F490669

General Info

Members Datasets Scaffolds Average Seq Length
1138 509 901 85

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0171713|Ga0496113_0171713_360_617
Length 85
Sequence MTLINSVKELIIDSLGLEDITVNDIADDMPLFNDEGLGLDSVDALELGLALQKKFGLQMENDSNALREHFHSVATLAKFIEAKRN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
64 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
65 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
66 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
67 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
68 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
69 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
70 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
71 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
72 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
73 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
74 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
75 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
76 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
77 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
78 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
79 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
80 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
81 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
82 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
83 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
84 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
85 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
86 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
87 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
88 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
89 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
90 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
91 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
92 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
93 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
94 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
95 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
96 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
97 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
98 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
99 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
100 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
101 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
102 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
103 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
104 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
105 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
106 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
107 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
108 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
109 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
110 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
111 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
112 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
113 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
114 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
115 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
116 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
117 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
118 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
119 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
120 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
121 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
122 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
123 2773857670 Pseudomonas sp. 478 Isolate Unclassified
124 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
125 2773857673 Pseudomonas sp. 443 Isolate Unclassified
126 2784132063 Pseudomonas sp. 424 Isolate Unclassified
127 2784132072 Pseudomonas sp. 460 Isolate Unclassified
128 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
129 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
130 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
131 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
132 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
133 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
134 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
135 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
136 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
137 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
138 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
139 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
140 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
141 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
142 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
143 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
144 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
145 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
146 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
147 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
148 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
149 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
150 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
151 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
152 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
153 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
154 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
155 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
156 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
157 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
158 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
159 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
160 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
161 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
162 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
163 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
164 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
165 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
166 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
167 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
168 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
169 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
170 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
171 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
172 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
173 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
174 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
175 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
176 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
177 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
178 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
179 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
180 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
181 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
182 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
183 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
184 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
185 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
186 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
187 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
188 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
189 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
190 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
191 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
192 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
193 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
194 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
195 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
196 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
197 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
198 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
199 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
200 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
201 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
202 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
203 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
204 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
205 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
206 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
207 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
208 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
209 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
210 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
211 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
212 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
213 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
214 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
215 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
216 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
217 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
218 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
219 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
220 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
221 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
222 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
223 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
224 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
225 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
226 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
227 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
228 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
229 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
230 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
231 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
232 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
233 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
234 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
235 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
236 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
237 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
238 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
239 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
240 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
241 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
242 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
243 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
244 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
245 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
246 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
247 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
248 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
249 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
250 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
251 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
252 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
253 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
254 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
255 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
256 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
257 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
258 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
259 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
260 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
261 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
262 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
263 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
264 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
267 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
268 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
269 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
270 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
271 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
272 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
273 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
274 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
275 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
276 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
277 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
278 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
279 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
280 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
281 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
282 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
283 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
284 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
290 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
291 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
293 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
295 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
296 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
297 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
321 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
