3300025207 Ga0209760_100082 Ga0209760_10008272 244
313 3300025231 Ga0207427_100005 Ga0207427_100005737 244
314 3300025233 Ga0209437_100018 Ga0209437_100018647 244
315 3300025261 Ga0209233_1000021 Ga0209233_1000021737 244
316 3300025711 Ga0207696_1000165 Ga0207696_100016515 244
317 3300025728 Ga0207655_1000754 Ga0207655_100075415 244
318 3300025735 Ga0207713_1000325 Ga0207713_100032539 244
319 3300025735 Ga0207713_1003599 Ga0207713_10035992 244
320 3300025914 Ga0207671_10000876 Ga0207671_1000087615 244
321 3300025920 Ga0207649_10000007 Ga0207649_10000007289 244
322 3300025934 Ga0207686_10001347 Ga0207686_1000134712 244
323 3300025935 Ga0207709_10002479 Ga0207709_1000247912 244
324 3300025945 Ga0207679_10000013 Ga0207679_1000001315 244
325 3300025961 Ga0207712_10009817 Ga0207712_100098176 244
326 3300027111 Ga0209281_1000091 Ga0209281_1000091145 244
327 3300027312 Ga0209371_1000929 Ga0209371_10009295 244
328 3300027666 Ga0209282_1042131 Ga0209282_10421312 244
329 3300027907 Ga0207428_10042514 Ga0207428_100425143 244
330 3300028379 Ga0268266_10136768 Ga0268266_101367682 244
331 3300030500 Ga0268256_1000782 Ga0268256_10007825 244
332 3300030521 Ga0307511_10008829 Ga0307511_100088292 244
333 3300039437 Ga0436365_1689934 Ga0436365_1689934_1622_2359 244
334 3300041407 Ga0439447_002739 Ga0439447_002739_5375_6142 244
335 3300041407 Ga0439447_013680 Ga0439447_013680_890_1657 244
336 3300041411 Ga0439466_0000289 Ga0439466_0000289_12501_13268 244
337 3300041411 Ga0439466_0001121 Ga0439466_0001121_3371_4138 244
338 3300041411 Ga0439466_0004035 Ga0439466_0004035_502_1269 244
339 3300042006 Ga0439432_001586 Ga0439432_001586_1368_2135 244
340 3300042006 Ga0439432_014726 Ga0439432_014726_1463_2230 244
341 3300042010 Ga0439452_000190 Ga0439452_000190_21102_21869 244
342 3300042010 Ga0439452_000443 Ga0439452_000443_7906_8673 244
343 3300042010 Ga0439452_001993 Ga0439452_001993_6341_7108 244
344 3300042115 Ga0450911_004119 Ga0450911_004119_959_1726 244
345 3300042876 Ga0451577_0277040 Ga0451577_0277040_472_1209 244
346 3300046453 Ga0495627_039198 Ga0495627_039198_171_938 244
347 3300046458 Ga0495591_027139 Ga0495591_027139_277_1044 244
348 3300046501 Ga0495607_0020047 Ga0495607_0020047_583_1350 244
349 3300046501 Ga0495607_0171456 Ga0495607_0171456_201_968 244
350 3300046507 Ga0495606_0002670 Ga0495606_0002670_9822_10589 244
351 3300046522 Ga0495643_0087473 Ga0495643_0087473_718_1485 244
352 3300046542 Ga0495597_0135952 Ga0495597_0135952_78_845 244
353 3300046660 Ga0495625_0135001 Ga0495625_0135001_419_1186 244
354 3300046665 Ga0495661_0058509 Ga0495661_0058509_1216_1983 244
355 3300046691 Ga0495670_0001599 Ga0495670_0001599_866_1633 244
356 3300047470 Ga0495681_0004777 Ga0495681_0004777_7132_7899 244
357 3300048919 Ga0496116_0000242 Ga0496116_0000242_9838_10605 244
358 3300048920 Ga0496117_0000270 Ga0496117_0000270_9843_10610 244
359 3300048921 Ga0496118_0069267 Ga0496118_0069267_1578_2345 244
360 3300048924 Ga0496121_0000318 Ga0496121_0000318_90222_90989 244
361 3300048925 Ga0496122_0141719 Ga0496122_0141719_241_1008 244
362 3300048927 Ga0496124_0002260 Ga0496124_0002260_22849_23616 244
363 iso_pu_bacteria 2826581358 2826582348 244
364 iso_pu_bacteria 2842815866 2842816999 244
365 iso_pu_bacteria 2842849001 2842852121 244
366 3300005288 Ga0065714_10021354 Ga0065714_100213541 245
367 3300013100 Ga0157373_10003814 Ga0157373_1000381410 245
368 3300013105 Ga0157369_10521216 Ga0157369_105212161 245
369 3300028379 Ga0268266_10002796 Ga0268266_1000279610 245
370 3300046453 Ga0495627_000646 Ga0495627_000646_10676_11443 245
371 3300046458 Ga0495591_000628 Ga0495591_000628_10164_10931 245
372 3300046460 Ga0495638_0011519 Ga0495638_0011519_1232_1999 245
373 3300046501 Ga0495607_0065376 Ga0495607_0065376_581_1351 245
374 3300046520 Ga0495637_0000466 Ga0495637_0000466_12415_13182 245
375 3300046648 Ga0495611_0000571 Ga0495611_0000571_10587_11354 245
376 3300046691 Ga0495670_0000388 Ga0495670_0000388_10512_11279 245
377 3300047321 Ga0495676_0021111 Ga0495676_0021111_637_1404 245
378 3300049571 Ga0501034_0042054 Ga0501034_0042054_1125_1886 245
379 3300049579 Ga0501043_0055575 Ga0501043_0055575_2296_3057 245
380 3300049581 Ga0501047_0530647 Ga0501047_0530647_89_850 245
381 iso_pu_bacteria 2510065053 2510282678 245
382 iso_pu_bacteria 2510065055 2510295333 245
383 iso_pu_bacteria 2510065058 2510311042 245
384 iso_pu_bacteria 2773857672 2774129165 245
385 iso_pu_bacteria 2842805378 2842807949 245
386 iso_pu_bacteria 2917832318 2917833288 245
387 iso_pu_bacteria 2919125081 2919126172 245
388 iso_pu_bacteria 2946027586 2946028288 245
389 iso_pu_bacteria 2974298342 2974302390 245
390 iso_pu_bacteria 2984499530 2984500056 245
391 iso_pu_bacteria 2984504281 2984506570 245
392 iso_pu_bacteria 8016728285 8016731414 245
393 3300002070 JGI24750J21931_1025787 JGI24750J21931_10257871 246
394 3300003781 Ga0055536_1000272 Ga0055536_100027217 246
395 3300003791 Ga0055530_10000548 Ga0055530_1000054811 246
396 3300003792 Ga0055540_1001116 Ga0055540_10011168 246
397 3300009011 Ga0105251_10000068 Ga0105251_1000006884 246
398 3300009036 Ga0105244_10030106 Ga0105244_100301062 246
399 3300009092 Ga0105250_10022663 Ga0105250_100226632 246
400 3300013100 Ga0157373_10006597 Ga0157373_100065972 246
401 3300013100 Ga0157373_10051866 Ga0157373_100518662 246
402 3300025292 Ga0209676_1000222 Ga0209676_100022217 246
403 3300025298 Ga0209050_1000296 Ga0209050_100029617 246
404 3300025303 Ga0209051_1000295 Ga0209051_100029563 246
405 3300025728 Ga0207655_1001733 Ga0207655_100173310 246
406 3300025735 Ga0207713_1000103 Ga0207713_1000103116 246
407 3300030742 Ga0316183_1101138 Ga0316183_11011381 246
408 3300030744 Ga0316181_1016487 Ga0316181_10164872 246
409 3300030744 Ga0316181_1111959 Ga0316181_11119592 246
410 3300031730 Ga0307516_10345550 Ga0307516_103455502 246
411 3300032004 Ga0307414_10422723 Ga0307414_104227232 246
412 3300041405 Ga0439438_012464 Ga0439438_012464_799_1566 246
413 3300041411 Ga0439466_0002385 Ga0439466_0002385_5908_6675 246
414 3300042016 Ga0439463_000120 Ga0439463_000120_8306_9073 246
415 3300042016 Ga0439463_000491 Ga0439463_000491_337_1104 246
416 3300042016 Ga0439463_001245 Ga0439463_001245_5813_6580 246