335 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
336 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
337 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
338 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
339 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
340 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
341 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
342 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
343 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
344 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
345 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
346 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
347 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
348 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
349 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
350 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
351 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
352 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
353 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
354 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
355 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
356 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
357 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
358 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
359 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
360 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
361 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
362 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
363 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
364 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
365 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
366 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
367 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
368 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
369 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
370 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
371 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
372 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
373 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
374 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
375 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
376 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
377 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
378 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
379 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
380 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
381 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
382 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
383 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
384 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
385 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
386 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
387 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
388 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
389 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
390 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
391 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
392 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
393 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
394 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
395 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
396 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
397 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
398 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
399 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
400 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
401 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
402 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
403 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
404 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
405 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
406 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
407 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
408 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
409 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
410 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
411 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
412 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
413 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
414 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
415 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
416 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
417 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
418 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
419 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
420 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
421 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
424 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
425 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
426 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
427 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
428 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
429 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
430 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
431 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
432 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
433 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
434 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
435 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
436 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
437 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
438 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
439 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
440 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
443 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
444 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
445 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
446 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
447 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
448 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
449 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
450 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
451 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
452 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
453 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
454 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
455 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
456 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
457 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
458 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
459 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
460 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
461 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
462 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
463 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
464 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
465 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
466 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
467 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
468 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
469 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
470 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
471 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
472 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
473 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
474 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
475 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
476 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
477 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
478 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
481 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
482 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
483 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
484 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
485 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
486 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
487 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
489 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
490 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
491 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
492 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
493 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
494 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
495 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
496 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
497 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
498 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
499 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
500 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
501 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
502 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
503 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
504 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
505 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
506 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
507 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
508 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
509 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79
Metatranscriptomes 0.18
Isolates 20.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 5.98
Nodule 2.28
Rhizoplane 6.06
Rhizosphere 75.57
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_519 2124908027 Bacteria 2759
2 MRS2a_Contig_66 2124908027 Bacteria 22945
3 SwRhRL2b_contig_1695330 2162886007 Bacteria 856
4 SwRhRL2b_contig_2788444 2162886007 Bacteria 2169
5 SwRhRL2b_contig_3562642 2162886007 Bacteria 910
6 JGI25155J39150_1004330 3300002704 Bacteria 686
7 JGI25162J39368_1000181 3300002737 Bacteria 67817
8 JGI25154J39366_1009645 3300002738 Bacteria 1178
9 JGI25163J39215_1000288 3300002771 Bacteria 17349
10 JGI25164J39214_1000146 3300002772 Bacteria 67817
11 JGI25165J46597_1000267 3300003214 Bacteria 67817
12 JGI26141J51220_1005744 3300003503 Bacteria 778
13 Ga0055538_1000037 3300003751 Bacteria 190238
14 Ga0055539_1000048 3300003752 Bacteria 190238
15 Ga0055533_1000059 3300003756 Bacteria 190238
16 Ga0055532_1000105 3300003758 Bacteria 91428
17 Ga0055525_1000128 3300003759 Bacteria 113553
18 Ga0055525_1017391 3300003759 Bacteria 610
19 Ga0055535_1014660 3300003761 Bacteria 1119
20 Ga0055536_1000328 3300003781 Bacteria 35005
21 Ga0055536_1000624 3300003781 Bacteria 24057
22 Ga0055536_1024225 3300003781 Bacteria 1763
23 Ga0055534_1051176 3300003784 Bacteria 587
24 Ga0055530_10000098 3300003791 Bacteria 73644
25 Ga0055530_10000333 3300003791 Bacteria 42485
26 Ga0055530_10002459 3300003791 Bacteria 11881
27 Ga0055540_1000138 3300003792 Bacteria 73170
28 Ga0055540_1000279 3300003792 Bacteria 45880
29 Ga0055540_1000586 3300003792 Bacteria 26511
30 Ga0055531_10000321 3300003794 Bacteria 47157
31 Ga0055541_1000035 3300003841 Bacteria 190238
32 Ga0058692_1007212 3300003856 Bacteria 2974
33 Ga0065714_10000567 3300005288 Bacteria 3727
34 Ga0065714_10002325 3300005288 Bacteria 36328
35 Ga0065714_10003191 3300005288 Bacteria 19843
36 Ga0065714_10004288 3300005288 Bacteria 13113
37 Ga0065714_10009527 3300005288 Bacteria 4347
38 Ga0065714_10066972 3300005288 Bacteria 6043
39 Ga0065714_10074580 3300005288 Bacteria 3012
40 Ga0065714_10075698 3300005288 Bacteria 2876
41 Ga0065714_10096624 3300005288 Bacteria 1756
42 Ga0065714_10105281 3300005288 Bacteria 1561
43 Ga0065714_10150668 3300005288 Bacteria 1107
44 Ga0065714_10259788 3300005288 Bacteria 759
45 Ga0065714_10373269 3300005288 Bacteria 613
46 Ga0065714_10492767 3300005288 Bacteria 528
47 Ga0065714_10513724 3300005288 Bacteria 516
48 Ga0065704_10014239 3300005289 Bacteria 1879
49 Ga0065704_10014750 3300005289 Bacteria 2549
50 Ga0065704_10033682 3300005289 Bacteria 1038
51 Ga0065704_10060882 3300005289 Bacteria 558
52 Ga0065704_10082681 3300005289 Bacteria 3566
53 Ga0065704_10191903 3300005289 Bacteria 1185
54 Ga0065704_10295533 3300005289 Bacteria 895
55 Ga0065704_10575365 3300005289 Bacteria 621
56 Ga0065712_10003956 3300005290 Bacteria 8653
57 Ga0065712_10079396 3300005290 Bacteria 3222
58 Ga0065712_10115636 3300005290 Bacteria 1748
59 Ga0065715_10108087 3300005293 Bacteria 2736
60 Ga0065715_10256124 3300005293 Bacteria 1152
61 Ga0070676_10068380 3300005328 Bacteria 2126
62 Ga0070670_100005149 3300005331 Bacteria 10999
63 Ga0070661_100000078 3300005344 Bacteria 77449
64 Ga0070669_100000827 3300005353 Bacteria 22538
65 Ga0070667_100943735 3300005367 Bacteria 804
66 Ga0070663_100061388 3300005455 Bacteria 2707
67 Ga0070662_100010823 3300005457 Bacteria 6005
68 Ga0070665_100057419 3300005548 Bacteria 3901
69 Ga0070665_100247376 3300005548 Bacteria 1783
70 Ga0070665_100299641 3300005548 Bacteria 1610
71 Ga0070665_100866789 3300005548 Bacteria 916
72 Ga0070665_101797481 3300005548 Bacteria 619
73 Ga0070664_100001480 3300005564 Bacteria 18717