417 3300042115 Ga0450911_000509 Ga0450911_000509_1039_1806 246
418 3300042439 Ga0439464_0040131 Ga0439464_0040131_521_1288 246
419 3300044712 Ga0453684_0017471 Ga0453684_0017471_6185_6958 246
420 3300044712 Ga0453684_0040463 Ga0453684_0040463_5535_6308 246
421 3300046452 Ga0495617_024999 Ga0495617_024999_959_1726 246
422 3300046458 Ga0495591_000334 Ga0495591_000334_15237_16004 246
423 3300046458 Ga0495591_002668 Ga0495591_002668_5691_6458 246
424 3300046471 Ga0495650_0001617 Ga0495650_0001617_12246_13013 246
425 3300046474 Ga0495605_0000376 Ga0495605_0000376_15320_16087 246
426 3300046474 Ga0495605_0171991 Ga0495605_0171991_64_831 246
427 3300046491 Ga0495584_0009992 Ga0495584_0009992_2919_3686 246
428 3300046492 Ga0495585_0010265 Ga0495585_0010265_2449_3216 246
429 3300046501 Ga0495607_0000751 Ga0495607_0000751_15435_16202 246
430 3300046501 Ga0495607_0003423 Ga0495607_0003423_3045_3812 246
431 3300046501 Ga0495607_0014244 Ga0495607_0014244_3758_4525 246
432 3300046506 Ga0495583_0001254 Ga0495583_0001254_25261_26028 246
433 3300046507 Ga0495606_0000115 Ga0495606_0000115_10753_11520 246
434 3300046507 Ga0495606_0001164 Ga0495606_0001164_22662_23429 246
435 3300046513 Ga0495616_0088639 Ga0495616_0088639_416_1183 246
436 3300046515 Ga0495620_0001611 Ga0495620_0001611_6210_6977 246
437 3300046515 Ga0495620_0001719 Ga0495620_0001719_1334_2101 246
438 3300046515 Ga0495620_0003034 Ga0495620_0003034_5969_6736 246
439 3300046518 Ga0495631_0004094 Ga0495631_0004094_3102_3869 246
440 3300046518 Ga0495631_0006065 Ga0495631_0006065_4659_5426 246
441 3300046519 Ga0495632_0001795 Ga0495632_0001795_8668_9435 246
442 3300046519 Ga0495632_0015933 Ga0495632_0015933_191_958 246
443 3300046520 Ga0495637_0000054 Ga0495637_0000054_83958_84725 246
444 3300046520 Ga0495637_0000269 Ga0495637_0000269_28094_28861 246
445 3300046522 Ga0495643_0009905 Ga0495643_0009905_3017_3784 246
446 3300046522 Ga0495643_0010294 Ga0495643_0010294_56_823 246
447 3300046524 Ga0495648_0000783 Ga0495648_0000783_29891_30658 246
448 3300046524 Ga0495648_0017798 Ga0495648_0017798_2867_3634 246
449 3300046530 Ga0495654_0003497 Ga0495654_0003497_2655_3422 246
450 3300046530 Ga0495654_0015931 Ga0495654_0015931_2633_3400 246
451 3300046538 Ga0495609_0000061 Ga0495609_0000061_14804_15571 246
452 3300046616 Ga0495668_0029435 Ga0495668_0029435_54_821 246
453 3300046616 Ga0495668_0093913 Ga0495668_0093913_416_1183 246
454 3300046660 Ga0495625_0000147 Ga0495625_0000147_14946_15713 246
455 3300046665 Ga0495661_0000153 Ga0495661_0000153_14961_15728 246
456 3300046665 Ga0495661_0001727 Ga0495661_0001727_2939_3706 246
457 3300046692 Ga0495671_0003042 Ga0495671_0003042_2509_3276 246
458 3300046694 Ga0495649_0007937 Ga0495649_0007937_2489_3256 246
459 3300046810 Ga0495660_0014906 Ga0495660_0014906_335_1102 246
460 3300046810 Ga0495660_0055822 Ga0495660_0055822_949_1716 246
461 3300047321 Ga0495676_0000027 Ga0495676_0000027_126090_126857 246
462 3300047323 Ga0495683_0052279 Ga0495683_0052279_456_1223 246
463 3300047446 Ga0495679_000237 Ga0495679_000237_14952_15719 246
464 3300047469 Ga0495673_0001807 Ga0495673_0001807_9851_10618 246
465 3300047469 Ga0495673_0005394 Ga0495673_0005394_280_1047 246
466 3300047469 Ga0495673_0012990 Ga0495673_0012990_129_896 246
467 3300047470 Ga0495681_0003215 Ga0495681_0003215_577_1344 246
468 3300047472 Ga0495686_0007608 Ga0495686_0007608_1052_1819 246
469 3300047472 Ga0495686_0125865 Ga0495686_0125865_336_1103 246
470 3300048091 Ga0495626_0000067 Ga0495626_0000067_124381_125148 246
471 3300048091 Ga0495626_0012837 Ga0495626_0012837_137_904 246
472 3300048915 Ga0496112_0228484 Ga0496112_0228484_779_1546 246
473 3300048916 Ga0496113_0214562 Ga0496113_0214562_201_968 246
474 3300048919 Ga0496116_0002076 Ga0496116_0002076_9840_10607 246
475 3300048921 Ga0496118_0042191 Ga0496118_0042191_1659_2426 246
476 3300048924 Ga0496121_0003788 Ga0496121_0003788_4366_5133 246
477 3300048924 Ga0496121_0004345 Ga0496121_0004345_15065_15832 246
478 3300048925 Ga0496122_0000517 Ga0496122_0000517_64111_64878 246
479 3300048926 Ga0496123_0000243 Ga0496123_0000243_15013_15780 246
480 3300048927 Ga0496124_0000511 Ga0496124_0000511_14900_15667 246
481 3300048927 Ga0496124_0002328 Ga0496124_0002328_13557_14324 246
482 3300048927 Ga0496124_0023005 Ga0496124_0023005_3372_4139 246
483 3300049459 Ga0495678_000499 Ga0495678_000499_28094_28861 246
484 3300049459 Ga0495678_002365 Ga0495678_002365_10865_11632 246
485 3300049459 Ga0495678_008793 Ga0495678_008793_1775_2542 246
486 3300049460 Ga0495682_0000804 Ga0495682_0000804_8527_9294 246
487 3300053117 Ga0500593_000476 Ga0500593_000476_13134_13898 246
488 3300003781 Ga0055536_1003957 Ga0055536_10039572 247
489 3300003781 Ga0055536_1008918 Ga0055536_10089182 247
490 3300003791 Ga0055530_10002934 Ga0055530_100029344 247
491 3300003792 Ga0055540_1000242 Ga0055540_100024224 247
492 3300003794 Ga0055531_10001033 Ga0055531_1000103312 247
493 3300005353 Ga0070669_100000158 Ga0070669_10000015834 247
494 3300005366 Ga0070659_100407812 Ga0070659_1004078121 247
495 3300005457 Ga0070662_100087854 Ga0070662_1000878542 247
496 3300005536 Ga0070697_100147240 Ga0070697_1001472402 247
497 3300006177 Ga0075362_10066213 Ga0075362_100662132 247
498 3300009011 Ga0105251_10000881 Ga0105251_1000088123 247
499 3300009036 Ga0105244_10011847 Ga0105244_100118473 247
500 3300009092 Ga0105250_10031572 Ga0105250_100315721 247
501 3300009092 Ga0105250_10038529 Ga0105250_100385292 247
502 3300009148 Ga0105243_10000867 Ga0105243_1000086714 247
503 3300013307 Ga0157372_10052807 Ga0157372_100528072 247
504 3300015265 Ga0182005_1018031 Ga0182005_10180313 247
505 3300025230 Ga0209563_101660 Ga0209563_1016604 247
506 3300025292 Ga0209676_1000015 Ga0209676_100001584 247
507 3300025292 Ga0209676_1000157 Ga0209676_100015789 247
508 3300025298 Ga0209050_1000030 Ga0209050_1000030354 247
509 3300025303 Ga0209051_1000143 Ga0209051_100014385 247
510 3300025304 Ga0209257_1000143 Ga0209257_10001433 247
511 3300025711 Ga0207696_1000151 Ga0207696_100015135 247
512 3300025728 Ga0207655_1000135 Ga0207655_1000135124 247
513 3300025728 Ga0207655_1004957 Ga0207655_10049577 247