74 Ga0075364_10092295 3300006051 Bacteria 2010
75 Ga0075364_10158259 3300006051 Bacteria 1528
76 Ga0075364_10294982 3300006051 Bacteria 1104
77 Ga0075364_10415208 3300006051 Bacteria 918
78 Ga0075364_10769723 3300006051 Bacteria 656
79 Ga0075364_11220035 3300006051 Bacteria 510
80 Ga0075432_10000629 3300006058 Bacteria 10741
81 Ga0075432_10006240 3300006058 Bacteria 4051
82 Ga0075432_10008257 3300006058 Bacteria 3550
83 Ga0075432_10012550 3300006058 Bacteria 2878
84 Ga0075432_10070614 3300006058 Bacteria 1254
85 Ga0075432_10240039 3300006058 Bacteria 732
86 Ga0075362_10086765 3300006177 Bacteria 1448
87 Ga0075362_10547845 3300006177 Bacteria 595
88 Ga0075362_10657816 3300006177 Bacteria 544
89 Ga0075369_10102719 3300006186 Bacteria 1283
90 Ga0075369_10129142 3300006186 Bacteria 1147
91 Ga0075370_10457159 3300006353 Bacteria 768
92 Ga0075436_100082129 3300006914 Bacteria 2235
93 Ga0075436_100088941 3300006914 Bacteria 2146
94 Ga0075436_100167362 3300006914 Bacteria 1551
95 Ga0075436_100819400 3300006914 Bacteria 694
96 Ga0075436_101568787 3300006914 Bacteria 500
97 Ga0079104_1000229 3300006946 Bacteria 75907
98 Ga0079104_1000296 3300006946 Bacteria 63123
99 Ga0099826_10010483 3300006948 Bacteria 6945
100 Ga0105251_10000113 3300009011 Bacteria 80570
101 Ga0105251_10000303 3300009011 Bacteria 49448
102 Ga0105251_10000361 3300009011 Bacteria 44718
103 Ga0105251_10001365 3300009011 Bacteria 21115
104 Ga0105251_10014426 3300009011 Bacteria 4367
105 Ga0105251_10063747 3300009011 Bacteria 1729
106 Ga0105251_10068655 3300009011 Bacteria 1654
107 Ga0105251_10097408 3300009011 Bacteria 1346
108 Ga0105251_10317388 3300009011 Bacteria 708
109 Ga0105251_10563166 3300009011 Bacteria 538
110 Ga0105244_10001234 3300009036 Bacteria 20974
111 Ga0105244_10005115 3300009036 Bacteria 8803
112 Ga0105244_10007513 3300009036 Bacteria 6920
113 Ga0105244_10008576 3300009036 Bacteria 6375
114 Ga0105244_10010319 3300009036 Bacteria 5671
115 Ga0105244_10025566 3300009036 Bacteria 3209
116 Ga0105244_10026634 3300009036 Bacteria 3126
117 Ga0105244_10032315 3300009036 Bacteria 2771
118 Ga0105244_10033297 3300009036 Bacteria 2718
119 Ga0105244_10033802 3300009036 Bacteria 2695
120 Ga0105244_10051275 3300009036 Bacteria 2103
121 Ga0105244_10056038 3300009036 Bacteria 1996
122 Ga0105244_10095872 3300009036 Bacteria 1455
123 Ga0105244_10132272 3300009036 Bacteria 1204
124 Ga0105244_10167578 3300009036 Bacteria 1047
125 Ga0105244_10186354 3300009036 Bacteria 982
126 Ga0105244_10422521 3300009036 Bacteria 613
127 Ga0105250_10000189 3300009092 Bacteria 52791
128 Ga0105250_10000211 3300009092 Bacteria 48658
129 Ga0105250_10002092 3300009092 Bacteria 10238
130 Ga0105250_10005321 3300009092 Bacteria 5777
131 Ga0105250_10040789 3300009092 Bacteria 1862
132 Ga0105250_10053490 3300009092 Bacteria 1620
133 Ga0105250_10069324 3300009092 Bacteria 1424
134 Ga0105250_10349254 3300009092 Bacteria 647
135 Ga0105250_10381733 3300009092 Bacteria 622
136 Ga0105245_11292020 3300009098 Bacteria 778
137 Ga0105243_10000370 3300009148 Bacteria 48223
138 Ga0105243_10000595 3300009148 Bacteria 36195
139 Ga0105243_10016178 3300009148 Bacteria 5644
140 Ga0105243_10048309 3300009148 Bacteria 3354
141 Ga0105243_10167546 3300009148 Bacteria 1900
142 Ga0105242_10000136 3300009176 Bacteria 53348
143 Ga0105242_10033413 3300009176 Bacteria 4118
144 Ga0105237_10098823 3300009545 Bacteria 2910
145 Ga0105249_10010128 3300009553 Bacteria 8277
146 Ga0105246_10002498 3300011119 Bacteria 11121
147 Ga0105246_10012442 3300011119 Bacteria 5311
148 Ga0105246_10014440 3300011119 Bacteria 4967
149 Ga0105246_10143127 3300011119 Bacteria 1801
150 Ga0105246_10233239 3300011119 Bacteria 1450
151 Ga0157336_1026916 3300012477 Bacteria 555
152 Ga0157345_1000068 3300012498 Bacteria 21372
153 Ga0157373_10005678 3300013100 Bacteria 9347
154 Ga0157373_10009194 3300013100 Bacteria 7308
155 Ga0157373_10010747 3300013100 Bacteria 6736
156 Ga0157373_10022016 3300013100 Bacteria 4625
157 Ga0157373_10045654 3300013100 Bacteria 3127
158 Ga0157373_10117043 3300013100 Bacteria 1873
159 Ga0157371_10000811 3300013102 Bacteria 35895
160 Ga0157371_10001369 3300013102 Bacteria 25570
161 Ga0157371_10005693 3300013102 Bacteria 10448
162 Ga0157371_10011701 3300013102 Bacteria 6742
163 Ga0157371_10036093 3300013102 Bacteria 3540
164 Ga0157370_10008166 3300013104 Bacteria 11316
165 Ga0157370_10016274 3300013104 Bacteria 7535
166 Ga0157370_10023179 3300013104 Bacteria 6168
167 Ga0157370_10097202 3300013104 Bacteria 2762
168 Ga0157370_10286829 3300013104 Bacteria 1521
169 Ga0157370_10327861 3300013104 Bacteria 1412
170 Ga0157370_11097829 3300013104 Bacteria 719
171 Ga0157370_11405170 3300013104 Bacteria 628
172 Ga0157369_10001261 3300013105 Bacteria 31458
173 Ga0157369_10001555 3300013105 Bacteria 28080
174 Ga0157369_10546563 3300013105 Bacteria 1197
175 Ga0157369_10717457 3300013105 Bacteria 1029
176 Ga0163162_10000737 3300013306 Bacteria 30385
177 Ga0163162_10014636 3300013306 Bacteria 7665
178 Ga0157372_10001525 3300013307 Bacteria 25180
179 Ga0157372_10008414 3300013307 Bacteria 10959
180 Ga0157372_10292524 3300013307 Bacteria 1894
181 Ga0157375_10092722 3300013308 Bacteria 3085
182 Ga0157375_11267717 3300013308 Bacteria 866
183 Ga0157375_12308093 3300013308 Bacteria 641
184 Ga0182008_10001166 3300014497 Bacteria 18127
185 Ga0182008_10002891 3300014497 Bacteria 10628
186 Ga0182008_10003251 3300014497 Bacteria 9914
187 Ga0182008_10025925 3300014497 Bacteria 2974
188 Ga0182008_10035903 3300014497 Bacteria 2481
189 Ga0182008_10392100 3300014497 Bacteria 744
190 Ga0182006_1000786 3300015261 Bacteria 21399
191 Ga0182006_1003146 3300015261 Bacteria 8632
192 Ga0182006_1005806 3300015261 Bacteria 5818
193 Ga0182006_1006236 3300015261 Bacteria 5560
194 Ga0182006_1007812 3300015261 Bacteria 4876
195 Ga0182006_1009153 3300015261 Bacteria 4450
196 Ga0182006_1012252 3300015261 Bacteria 3752
197 Ga0182006_1034428 3300015261 Bacteria 2026
198 Ga0182007_10000194 3300015262 Bacteria 40895
199 Ga0182007_10024749 3300015262 Bacteria 2097
200 Ga0182007_10211770 3300015262 Bacteria 681
201 Ga0182007_10423366 3300015262 Bacteria 510
202 Ga0182005_1000459 3300015265 Bacteria 21396
203 Ga0182005_1018158 3300015265 Bacteria 1944
204 Ga0182005_1019390 3300015265 Bacteria 1874
205 Ga0182005_1031413 3300015265 Bacteria 1447
206 Ga0182005_1033418 3300015265 Bacteria 1399
207 Ga0182005_1053576 3300015265 Bacteria 1098
208 Ga0163161_10000719 3300017792 Bacteria 26142
209 Ga0163161_10001156 3300017792 Bacteria 19877
210 Ga0163161_10006622 3300017792 Bacteria 8021
211 Ga0163161_10012332 3300017792 Bacteria 5932
212 Ga0163161_10067424 3300017792 Bacteria 2614
213 Ga0163161_10074001 3300017792 Bacteria 2497
214 Ga0163161_10123795 3300017792 Bacteria 1945
215 Ga0163161_10421059 3300017792 Bacteria 1074
216 Ga0209435_100738 3300025206 Bacteria 5418
217 Ga0209760_100128 3300025207 Bacteria 50562
218 Ga0209784_100028 3300025224 Bacteria 357464
219 Ga0209566_100028 3300025225 Bacteria 357464
220 Ga0209674_100047 3300025226 Bacteria 357464
221 Ga0209147_100031 3300025229 Bacteria 357464
222 Ga0209563_100050 3300025230 Bacteria 357464
223 Ga0209563_101330 3300025230 Bacteria 6728
224 Ga0207427_100014 3300025231 Bacteria 561361
225 Ga0209437_100016 3300025233 Bacteria 710118
226 Ga0209437_130276 3300025233 Bacteria 554
227 Ga0209258_100150 3300025242 Bacteria 161813
228 Ga0209646_1000183 3300025246 Bacteria 79021
229 Ga0209677_100029 3300025253 Bacteria 357464
230 Ga0209759_1023788 3300025256 Bacteria 1340
231 Ga0209129_1040143 3300025258 Bacteria 744
232 Ga0209233_1000036 3300025261 Bacteria 561361
233 Ga0209675_1002235 3300025291 Bacteria 10113
234 Ga0209676_1000025 3300025292 Bacteria 577569
235 Ga0209676_1000032 3300025292 Bacteria 469558
236 Ga0209676_1000318 3300025292 Bacteria 94045
237 Ga0209676_1005098 3300025292 Bacteria 7010
238 Ga0209676_1054026 3300025292 Bacteria 1037
239 Ga0209050_1000025 3300025298 Bacteria 528225
240 Ga0209050_1000028 3300025298 Bacteria 477133
241 Ga0209050_1000520 3300025298 Bacteria 64262
242 Ga0209051_1000026 3300025303 Bacteria 413311
243 Ga0209051_1000080 3300025303 Bacteria 199694
244 Ga0209051_1000334 3300025303 Bacteria 70713
245 Ga0209257_1000034 3300025304 Bacteria 662719
246 Ga0209257_1016807 3300025304 Bacteria 2931
247 Ga0209257_1044406 3300025304 Bacteria 1297
248 Ga0207696_1000020 3300025711 Bacteria 434998
249 Ga0207696_1000057 3300025711 Bacteria 249404
250 Ga0207696_1000084 3300025711 Bacteria 196086
251 Ga0207696_1001201 3300025711 Bacteria 14759
252 Ga0207696_1002125 3300025711 Bacteria 9949
253 Ga0207696_1003512 3300025711 Bacteria 7091
254 Ga0207696_1023018 3300025711 Bacteria 1971
255 Ga0207696_1027145 3300025711 Bacteria 1767
256 Ga0207696_1033741 3300025711 Bacteria 1533
257 Ga0207696_1088559 3300025711 Bacteria 849
258 Ga0207655_1000014 3300025728 Bacteria 607124
259 Ga0207655_1000326 3300025728 Bacteria 70089
260 Ga0207655_1000405 3300025728 Bacteria 59516
261 Ga0207655_1001697 3300025728 Bacteria 19386
262 Ga0207655_1001720 3300025728 Bacteria 19228
263 Ga0207655_1002603 3300025728 Bacteria 14351
264 Ga0207655_1003573 3300025728 Bacteria 11507
265 Ga0207655_1008096 3300025728 Bacteria 6724
266 Ga0207655_1013146 3300025728 Bacteria 4773
267 Ga0207655_1017799 3300025728 Bacteria 3815
268 Ga0207655_1041144 3300025728 Bacteria 1983
269 Ga0207655_1057145 3300025728 Bacteria 1534
270 Ga0207655_1068932 3300025728 Bacteria 1324
271 Ga0207655_1086629 3300025728 Bacteria 1114
272 Ga0207713_1000031 3300025735 Bacteria 283971
273 Ga0207713_1000114 3300025735 Bacteria 132170
274 Ga0207713_1000434 3300025735 Bacteria 44039
275 Ga0207713_1000632 3300025735 Bacteria 34264
276 Ga0207713_1002064 3300025735 Bacteria 15016
277 Ga0207713_1002309 3300025735 Bacteria 14016
278 Ga0207713_1006008 3300025735 Bacteria 7485
279 Ga0207713_1006241 3300025735 Bacteria 7296
280 Ga0207713_1018301 3300025735 Bacteria 3474
281 Ga0207713_1026722 3300025735 Bacteria 2638
282 Ga0207713_1081426 3300025735 Bacteria 1163
283 Ga0207713_1109465 3300025735 Bacteria 942
284 Ga0207713_1155375 3300025735 Bacteria 734
285 Ga0207645_10211141 3300025907 Bacteria 1279
286 Ga0207671_10000015 3300025914 Bacteria 439607
287 Ga0207663_10837357 3300025916 Bacteria 734
288 Ga0207649_10000001 3300025920 Bacteria 537851
289 Ga0207681_10001050 3300025923 Bacteria 17915
290 Ga0207650_10000273 3300025925 Bacteria 54321
291 Ga0207706_10013926 3300025933 Bacteria 7293
292 Ga0207686_10011033 3300025934 Bacteria 4933
293 Ga0207686_10178993 3300025934 Bacteria 1502
294 Ga0207709_10000022 3300025935 Bacteria 383573
295 Ga0207709_10000164 3300025935 Bacteria 91154
296 Ga0207709_10016199 3300025935 Bacteria 4143
297 Ga0207709_10027420 3300025935 Bacteria 3281
298 Ga0207709_11410629 3300025935 Bacteria 577
299 Ga0207679_10000011 3300025945 Bacteria 346112
300 Ga0207712_10010042 3300025961 Bacteria 6000
301 Ga0207668_10987916 3300025972 Bacteria 752
302 Ga0207658_10561768 3300025986 Bacteria 1022
303 Ga0207678_10082181 3300026067 Bacteria 2757
304 Ga0207698_11740210 3300026142 Bacteria 639
305 Ga0209281_1000026 3300027111 Bacteria 465877
306 Ga0209281_1000033 3300027111 Bacteria 383539
307 Ga0209281_1001786 3300027111 Bacteria 10833
308 Ga0209281_1001999 3300027111 Bacteria 9328
309 Ga0209371_1000032 3300027312 Bacteria 392355
310 Ga0209371_1021928 3300027312 Bacteria 1538
311 Ga0209969_1009852 3300027360 Bacteria 1364
312 Ga0209981_1004460 3300027378 Bacteria 1838
313 Ga0209981_1046684 3300027378 Bacteria 652
314 Ga0209984_1004871 3300027424 Bacteria 1594
315 Ga0209995_1003474 3300027471 Bacteria 2511
316 Ga0209968_1011623 3300027526 Bacteria 1366
317 Ga0209999_1017268 3300027543 Bacteria 1316
318 Ga0209999_1020527 3300027543 Bacteria 1213
319 Ga0209982_1071012 3300027552 Bacteria 570
320 Ga0209983_1063231 3300027665 Bacteria 819
321 Ga0209971_1024703 3300027682 Bacteria 1435
322 Ga0209974_10185800 3300027876 Bacteria 763
323 Ga0207428_10007376 3300027907 Bacteria 10027
324 Ga0207428_10031873 3300027907 Bacteria 4342
325 Ga0207428_10081146 3300027907 Bacteria 2533
326 Ga0207428_10111409 3300027907 Bacteria 2106
327 Ga0207428_10142279 3300027907 Bacteria 1830
328 Ga0207428_10220566 3300027907 Bacteria 1422
329 Ga0207428_10334300 3300027907 Bacteria 1117
330 Ga0207428_10396062 3300027907 Bacteria 1011
331 Ga0268266_10008655 3300028379 Bacteria 9035
332 Ga0268266_10337223 3300028379 Bacteria 1414
333 Ga0268266_10823226 3300028379 Bacteria 897
334 Ga0268266_11557832 3300028379 Bacteria 636
335 Ga0307517_10401466 3300028786 Bacteria 725
336 Ga0307517_10465541 3300028786 Bacteria 651
337 Ga0268256_1000050 3300030500 Bacteria 300675
338 Ga0268256_1024694 3300030500 Bacteria 1538
339 Ga0307511_10363727 3300030521 Bacteria 614
340 Ga0316177_1197218 3300030731 Bacteria 5873
341 Ga0314311_1061251 3300030733 Bacteria 1883
342 Ga0316179_1032179 3300030734 Bacteria 4416
343 Ga0316178_1048724 3300030735 Bacteria 10017
344 Ga0316178_1051966 3300030735 Bacteria 754
345 Ga0316183_1029617 3300030742 Bacteria 6544
346 Ga0316182_1113139 3300030745 Bacteria 606
347 Ga0265316_10492113 3300031344 Bacteria 877
348 Ga0307408_100014933 3300031548 Bacteria 5167
349 Ga0307408_100046272 3300031548 Bacteria 3111
350 Ga0307408_100730530 3300031548 Bacteria 892
351 Ga0307516_10222999 3300031730 Bacteria 1593
352 Ga0307405_10004700 3300031731 Bacteria 6495
353 Ga0307405_10191228 3300031731 Bacteria 1478
354 Ga0307405_10497367 3300031731 Bacteria 976
355 Ga0307405_10846056 3300031731 Bacteria 770
356 Ga0307413_10009019 3300031824 Bacteria 4748
357 Ga0307413_10720932 3300031824 Bacteria 830
358 Ga0307413_10934500 3300031824 Bacteria 739
359 Ga0307406_10009078 3300031901 Bacteria 5563
360 Ga0307407_10085773 3300031903 Bacteria 1916
361 Ga0307412_10018625 3300031911 Bacteria 4183
362 Ga0307409_100195072 3300031995 Bacteria 1806
363 Ga0307409_100807614 3300031995 Bacteria 946
364 Ga0307416_100384947 3300032002 Bacteria 1434
365 Ga0307416_102427497 3300032002 Bacteria 623
366 Ga0307414_10024303 3300032004 Bacteria 3862
367 Ga0307414_10181710 3300032004 Bacteria 1692
368 Ga0307414_10474370 3300032004 Bacteria 1102
369 Ga0307414_10922040 3300032004 Bacteria 801
370 Ga0307411_10021289 3300032005 Bacteria 3790
371 Ga0307411_10233000 3300032005 Bacteria 1436
372 Ga0307510_10001604 3300033180 Bacteria 25008
373 Ga0307510_10237407 3300033180 Bacteria 1320
374 Ga0237819_12627 3300038705 Bacteria 1039
375 Ga0439438_000895 3300041405 Bacteria 13240
376 Ga0439438_001683 3300041405 Bacteria 9722
377 Ga0439438_002675 3300041405 Bacteria 7507
378 Ga0439438_005049 3300041405 Bacteria 4921
379 Ga0439438_010772 3300041405 Bacteria 2876
380 Ga0439438_041283 3300041405 Bacteria 1196
381 Ga0439447_001542 3300041407 Bacteria 8416
382 Ga0439447_006299 3300041407 Bacteria 3862
383 Ga0439447_019552 3300041407 Bacteria 1804
384 Ga0439447_044075 3300041407 Bacteria 1079
385 Ga0439447_125681 3300041407 Bacteria 588
386 Ga0439466_0003017 3300041411 Bacteria 6564
387 Ga0439466_0012045 3300041411 Bacteria 3192
388 Ga0439466_0020412 3300041411 Bacteria 2361
389 Ga0439466_0026577 3300041411 Bacteria 2011
390 Ga0439466_0137561 3300041411 Bacteria 750
391 Ga0439466_0191179 3300041411 Bacteria 623
392 Ga0451787_107608 3300041441 Bacteria 669
393 Ga0451841_0079951 3300041498 Bacteria 684
394 Ga0451843_1121095 3300041509 Bacteria 806
395 Ga0451853_1362176 3300041512 Bacteria 626
396 Ga0439437_001799 3300042000 Bacteria 2271
397 Ga0439432_000366 3300042006 Bacteria 16615
398 Ga0439432_006395 3300042006 Bacteria 4210
399 Ga0439432_010204 3300042006 Bacteria 3259
400 Ga0439432_025862 3300042006 Bacteria 1923
401 Ga0439432_057191 3300042006 Bacteria 1207
402 Ga0439451_003503 3300042009 Bacteria 3183
403 Ga0439451_004084 3300042009 Bacteria 2964
404 Ga0439451_011313 3300042009 Bacteria 1800
405 Ga0439451_056842 3300042009 Bacteria 783
406 Ga0439452_000231 3300042010 Bacteria 38808
407 Ga0439452_000245 3300042010 Bacteria 37540
408 Ga0439452_000971 3300042010 Bacteria 12881
409 Ga0439452_002718 3300042010 Bacteria 6415
410 Ga0439452_002778 3300042010 Bacteria 6324
411 Ga0439452_028175 3300042010 Bacteria 1404
412 Ga0439456_000187 3300042013 Bacteria 17986
413 Ga0439456_007003 3300042013 Bacteria 2308
414 Ga0439456_012155 3300042013 Bacteria 1784
415 Ga0439456_023978 3300042013 Bacteria 1294
416 Ga0439463_001159 3300042016 Bacteria 7049
417 Ga0439463_001542 3300042016 Bacteria 6070
418 Ga0450911_000018 3300042115 Bacteria 104759
419 Ga0450911_000158 3300042115 Bacteria 27057
420 Ga0450911_002055 3300042115 Bacteria 4145
421 Ga0450911_002532 3300042115 Bacteria 3553
422 Ga0450920_001497 3300042122 Bacteria 3873
423 Ga0450922_000113 3300042124 Bacteria 7891
424 Ga0450922_000641 3300042124 Bacteria 3649
425 Ga0450923_004266 3300042125 Bacteria 2235
426 Ga0450892_001826 3300042130 Bacteria 1927
427 Ga0450902_003149 3300042137 Bacteria 2389
428 Ga0450902_006942 3300042137 Bacteria 1742
429 Ga0450903_016187 3300042138 Bacteria 1170
430 Ga0450904_000008 3300042139 Bacteria 47688
431 Ga0450904_010141 3300042139 Bacteria 929
432 Ga0450904_017293 3300042139 Bacteria 723
433 Ga0450905_018025 3300042142 Bacteria 1026
434 Ga0450906_000584 3300042145 Bacteria 7742
435 Ga0450906_001928 3300042145 Bacteria 4535
436 Ga0450907_000396 3300042146 Bacteria 13194
437 Ga0450907_003169 3300042146 Bacteria 2974
438 Ga0450907_052794 3300042146 Bacteria 699
439 Ga0450910_006884 3300042147 Bacteria 1575
440 Ga0439446_0000057 3300042156 Bacteria 17480
441 Ga0439446_0000824 3300042156 Bacteria 6611
442 Ga0450908_019721 3300042184 Bacteria 1186
443 Ga0450909_001747 3300042185 Bacteria 3054
444 Ga0450909_022410 3300042185 Bacteria 945
445 Ga0439459_0003689 3300042438 Bacteria 2442
446 Ga0439464_0000113 3300042439 Bacteria 12443
447 Ga0439464_0070243 3300042439 Bacteria 1035
448 Ga0439464_0072344 3300042439 Bacteria 1021
449 Ga0439464_0120513 3300042439 Bacteria 808
450 Ga0439460_0001407 3300042461 Bacteria 5677
451 Ga0439460_0010401 3300042461 Bacteria 2379
452 Ga0450916_018021 3300042530 Bacteria 948
453 Ga0450918_049832 3300042531 Bacteria 761
454 Ga0450918_062917 3300042531 Bacteria 688
455 Ga0450893_0007354 3300042532 Bacteria 1789
456 Ga0439440_0001938 3300042993 Bacteria 3845
457 Ga0495617_000311 3300046452 Bacteria 27369
458 Ga0495617_001853 3300046452 Bacteria 8956
459 Ga0495617_006439 3300046452 Bacteria 4114
460 Ga0495617_010746 3300046452 Bacteria 3134
461 Ga0495617_011375 3300046452 Bacteria 3036
462 Ga0495617_046341 3300046452 Bacteria 1449
463 Ga0495617_049237 3300046452 Bacteria 1402
464 Ga0495617_239574 3300046452 Bacteria 560
465 Ga0495627_000023 3300046453 Bacteria 251113
466 Ga0495627_000535 3300046453 Bacteria 31404
467 Ga0495627_000700 3300046453 Bacteria 25589
468 Ga0495627_006751 3300046453 Bacteria 4466
469 Ga0495627_014667 3300046453 Bacteria 2727
470 Ga0495627_015765 3300046453 Bacteria 2603
471 Ga0495627_019329 3300046453 Bacteria 2285
472 Ga0495603_0020970 3300046455 Bacteria 3957
473 Ga0495603_0064146 3300046455 Bacteria 2166
474 Ga0495603_0181857 3300046455 Bacteria 1216
475 Ga0495590_0004906 3300046457 Bacteria 5347
476 Ga0495590_0006565 3300046457 Bacteria 4536
477 Ga0495590_0042753 3300046457 Bacteria 1580
478 Ga0495591_000025 3300046458 Bacteria 189897
479 Ga0495591_000244 3300046458 Bacteria 52389
480 Ga0495591_001000 3300046458 Bacteria 19227
481 Ga0495591_005123 3300046458 Bacteria 6150
482 Ga0495591_005462 3300046458 Bacteria 5882
483 Ga0495591_016161 3300046458 Bacteria 2611
484 Ga0495591_040332 3300046458 Bacteria 1331
485 Ga0495591_051068 3300046458 Bacteria 1129
486 Ga0495591_058227 3300046458 Bacteria 1033
487 Ga0495591_066175 3300046458 Bacteria 948
488 Ga0495591_096317 3300046458 Bacteria 737
489 Ga0495638_0001218 3300046460 Bacteria 24478
490 Ga0495638_0013481 3300046460 Bacteria 5563
491 Ga0495638_0036944 3300046460 Bacteria 3108
492 Ga0495638_0058487 3300046460 Bacteria 2388
493 Ga0495638_0080601 3300046460 Bacteria 1977
494 Ga0495638_0118206 3300046460 Bacteria 1568
495 Ga0495638_0300914 3300046460 Bacteria 864
496 Ga0495653_0004108 3300046463 Bacteria 11772
497 Ga0495653_0130321 3300046463 Bacteria 1781
498 Ga0495653_0157579 3300046463 Bacteria 1579
499 Ga0495650_0001423 3300046471 Bacteria 23239
500 Ga0495650_0002476 3300046471 Bacteria 14863
501 Ga0495650_0010158 3300046471 Bacteria 5278
502 Ga0495650_0029630 3300046471 Bacteria 2491
503 Ga0495650_0151957 3300046471 Bacteria 830
504 Ga0495582_0010897 3300046473 Bacteria 5004
505 Ga0495605_0000095 3300046474 Bacteria 112622
506 Ga0495605_0000246 3300046474 Bacteria 64351
507 Ga0495605_0000311 3300046474 Bacteria 50989
508 Ga0495605_0000328 3300046474 Bacteria 48074
509 Ga0495605_0002025 3300046474 Bacteria 12779
510 Ga0495605_0007893 3300046474 Bacteria 6027
511 Ga0495605_0018026 3300046474 Bacteria 3791
512 Ga0495605_0023804 3300046474 Bacteria 3215
513 Ga0495605_0024999 3300046474 Bacteria 3117
514 Ga0495605_0059571 3300046474 Bacteria 1833
515 Ga0495639_0000238 3300046475 Bacteria 27395
516 Ga0495584_0000695 3300046491 Bacteria 22284
517 Ga0495584_0001583 3300046491 Bacteria 13454
518 Ga0495584_0004871 3300046491 Bacteria 7174
519 Ga0495584_0018626 3300046491 Bacteria 3529
520 Ga0495584_0326710 3300046491 Bacteria 779
521 Ga0495584_0550072 3300046491 Bacteria 588
522 Ga0495585_0000279 3300046492 Bacteria 51082
523 Ga0495585_0002190 3300046492 Bacteria 14192
524 Ga0495585_0008964 3300046492 Bacteria 6030
525 Ga0495585_0026970 3300046492 Bacteria 3279
526 Ga0495585_0048896 3300046492 Bacteria 2350
527 Ga0495585_0057220 3300046492 Bacteria 2152
528 Ga0495585_0095296 3300046492 Bacteria 1598
529 Ga0495585_0146964 3300046492 Bacteria 1231
530 Ga0495585_0172693 3300046492 Bacteria 1115
531 Ga0495594_0002893 3300046499 Bacteria 8932
532 Ga0495594_0012103 3300046499 Bacteria 4491
533 Ga0495594_0046054 3300046499 Bacteria 2394
534 Ga0495594_0112800 3300046499 Bacteria 1533
535 Ga0495596_0000273 3300046500 Bacteria 34263
536 Ga0495596_0001654 3300046500 Bacteria 12664
537 Ga0495596_0236284 3300046500 Bacteria 709
538 Ga0495607_0000181 3300046501 Bacteria 67120
539 Ga0495607_0000347 3300046501 Bacteria 47969
540 Ga0495607_0000776 3300046501 Bacteria 30570
541 Ga0495607_0000926 3300046501 Bacteria 27382
542 Ga0495607_0003337 3300046501 Bacteria 12321
543 Ga0495607_0009192 3300046501 Bacteria 6715
544 Ga0495607_0014199 3300046501 Bacteria 5194
545 Ga0495607_0025937 3300046501 Bacteria 3639
546 Ga0495607_0028987 3300046501 Bacteria 3409
547 Ga0495607_0034676 3300046501 Bacteria 3059
548 Ga0495607_0089962 3300046501 Bacteria 1665
549 Ga0495607_0101344 3300046501 Bacteria 1541
550 Ga0495607_0104675 3300046501 Bacteria 1509
551 Ga0495607_0132620 3300046501 Bacteria 1294
552 Ga0495607_0203983 3300046501 Bacteria 976
553 Ga0495583_0000015 3300046506 Bacteria 316392
554 Ga0495583_0000756 3300046506 Bacteria 41068
555 Ga0495583_0001231 3300046506 Bacteria 27233
556 Ga0495583_0001865 3300046506 Bacteria 19601
557 Ga0495583_0002457 3300046506 Bacteria 15823
558 Ga0495583_0003396 3300046506 Bacteria 12183
559 Ga0495583_0008468 3300046506 Bacteria 6278
560 Ga0495583_0341314 3300046506 Bacteria 591
561 Ga0495583_0367152 3300046506 Bacteria 567
562 Ga0495606_0000177 3300046507 Bacteria 112843
563 Ga0495606_0000214 3300046507 Bacteria 103149
564 Ga0495606_0001468 3300046507 Bacteria 31498
565 Ga0495606_0012176 3300046507 Bacteria 6932
566 Ga0495606_0069590 3300046507 Bacteria 2222
567 Ga0495606_0179099 3300046507 Bacteria 1223
568 Ga0495606_0282157 3300046507 Bacteria 907
569 Ga0495610_0001656 3300046512 Bacteria 19581
570 Ga0495610_0002687 3300046512 Bacteria 14660
571 Ga0495610_0010456 3300046512 Bacteria 5764
572 Ga0495610_0028792 3300046512 Bacteria 2933
573 Ga0495610_0033826 3300046512 Bacteria 2638
574 Ga0495610_0039249 3300046512 Bacteria 2396
575 Ga0495610_0039894 3300046512 Bacteria 2370
576 Ga0495610_0086714 3300046512 Bacteria 1425
577 Ga0495610_0101242 3300046512 Bacteria 1290
578 Ga0495610_0107256 3300046512 Bacteria 1242
579 Ga0495610_0295284 3300046512 Bacteria 626
580 Ga0495616_0003688 3300046513 Bacteria 9783
581 Ga0495616_0007911 3300046513 Bacteria 6339
582 Ga0495616_0033883 3300046513 Bacteria 2656
583 Ga0495616_0041168 3300046513 Bacteria 2357
584 Ga0495616_0042197 3300046513 Bacteria 2323
585 Ga0495616_0074355 3300046513 Bacteria 1637
586 Ga0495616_0172396 3300046513 Bacteria 966
587 Ga0495620_0000042 3300046515 Bacteria 112107
588 Ga0495620_0000456 3300046515 Bacteria 26967
589 Ga0495620_0002609 3300046515 Bacteria 10428
590 Ga0495620_0251774 3300046515 Bacteria 673
591 Ga0495630_0777093 3300046517 Bacteria 731
592 Ga0495631_0000772 3300046518 Bacteria 20599
593 Ga0495631_0001940 3300046518 Bacteria 12135
594 Ga0495631_0004156 3300046518 Bacteria 7760
595 Ga0495631_0006774 3300046518 Bacteria 5882
596 Ga0495631_0029731 3300046518 Bacteria 2482
597 Ga0495631_0081625 3300046518 Bacteria 1394
598 Ga0495631_0106972 3300046518 Bacteria 1202
599 Ga0495632_0000573 3300046519 Bacteria 34214
600 Ga0495632_0008250 3300046519 Bacteria 6418
601 Ga0495632_0011187 3300046519 Bacteria 5255
602 Ga0495632_0015502 3300046519 Bacteria 4268
603 Ga0495632_0016923 3300046519 Bacteria 4040
604 Ga0495632_0022401 3300046519 Bacteria 3386
605 Ga0495632_0024290 3300046519 Bacteria 3221
606 Ga0495632_0027931 3300046519 Bacteria 2948
607 Ga0495632_0064762 3300046519 Bacteria 1766
608 Ga0495632_0103037 3300046519 Bacteria 1344
609 Ga0495637_0000020 3300046520 Bacteria 181611
610 Ga0495637_0000260 3300046520 Bacteria 41743
611 Ga0495637_0000425 3300046520 Bacteria 30857
612 Ga0495637_0002002 3300046520 Bacteria 11492
613 Ga0495637_0002683 3300046520 Bacteria 9712
614 Ga0495637_0003016 3300046520 Bacteria 9028
615 Ga0495637_0006468 3300046520 Bacteria 5878
616 Ga0495637_0009737 3300046520 Bacteria 4677
617 Ga0495637_0014100 3300046520 Bacteria 3776
618 Ga0495637_0014677 3300046520 Bacteria 3690
619 Ga0495637_0018276 3300046520 Bacteria 3253
620 Ga0495637_0027677 3300046520 Bacteria 2534
621 Ga0495637_0030720 3300046520 Bacteria 2381
622 Ga0495637_0033302 3300046520 Bacteria 2264
623 Ga0495643_0001642 3300046522 Bacteria 19726
624 Ga0495643_0004173 3300046522 Bacteria 10258
625 Ga0495643_0009933 3300046522 Bacteria 5881
626 Ga0495643_0011157 3300046522 Bacteria 5491
627 Ga0495643_0039836 3300046522 Bacteria 2568
628 Ga0495643_0047262 3300046522 Bacteria 2331
629 Ga0495643_0051294 3300046522 Bacteria 2219
630 Ga0495644_0001530 3300046523 Bacteria 9436
631 Ga0495644_0003810 3300046523 Bacteria 5930
632 Ga0495644_0009094 3300046523 Bacteria 3826
633 Ga0495644_0419171 3300046523 Bacteria 531
634 Ga0495648_0001818 3300046524 Bacteria 20552
635 Ga0495648_0006167 3300046524 Bacteria 9825
636 Ga0495648_0010821 3300046524 Bacteria 6928
637 Ga0495648_0014424 3300046524 Bacteria 5786
638 Ga0495648_0017025 3300046524 Bacteria 5215
639 Ga0495648_0047781 3300046524 Bacteria 2641
640 Ga0495648_0162581 3300046524 Bacteria 1152