514 3300025728 Ga0207655_1018736 Ga0207655_10187361 247
515 3300025735 Ga0207713_1050375 Ga0207713_10503752 247
516 3300025932 Ga0207690_10391921 Ga0207690_103919212 247
517 3300025933 Ga0207706_10011123 Ga0207706_100111233 247
518 3300025935 Ga0207709_10001047 Ga0207709_100010476 247
519 3300026067 Ga0207678_10710562 Ga0207678_107105621 247
520 3300027111 Ga0209281_1020632 Ga0209281_10206322 247
521 3300042435 Ga0439434_0000184 Ga0439434_0000184_15814_16566 247
522 3300044683 Ga0466965_0064128 Ga0466965_0064128_483_1301 247
523 3300046453 Ga0495627_010851 Ga0495627_010851_1758_2525 247
524 3300046457 Ga0495590_0002659 Ga0495590_0002659_2824_3591 247
525 3300046458 Ga0495591_000198 Ga0495591_000198_47569_48336 247
526 3300046458 Ga0495591_002016 Ga0495591_002016_11032_11799 247
527 3300046458 Ga0495591_017440 Ga0495591_017440_86_853 247
528 3300046460 Ga0495638_0011328 Ga0495638_0011328_3568_4335 247
529 3300046460 Ga0495638_0057233 Ga0495638_0057233_1207_1974 247
530 3300046460 Ga0495638_0060978 Ga0495638_0060978_1411_2178 247
531 3300046471 Ga0495650_0008792 Ga0495650_0008792_4315_5082 247
532 3300046471 Ga0495650_0076954 Ga0495650_0076954_446_1213 247
533 3300046474 Ga0495605_0000019 Ga0495605_0000019_242239_243006 247
534 3300046474 Ga0495605_0000664 Ga0495605_0000664_25182_25949 247
535 3300046474 Ga0495605_0002242 Ga0495605_0002242_3201_3968 247
536 3300046491 Ga0495584_0006909 Ga0495584_0006909_3471_4238 247
537 3300046499 Ga0495594_0011120 Ga0495594_0011120_383_1150 247
538 3300046500 Ga0495596_0000175 Ga0495596_0000175_20722_21489 247
539 3300046501 Ga0495607_0000306 Ga0495607_0000306_38134_38901 247
540 3300046506 Ga0495583_0000146 Ga0495583_0000146_27005_27772 247
541 3300046512 Ga0495610_0003687 Ga0495610_0003687_10802_11569 247
542 3300046512 Ga0495610_0008413 Ga0495610_0008413_1219_1986 247
543 3300046513 Ga0495616_0035228 Ga0495616_0035228_1252_2019 247
544 3300046515 Ga0495620_0000108 Ga0495620_0000108_27029_27796 247
545 3300046520 Ga0495637_0000194 Ga0495637_0000194_25935_26702 247
546 3300046520 Ga0495637_0041970 Ga0495637_0041970_220_987 247
547 3300046522 Ga0495643_0019663 Ga0495643_0019663_78_845 247
548 3300046524 Ga0495648_0002748 Ga0495648_0002748_6336_7103 247
549 3300046530 Ga0495654_0001010 Ga0495654_0001010_7976_8743 247
550 3300046538 Ga0495609_0000101 Ga0495609_0000101_27006_27773 247
551 3300046542 Ga0495597_0000676 Ga0495597_0000676_6430_7197 247
552 3300046542 Ga0495597_0004012 Ga0495597_0004012_812_1579 247
553 3300046542 Ga0495597_0005967 Ga0495597_0005967_2650_3417 247
554 3300046558 Ga0495633_0000129 Ga0495633_0000129_73045_73812 247
555 3300046616 Ga0495668_0001708 Ga0495668_0001708_14667_15434 247
556 3300046648 Ga0495611_0001821 Ga0495611_0001821_6959_7726 247
557 3300046665 Ga0495661_0074274 Ga0495661_0074274_450_1217 247
558 3300046691 Ga0495670_0003795 Ga0495670_0003795_1758_2525 247
559 3300047446 Ga0495679_000495 Ga0495679_000495_114_881 247
560 3300047469 Ga0495673_0001628 Ga0495673_0001628_8634_9401 247
561 3300047469 Ga0495673_0008202 Ga0495673_0008202_3340_4107 247
562 3300047472 Ga0495686_0127672 Ga0495686_0127672_128_895 247
563 3300048091 Ga0495626_0000684 Ga0495626_0000684_20681_21448 247
564 3300048091 Ga0495626_0001171 Ga0495626_0001171_10226_10993 247
565 3300048925 Ga0496122_0138317 Ga0496122_0138317_457_1224 247
566 3300048926 Ga0496123_0040963 Ga0496123_0040963_2274_3041 247
567 3300048927 Ga0496124_0028667 Ga0496124_0028667_3383_4156 247
568 iso_pu_bacteria 2554235132 2554818311 247
569 iso_pu_bacteria 2606217733 2608380395 247
570 iso_pu_bacteria 2808606379 2808942257 247
571 iso_pu_bacteria 8011350971 8011351071 247
572 3300005290 Ga0065712_10074016 Ga0065712_100740161 248
573 3300005331 Ga0070670_100000010 Ga0070670_100000010194 248
574 3300005353 Ga0070669_100002451 Ga0070669_1000024512 248
575 3300005355 Ga0070671_100000012 Ga0070671_100000012129 248
576 3300005365 Ga0070688_100002333 Ga0070688_1000023332 248
577 3300005367 Ga0070667_100000097 Ga0070667_10000009721 248
578 3300005466 Ga0070685_10000077 Ga0070685_1000007720 248
579 3300005548 Ga0070665_100078702 Ga0070665_1000787026 248
580 3300005617 Ga0068859_100014469 Ga0068859_1000144695 248
581 3300005618 Ga0068864_100000018 Ga0068864_100000018100 248
582 3300005842 Ga0068858_100024458 Ga0068858_1000244583 248
583 3300005843 Ga0068860_100000532 Ga0068860_10000053234 248
584 3300005844 Ga0068862_100000522 Ga0068862_10000052218 248
585 3300006931 Ga0097620_100014468 Ga0097620_1000144685 248
586 3300009092 Ga0105250_10037205 Ga0105250_100372052 248
587 3300009177 Ga0105248_10123998 Ga0105248_101239982 248
588 3300009553 Ga0105249_10093807 Ga0105249_100938073 248
589 3300013306 Ga0163162_10079724 Ga0163162_100797244 248
590 3300014325 Ga0163163_10001112 Ga0163163_1000111212 248
591 3300014968 Ga0157379_10054053 Ga0157379_100540532 248
592 3300015261 Ga0182006_1002154 Ga0182006_100215410 248
593 3300025711 Ga0207696_1024677 Ga0207696_10246772 248
594 3300025900 Ga0207710_10008242 Ga0207710_100082426 248
595 3300025923 Ga0207681_10006732 Ga0207681_100067329 248
596 3300025925 Ga0207650_10000003 Ga0207650_10000003308 248
597 3300025931 Ga0207644_10001111 Ga0207644_100011113 248
598 3300025941 Ga0207711_10002049 Ga0207711_100020492 248
599 3300025961 Ga0207712_10025348 Ga0207712_100253483 248
600 3300025986 Ga0207658_10000007 Ga0207658_1000000797 248
601 3300026088 Ga0207641_10094982 Ga0207641_100949823 248
602 3300026095 Ga0207676_10000003 Ga0207676_10000003787 248
603 3300028379 Ga0268266_10041478 Ga0268266_100414781 248
604 3300028380 Ga0268265_10000234 Ga0268265_100002342 248
605 3300028381 Ga0268264_10000009 Ga0268264_10000009347 248
606 3300042013 Ga0439456_000036 Ga0439456_000036_14688_15455 248
607 3300046526 Ga0495666_0107903 Ga0495666_0107903_91_858 248
608 3300046542 Ga0495597_0021813 Ga0495597_0021813_1952_2719 248
609 3300046810 Ga0495660_0004060 Ga0495660_0004060_5370_6137 248
610 3300047469 Ga0495673_0000389 Ga0495673_0000389_6264_7031 248
611 3300048928 Ga0496125_0021605 Ga0496125_0021605_4394_5143 248
612 3300048929 Ga0496126_0698856 Ga0496126_0698856_23_772 248
613 iso_pu_bacteria 2808606373 2808905826 248