641 Ga0495648_0180743 3300046524 Bacteria 1072
642 Ga0495648_0347450 3300046524 Bacteria 678
643 Ga0495666_0042236 3300046526 Bacteria 2205
644 Ga0495642_0000088 3300046528 Bacteria 53831
645 Ga0495642_0003349 3300046528 Bacteria 6332
646 Ga0495654_0000992 3300046530 Bacteria 20889
647 Ga0495654_0001624 3300046530 Bacteria 15239
648 Ga0495654_0002244 3300046530 Bacteria 12516
649 Ga0495654_0003637 3300046530 Bacteria 9367
650 Ga0495654_0006263 3300046530 Bacteria 6776
651 Ga0495654_0007205 3300046530 Bacteria 6237
652 Ga0495654_0008879 3300046530 Bacteria 5526
653 Ga0495654_0033252 3300046530 Bacteria 2610
654 Ga0495654_0045705 3300046530 Bacteria 2159
655 Ga0495654_0069871 3300046530 Bacteria 1666
656 Ga0495654_0131244 3300046530 Bacteria 1124
657 Ga0495654_0194801 3300046530 Bacteria 870
658 Ga0495654_0254286 3300046530 Bacteria 730
659 Ga0495654_0265897 3300046530 Bacteria 709
660 Ga0495654_0411999 3300046530 Bacteria 535
661 Ga0495586_0036139 3300046535 Bacteria 2651
662 Ga0495587_0002264 3300046536 Bacteria 12872
663 Ga0495609_0000053 3300046538 Bacteria 149126
664 Ga0495609_0000102 3300046538 Bacteria 100762
665 Ga0495609_0000685 3300046538 Bacteria 26127
666 Ga0495609_0008822 3300046538 Bacteria 4907
667 Ga0495609_0010335 3300046538 Bacteria 4480
668 Ga0495609_0016172 3300046538 Bacteria 3478
669 Ga0495609_0267683 3300046538 Bacteria 701
670 Ga0495597_0000186 3300046542 Bacteria 55973
671 Ga0495597_0003248 3300046542 Bacteria 9645
672 Ga0495597_0007861 3300046542 Bacteria 5381
673 Ga0495597_0008578 3300046542 Bacteria 5111
674 Ga0495597_0033820 3300046542 Bacteria 2312
675 Ga0495597_0057902 3300046542 Bacteria 1694
676 Ga0495597_0129242 3300046542 Bacteria 1048
677 Ga0495597_0266606 3300046542 Bacteria 670
678 Ga0495645_0075070 3300046543 Bacteria 2433
679 Ga0495622_0004508 3300046557 Bacteria 6449
680 Ga0495622_0006910 3300046557 Bacteria 5270
681 Ga0495622_0014570 3300046557 Bacteria 3651
682 Ga0495633_0000366 3300046558 Bacteria 48617
683 Ga0495633_0008456 3300046558 Bacteria 5787
684 Ga0495633_0012245 3300046558 Bacteria 4573
685 Ga0495656_0005706 3300046615 Bacteria 4314
686 Ga0495668_0000866 3300046616 Bacteria 34104
687 Ga0495668_0005631 3300046616 Bacteria 8415
688 Ga0495668_0006331 3300046616 Bacteria 7777
689 Ga0495668_0038164 3300046616 Bacteria 2685
690 Ga0495668_0158296 3300046616 Bacteria 1240
691 Ga0495668_0172624 3300046616 Bacteria 1184
692 Ga0495611_0000193 3300046648 Bacteria 43575
693 Ga0495611_0000386 3300046648 Bacteria 28151
694 Ga0495611_0038256 3300046648 Bacteria 2133
695 Ga0495625_0000086 3300046660 Bacteria 151735
696 Ga0495625_0014227 3300046660 Bacteria 6361
697 Ga0495625_0023064 3300046660 Bacteria 4759
698 Ga0495625_0047562 3300046660 Bacteria 3092
699 Ga0495625_0051020 3300046660 Bacteria 2967
700 Ga0495625_0172274 3300046660 Bacteria 1444
701 Ga0495625_0919058 3300046660 Bacteria 500
702 Ga0495635_0002064 3300046663 Bacteria 13612
703 Ga0495659_0000084 3300046664 Bacteria 40750
704 Ga0495661_0000048 3300046665 Bacteria 144678
705 Ga0495661_0000058 3300046665 Bacteria 133316
706 Ga0495661_0000131 3300046665 Bacteria 90795
707 Ga0495661_0000171 3300046665 Bacteria 76610
708 Ga0495661_0003488 3300046665 Bacteria 11593
709 Ga0495661_0021482 3300046665 Bacteria 4208
710 Ga0495661_0029482 3300046665 Bacteria 3501
711 Ga0495661_0032435 3300046665 Bacteria 3301
712 Ga0495661_0064607 3300046665 Bacteria 2159
713 Ga0495661_0478205 3300046665 Bacteria 596
714 Ga0495588_0561079 3300046674 Bacteria 598
715 Ga0495623_0097382 3300046679 Bacteria 1796
716 Ga0495646_0002514 3300046680 Bacteria 11265
717 Ga0495646_0065160 3300046680 Bacteria 2157
718 Ga0495669_0000863 3300046684 Bacteria 12822
719 Ga0495624_0003730 3300046690 Bacteria 11262
720 Ga0495670_0001330 3300046691 Bacteria 12054
721 Ga0495670_0001965 3300046691 Bacteria 10098
722 Ga0495670_0006959 3300046691 Bacteria 5571
723 Ga0495670_0013963 3300046691 Bacteria 3950
724 Ga0495670_0152413 3300046691 Bacteria 1212
725 Ga0495671_0000157 3300046692 Bacteria 59803
726 Ga0495671_0001631 3300046692 Bacteria 14731
727 Ga0495671_0008090 3300046692 Bacteria 5936
728 Ga0495671_0010403 3300046692 Bacteria 5156
729 Ga0495671_0010603 3300046692 Bacteria 5096
730 Ga0495671_0021831 3300046692 Bacteria 3357
731 Ga0495671_0030560 3300046692 Bacteria 2758
732 Ga0495671_0048014 3300046692 Bacteria 2130
733 Ga0495671_0076155 3300046692 Bacteria 1645
734 Ga0495671_0268103 3300046692 Bacteria 823
735 Ga0495671_0365737 3300046692 Bacteria 691
736 Ga0495671_0447179 3300046692 Bacteria 618
737 Ga0495649_0000782 3300046694 Bacteria 25561
738 Ga0495649_0000965 3300046694 Bacteria 22681
739 Ga0495649_0003415 3300046694 Bacteria 10734
740 Ga0495649_0005077 3300046694 Bacteria 8452
741 Ga0495649_0012685 3300046694 Bacteria 4889
742 Ga0495649_0039996 3300046694 Bacteria 2569
743 Ga0495649_0044142 3300046694 Bacteria 2433
744 Ga0495649_0067856 3300046694 Bacteria 1913
745 Ga0495649_0079528 3300046694 Bacteria 1753
746 Ga0495649_0149004 3300046694 Bacteria 1229
747 Ga0495649_0185610 3300046694 Bacteria 1083
748 Ga0495649_0238120 3300046694 Bacteria 937
749 Ga0495589_0000647 3300046794 Bacteria 22840
750 Ga0495589_0010462 3300046794 Bacteria 4821
751 Ga0495589_0022488 3300046794 Bacteria 3217
752 Ga0495589_0089693 3300046794 Bacteria 1493
753 Ga0495589_0136770 3300046794 Bacteria 1174
754 Ga0495589_0324325 3300046794 Bacteria 711
755 Ga0495589_0336653 3300046794 Bacteria 696
756 Ga0495600_0006017 3300046809 Bacteria 7341
757 Ga0495660_0000608 3300046810 Bacteria 28251
758 Ga0495660_0002259 3300046810 Bacteria 12393
759 Ga0495660_0003303 3300046810 Bacteria 10011
760 Ga0495660_0009171 3300046810 Bacteria 5779
761 Ga0495660_0025137 3300046810 Bacteria 3384
762 Ga0495660_0027555 3300046810 Bacteria 3214
763 Ga0495660_0027786 3300046810 Bacteria 3198
764 Ga0495660_0040761 3300046810 Bacteria 2573
765 Ga0495660_0041094 3300046810 Bacteria 2561
766 Ga0495660_0052287 3300046810 Bacteria 2219
767 Ga0495660_0126262 3300046810 Bacteria 1288
768 Ga0495581_0056830 3300047315 Bacteria 2258
769 Ga0495581_0446440 3300047315 Bacteria 753
770 Ga0495636_0006323 3300047318 Bacteria 4652
771 Ga0495672_0001137 3300047320 Bacteria 26897
772 Ga0495672_0001678 3300047320 Bacteria 21460
773 Ga0495672_0002315 3300047320 Bacteria 17677
774 Ga0495672_0006904 3300047320 Bacteria 8654
775 Ga0495672_0010588 3300047320 Bacteria 6556
776 Ga0495672_0010862 3300047320 Bacteria 6459
777 Ga0495672_0035686 3300047320 Bacteria 3060
778 Ga0495672_0042589 3300047320 Bacteria 2737
779 Ga0495672_0051176 3300047320 Bacteria 2434
780 Ga0495672_0053590 3300047320 Bacteria 2363
781 Ga0495672_0070587 3300047320 Bacteria 1978
782 Ga0495672_0075132 3300047320 Bacteria 1901
783 Ga0495672_0152416 3300047320 Bacteria 1197
784 Ga0495672_0202626 3300047320 Bacteria 991
785 Ga0495672_0232738 3300047320 Bacteria 903
786 Ga0495672_0418758 3300047320 Bacteria 609
787 Ga0495672_0558684 3300047320 Bacteria 500
788 Ga0495676_0000022 3300047321 Bacteria 163719
789 Ga0495680_0001940 3300047322 Bacteria 21762
790 Ga0495680_0074016 3300047322 Bacteria 2587
791 Ga0495680_0137993 3300047322 Bacteria 1786
792 Ga0495683_0000030 3300047323 Bacteria 150551
793 Ga0495683_0004987 3300047323 Bacteria 7433
794 Ga0495683_0006671 3300047323 Bacteria 6288
795 Ga0495683_0014226 3300047323 Bacteria 4144
796 Ga0495683_0026016 3300047323 Bacteria 2996
797 Ga0495683_0027478 3300047323 Bacteria 2909
798 Ga0495683_0080881 3300047323 Bacteria 1584
799 Ga0495683_0285285 3300047323 Bacteria 713
800 Ga0495687_003760 3300047443 Bacteria 10731
801 Ga0495687_058858 3300047443 Bacteria 1592
802 Ga0495675_0002663 3300047444 Bacteria 10696
803 Ga0495675_0088676 3300047444 Bacteria 1942
804 Ga0495679_000218 3300047446 Bacteria 48725
805 Ga0495679_000558 3300047446 Bacteria 26165
806 Ga0495679_053350 3300047446 Bacteria 1207
807 Ga0495673_0000544 3300047469 Bacteria 38535
808 Ga0495673_0002696 3300047469 Bacteria 12217
809 Ga0495673_0004063 3300047469 Bacteria 9316
810 Ga0495673_0004098 3300047469 Bacteria 9251
811 Ga0495673_0005033 3300047469 Bacteria 8095
812 Ga0495673_0009378 3300047469 Bacteria 5418
813 Ga0495673_0010967 3300047469 Bacteria 4902
814 Ga0495673_0014764 3300047469 Bacteria 4051
815 Ga0495673_0056021 3300047469 Bacteria 1707
816 Ga0495673_0065626 3300047469 Bacteria 1541
817 Ga0495673_0079042 3300047469 Bacteria 1366
818 Ga0495673_0118531 3300047469 Bacteria 1050
819 Ga0495681_0000351 3300047470 Bacteria 36044
820 Ga0495681_0000534 3300047470 Bacteria 29137
821 Ga0495681_0001655 3300047470 Bacteria 16511
822 Ga0495681_0004365 3300047470 Bacteria 9668
823 Ga0495681_0005015 3300047470 Bacteria 8924
824 Ga0495681_0005274 3300047470 Bacteria 8676
825 Ga0495681_0007510 3300047470 Bacteria 6949
826 Ga0495681_0026986 3300047470 Bacteria 2978
827 Ga0495681_0030258 3300047470 Bacteria 2759
828 Ga0495681_0042116 3300047470 Bacteria 2212
829 Ga0495681_0141397 3300047470 Bacteria 1016
830 Ga0495681_0192004 3300047470 Bacteria 833
831 Ga0495686_0032205 3300047472 Bacteria 3394
832 Ga0495686_0052756 3300047472 Bacteria 2549
833 Ga0495686_0067717 3300047472 Bacteria 2203
834 Ga0495593_0413608 3300047673 Bacteria 674
835 Ga0495626_0000039 3300048091 Bacteria 175454
836 Ga0495626_0000391 3300048091 Bacteria 45354
837 Ga0495626_0000562 3300048091 Bacteria 36865
838 Ga0495626_0000876 3300048091 Bacteria 26763
839 Ga0495626_0001894 3300048091 Bacteria 15625
840 Ga0495626_0006428 3300048091 Bacteria 6694
841 Ga0495626_0024216 3300048091 Bacteria 2978
842 Ga0495626_0250501 3300048091 Bacteria 710
843 Ga0496102_0814629 3300048905 Bacteria 856
844 Ga0496112_0103806 3300048915 Bacteria 2813
845 Ga0496113_0171713 3300048916 Bacteria 1717
846 Ga0496116_0000376 3300048919 Bacteria 66696
847 Ga0496116_0001403 3300048919 Bacteria 27112
848 Ga0496116_0004841 3300048919 Bacteria 12698
849 Ga0496116_0223921 3300048919 Bacteria 961
850 Ga0496117_0017466 3300048920 Bacteria 5990
851 Ga0496117_0025304 3300048920 Bacteria 4669
852 Ga0496117_0071488 3300048920 Bacteria 2325
853 Ga0496118_0027663 3300048921 Bacteria 4791
854 Ga0496118_0207822 3300048921 Bacteria 1152
855 Ga0496119_0000082 3300048922 Bacteria 138565
856 Ga0496120_0118188 3300048923 Bacteria 1374
857 Ga0496121_0001119 3300048924 Bacteria 47137
858 Ga0496121_0001386 3300048924 Bacteria 41013
859 Ga0496121_0064432 3300048924 Bacteria 2988
860 Ga0496121_0133328 3300048924 Bacteria 1855
861 Ga0496122_0003673 3300048925 Bacteria 19907
862 Ga0496122_0012580 3300048925 Bacteria 8401
863 Ga0496122_0015370 3300048925 Bacteria 7322
864 Ga0496122_0294135 3300048925 Bacteria 880
865 Ga0496123_0005103 3300048926 Bacteria 13405
866 Ga0496123_0013475 3300048926 Bacteria 6858
867 Ga0496123_0030648 3300048926 Bacteria 3933
868 Ga0496123_0234062 3300048926 Bacteria 917
869 Ga0496124_0000120 3300048927 Bacteria 163899
870 Ga0496124_0023214 3300048927 Bacteria 5668
871 Ga0496124_0024564 3300048927 Bacteria 5474
872 Ga0496124_0069948 3300048927 Bacteria 2912
873 Ga0496124_0257805 3300048927 Bacteria 1285
874 Ga0496124_0468855 3300048927 Bacteria 853
875 Ga0496125_0027012 3300048928 Bacteria 5212
876 Ga0496125_0224131 3300048928 Bacteria 1208
877 Ga0496126_0025547 3300048929 Bacteria 5680
878 Ga0495678_000017 3300049459 Bacteria 282592
879 Ga0495678_000693 3300049459 Bacteria 30734
880 Ga0495678_006583 3300049459 Bacteria 6158
881 Ga0495678_007899 3300049459 Bacteria 5457
882 Ga0495678_009818 3300049459 Bacteria 4699
883 Ga0495678_011373 3300049459 Bacteria 4264
884 Ga0495678_012734 3300049459 Bacteria 3976
885 Ga0495678_023227 3300049459 Bacteria 2700
886 Ga0495678_103369 3300049459 Bacteria 984
887 Ga0495678_170849 3300049459 Bacteria 688
888 Ga0495682_0000182 3300049460 Bacteria 51816
889 Ga0495682_0003690 3300049460 Bacteria 6745
890 Ga0495682_0009136 3300049460 Bacteria 3882
891 Ga0495682_0055576 3300049460 Bacteria 1435
892 Ga0501314_017707 3300049530 Bacteria 720
893 Ga0501043_0015187 3300049579 Bacteria 6030
894 Ga0501240_007996 3300049673 Bacteria 1344
895 Ga0501226_000002 3300049853 Bacteria 426935
896 nmdc:mga08x19_130499_c1 3300050514 Bacteria 1690
897 nmdc:mga0sz30_482368_c1 3300050516 Bacteria 557
898 Ga0500572_159648 3300053111 Bacteria 737
899 Ga0500573_0032704 3300053140 Bacteria 3001
900 Ga0500577_0109599 3300053142 Bacteria 1138
901 Ga0587068_073501 3300059641 Bacteria 679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10092295 Ga0075364_100922954 74
2 3300009011 Ga0105251_10000303 Ga0105251_1000030317 74
3 3300009011 Ga0105251_10001365 Ga0105251_1000136512 74
4 3300009092 Ga0105250_10000211 Ga0105250_1000021126 74
5 3300015261 Ga0182006_1005806 Ga0182006_10058062 74
6 3300015265 Ga0182005_1019390 Ga0182005_10193904 74
7 3300017792 Ga0163161_10067424 Ga0163161_100674244 74
8 3300017792 Ga0163161_10421059 Ga0163161_104210593 74
9 3300025711 Ga0207696_1000020 Ga0207696_100002028 74
10 3300025735 Ga0207713_1000114 Ga0207713_100011420 74
11 3300025735 Ga0207713_1018301 Ga0207713_10183013 74
12 3300042137 Ga0450902_003149 Ga0450902_003149_257_532 74
13 3300042138 Ga0450903_016187 Ga0450903_016187_55_330 74
14 3300042139 Ga0450904_017293 Ga0450904_017293_221_496 74
15 3300042531 Ga0450918_062917 Ga0450918_062917_369_644 74
16 3300046452 Ga0495617_006439 Ga0495617_006439_139_414 74
17 3300046457 Ga0495590_0006565 Ga0495590_0006565_1474_1749 74
18 3300046458 Ga0495591_000244 Ga0495591_000244_33672_33947 74
19 3300046458 Ga0495591_096317 Ga0495591_096317_447_707 74
20 3300046460 Ga0495638_0001218 Ga0495638_0001218_5016_5276 74
21 3300046460 Ga0495638_0080601 Ga0495638_0080601_707_982 74
22 3300046460 Ga0495638_0118206 Ga0495638_0118206_73_348 74
23 3300046471 Ga0495650_0151957 Ga0495650_0151957_63_338 74
24 3300046474 Ga0495605_0018026 Ga0495605_0018026_996_1271 74
25 3300046491 Ga0495584_0018626 Ga0495584_0018626_1624_1899 74
26 3300046500 Ga0495596_0000273 Ga0495596_0000273_18370_18645 74
27 3300046501 Ga0495607_0028987 Ga0495607_0028987_207_482 74
28 3300046501 Ga0495607_0034676 Ga0495607_0034676_2258_2533 74
29 3300046507 Ga0495606_0000177 Ga0495606_0000177_93015_93275 74
30 3300046507 Ga0495606_0179099 Ga0495606_0179099_656_931 74
31 3300046512 Ga0495610_0002687 Ga0495610_0002687_14083_14358 74
32 3300046513 Ga0495616_0074355 Ga0495616_0074355_707_982 74
33 3300046518 Ga0495631_0029731 Ga0495631_0029731_203_478 74
34 3300046519 Ga0495632_0015502 Ga0495632_0015502_2317_2592 74
35 3300046519 Ga0495632_0027931 Ga0495632_0027931_1891_2166 74
36 3300046520 Ga0495637_0000260 Ga0495637_0000260_9235_9510 74
37 3300046522 Ga0495643_0001642 Ga0495643_0001642_15128_15388 74
38 3300046522 Ga0495643_0004173 Ga0495643_0004173_222_482 74
39 3300046522 Ga0495643_0039836 Ga0495643_0039836_769_1044 74
40 3300046522 Ga0495643_0047262 Ga0495643_0047262_527_802 74
41 3300046523 Ga0495644_0003810 Ga0495644_0003810_996_1271 74
42 3300046524 Ga0495648_0017025 Ga0495648_0017025_1604_1879 74
43 3300046530 Ga0495654_0003637 Ga0495654_0003637_6776_7051 74
44 3300046530 Ga0495654_0008879 Ga0495654_0008879_300_560 74
45 3300046542 Ga0495597_0008578 Ga0495597_0008578_3043_3318 74
46 3300046542 Ga0495597_0033820 Ga0495597_0033820_1945_2220 74
47 3300046542 Ga0495597_0057902 Ga0495597_0057902_1367_1627 74
48 3300046616 Ga0495668_0000866 Ga0495668_0000866_32191_32466 74
49 3300046660 Ga0495625_0014227 Ga0495625_0014227_3751_4026 74
50 3300046660 Ga0495625_0051020 Ga0495625_0051020_1804_2064 74
51 3300046665 Ga0495661_0021482 Ga0495661_0021482_3641_3916 74
52 3300046692 Ga0495671_0001631 Ga0495671_0001631_3317_3577 74
53 3300046692 Ga0495671_0008090 Ga0495671_0008090_4833_5108 74
54 3300046694 Ga0495649_0000965 Ga0495649_0000965_5640_5900 74
55 3300046694 Ga0495649_0039996 Ga0495649_0039996_208_468 74
56 3300046694 Ga0495649_0067856 Ga0495649_0067856_34_309 74
57 3300046694 Ga0495649_0079528 Ga0495649_0079528_293_568 74
58 3300046694 Ga0495649_0185610 Ga0495649_0185610_36_296 74
59 3300046794 Ga0495589_0022488 Ga0495589_0022488_2366_2641 74
60 3300046810 Ga0495660_0009171 Ga0495660_0009171_2883_3158 74
61 3300046810 Ga0495660_0126262 Ga0495660_0126262_29_304 74
62 3300047320 Ga0495672_0002315 Ga0495672_0002315_16574_16834 74
63 3300047320 Ga0495672_0051176 Ga0495672_0051176_57_332 74
64 3300047323 Ga0495683_0027478 Ga0495683_0027478_79_354 74
65 3300047469 Ga0495673_0010967 Ga0495673_0010967_3747_4022 74
66 3300047470 Ga0495681_0001655 Ga0495681_0001655_3288_3563 74
67 3300047470 Ga0495681_0026986 Ga0495681_0026986_684_944 74
68 3300047470 Ga0495681_0141397 Ga0495681_0141397_50_325 74
69 3300047472 Ga0495686_0032205 Ga0495686_0032205_117_392 74
70 3300047472 Ga0495686_0052756 Ga0495686_0052756_602_862 74
71 3300048091 Ga0495626_0000562 Ga0495626_0000562_17910_18185 74
72 3300048927 Ga0496124_0257805 Ga0496124_0257805_715_975 74
73 3300049459 Ga0495678_011373 Ga0495678_011373_529_804 74
74 3300049459 Ga0495678_012734 Ga0495678_012734_3510_3785 74
75 3300049459 Ga0495678_103369 Ga0495678_103369_46_306 74
76 3300006946 Ga0079104_1000229 Ga0079104_100022937 75
77 3300006948 Ga0099826_10010483 Ga0099826_100104836 75
78 3300009036 Ga0105244_10422521 Ga0105244_104225211 75
79 3300025735 Ga0207713_1155375 Ga0207713_11553752 75
80 3300027111 Ga0209281_1000033 Ga0209281_1000033222 75
81 3300030733 Ga0314311_1061251 Ga0314311_10612514 75
82 3300030742 Ga0316183_1029617 Ga0316183_10296173 75
83 3300031548 Ga0307408_100014933 Ga0307408_1000149337 75
84 3300031731 Ga0307405_10004700 Ga0307405_100047007 75
85 3300031824 Ga0307413_10009019 Ga0307413_100090196 75
86 3300031901 Ga0307406_10009078 Ga0307406_100090786 75
87 3300031903 Ga0307407_10085773 Ga0307407_100857733 75
88 3300031911 Ga0307412_10018625 Ga0307412_100186256 75
89 3300031995 Ga0307409_100195072 Ga0307409_1001950722 75
90 3300032004 Ga0307414_10024303 Ga0307414_100243034 75
91 3300032005 Ga0307411_10021289 Ga0307411_100212893 75
92 3300041411 Ga0439466_0191179 Ga0439466_0191179_58_318 75
93 3300042000 Ga0439437_001799 Ga0439437_001799_1260_1520 75
94 3300042013 Ga0439456_023978 Ga0439456_023978_336_596 75
95 3300042115 Ga0450911_000018 Ga0450911_000018_15804_16064 75
96 3300042130 Ga0450892_001826 Ga0450892_001826_856_1116 75
97 3300042139 Ga0450904_000008 Ga0450904_000008_42399_42659 75
98 3300042139 Ga0450904_010141 Ga0450904_010141_289_549 75
99 3300042142 Ga0450905_018025 Ga0450905_018025_341_601 75
100 3300042156 Ga0439446_0000824 Ga0439446_0000824_288_548 75
101 3300042438 Ga0439459_0003689 Ga0439459_0003689_324_584 75
102 3300042530 Ga0450916_018021 Ga0450916_018021_455_715 75
103 3300042532 Ga0450893_0007354 Ga0450893_0007354_1228_1488 75
104 3300049530 Ga0501314_017707 Ga0501314_017707_311_571 75
105 3300049853 Ga0501226_000002 Ga0501226_000002_367565_367825 75
106 3300009011 Ga0105251_10317388 Ga0105251_103173881 76
107 3300009036 Ga0105244_10025566 Ga0105244_100255664 76
108 3300025728 Ga0207655_1013146 Ga0207655_10131464 76
109 3300025735 Ga0207713_1081426 Ga0207713_10814262 76
110 3300027111 Ga0209281_1001999 Ga0209281_10019998 76
111 3300032004 Ga0307414_10181710 Ga0307414_101817104 76
112 3300046473 Ga0495582_0010897 Ga0495582_0010897_1125_1385 76
113 3300046499 Ga0495594_0112800 Ga0495594_0112800_1183_1443 76
114 3300046517 Ga0495630_0777093 Ga0495630_0777093_106_366 76
115 3300046526 Ga0495666_0042236 Ga0495666_0042236_109_369 76
116 3300046535 Ga0495586_0036139 Ga0495586_0036139_57_317 76
117 3300046536 Ga0495587_0002264 Ga0495587_0002264_1833_2093 76
118 3300046543 Ga0495645_0075070 Ga0495645_0075070_37_297 76
119 3300046663 Ga0495635_0002064 Ga0495635_0002064_119_379 76
120 3300046680 Ga0495646_0002514 Ga0495646_0002514_6223_6483 76
121 3300046809 Ga0495600_0006017 Ga0495600_0006017_6082_6342 76
122 3300047315 Ga0495581_0446440 Ga0495581_0446440_15_275 76
123 3300047322 Ga0495680_0001940 Ga0495680_0001940_14041_14301 76
124 3300047444 Ga0495675_0002663 Ga0495675_0002663_5955_6215 76
125 3300047673 Ga0495593_0413608 Ga0495593_0413608_393_653 76
126 3300006186 Ga0075369_10102719 Ga0075369_101027192 77
127 3300006914 Ga0075436_101568787 Ga0075436_1015687872 77
128 3300009036 Ga0105244_10095872 Ga0105244_100958722 77
129 3300013308 Ga0157375_11267717 Ga0157375_112677173 77
130 3300027907 Ga0207428_10007376 Ga0207428_100073766 77
131 3300031344 Ga0265316_10492113 Ga0265316_104921132 77
132 3300048929 Ga0496126_0025547 Ga0496126_0025547_3327_3596 77
133 3300050514 nmdc:mga08x19_130499_c1 nmdc:mga08x19_130499_c1_180_455 77
134 3300025292 Ga0209676_1054026 Ga0209676_10540262 78
135 3300042013 Ga0439456_000187 Ga0439456_000187_5617_5889 79
136 3300042125 Ga0450923_004266 Ga0450923_004266_49_324 80
137 iso_pu_bacteria 2919497567 2919500900 80
138 3300005344 Ga0070661_100000078 Ga0070661_10000007841 81
139 3300005564 Ga0070664_100001480 Ga0070664_1000014801 81
140 3300009036 Ga0105244_10010319 Ga0105244_100103195 81
141 3300009176 Ga0105242_10000136 Ga0105242_1000013626 81
142 3300011119 Ga0105246_10012442 Ga0105246_100124424 81
143 3300014497 Ga0182008_10392100 Ga0182008_103921001 81
144 3300015261 Ga0182006_1009153 Ga0182006_10091534 81
145 3300025728 Ga0207655_1000326 Ga0207655_100032637 81
146 3300025920 Ga0207649_10000001 Ga0207649_10000001220 81
147 3300025934 Ga0207686_10011033 Ga0207686_100110334 81
148 3300025945 Ga0207679_10000011 Ga0207679_10000011220 81
149 3300031548 Ga0307408_100046272 Ga0307408_1000462722 81
150 3300046463 Ga0495653_0004108 Ga0495653_0004108_6844_7116 81
151 3300046492 Ga0495585_0002190 Ga0495585_0002190_11016_11288 81
152 3300046507 Ga0495606_0001468 Ga0495606_0001468_13889_14161 81
153 3300046513 Ga0495616_0172396 Ga0495616_0172396_466_738 81
154 3300046665 Ga0495661_0000048 Ga0495661_0000048_76983_77255 81
155 3300049459 Ga0495678_023227 Ga0495678_023227_2064_2336 81
156 iso_pu_bacteria 2511231156 2511822461 81
157 iso_pu_bacteria 2599185212 2599614596 81
158 iso_pu_bacteria 2599185302 2599943595 81
159 iso_pu_bacteria 2599185304 2599955906 81
160 iso_pu_bacteria 2599185309 2599984599 81
161 iso_pu_bacteria 2599185310 2599991248 81
162 iso_pu_bacteria 2599185311 2599994846 81
163 iso_pu_bacteria 2599185312 2600002221 81
164 iso_pu_bacteria 2599185316 2600023973 81
165 iso_pu_bacteria 2599185317 2600030990 81
166 iso_pu_bacteria 2599185318 2600034666 81
167 iso_pu_bacteria 2599185319 2600043459 81
168 iso_pu_bacteria 2599185320 2600048059 81
169 iso_pu_bacteria 2599185322 2600061332 81
170 iso_pu_bacteria 2599185323 2600067612 81
171 iso_pu_bacteria 2599185325 2600077666 81
172 iso_pu_bacteria 2600254930 2600360881 81
173 iso_pu_bacteria 2643221650 2644282069 81
174 iso_pu_bacteria 2651869719 2652543415 81
175 iso_pu_bacteria 2667528176 2671127342 81
176 iso_pu_bacteria 2808606361 2808855945 81
177 iso_pu_bacteria 2808606376 2808922740 81
178 iso_pu_bacteria 2808606378 2808936025 81
179 iso_pu_bacteria 2808606380 2808944427 81
180 iso_pu_bacteria 2808606383 2808964478 81
181 iso_pu_bacteria 2808606389 2808999366 81
182 iso_pu_bacteria 2825651385 2825654260 81
183 iso_pu_bacteria 2842854478 2842858720 81
184 iso_pu_bacteria 2913036834 2913037292 81
185 iso_pu_bacteria 2923586266 2923589792 81
186 iso_pu_bacteria 2929144301 2929144823 81
187 iso_pu_bacteria 2931369376 2931371841 81
188 iso_pu_bacteria 2988728565 2988732212 81
189 iso_pu_bacteria 3007866637 3007872015 81
190 iso_pu_bacteria 8056143049 8056143745 81
191 3300009148 Ga0105243_10000595 Ga0105243_1000059525 82
192 3300009553 Ga0105249_10010128 Ga0105249_100101285 82
193 3300013102 Ga0157371_10000811 Ga0157371_1000081125 82
194 3300014497 Ga0182008_10001166 Ga0182008_1000116612 82
195 3300031824 Ga0307413_10934500 Ga0307413_109345002 82
196 3300046679 Ga0495623_0097382 Ga0495623_0097382_1377_1652 82
197 3300047322 Ga0495680_0074016 Ga0495680_0074016_294_569 82
198 3300048919 Ga0496116_0000376 Ga0496116_0000376_44092_44340 82
199 3300048920 Ga0496117_0071488 Ga0496117_0071488_1769_2017 82
200 3300048926 Ga0496123_0013475 Ga0496123_0013475_6570_6818 82
201 iso_pu_bacteria 2510065053 2510284311 82
202 iso_pu_bacteria 2510065055 2510293000 82
203 iso_pu_bacteria 2510065058 2510312506 82
204 iso_pu_bacteria 2511231004 2511256405 82
205 iso_pu_bacteria 2511231006 2511266102 82
206 iso_pu_bacteria 2511231010 2511288780 82
207 iso_pu_bacteria 2511231011 2511297353 82
208 iso_pu_bacteria 2511231016 2511326019 82
209 iso_pu_bacteria 2511231018 2511336316 82
210 iso_pu_bacteria 2511231019 2511345834 82
211 iso_pu_bacteria 2511231020 2511349121 82
212 iso_pu_bacteria 2511231021 2511355996 82
213 iso_pu_bacteria 2511231022 2511362600 82
214 iso_pu_bacteria 2511231023 2511366823 82
215 iso_pu_bacteria 2511231031 2511411321 82
216 iso_pu_bacteria 2512047018 2512325962 82
217 iso_pu_bacteria 2582580891 2583789798 82
218 iso_pu_bacteria 2597489887 2597855668 82
219 iso_pu_bacteria 2599185155 2599327418 82
220 iso_pu_bacteria 2599185185 2599485570 82
221 iso_pu_bacteria 2599185188 2599500104 82
222 iso_pu_bacteria 2599185248 2599769417 82
223 iso_pu_bacteria 2599185257 2599806699 82
224 iso_pu_bacteria 2599185289 2599886837 82
225 iso_pu_bacteria 2599185291 2599898166 82
226 iso_pu_bacteria 2599185300 2599930899 82
227 iso_pu_bacteria 2599185305 2599962035 82
228 iso_pu_bacteria 2599185306 2599964555 82
229 iso_pu_bacteria 2599185308 2599978904 82
230 iso_pu_bacteria 2599185313 2600004868 82
231 iso_pu_bacteria 2599185314 2600012864 82
232 iso_pu_bacteria 2599185315 2600018969 82
233 iso_pu_bacteria 2599185321 2600053330 82
234 iso_pu_bacteria 2599185324 2600071797 82
235 iso_pu_bacteria 2600254931 2600364877 82
236 iso_pu_bacteria 2600255318 2601797840 82
237 iso_pu_bacteria 2600255389 2602008649 82
238 iso_pu_bacteria 2603880185 2606076677 82
239 iso_pu_bacteria 2603880199 2606128909 82
240 iso_pu_bacteria 2623620443 2624478229 82
241 iso_pu_bacteria 2643221565 2643840997 82
242 iso_pu_bacteria 2643221589 2643954895 82
243 iso_pu_bacteria 2643221602 2644024535 82
244 iso_pu_bacteria 2643221633 2644186129 82
245 iso_pu_bacteria 2667528170 2671090795 82
246 iso_pu_bacteria 2671180172 2671772350 82
247 iso_pu_bacteria 2675903515 2678260995 82
248 iso_pu_bacteria 2713897149 2715755484 82
249 iso_pu_bacteria 2738543004 2739198034 82
250 iso_pu_bacteria 2738543020 2739288585 82
251 iso_pu_bacteria 2738543021 2739293897 82
252 iso_pu_bacteria 2738543025 2739311288 82
253 iso_pu_bacteria 2740892503 2743735085 82
254 iso_pu_bacteria 2744054620 2745006306 82
255 iso_pu_bacteria 2773857670 2774119553 82
256 iso_pu_bacteria 2773857672 2774131491 82
257 iso_pu_bacteria 2773857673 2774134745 82
258 iso_pu_bacteria 2784132063 2784261039 82
259 iso_pu_bacteria 2784132072 2784315964 82
260 iso_pu_bacteria 2791355520 2794593985 82
261 iso_pu_bacteria 2808606377 2808932183 82
262 iso_pu_bacteria 2808606379 2808939679 82
263 iso_pu_bacteria 2808606381 2808954216 82
264 iso_pu_bacteria 2808606382 2808955876 82
265 iso_pu_bacteria 2811994881 2812370185 82
266 iso_pu_bacteria 2823421272 2823425496 82
267 iso_pu_bacteria 2826581358 2826586870 82