614 iso_pu_bacteria 2811994881 2812369855 248
615 iso_pu_bacteria 2923519811 2923523941 248
616 iso_pu_bacteria 3007419365 3007422426 248
617 iso_pu_bacteria 8011350971 8011356246 248
618 iso_pu_bacteria 8056137416 8056140045 248
619 3300009011 Ga0105251_10071828 Ga0105251_100718282 249
620 3300009036 Ga0105244_10005309 Ga0105244_100053092 249
621 3300009148 Ga0105243_10001447 Ga0105243_1000144710 249
622 3300011119 Ga0105246_10000504 Ga0105246_1000050415 249
623 3300025728 Ga0207655_1001422 Ga0207655_10014229 249
624 3300025735 Ga0207713_1003772 Ga0207713_10037722 249
625 3300025735 Ga0207713_1006916 Ga0207713_10069165 249
626 3300025735 Ga0207713_1041073 Ga0207713_10410732 249
627 3300025735 Ga0207713_1048900 Ga0207713_10489002 249
628 3300025935 Ga0207709_10000107 Ga0207709_1000010743 249
629 3300046501 Ga0495607_0012685 Ga0495607_0012685_4128_4895 249
630 3300046665 Ga0495661_0000196 Ga0495661_0000196_27014_27781 249
631 3300046665 Ga0495661_0082777 Ga0495661_0082777_705_1472 249
632 3300046691 Ga0495670_0005439 Ga0495670_0005439_4134_4901 249
633 3300046692 Ga0495671_0001900 Ga0495671_0001900_7624_8391 249
634 3300046794 Ga0495589_0002719 Ga0495589_0002719_8395_9162 249
635 3300047323 Ga0495683_0000075 Ga0495683_0000075_26938_27705 249
636 3300047470 Ga0495681_0022208 Ga0495681_0022208_747_1514 249
637 3300049459 Ga0495678_000106 Ga0495678_000106_26933_27700 249
638 iso_pu_bacteria 2738543020 2739288737 249
639 iso_pu_bacteria 2738543020 2739289693 249
640 iso_pu_bacteria 2738543021 2739294049 249
641 iso_pu_bacteria 2738543021 2739295005 249
642 iso_pu_bacteria 2842805378 2842805456 249
643 iso_pu_bacteria 2554235132 2554818595 250
644 iso_pu_bacteria 2606217733 2608384257 250
645 iso_pu_bacteria 2860339153 2860345250 250
646 iso_pu_bacteria 2912963787 2912963883 250
647 iso_pu_bacteria 2931396565 2931398449 250
648 iso_pu_bacteria 2939651529 2939654486 250
649 iso_pu_bacteria 8019769354 8019769374 250
650 iso_pu_bacteria 8057798959 8057802339 250
651 3300042115 Ga0450911_000011 Ga0450911_000011_120309_121067 251
652 3300042118 Ga0450914_000201 Ga0450914_000201_705_1466 251
653 3300042139 Ga0450904_000097 Ga0450904_000097_10939_11697 251
654 3300042156 Ga0439446_0002934 Ga0439446_0002934_692_1450 251
655 3300042530 Ga0450916_000505 Ga0450916_000505_822_1580 251
656 3300049568 Ga0501031_0079268 Ga0501031_0079268_803_1561 251
657 3300049574 Ga0501038_0165610 Ga0501038_0165610_881_1639 251
658 3300049853 Ga0501226_000034 Ga0501226_000034_34256_35014 251
659 iso_pu_bacteria 2511231006 2511264702 251
660 iso_pu_bacteria 2511231007 2511274353 251
661 iso_pu_bacteria 2511231008 2511279868 251
662 iso_pu_bacteria 2511231010 2511289681 251
663 iso_pu_bacteria 2511231011 2511294610 251
664 iso_pu_bacteria 2511231012 2511298919 251
665 iso_pu_bacteria 2511231014 2511313102 251
666 iso_pu_bacteria 2511231015 2511322234 251
667 iso_pu_bacteria 2511231016 2511325254 251
668 iso_pu_bacteria 2511231017 2511332238 251
669 iso_pu_bacteria 2511231019 2511347000 251
670 iso_pu_bacteria 2511231020 2511348012 251
671 iso_pu_bacteria 2511231021 2511359156 251
672 iso_pu_bacteria 2511231022 2511366124 251
673 iso_pu_bacteria 2511231023 2511370490 251
674 iso_pu_bacteria 2511231024 2511377020 251
675 iso_pu_bacteria 2511231031 2511412441 251
676 iso_pu_bacteria 2511231156 2511822033 251
677 iso_pu_bacteria 2512047018 2512325215 251
678 iso_pu_bacteria 2554235231 2555245329 251
679 iso_pu_bacteria 2554235341 2555667044 251
680 iso_pu_bacteria 2582580891 2583795313 251
681 iso_pu_bacteria 2597489887 2597855295 251
682 iso_pu_bacteria 2597489888 2597861296 251
683 iso_pu_bacteria 2597489889 2597867043 251
684 iso_pu_bacteria 2599185160 2599355547 251
685 iso_pu_bacteria 2599185161 2599363050 251
686 iso_pu_bacteria 2599185162 2599368644 251
687 iso_pu_bacteria 2599185163 2599376159 251
688 iso_pu_bacteria 2599185164 2599380653 251
689 iso_pu_bacteria 2599185165 2599387831 251
690 iso_pu_bacteria 2599185166 2599395017 251
691 iso_pu_bacteria 2599185167 2599401183 251
692 iso_pu_bacteria 2599185168 2599406782 251
693 iso_pu_bacteria 2599185179 2599449484 251
694 iso_pu_bacteria 2599185181 2599462381 251
695 iso_pu_bacteria 2599185182 2599468196 251
696 iso_pu_bacteria 2599185185 2599487421 251
697 iso_pu_bacteria 2599185186 2599491398 251
698 iso_pu_bacteria 2599185188 2599503814 251
699 iso_pu_bacteria 2599185189 2599506122 251
700 iso_pu_bacteria 2599185190 2599511556 251
701 iso_pu_bacteria 2599185191 2599516530 251
702 iso_pu_bacteria 2599185212 2599612597 251
703 iso_pu_bacteria 2599185248 2599767791 251
704 iso_pu_bacteria 2599185257 2599804223 251
705 iso_pu_bacteria 2599185288 2599879417 251
706 iso_pu_bacteria 2599185289 2599887892 251
707 iso_pu_bacteria 2599185290 2599893059 251
708 iso_pu_bacteria 2599185291 2599899417 251
709 iso_pu_bacteria 2599185300 2599933247 251
710 iso_pu_bacteria 2599185302 2599942004 251
711 iso_pu_bacteria 2599185303 2599948637 251
712 iso_pu_bacteria 2599185304 2599954985 251
713 iso_pu_bacteria 2599185305 2599963560 251
714 iso_pu_bacteria 2599185306 2599966423 251
715 iso_pu_bacteria 2599185307 2599975255 251
716 iso_pu_bacteria 2599185308 2599977272 251
717 iso_pu_bacteria 2599185309 2599986292 251
718 iso_pu_bacteria 2599185310 2599991345 251
719 iso_pu_bacteria 2599185311 2599995162 251
720 iso_pu_bacteria 2599185312 2600000826 251
721 iso_pu_bacteria 2599185313 2600007474 251
722 iso_pu_bacteria 2599185314 2600011295 251
723 iso_pu_bacteria 2599185315 2600020215 251
724 iso_pu_bacteria 2599185316 2600026578 251
725 iso_pu_bacteria 2599185317 2600029540 251
726 iso_pu_bacteria 2599185318 2600037608 251
727 iso_pu_bacteria 2599185319 2600044264 251
728 iso_pu_bacteria 2599185320 2600050046 251
729 iso_pu_bacteria 2599185321 2600054706 251
730 iso_pu_bacteria 2599185322 2600059889 251
731 iso_pu_bacteria 2599185323 2600065308 251
732 iso_pu_bacteria 2599185324 2600073249 251
733 iso_pu_bacteria 2599185325 2600078980 251
734 iso_pu_bacteria 2599185356 2600215003 251
735 iso_pu_bacteria 2600254930 2600358776 251
736 iso_pu_bacteria 2600254931 2600363094 251
737 iso_pu_bacteria 2600255283 2601627782 251
738 iso_pu_bacteria 2600255296 2601693370 251
739 iso_pu_bacteria 2600255313 2601775169 251
740 iso_pu_bacteria 2600255318 2601798184 251
741 iso_pu_bacteria 2603880185 2606077072 251
742 iso_pu_bacteria 2603880199 2606129682 251
743 iso_pu_bacteria 2619619299 2621296449 251
744 iso_pu_bacteria 2623620443 2624477811 251
745 iso_pu_bacteria 2623620446 2624489389 251
746 iso_pu_bacteria 2643221565 2643843165 251
747 iso_pu_bacteria 2643221571 2643873585 251
748 iso_pu_bacteria 2643221589 2643956033 251
749 iso_pu_bacteria 2643221602 2644020155 251
750 iso_pu_bacteria 2643221633 2644184167 251
751 iso_pu_bacteria 2643221650 2644282863 251
752 iso_pu_bacteria 2643221713 2644624398 251
753 iso_pu_bacteria 2651869719 2652544482 251
754 iso_pu_bacteria 2667528170 2671091921 251
755 iso_pu_bacteria 2667528171 2671099691 251
756 iso_pu_bacteria 2667528176 2671129625 251
757 iso_pu_bacteria 2671180172 2671771232 251
758 iso_pu_bacteria 2675903420 2677900373 251
759 iso_pu_bacteria 2675903515 2678266506 251
760 iso_pu_bacteria 2713897148 2715749509 251
761 iso_pu_bacteria 2713897149 2715754506 251
762 iso_pu_bacteria 2721755607 2723246199 251
763 iso_pu_bacteria 2738541265 2738673395 251
764 iso_pu_bacteria 2738541271 2738690672 251
765 iso_pu_bacteria 2738541282 2738751788 251
766 iso_pu_bacteria 2738541294 2738807641 251
767 iso_pu_bacteria 2738541303 2738860829 251
768 iso_pu_bacteria 2738541309 2738895001 251
769 iso_pu_bacteria 2738543004 2739200952 251
770 iso_pu_bacteria 2738543015 2739261788 251
771 iso_pu_bacteria 2738543016 2739266446 251
772 iso_pu_bacteria 2738543025 2739312156 251
773 iso_pu_bacteria 2740892503 2743740864 251
774 iso_pu_bacteria 2744054620 2745007736 251
775 iso_pu_bacteria 2765235841 2765581309 251
776 iso_pu_bacteria 2773857670 2774118033 251
777 iso_pu_bacteria 2773857673 2774136530 251
778 iso_pu_bacteria 2784132063 2784261474 251
779 iso_pu_bacteria 2784132072 2784316520 251
780 iso_pu_bacteria 2791355520 2794593604 251
781 iso_pu_bacteria 2806310737 2807405892 251
782 iso_pu_bacteria 2806310745 2807454227 251
783 iso_pu_bacteria 2808606361 2808858624 251
784 iso_pu_bacteria 2808606376 2808923943 251
785 iso_pu_bacteria 2808606377 2808928115 251
786 iso_pu_bacteria 2808606378 2808938584 251
787 iso_pu_bacteria 2808606380 2808946202 251
788 iso_pu_bacteria 2808606381 2808950703 251
789 iso_pu_bacteria 2808606382 2808960674 251
790 iso_pu_bacteria 2808606383 2808967129 251
791 iso_pu_bacteria 2808606385 2808980049 251
792 iso_pu_bacteria 2808606388 2808995769 251
793 iso_pu_bacteria 2808606389 2809001939 251
794 iso_pu_bacteria 2816332298 2817488072 251
795 iso_pu_bacteria 2818991456 2819655466 251
796 iso_pu_bacteria 2818991464 2819704838 251
797 iso_pu_bacteria 2825651385 2825654706 251
798 iso_pu_bacteria 2834028612 2834031330 251
799 iso_pu_bacteria 2842826826 2842832034 251
800 iso_pu_bacteria 2842832357 2842833780 251
801 iso_pu_bacteria 2842837860 2842838305 251
802 iso_pu_bacteria 2842843487 2842846014 251
803 iso_pu_bacteria 2842854478 2842855968 251
804 iso_pu_bacteria 2844665904 2844667531 251
805 iso_pu_bacteria 2852612431 2852616727 251
806 iso_pu_bacteria 2852657418 2852662613 251
807 iso_pu_bacteria 2852667396 2852671695 251
808 iso_pu_bacteria 2860867994 2860868096 251
809 iso_pu_bacteria 2878029506 2878029754 251
810 iso_pu_bacteria 2880230671 2880230704 251
811 iso_pu_bacteria 2904518522 2904518615 251
812 iso_pu_bacteria 2904550169 2904553440 251
813 iso_pu_bacteria 2908446538 2908446685 251
814 iso_pu_bacteria 2913036834 2913036894 251
815 iso_pu_bacteria 2917070673 2917070781 251
816 iso_pu_bacteria 2919063839 2919067989 251
817 iso_pu_bacteria 2919155634 2919156189 251
818 iso_pu_bacteria 2919385768 2919388836 251
819 iso_pu_bacteria 2919456309 2919457905 251
820 iso_pu_bacteria 2919481497 2919487013 251
821 iso_pu_bacteria 2919487758 2919487799 251
822 iso_pu_bacteria 2919697872 2919702406 251
823 iso_pu_bacteria 2923153595 2923153696 251
824 iso_pu_bacteria 2923586266 2923589324 251
825 iso_pu_bacteria 2929144301 2929144364 251
826 iso_pu_bacteria 2929189879 2929189979 251
827 iso_pu_bacteria 2931369376 2931372309 251
828 iso_pu_bacteria 2931390751 2931391040 251
829 iso_pu_bacteria 2935353572 2935357884 251
830 iso_pu_bacteria 2939636861 2939640523 251
831 iso_pu_bacteria 2945928738 2945930503 251
832 iso_pu_bacteria 2945961074 2945967252 251
833 iso_pu_bacteria 2946006987 2946012849 251
834 iso_pu_bacteria 2947233263 2947234805 251
835 iso_pu_bacteria 2969304461 2969304510 251
836 iso_pu_bacteria 2974289157 2974293740 251
837 iso_pu_bacteria 2984286254 2984292417 251
838 iso_pu_bacteria 2988728565 2988731826 251
839 iso_pu_bacteria 2998139840 2998140074 251
840 iso_pu_bacteria 3007252601 3007253994 251
841 iso_pu_bacteria 3007315729 3007317262 251
842 iso_pu_bacteria 3007395558 3007398979 251
843 iso_pu_bacteria 3007419365 3007419681 251
844 iso_pu_bacteria 3007511990 3007517492 251
845 iso_pu_bacteria 3007614139 3007617046 251
846 iso_pu_bacteria 3007619802 3007623817 251
847 iso_pu_bacteria 3007718800 3007722064 251
848 iso_pu_bacteria 3007803356 3007804062 251
849 iso_pu_bacteria 3007855910 3007859519 251
850 iso_pu_bacteria 3007861166 3007864748 251
851 iso_pu_bacteria 3007866637 3007871724 251
852 iso_pu_bacteria 637000220 637317447 251
853 iso_pu_bacteria 8015687852 8015687959 251
854 iso_pu_bacteria 8019775933 8019779629 251
855 iso_pu_bacteria 8029995093 8029995176 251
856 iso_pu_bacteria 8052494512 8052494527 251
857 iso_pu_bacteria 8054285046 8054287601 251
858 iso_pu_bacteria 8054347763 8054349212 251
859 iso_pu_bacteria 8054503363 8054503646 251
860 iso_pu_bacteria 8054929484 8054930031 251
861 iso_pu_bacteria 8055770955 8055771057 251
862 iso_pu_bacteria 8055817908 8055818009 251
863 iso_pu_bacteria 8055878733 8055883518 251
864 iso_pu_bacteria 8056115690 8056116224 251
865 iso_pu_bacteria 8056120720 8056120821 251
866 iso_pu_bacteria 8056125926 8056126093 251
867 iso_pu_bacteria 8056131705 8056131978 251
868 iso_pu_bacteria 8056137416 8056137516 251
869 iso_pu_bacteria 8056143049 8056143302 251
870 iso_pu_bacteria 8056148874 8056151124 251
871 iso_pu_bacteria 8056155041 8056160071 251