268 iso_pu_bacteria 2842805378 2842807105 82
269 iso_pu_bacteria 2842815866 2842816688 82
270 iso_pu_bacteria 2842849001 2842852264 82
271 iso_pu_bacteria 2852657418 2852660445 82
272 iso_pu_bacteria 2860339153 2860343636 82
273 iso_pu_bacteria 2878029506 2878030172 82
274 iso_pu_bacteria 2880230671 2880231120 82
275 iso_pu_bacteria 2904518522 2904519578 82
276 iso_pu_bacteria 2917832318 2917836375 82
277 iso_pu_bacteria 2919063839 2919066146 82
278 iso_pu_bacteria 2919125081 2919127492 82
279 iso_pu_bacteria 2919456309 2919459991 82
280 iso_pu_bacteria 2919481497 2919486897 82
281 iso_pu_bacteria 2919501602 2919502231 82
282 iso_pu_bacteria 2923519811 2923524276 82
283 iso_pu_bacteria 2926063275 2926063904 82
284 iso_pu_bacteria 2931396565 2931398845 82
285 iso_pu_bacteria 2969304461 2969304965 82
286 iso_pu_bacteria 2974298342 2974301731 82
287 iso_pu_bacteria 2984286254 2984291979 82
288 iso_pu_bacteria 2984499530 2984500700 82
289 iso_pu_bacteria 2984504281 2984507223 82
290 iso_pu_bacteria 2990196909 2990199574 82
291 iso_pu_bacteria 3007252601 3007255374 82
292 iso_pu_bacteria 3007315729 3007315820 82
293 iso_pu_bacteria 3007395558 3007399631 82
294 iso_pu_bacteria 3007511990 3007517913 82
295 iso_pu_bacteria 3007619802 3007624982 82
296 iso_pu_bacteria 3007718800 3007721229 82
297 iso_pu_bacteria 8015687852 8015688329 82
298 iso_pu_bacteria 8016728285 8016730680 82
299 iso_pu_bacteria 8055770955 8055771426 82
300 iso_pu_bacteria 8056155041 8056158520 82
301 iso_pu_bacteria 8056172158 8056176698 82
302 iso_pu_bacteria 8056177738 8056183035 82
303 3300002704 JGI25155J39150_1004330 JGI25155J39150_10043301 83
304 3300002738 JGI25154J39366_1009645 JGI25154J39366_10096452 83
305 3300003751 Ga0055538_1000037 Ga0055538_100003787 83
306 3300003752 Ga0055539_1000048 Ga0055539_100004887 83
307 3300003756 Ga0055533_1000059 Ga0055533_100005987 83
308 3300003758 Ga0055532_1000105 Ga0055532_100010510 83
309 3300003759 Ga0055525_1000128 Ga0055525_100012873 83
310 3300003761 Ga0055535_1014660 Ga0055535_10146601 83
311 3300003841 Ga0055541_1000035 Ga0055541_100003573 83
312 3300025206 Ga0209435_100738 Ga0209435_1007385 83
313 3300025224 Ga0209784_100028 Ga0209784_10002873 83
314 3300025225 Ga0209566_100028 Ga0209566_10002873 83
315 3300025226 Ga0209674_100047 Ga0209674_10004773 83
316 3300025229 Ga0209147_100031 Ga0209147_10003173 83
317 3300025230 Ga0209563_100050 Ga0209563_10005073 83
318 3300025233 Ga0209437_130276 Ga0209437_1302761 83
319 3300025242 Ga0209258_100150 Ga0209258_10015028 83
320 3300025246 Ga0209646_1000183 Ga0209646_100018310 83
321 3300025253 Ga0209677_100029 Ga0209677_10002973 83
322 3300025256 Ga0209759_1023788 Ga0209759_10237882 83
323 3300025916 Ga0207663_10837357 Ga0207663_108373572 83
324 3300005288 Ga0065714_10074580 Ga0065714_100745802 84
325 3300048916 Ga0496113_0171713 Ga0496113_0171713_360_617 84
326 2162886007 SwRhRL2b_contig_2788444 SwRhRL2b_0558.00008020 85
327 3300003781 Ga0055536_1024225 Ga0055536_10242254 85
328 3300003791 Ga0055530_10000098 Ga0055530_1000009841 85
329 3300003792 Ga0055540_1000138 Ga0055540_100013826 85
330 3300005288 Ga0065714_10002325 Ga0065714_1000232513 85
331 3300005289 Ga0065704_10082681 Ga0065704_100826813 85
332 3300013100 Ga0157373_10117043 Ga0157373_101170433 85
333 3300025292 Ga0209676_1005098 Ga0209676_10050989 85
334 3300025298 Ga0209050_1000028 Ga0209050_1000028273 85
335 3300025303 Ga0209051_1000080 Ga0209051_1000080106 85
336 3300025304 Ga0209257_1016807 Ga0209257_10168074 85
337 3300030731 Ga0316177_1197218 Ga0316177_11972182 85
338 3300030735 Ga0316178_1051966 Ga0316178_10519662 85
339 3300030745 Ga0316182_1113139 Ga0316182_11131391 85
340 3300031995 Ga0307409_100807614 Ga0307409_1008076142 85
341 3300046530 Ga0495654_0254286 Ga0495654_0254286_10_285 85
342 3300046692 Ga0495671_0010603 Ga0495671_0010603_4810_5085 85
343 3300048927 Ga0496124_0024564 Ga0496124_0024564_1257_1514 85
344 iso_pu_bacteria 2597489888 2597861668 85
345 iso_pu_bacteria 2597489889 2597867393 85
346 iso_pu_bacteria 2599185167 2599398845 85
347 iso_pu_bacteria 2599185179 2599450900 85
348 iso_pu_bacteria 2599185189 2599506434 85
349 iso_pu_bacteria 2599185190 2599514154 85
350 iso_pu_bacteria 2599185191 2599518755 85
351 iso_pu_bacteria 2599185288 2599882670 85
352 iso_pu_bacteria 2599185290 2599893511 85
353 iso_pu_bacteria 2599185303 2599950753 85
354 iso_pu_bacteria 2600255296 2601692353 85
355 iso_pu_bacteria 2619619299 2621302172 85
356 iso_pu_bacteria 2643221571 2643872613 85
357 iso_pu_bacteria 2643221713 2644619654 85
358 iso_pu_bacteria 2675903420 2677898948 85
359 iso_pu_bacteria 2718217725 2718632166 85
360 iso_pu_bacteria 2721755607 2723246566 85
361 iso_pu_bacteria 2738541265 2738674093 85
362 iso_pu_bacteria 2738541282 2738752486 85
363 iso_pu_bacteria 2738541294 2738807901 85
364 iso_pu_bacteria 2738541303 2738861527 85
365 iso_pu_bacteria 2738541309 2738895261 85
366 iso_pu_bacteria 2808606385 2808976654 85
367 iso_pu_bacteria 2808606388 2808991908 85
368 iso_pu_bacteria 2816332298 2817488418 85
369 iso_pu_bacteria 2834028612 2834032205 85
370 iso_pu_bacteria 2842826826 2842832091 85
371 iso_pu_bacteria 2842837860 2842838641 85
372 iso_pu_bacteria 2852612431 2852617082 85
373 iso_pu_bacteria 2852667396 2852671929 85
374 iso_pu_bacteria 2860867994 2860868442 85
375 iso_pu_bacteria 2908446538 2908447035 85
376 iso_pu_bacteria 2929189879 2929190307 85
377 iso_pu_bacteria 2931390751 2931391386 85
378 iso_pu_bacteria 2945928738 2945930160 85
379 iso_pu_bacteria 2945961074 2945967596 85
380 iso_pu_bacteria 2946006987 2946012507 85
381 iso_pu_bacteria 2946027586 2946028650 85
382 iso_pu_bacteria 2947233263 2947235177 85
383 iso_pu_bacteria 3007861166 3007864319 85
384 iso_pu_bacteria 8054285046 8054291530 85
385 iso_pu_bacteria 8054347763 8054350124 85
386 iso_pu_bacteria 8054503363 8054503973 85
387 iso_pu_bacteria 8055817908 8055818369 85
388 iso_pu_bacteria 8056131705 8056132343 85
389 iso_pu_bacteria 8056148874 8056152483 85
390 iso_pu_bacteria 8056161164 8056164349 85
391 2124908027 MRS2a_Contig_66 MRS2a_00520880 86
392 2162886007 SwRhRL2b_contig_1695330 SwRhRL2b_0498.00009190 86
393 3300002737 JGI25162J39368_1000181 JGI25162J39368_100018133 86
394 3300002771 JGI25163J39215_1000288 JGI25163J39215_10002883 86
395 3300002772 JGI25164J39214_1000146 JGI25164J39214_100014625 86
396 3300003214 JGI25165J46597_1000267 JGI25165J46597_100026725 86
397 3300003503 JGI26141J51220_1005744 JGI26141J51220_10057442 86
398 3300003781 Ga0055536_1000328 Ga0055536_100032828 86
399 3300003784 Ga0055534_1051176 Ga0055534_10511762 86
400 3300003791 Ga0055530_10000333 Ga0055530_1000033316 86
401 3300003791 Ga0055530_10002459 Ga0055530_100024599 86
402 3300003792 Ga0055540_1000279 Ga0055540_100027916 86
403 3300003792 Ga0055540_1000586 Ga0055540_100058610 86
404 3300003794 Ga0055531_10000321 Ga0055531_1000032111 86
405 3300003856 Ga0058692_1007212 Ga0058692_10072123 86
406 3300005288 Ga0065714_10000567 Ga0065714_100005673 86
407 3300005288 Ga0065714_10009527 Ga0065714_100095274 86
408 3300005288 Ga0065714_10075698 Ga0065714_100756983 86
409 3300005288 Ga0065714_10105281 Ga0065714_101052814 86
410 3300005288 Ga0065714_10150668 Ga0065714_101506681 86
411 3300005288 Ga0065714_10259788 Ga0065714_102597882 86
412 3300005288 Ga0065714_10373269 Ga0065714_103732691 86
413 3300005288 Ga0065714_10492767 Ga0065714_104927672 86
414 3300005288 Ga0065714_10513724 Ga0065714_105137242 86
415 3300005289 Ga0065704_10014239 Ga0065704_100142393 86
416 3300005289 Ga0065704_10033682 Ga0065704_100336822 86
417 3300005289 Ga0065704_10060882 Ga0065704_100608821 86
418 3300005289 Ga0065704_10191903 Ga0065704_101919032 86
419 3300005289 Ga0065704_10295533 Ga0065704_102955333 86
420 3300005289 Ga0065704_10575365 Ga0065704_105753652 86
421 3300005290 Ga0065712_10003956 Ga0065712_100039568 86
422 3300005290 Ga0065712_10079396 Ga0065712_100793965 86
423 3300005293 Ga0065715_10108087 Ga0065715_101080873 86
424 3300005328 Ga0070676_10068380 Ga0070676_100683803 86
425 3300005353 Ga0070669_100000827 Ga0070669_1000008278 86
426 3300005367 Ga0070667_100943735 Ga0070667_1009437352 86
427 3300005455 Ga0070663_100061388 Ga0070663_1000613883 86
428 3300005457 Ga0070662_100010823 Ga0070662_1000108233 86
429 3300005548 Ga0070665_100057419 Ga0070665_1000574195 86
430 3300005548 Ga0070665_100247376 Ga0070665_1002473761 86
431 3300005548 Ga0070665_100866789 Ga0070665_1008667892 86
432 3300006051 Ga0075364_10158259 Ga0075364_101582593 86
433 3300006051 Ga0075364_10294982 Ga0075364_102949822 86
434 3300006051 Ga0075364_10415208 Ga0075364_104152082 86
435 3300006051 Ga0075364_10769723 Ga0075364_107697232 86
436 3300006058 Ga0075432_10008257 Ga0075432_100082574 86
437 3300006177 Ga0075362_10086765 Ga0075362_100867652 86
438 3300006177 Ga0075362_10657816 Ga0075362_106578161 86
439 3300006186 Ga0075369_10129142 Ga0075369_101291422 86
440 3300006353 Ga0075370_10457159 Ga0075370_104571593 86
441 3300006914 Ga0075436_100167362 Ga0075436_1001673622 86
442 3300006946 Ga0079104_1000296 Ga0079104_100029622 86
443 3300009011 Ga0105251_10000113 Ga0105251_1000011332 86
444 3300009011 Ga0105251_10000361 Ga0105251_1000036113 86
445 3300009011 Ga0105251_10014426 Ga0105251_100144266 86
446 3300009011 Ga0105251_10063747 Ga0105251_100637473 86
447 3300009011 Ga0105251_10068655 Ga0105251_100686553 86
448 3300009011 Ga0105251_10097408 Ga0105251_100974081 86
449 3300009011 Ga0105251_10563166 Ga0105251_105631661 86
450 3300009036 Ga0105244_10001234 Ga0105244_100012349 86
451 3300009036 Ga0105244_10007513 Ga0105244_100075134 86
452 3300009036 Ga0105244_10008576 Ga0105244_100085763 86
453 3300009036 Ga0105244_10026634 Ga0105244_100266343 86
454 3300009036 Ga0105244_10032315 Ga0105244_100323154 86
455 3300009036 Ga0105244_10033297 Ga0105244_100332974 86
456 3300009036 Ga0105244_10033802 Ga0105244_100338023 86
457 3300009036 Ga0105244_10051275 Ga0105244_100512753 86
458 3300009036 Ga0105244_10132272 Ga0105244_101322722 86
459 3300009036 Ga0105244_10186354 Ga0105244_101863543 86
460 3300009092 Ga0105250_10002092 Ga0105250_100020926 86
461 3300009092 Ga0105250_10005321 Ga0105250_100053212 86
462 3300009092 Ga0105250_10053490 Ga0105250_100534902 86
463 3300009092 Ga0105250_10069324 Ga0105250_100693244 86
464 3300009092 Ga0105250_10349254 Ga0105250_103492541 86
465 3300009092 Ga0105250_10381733 Ga0105250_103817332 86
466 3300009098 Ga0105245_11292020 Ga0105245_112920203 86
467 3300009148 Ga0105243_10000370 Ga0105243_1000037024 86
468 3300009148 Ga0105243_10016178 Ga0105243_100161782 86
469 3300009148 Ga0105243_10048309 Ga0105243_100483093 86
470 3300009148 Ga0105243_10167546 Ga0105243_101675462 86
471 3300009176 Ga0105242_10033413 Ga0105242_100334134 86
472 3300011119 Ga0105246_10002498 Ga0105246_100024987 86
473 3300011119 Ga0105246_10014440 Ga0105246_100144405 86
474 3300011119 Ga0105246_10233239 Ga0105246_102332391 86
475 3300012477 Ga0157336_1026916 Ga0157336_10269162 86
476 3300012498 Ga0157345_1000068 Ga0157345_100006817 86
477 3300013100 Ga0157373_10009194 Ga0157373_100091944 86
478 3300013100 Ga0157373_10010747 Ga0157373_100107475 86
479 3300013100 Ga0157373_10022016 Ga0157373_100220164 86
480 3300013102 Ga0157371_10001369 Ga0157371_1000136916 86
481 3300013102 Ga0157371_10005693 Ga0157371_100056934 86
482 3300013102 Ga0157371_10036093 Ga0157371_100360935 86
483 3300013104 Ga0157370_10008166 Ga0157370_100081668 86
484 3300013104 Ga0157370_10016274 Ga0157370_100162745 86
485 3300013104 Ga0157370_10023179 Ga0157370_100231795 86
486 3300013104 Ga0157370_10097202 Ga0157370_100972024 86
487 3300013104 Ga0157370_10327861 Ga0157370_103278613 86
488 3300013104 Ga0157370_11097829 Ga0157370_110978292 86
489 3300013104 Ga0157370_11405170 Ga0157370_114051702 86
490 3300013105 Ga0157369_10001261 Ga0157369_100012617 86
491 3300013105 Ga0157369_10001555 Ga0157369_100015557 86
492 3300013105 Ga0157369_10717457 Ga0157369_107174573 86
493 3300013306 Ga0163162_10014636 Ga0163162_100146364 86
494 3300013307 Ga0157372_10001525 Ga0157372_1000152511 86
495 3300013307 Ga0157372_10008414 Ga0157372_100084147 86
496 3300013307 Ga0157372_10292524 Ga0157372_102925242 86
497 3300013308 Ga0157375_10092722 Ga0157375_100927223 86
498 3300013308 Ga0157375_12308093 Ga0157375_123080932 86
499 3300014497 Ga0182008_10025925 Ga0182008_100259253 86
500 3300014497 Ga0182008_10035903 Ga0182008_100359032 86
501 3300015261 Ga0182006_1006236 Ga0182006_10062364 86
502 3300015261 Ga0182006_1007812 Ga0182006_10078124 86
503 3300015261 Ga0182006_1012252 Ga0182006_10122524 86
504 3300015261 Ga0182006_1034428 Ga0182006_10344283 86
505 3300015262 Ga0182007_10024749 Ga0182007_100247493 86
506 3300015262 Ga0182007_10211770 Ga0182007_102117702 86
507 3300015265 Ga0182005_1031413 Ga0182005_10314132 86
508 3300015265 Ga0182005_1033418 Ga0182005_10334183 86
509 3300015265 Ga0182005_1053576 Ga0182005_10535762 86
510 3300017792 Ga0163161_10000719 Ga0163161_1000071922 86
511 3300017792 Ga0163161_10012332 Ga0163161_100123326 86
512 3300017792 Ga0163161_10074001 Ga0163161_100740013 86
513 3300017792 Ga0163161_10123795 Ga0163161_101237954 86
514 3300025207 Ga0209760_100128 Ga0209760_10012826 86
515 3300025231 Ga0207427_100014 Ga0207427_100014377 86
516 3300025233 Ga0209437_100016 Ga0209437_100016260 86
517 3300025258 Ga0209129_1040143 Ga0209129_10401432 86
518 3300025261 Ga0209233_1000036 Ga0209233_1000036377 86
519 3300025291 Ga0209675_1002235 Ga0209675_10022358 86