872 iso_pu_bacteria 8056161164 8056164007 251
873 iso_pu_bacteria 8056166840 8056170973 251
874 iso_pu_bacteria 8056172158 8056177106 251
875 iso_pu_bacteria 8056177738 8056182197 251
876 iso_pu_bacteria 8056569372 8056570805 251
877 3300027395 Ga0209996_1002016 Ga0209996_10020163 252
878 3300027471 Ga0209995_1004740 Ga0209995_10047401 252
879 3300027526 Ga0209968_1004678 Ga0209968_10046782 252
880 3300027617 Ga0210002_1006695 Ga0210002_10066952 252
881 3300027665 Ga0209983_1001053 Ga0209983_10010536 252
882 3300027876 Ga0209974_10057638 Ga0209974_100576382 252
883 3300013104 Ga0157370_10000698 Ga0157370_1000069813 253
884 3300046507 Ga0495606_0000246 Ga0495606_0000246_39087_39854 253
885 3300046522 Ga0495643_0001680 Ga0495643_0001680_8834_9601 253
886 3300046522 Ga0495643_0002454 Ga0495643_0002454_10624_11391 253
887 3300046692 Ga0495671_0001192 Ga0495671_0001192_13324_14091 253
888 3300046694 Ga0495649_0000711 Ga0495649_0000711_16672_17439 253
889 3300046694 Ga0495649_0009797 Ga0495649_0009797_3099_3866 253
890 3300046810 Ga0495660_0036778 Ga0495660_0036778_1857_2624 253
891 3300046463 Ga0495653_0147285 Ga0495653_0147285_400_1164 254
892 3300046526 Ga0495666_0042994 Ga0495666_0042994_400_1164 254
893 3300046536 Ga0495587_0057179 Ga0495587_0057179_1131_1895 254
894 3300046642 Ga0495634_0015246 Ga0495634_0015246_3698_4462 254
895 3300046663 Ga0495635_0000604 Ga0495635_0000604_3138_3902 254
896 3300046680 Ga0495646_0039441 Ga0495646_0039441_1036_1800 254
897 3300047317 Ga0495604_0012043 Ga0495604_0012043_5155_5919 254
898 3300047319 Ga0495674_0034797 Ga0495674_0034797_936_1700 254
899 3300047673 Ga0495593_0071064 Ga0495593_0071064_925_1689 254
900 3300048905 Ga0496102_0034338 Ga0496102_0034338_2726_3490 254
901 3300048906 Ga0496103_0014973 Ga0496103_0014973_908_1672 254
902 3300048919 Ga0496116_0023569 Ga0496116_0023569_1052_1816 254
903 3300048929 Ga0496126_0099192 Ga0496126_0099192_639_1406 254
904 2124908027 MRS2a_Contig_6737 MRS2a_00594650 255
905 2124908027 MRS2a_Contig_799 MRS2a_00654200 255
906 3300003856 Ga0058692_1008307 Ga0058692_10083072 255
907 3300005288 Ga0065714_10002860 Ga0065714_100028609 255
908 3300005288 Ga0065714_10107372 Ga0065714_101073722 255
909 3300005289 Ga0065704_10001959 Ga0065704_100019592 255
910 3300005289 Ga0065704_10009110 Ga0065704_100091104 255
911 3300005290 Ga0065712_10001109 Ga0065712_100011093 255
912 3300005293 Ga0065715_10013766 Ga0065715_100137662 255
913 3300006058 Ga0075432_10000648 Ga0075432_100006485 255
914 3300006177 Ga0075362_10072007 Ga0075362_100720071 255
915 3300006186 Ga0075369_10045588 Ga0075369_100455882 255
916 3300006944 Ga0099823_1000217 Ga0099823_10002179 255
917 3300006946 Ga0079104_1000291 Ga0079104_100029143 255
918 3300009036 Ga0105244_10001163 Ga0105244_100011633 255
919 3300009036 Ga0105244_10007469 Ga0105244_100074695 255
920 3300009036 Ga0105244_10030745 Ga0105244_100307452 255
921 3300009036 Ga0105244_10072164 Ga0105244_100721642 255
922 3300009036 Ga0105244_10076055 Ga0105244_100760552 255
923 3300009092 Ga0105250_10023442 Ga0105250_100234422 255
924 3300009092 Ga0105250_10056987 Ga0105250_100569871 255
925 3300009148 Ga0105243_10010141 Ga0105243_100101416 255
926 3300009176 Ga0105242_10214496 Ga0105242_102144962 255
927 3300011119 Ga0105246_10010894 Ga0105246_100108947 255
928 3300013100 Ga0157373_10023762 Ga0157373_100237625 255
929 3300013104 Ga0157370_10186706 Ga0157370_101867062 255
930 3300013306 Ga0163162_10224194 Ga0163162_102241942 255
931 3300013307 Ga0157372_10013753 Ga0157372_100137533 255
932 3300014497 Ga0182008_10003405 Ga0182008_100034052 255
933 3300015261 Ga0182006_1001380 Ga0182006_100138010 255
934 3300015261 Ga0182006_1003537 Ga0182006_10035374 255
935 3300015262 Ga0182007_10000228 Ga0182007_1000022815 255
936 3300015265 Ga0182005_1000375 Ga0182005_100037515 255
937 3300017792 Ga0163161_10050909 Ga0163161_100509093 255
938 3300017792 Ga0163161_10287792 Ga0163161_102877921 255
939 3300017792 Ga0163161_10339170 Ga0163161_103391701 255
940 3300025292 Ga0209676_1002823 Ga0209676_10028233 255
941 3300025292 Ga0209676_1004012 Ga0209676_10040126 255
942 3300025298 Ga0209050_1001114 Ga0209050_100111419 255
943 3300025303 Ga0209051_1005691 Ga0209051_10056916 255
944 3300025711 Ga0207696_1000055 Ga0207696_1000055241 255
945 3300025711 Ga0207696_1003300 Ga0207696_10033003 255
946 3300025711 Ga0207696_1007367 Ga0207696_10073672 255
947 3300025711 Ga0207696_1015831 Ga0207696_10158312 255
948 3300025711 Ga0207696_1028968 Ga0207696_10289682 255
949 3300025728 Ga0207655_1000548 Ga0207655_100054816 255
950 3300025728 Ga0207655_1000667 Ga0207655_100066716 255
951 3300025728 Ga0207655_1001254 Ga0207655_10012542 255
952 3300025728 Ga0207655_1004181 Ga0207655_10041819 255
953 3300025728 Ga0207655_1008902 Ga0207655_10089028 255
954 3300025728 Ga0207655_1009242 Ga0207655_10092422 255
955 3300025728 Ga0207655_1026577 Ga0207655_10265772 255
956 3300025728 Ga0207655_1038021 Ga0207655_10380212 255
957 3300025728 Ga0207655_1087014 Ga0207655_10870141 255
958 3300025735 Ga0207713_1004686 Ga0207713_10046864 255
959 3300025735 Ga0207713_1010743 Ga0207713_10107434 255
960 3300025735 Ga0207713_1016458 Ga0207713_10164583 255
961 3300025735 Ga0207713_1020322 Ga0207713_10203222 255
962 3300025735 Ga0207713_1022973 Ga0207713_10229732 255
963 3300025934 Ga0207686_10388387 Ga0207686_103883871 255
964 3300025935 Ga0207709_10009947 Ga0207709_100099472 255
965 3300025935 Ga0207709_10136564 Ga0207709_101365643 255
966 3300025935 Ga0207709_10544924 Ga0207709_105449241 255
967 3300027111 Ga0209281_1000237 Ga0209281_100023738 255
968 3300027296 Ga0209389_1000065 Ga0209389_100006589 255
969 3300027312 Ga0209371_1000176 Ga0209371_100017622 255
970 3300027907 Ga0207428_10051774 Ga0207428_100517741 255
971 3300027907 Ga0207428_10299703 Ga0207428_102997032 255
972 3300030500 Ga0268256_1000146 Ga0268256_100014678 255
973 3300041405 Ga0439438_005624 Ga0439438_005624_2389_3156 255
974 3300041411 Ga0439466_0001334 Ga0439466_0001334_7001_7768 255
975 3300042006 Ga0439432_031069 Ga0439432_031069_129_896 255
976 3300042009 Ga0439451_002140 Ga0439451_002140_209_976 255
977 3300042010 Ga0439452_008676 Ga0439452_008676_1368_2135 255
978 3300042013 Ga0439456_005910 Ga0439456_005910_369_1136 255
979 3300042115 Ga0450911_000211 Ga0450911_000211_21423_22190 255
980 3300042121 Ga0450919_003455 Ga0450919_003455_570_1337 255
981 3300042124 Ga0450922_001769 Ga0450922_001769_511_1278 255
982 3300042127 Ga0450890_000131 Ga0450890_000131_945_1712 255
983 3300042137 Ga0450902_001841 Ga0450902_001841_1169_1939 255
984 3300042142 Ga0450905_000157 Ga0450905_000157_621_1391 255
985 3300042145 Ga0450906_006046 Ga0450906_006046_640_1407 255
986 3300042146 Ga0450907_000110 Ga0450907_000110_9599_10366 255
987 3300042146 Ga0450907_003387 Ga0450907_003387_965_1732 255
988 3300042147 Ga0450910_002043 Ga0450910_002043_1558_2325 255
989 3300042156 Ga0439446_0004933 Ga0439446_0004933_1450_2217 255
990 3300042184 Ga0450908_005890 Ga0450908_005890_532_1299 255
991 3300042435 Ga0439434_0000092 Ga0439434_0000092_14702_15469 255
992 3300042461 Ga0439460_0001270 Ga0439460_0001270_3225_3992 255
993 3300042461 Ga0439460_0009852 Ga0439460_0009852_602_1369 255
994 3300042461 Ga0439460_0018324 Ga0439460_0018324_548_1315 255
995 3300042531 Ga0450918_008576 Ga0450918_008576_448_1215 255
996 3300042533 Ga0450901_000463 Ga0450901_000463_642_1412 255
997 3300042993 Ga0439440_0005351 Ga0439440_0005351_971_1738 255
998 3300046452 Ga0495617_012651 Ga0495617_012651_643_1410 255
999 3300046453 Ga0495627_000095 Ga0495627_000095_90594_91361 255
1000 3300046455 Ga0495603_0001944 Ga0495603_0001944_1005_1772 255
1001 3300046455 Ga0495603_0161761 Ga0495603_0161761_374_1141 255
1002 3300046457 Ga0495590_0007106 Ga0495590_0007106_2914_3681 255
1003 3300046458 Ga0495591_020022 Ga0495591_020022_446_1213 255
1004 3300046458 Ga0495591_020266 Ga0495591_020266_1204_1971 255
1005 3300046458 Ga0495591_025531 Ga0495591_025531_1002_1769 255
1006 3300046459 Ga0495629_0083415 Ga0495629_0083415_942_1709 255
1007 3300046463 Ga0495653_0006872 Ga0495653_0006872_1890_2657 255
1008 3300046471 Ga0495650_0004680 Ga0495650_0004680_7432_8199 255
1009 3300046471 Ga0495650_0048726 Ga0495650_0048726_474_1241 255
1010 3300046473 Ga0495582_0000456 Ga0495582_0000456_20732_21499 255
1011 3300046474 Ga0495605_0007209 Ga0495605_0007209_1119_1886 255
1012 3300046475 Ga0495639_0000295 Ga0495639_0000295_786_1553 255
1013 3300046491 Ga0495584_0000408 Ga0495584_0000408_8781_9548 255
1014 3300046491 Ga0495584_0002026 Ga0495584_0002026_4257_5024 255
1015 3300046491 Ga0495584_0002140 Ga0495584_0002140_3798_4565 255
1016 3300046491 Ga0495584_0007040 Ga0495584_0007040_4134_4901 255
1017 3300046491 Ga0495584_0046053 Ga0495584_0046053_1322_2089 255
1018 3300046492 Ga0495585_0035713 Ga0495585_0035713_995_1762 255
1019 3300046492 Ga0495585_0037229 Ga0495585_0037229_1492_2259 255
1020 3300046501 Ga0495607_0000024 Ga0495607_0000024_137603_138370 255
1021 3300046501 Ga0495607_0001123 Ga0495607_0001123_8515_9282 255
1022 3300046501 Ga0495607_0095448 Ga0495607_0095448_289_1056 255
1023 3300046506 Ga0495583_0002206 Ga0495583_0002206_3574_4341 255
1024 3300046507 Ga0495606_0007824 Ga0495606_0007824_7640_8407 255
1025 3300046507 Ga0495606_0038528 Ga0495606_0038528_1443_2210 255
1026 3300046512 Ga0495610_0014124 Ga0495610_0014124_227_994 255
1027 3300046512 Ga0495610_0054587 Ga0495610_0054587_266_1033 255
1028 3300046513 Ga0495616_0000852 Ga0495616_0000852_6692_7459 255
1029 3300046513 Ga0495616_0051050 Ga0495616_0051050_438_1205 255
1030 3300046515 Ga0495620_0000023 Ga0495620_0000023_14715_15485 255
1031 3300046515 Ga0495620_0003388 Ga0495620_0003388_680_1447 255
1032 3300046518 Ga0495631_0001318 Ga0495631_0001318_13335_14102 255
1033 3300046519 Ga0495632_0001735 Ga0495632_0001735_6481_7251 255
1034 3300046519 Ga0495632_0003309 Ga0495632_0003309_4007_4774 255
1035 3300046520 Ga0495637_0006747 Ga0495637_0006747_3547_4314 255
1036 3300046522 Ga0495643_0000730 Ga0495643_0000730_23857_24627 255
1037 3300046522 Ga0495643_0001170 Ga0495643_0001170_9942_10712 255
1038 3300046524 Ga0495648_0002460 Ga0495648_0002460_9697_10467 255
1039 3300046524 Ga0495648_0012345 Ga0495648_0012345_1468_2235 255
1040 3300046524 Ga0495648_0183970 Ga0495648_0183970_223_990 255
1041 3300046526 Ga0495666_0005396 Ga0495666_0005396_147_914 255
1042 3300046526 Ga0495666_0058971 Ga0495666_0058971_700_1467 255
1043 3300046528 Ga0495642_0000536 Ga0495642_0000536_14402_15169 255
1044 3300046528 Ga0495642_0000555 Ga0495642_0000555_1099_1866 255
1045 3300046530 Ga0495654_0002438 Ga0495654_0002438_787_1554 255
1046 3300046530 Ga0495654_0009898 Ga0495654_0009898_3928_4695 255
1047 3300046530 Ga0495654_0090195 Ga0495654_0090195_134_901 255
1048 3300046535 Ga0495586_0022525 Ga0495586_0022525_629_1396 255
1049 3300046536 Ga0495587_0003520 Ga0495587_0003520_9049_9816 255
1050 3300046538 Ga0495609_0011057 Ga0495609_0011057_1869_2636 255
1051 3300046538 Ga0495609_0022196 Ga0495609_0022196_1674_2441 255
1052 3300046557 Ga0495622_0005884 Ga0495622_0005884_4137_4904 255
1053 3300046557 Ga0495622_0006049 Ga0495622_0006049_1899_2666 255
1054 3300046557 Ga0495622_0020035 Ga0495622_0020035_700_1467 255
1055 3300046558 Ga0495633_0003624 Ga0495633_0003624_810_1577 255
1056 3300046615 Ga0495656_0004240 Ga0495656_0004240_2799_3566 255
1057 3300046616 Ga0495668_0003520 Ga0495668_0003520_1090_1857 255
1058 3300046642 Ga0495634_0311913 Ga0495634_0311913_54_821 255
1059 3300046648 Ga0495611_0000525 Ga0495611_0000525_12489_13256 255
1060 3300046660 Ga0495625_0011548 Ga0495625_0011548_998_1765 255
1061 3300046660 Ga0495625_0159038 Ga0495625_0159038_201_968 255
1062 3300046663 Ga0495635_0000583 Ga0495635_0000583_22050_22817 255
1063 3300046664 Ga0495659_0001461 Ga0495659_0001461_694_1461 255
1064 3300046664 Ga0495659_0006759 Ga0495659_0006759_122_889 255
1065 3300046665 Ga0495661_0063649 Ga0495661_0063649_1288_2055 255
1066 3300046674 Ga0495588_0005506 Ga0495588_0005506_487_1254 255
1067 3300046679 Ga0495623_0050832 Ga0495623_0050832_761_1528 255
1068 3300046684 Ga0495669_0160323 Ga0495669_0160323_125_892 255
1069 3300046689 Ga0495613_0054929 Ga0495613_0054929_638_1405 255
1070 3300046691 Ga0495670_0007272 Ga0495670_0007272_4426_5193 255
1071 3300046692 Ga0495671_0000471 Ga0495671_0000471_18570_19337 255
1072 3300046692 Ga0495671_0002856 Ga0495671_0002856_8897_9664 255
1073 3300046692 Ga0495671_0042708 Ga0495671_0042708_38_805 255
1074 3300046692 Ga0495671_0086214 Ga0495671_0086214_356_1123 255
1075 3300046694 Ga0495649_0000968 Ga0495649_0000968_7096_7863 255
1076 3300046694 Ga0495649_0013458 Ga0495649_0013458_70_837 255
1077 3300046694 Ga0495649_0077864 Ga0495649_0077864_415_1182 255
1078 3300046794 Ga0495589_0007109 Ga0495589_0007109_4999_5766 255
1079 3300046794 Ga0495589_0014900 Ga0495589_0014900_607_1374 255
1080 3300046794 Ga0495589_0026339 Ga0495589_0026339_1869_2636 255
1081 3300046794 Ga0495589_0055325 Ga0495589_0055325_1043_1810 255
1082 3300046809 Ga0495600_0000547 Ga0495600_0000547_15228_15995 255
1083 3300046810 Ga0495660_0000431 Ga0495660_0000431_21552_22364 255
1084 3300046810 Ga0495660_0020968 Ga0495660_0020968_198_965 255
1085 3300047315 Ga0495581_0107187 Ga0495581_0107187_347_1114 255
1086 3300047317 Ga0495604_0016005 Ga0495604_0016005_4374_5141 255
1087 3300047318 Ga0495636_0008819 Ga0495636_0008819_2913_3680 255
1088 3300047320 Ga0495672_0003447 Ga0495672_0003447_9829_10596 255
1089 3300047320 Ga0495672_0004295 Ga0495672_0004295_1148_1915 255
1090 3300047320 Ga0495672_0005642 Ga0495672_0005642_4778_5545 255
1091 3300047320 Ga0495672_0006899 Ga0495672_0006899_7640_8407 255
1092 3300047322 Ga0495680_0005758 Ga0495680_0005758_3911_4678 255
1093 3300047323 Ga0495683_0001303 Ga0495683_0001303_9829_10596 255
1094 3300047323 Ga0495683_0001374 Ga0495683_0001374_1039_1806 255
1095 3300047323 Ga0495683_0071627 Ga0495683_0071627_492_1259 255
1096 3300047323 Ga0495683_0165052 Ga0495683_0165052_154_921 255
1097 3300047443 Ga0495687_003446 Ga0495687_003446_6459_7226 255
1098 3300047443 Ga0495687_004754 Ga0495687_004754_1041_1808 255
1099 3300047443 Ga0495687_010017 Ga0495687_010017_586_1353 255
1100 3300047444 Ga0495675_0156627 Ga0495675_0156627_147_914 255
1101 3300047445 Ga0495677_0001006 Ga0495677_0001006_3855_4622 255
1102 3300047447 Ga0495685_066872 Ga0495685_066872_312_1079 255
1103 3300047469 Ga0495673_0019427 Ga0495673_0019427_1034_1801 255
1104 3300047469 Ga0495673_0041012 Ga0495673_0041012_367_1134 255
1105 3300047469 Ga0495673_0095900 Ga0495673_0095900_119_886 255
1106 3300047470 Ga0495681_0003081 Ga0495681_0003081_9912_10679 255
1107 3300047470 Ga0495681_0031756 Ga0495681_0031756_429_1196 255
1108 3300047673 Ga0495593_0038639 Ga0495593_0038639_1430_2197 255
1109 3300047673 Ga0495593_0106202 Ga0495593_0106202_146_913 255
1110 3300048091 Ga0495626_0000507 Ga0495626_0000507_20326_21093 255
1111 3300048091 Ga0495626_0000996 Ga0495626_0000996_22873_23640 255
1112 3300048091 Ga0495626_0001627 Ga0495626_0001627_9407_10174 255
1113 3300048091 Ga0495626_0013045 Ga0495626_0013045_2532_3299 255
1114 3300048091 Ga0495626_0027693 Ga0495626_0027693_1811_2578 255
1115 3300048091 Ga0495626_0033525 Ga0495626_0033525_544_1311 255
1116 3300048909 Ga0496106_0484204 Ga0496106_0484204_16_783 255
1117 3300048913 Ga0496110_0146071 Ga0496110_0146071_640_1407 255
1118 3300048914 Ga0496111_0049816 Ga0496111_0049816_357_1124 255
1119 3300048917 Ga0496114_0024637 Ga0496114_0024637_3435_4205 255
1120 3300048919 Ga0496116_0001670 Ga0496116_0001670_22890_23657 255
1121 3300048920 Ga0496117_0002067 Ga0496117_0002067_1440_2210 255
1122 3300048922 Ga0496119_0000704 Ga0496119_0000704_14312_15130 255
1123 3300048923 Ga0496120_0001473 Ga0496120_0001473_19316_20134 255
1124 3300048924 Ga0496121_0149535 Ga0496121_0149535_853_1620 255
1125 3300048924 Ga0496121_0268043 Ga0496121_0268043_275_1042 255
1126 3300048925 Ga0496122_0002629 Ga0496122_0002629_9358_10128 255
1127 3300048925 Ga0496122_0007631 Ga0496122_0007631_749_1516 255
1128 3300048926 Ga0496123_0007055 Ga0496123_0007055_1410_2180 255
1129 3300048927 Ga0496124_0001467 Ga0496124_0001467_32751_33521 255
1130 3300048927 Ga0496124_0015657 Ga0496124_0015657_1924_2694 255
1131 3300048927 Ga0496124_0087458 Ga0496124_0087458_1217_1987 255
1132 3300048927 Ga0496124_0107378 Ga0496124_0107378_802_1569 255
1133 3300048927 Ga0496124_0216254 Ga0496124_0216254_504_1274 255
1134 3300048928 Ga0496125_0002177 Ga0496125_0002177_15009_15779 255
1135 3300048928 Ga0496125_0045763 Ga0496125_0045763_1061_1831 255
1136 3300048928 Ga0496125_0113892 Ga0496125_0113892_755_1522 255
1137 3300048929 Ga0496126_0055003 Ga0496126_0055003_1358_2128 255
1138 3300049459 Ga0495678_000694 Ga0495678_000694_21270_22037 255
1139 3300049459 Ga0495678_008447 Ga0495678_008447_4349_5116 255
1140 3300049460 Ga0495682_0000069 Ga0495682_0000069_78992_79759 255
1141 3300049460 Ga0495682_0021349 Ga0495682_0021349_818_1585 255
1142 3300049571 Ga0501034_0000164 Ga0501034_0000164_109533_110303 255
1143 3300050516 nmdc:mga0sz30_7760_c1 nmdc:mga0sz30_7760_c1_3154_3921 255
1144 3300053135 Ga0500659_0002369 Ga0500659_0002369_929_1699 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

30

221

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.4784 16 201
7yub-assembly1.cif.gz_R s1p-bound human spns2 0.4495 7 204
6h7d-assembly1.cif.gz_A crystal structure of a. thaliana sugar transport protein 10 in complex with glucose in the outward occluded state 0.4471 12 202
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.4445 16 201
6ob7-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, dilazep bound 0.441 8 232
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9048 15 203 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8914 15 203 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7232 15 203 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6711 15 203 1.20.1250.20
af_Q54DL1_165_416_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5432 6 206 1.20.1250.20
ID Description Score Start End GO Terms
AF-N6V0S1-F1-model_v4 Integral membrane protein TerC 0.9359 2 239 GO:0016020
AF-A0A0F0KRP1-F1-model_v4 Integral membrane protein TerC family protein 0.9325 5 242 GO:0016020
AF-A0A2L0WE71-F1-model_v4 deleted 0.9297 2 239
AF-A0A561C2F0-F1-model_v4 deleted 0.9288 2 242
AF-A0A6S7CNP0-F1-model_v4 Membrane protein TerC 0.9282 3 242 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.51 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map