520 3300025292 Ga0209676_1000025 Ga0209676_1000025261 86
521 3300025292 Ga0209676_1000032 Ga0209676_1000032358 86
522 3300025298 Ga0209050_1000025 Ga0209050_1000025359 86
523 3300025298 Ga0209050_1000520 Ga0209050_100052027 86
524 3300025303 Ga0209051_1000026 Ga0209051_100002656 86
525 3300025303 Ga0209051_1000334 Ga0209051_100033442 86
526 3300025304 Ga0209257_1000034 Ga0209257_1000034261 86
527 3300025304 Ga0209257_1044406 Ga0209257_10444062 86
528 3300025711 Ga0207696_1000057 Ga0207696_100005789 86
529 3300025711 Ga0207696_1001201 Ga0207696_100120111 86
530 3300025711 Ga0207696_1002125 Ga0207696_10021256 86
531 3300025711 Ga0207696_1003512 Ga0207696_10035122 86
532 3300025711 Ga0207696_1027145 Ga0207696_10271452 86
533 3300025728 Ga0207655_1000014 Ga0207655_1000014217 86
534 3300025728 Ga0207655_1000405 Ga0207655_100040524 86
535 3300025728 Ga0207655_1001720 Ga0207655_10017204 86
536 3300025728 Ga0207655_1002603 Ga0207655_10026035 86
537 3300025728 Ga0207655_1003573 Ga0207655_10035733 86
538 3300025728 Ga0207655_1008096 Ga0207655_10080968 86
539 3300025728 Ga0207655_1017799 Ga0207655_10177992 86
540 3300025728 Ga0207655_1068932 Ga0207655_10689323 86
541 3300025728 Ga0207655_1086629 Ga0207655_10866292 86
542 3300025735 Ga0207713_1000031 Ga0207713_1000031120 86
543 3300025735 Ga0207713_1000632 Ga0207713_10006329 86
544 3300025735 Ga0207713_1002064 Ga0207713_100206412 86
545 3300025735 Ga0207713_1002309 Ga0207713_10023097 86
546 3300025735 Ga0207713_1006008 Ga0207713_10060084 86
547 3300025735 Ga0207713_1006241 Ga0207713_10062414 86
548 3300025735 Ga0207713_1026722 Ga0207713_10267224 86
549 3300025735 Ga0207713_1109465 Ga0207713_11094652 86
550 3300025907 Ga0207645_10211141 Ga0207645_102111412 86
551 3300025923 Ga0207681_10001050 Ga0207681_100010506 86
552 3300025933 Ga0207706_10013926 Ga0207706_100139266 86
553 3300025934 Ga0207686_10178993 Ga0207686_101789934 86
554 3300025935 Ga0207709_10000022 Ga0207709_10000022259 86
555 3300025935 Ga0207709_10000164 Ga0207709_1000016464 86
556 3300025935 Ga0207709_10016199 Ga0207709_100161994 86
557 3300025935 Ga0207709_10027420 Ga0207709_100274203 86
558 3300025935 Ga0207709_11410629 Ga0207709_114106292 86
559 3300025961 Ga0207712_10010042 Ga0207712_100100425 86
560 3300025972 Ga0207668_10987916 Ga0207668_109879162 86
561 3300025986 Ga0207658_10561768 Ga0207658_105617683 86
562 3300026067 Ga0207678_10082181 Ga0207678_100821815 86
563 3300026142 Ga0207698_11740210 Ga0207698_117402102 86
564 3300027111 Ga0209281_1000026 Ga0209281_1000026307 86
565 3300027312 Ga0209371_1000032 Ga0209371_100003286 86
566 3300027312 Ga0209371_1021928 Ga0209371_10219282 86
567 3300027360 Ga0209969_1009852 Ga0209969_10098524 86
568 3300027378 Ga0209981_1004460 Ga0209981_10044602 86
569 3300027378 Ga0209981_1046684 Ga0209981_10466842 86
570 3300027424 Ga0209984_1004871 Ga0209984_10048712 86
571 3300027471 Ga0209995_1003474 Ga0209995_10034744 86
572 3300027526 Ga0209968_1011623 Ga0209968_10116233 86
573 3300027543 Ga0209999_1017268 Ga0209999_10172683 86
574 3300027543 Ga0209999_1020527 Ga0209999_10205273 86
575 3300027552 Ga0209982_1071012 Ga0209982_10710122 86
576 3300027665 Ga0209983_1063231 Ga0209983_10632312 86
577 3300027682 Ga0209971_1024703 Ga0209971_10247033 86
578 3300027876 Ga0209974_10185800 Ga0209974_101858003 86
579 3300027907 Ga0207428_10081146 Ga0207428_100811463 86
580 3300027907 Ga0207428_10334300 Ga0207428_103343002 86
581 3300027907 Ga0207428_10396062 Ga0207428_103960622 86
582 3300028379 Ga0268266_10008655 Ga0268266_100086555 86
583 3300028379 Ga0268266_10823226 Ga0268266_108232263 86
584 3300028379 Ga0268266_11557832 Ga0268266_115578322 86
585 3300028786 Ga0307517_10465541 Ga0307517_104655412 86
586 3300030500 Ga0268256_1000050 Ga0268256_10000509 86
587 3300030500 Ga0268256_1024694 Ga0268256_10246943 86
588 3300030521 Ga0307511_10363727 Ga0307511_103637271 86
589 3300031730 Ga0307516_10222999 Ga0307516_102229993 86
590 3300031731 Ga0307405_10846056 Ga0307405_108460562 86
591 3300032002 Ga0307416_100384947 Ga0307416_1003849472 86
592 3300033180 Ga0307510_10001604 Ga0307510_1000160424 86
593 3300033180 Ga0307510_10237407 Ga0307510_102374073 86
594 3300038705 Ga0237819_12627 Ga0237819_12627_336_596 86
595 3300041405 Ga0439438_001683 Ga0439438_001683_5071_5331 86
596 3300041405 Ga0439438_002675 Ga0439438_002675_6942_7202 86
597 3300041405 Ga0439438_005049 Ga0439438_005049_1324_1584 86
598 3300041405 Ga0439438_010772 Ga0439438_010772_777_1037 86
599 3300041407 Ga0439447_001542 Ga0439447_001542_4678_4938 86
600 3300041407 Ga0439447_006299 Ga0439447_006299_3446_3706 86
601 3300041407 Ga0439447_019552 Ga0439447_019552_38_298 86
602 3300041407 Ga0439447_125681 Ga0439447_125681_195_476 86
603 3300041411 Ga0439466_0003017 Ga0439466_0003017_3369_3629 86
604 3300041411 Ga0439466_0012045 Ga0439466_0012045_925_1185 86
605 3300041411 Ga0439466_0026577 Ga0439466_0026577_191_451 86
606 3300041512 Ga0451853_1362176 Ga0451853_1362176_322_582 86
607 3300042006 Ga0439432_000366 Ga0439432_000366_4514_4774 86
608 3300042006 Ga0439432_006395 Ga0439432_006395_720_980 86
609 3300042006 Ga0439432_025862 Ga0439432_025862_1084_1356 86
610 3300042006 Ga0439432_057191 Ga0439432_057191_661_921 86
611 3300042009 Ga0439451_003503 Ga0439451_003503_2008_2268 86
612 3300042009 Ga0439451_004084 Ga0439451_004084_1592_1864 86
613 3300042009 Ga0439451_011313 Ga0439451_011313_647_907 86
614 3300042009 Ga0439451_056842 Ga0439451_056842_114_374 86
615 3300042010 Ga0439452_000231 Ga0439452_000231_32559_32819 86
616 3300042010 Ga0439452_000971 Ga0439452_000971_7596_7856 86
617 3300042010 Ga0439452_002718 Ga0439452_002718_3391_3651 86
618 3300042010 Ga0439452_002778 Ga0439452_002778_4778_5038 86
619 3300042010 Ga0439452_028175 Ga0439452_028175_894_1154 86
620 3300042013 Ga0439456_012155 Ga0439456_012155_1287_1547 86
621 3300042016 Ga0439463_001159 Ga0439463_001159_2011_2271 86
622 3300042016 Ga0439463_001542 Ga0439463_001542_2226_2486 86
623 3300042115 Ga0450911_002055 Ga0450911_002055_193_453 86
624 3300042124 Ga0450922_000641 Ga0450922_000641_54_326 86
625 3300042137 Ga0450902_006942 Ga0450902_006942_202_462 86
626 3300042145 Ga0450906_000584 Ga0450906_000584_1666_1926 86
627 3300042146 Ga0450907_000396 Ga0450907_000396_40_300 86
628 3300042146 Ga0450907_003169 Ga0450907_003169_1423_1683 86
629 3300042156 Ga0439446_0000057 Ga0439446_0000057_5149_5409 86
630 3300042185 Ga0450909_001747 Ga0450909_001747_838_1098 86
631 3300042185 Ga0450909_022410 Ga0450909_022410_57_317 86
632 3300042439 Ga0439464_0000113 Ga0439464_0000113_11491_11751 86
633 3300042439 Ga0439464_0070243 Ga0439464_0070243_709_969 86
634 3300042439 Ga0439464_0072344 Ga0439464_0072344_504_764 86
635 3300042439 Ga0439464_0120513 Ga0439464_0120513_157_417 86
636 3300042461 Ga0439460_0001407 Ga0439460_0001407_3033_3293 86
637 3300042461 Ga0439460_0010401 Ga0439460_0010401_1479_1739 86
638 3300042993 Ga0439440_0001938 Ga0439440_0001938_2099_2359 86
639 3300046452 Ga0495617_000311 Ga0495617_000311_6014_6274 86
640 3300046452 Ga0495617_001853 Ga0495617_001853_2302_2562 86
641 3300046452 Ga0495617_010746 Ga0495617_010746_1876_2136 86
642 3300046452 Ga0495617_046341 Ga0495617_046341_431_691 86
643 3300046452 Ga0495617_239574 Ga0495617_239574_281_541 86
644 3300046453 Ga0495627_000023 Ga0495627_000023_78104_78364 86
645 3300046453 Ga0495627_000700 Ga0495627_000700_1926_2186 86
646 3300046453 Ga0495627_006751 Ga0495627_006751_3742_4002 86
647 3300046453 Ga0495627_015765 Ga0495627_015765_494_754 86
648 3300046453 Ga0495627_019329 Ga0495627_019329_85_360 86
649 3300046455 Ga0495603_0181857 Ga0495603_0181857_807_1067 86
650 3300046457 Ga0495590_0042753 Ga0495590_0042753_134_406 86
651 3300046458 Ga0495591_000025 Ga0495591_000025_19699_19959 86
652 3300046458 Ga0495591_001000 Ga0495591_001000_12495_12755 86
653 3300046458 Ga0495591_005123 Ga0495591_005123_292_567 86
654 3300046458 Ga0495591_005462 Ga0495591_005462_37_312 86
655 3300046458 Ga0495591_016161 Ga0495591_016161_2080_2340 86
656 3300046458 Ga0495591_040332 Ga0495591_040332_684_944 86
657 3300046458 Ga0495591_066175 Ga0495591_066175_86_346 86
658 3300046463 Ga0495653_0130321 Ga0495653_0130321_159_434 86
659 3300046463 Ga0495653_0157579 Ga0495653_0157579_839_1099 86
660 3300046471 Ga0495650_0001423 Ga0495650_0001423_14919_15179 86
661 3300046471 Ga0495650_0002476 Ga0495650_0002476_6128_6388 86
662 3300046471 Ga0495650_0010158 Ga0495650_0010158_1199_1459 86
663 3300046471 Ga0495650_0029630 Ga0495650_0029630_137_412 86
664 3300046474 Ga0495605_0000095 Ga0495605_0000095_4411_4671 86
665 3300046474 Ga0495605_0000246 Ga0495605_0000246_23162_23422 86
666 3300046474 Ga0495605_0000311 Ga0495605_0000311_27485_27745 86
667 3300046474 Ga0495605_0000328 Ga0495605_0000328_21262_21522 86
668 3300046474 Ga0495605_0007893 Ga0495605_0007893_3896_4156 86
669 3300046474 Ga0495605_0023804 Ga0495605_0023804_492_752 86
670 3300046474 Ga0495605_0059571 Ga0495605_0059571_1495_1755 86
671 3300046491 Ga0495584_0000695 Ga0495584_0000695_21932_22192 86
672 3300046491 Ga0495584_0001583 Ga0495584_0001583_11332_11592 86
673 3300046491 Ga0495584_0004871 Ga0495584_0004871_1380_1640 86
674 3300046491 Ga0495584_0326710 Ga0495584_0326710_462_722 86
675 3300046492 Ga0495585_0000279 Ga0495585_0000279_30661_30921 86
676 3300046492 Ga0495585_0008964 Ga0495585_0008964_5742_6002 86
677 3300046492 Ga0495585_0026970 Ga0495585_0026970_814_1074 86
678 3300046492 Ga0495585_0095296 Ga0495585_0095296_1317_1577 86
679 3300046492 Ga0495585_0172693 Ga0495585_0172693_571_831 86
680 3300046499 Ga0495594_0002893 Ga0495594_0002893_7962_8222 86
681 3300046499 Ga0495594_0012103 Ga0495594_0012103_3470_3730 86
682 3300046500 Ga0495596_0001654 Ga0495596_0001654_4259_4519 86
683 3300046500 Ga0495596_0236284 Ga0495596_0236284_281_541 86
684 3300046501 Ga0495607_0000181 Ga0495607_0000181_20711_20971 86
685 3300046501 Ga0495607_0000347 Ga0495607_0000347_19383_19643 86
686 3300046501 Ga0495607_0000776 Ga0495607_0000776_18375_18635 86
687 3300046501 Ga0495607_0000926 Ga0495607_0000926_6019_6279 86
688 3300046501 Ga0495607_0009192 Ga0495607_0009192_3720_3980 86
689 3300046501 Ga0495607_0014199 Ga0495607_0014199_1432_1692 86
690 3300046501 Ga0495607_0025937 Ga0495607_0025937_1341_1601 86
691 3300046501 Ga0495607_0101344 Ga0495607_0101344_743_1003 86
692 3300046501 Ga0495607_0104675 Ga0495607_0104675_403_663 86
693 3300046501 Ga0495607_0132620 Ga0495607_0132620_163_438 86
694 3300046501 Ga0495607_0203983 Ga0495607_0203983_80_340 86
695 3300046506 Ga0495583_0000015 Ga0495583_0000015_168876_169136 86
696 3300046506 Ga0495583_0000756 Ga0495583_0000756_17800_18060 86
697 3300046506 Ga0495583_0001231 Ga0495583_0001231_21254_21514 86
698 3300046506 Ga0495583_0001865 Ga0495583_0001865_10461_10721 86
699 3300046506 Ga0495583_0002457 Ga0495583_0002457_5440_5700 86
700 3300046506 Ga0495583_0003396 Ga0495583_0003396_9235_9495 86
701 3300046506 Ga0495583_0008468 Ga0495583_0008468_64_324 86
702 3300046506 Ga0495583_0341314 Ga0495583_0341314_267_527 86
703 3300046507 Ga0495606_0000214 Ga0495606_0000214_83745_84005 86
704 3300046507 Ga0495606_0012176 Ga0495606_0012176_5829_6104 86
705 3300046507 Ga0495606_0282157 Ga0495606_0282157_629_889 86
706 3300046512 Ga0495610_0001656 Ga0495610_0001656_14199_14459 86
707 3300046512 Ga0495610_0010456 Ga0495610_0010456_5480_5740 86
708 3300046512 Ga0495610_0033826 Ga0495610_0033826_2290_2550 86
709 3300046512 Ga0495610_0039249 Ga0495610_0039249_90_350 86
710 3300046512 Ga0495610_0039894 Ga0495610_0039894_740_1000 86
711 3300046512 Ga0495610_0107256 Ga0495610_0107256_850_1110 86
712 3300046512 Ga0495610_0295284 Ga0495610_0295284_95_370 86
713 3300046513 Ga0495616_0003688 Ga0495616_0003688_5727_5987 86
714 3300046513 Ga0495616_0007911 Ga0495616_0007911_3110_3370 86
715 3300046513 Ga0495616_0041168 Ga0495616_0041168_1890_2150 86
716 3300046513 Ga0495616_0042197 Ga0495616_0042197_1926_2201 86
717 3300046515 Ga0495620_0000042 Ga0495620_0000042_83413_83673 86
718 3300046515 Ga0495620_0000456 Ga0495620_0000456_4046_4321 86
719 3300046515 Ga0495620_0002609 Ga0495620_0002609_2744_3004 86
720 3300046515 Ga0495620_0251774 Ga0495620_0251774_64_324 86
721 3300046518 Ga0495631_0000772 Ga0495631_0000772_20268_20528 86
722 3300046518 Ga0495631_0001940 Ga0495631_0001940_6138_6413 86
723 3300046518 Ga0495631_0004156 Ga0495631_0004156_4877_5137 86
724 3300046518 Ga0495631_0081625 Ga0495631_0081625_886_1146 86
725 3300046518 Ga0495631_0106972 Ga0495631_0106972_129_389 86
726 3300046519 Ga0495632_0000573 Ga0495632_0000573_12599_12859 86
727 3300046519 Ga0495632_0008250 Ga0495632_0008250_6125_6385 86
728 3300046519 Ga0495632_0016923 Ga0495632_0016923_3286_3546 86
729 3300046519 Ga0495632_0022401 Ga0495632_0022401_1849_2109 86
730 3300046519 Ga0495632_0064762 Ga0495632_0064762_1389_1664 86
731 3300046519 Ga0495632_0103037 Ga0495632_0103037_1041_1301 86
732 3300046520 Ga0495637_0000020 Ga0495637_0000020_113858_114118 86
733 3300046520 Ga0495637_0000425 Ga0495637_0000425_4321_4581 86
734 3300046520 Ga0495637_0002002 Ga0495637_0002002_6352_6612 86
735 3300046520 Ga0495637_0006468 Ga0495637_0006468_5175_5435 86
736 3300046520 Ga0495637_0009737 Ga0495637_0009737_817_1077 86
737 3300046520 Ga0495637_0014100 Ga0495637_0014100_205_465 86
738 3300046520 Ga0495637_0027677 Ga0495637_0027677_509_769 86
739 3300046520 Ga0495637_0030720 Ga0495637_0030720_1313_1573 86
740 3300046522 Ga0495643_0009933 Ga0495643_0009933_161_421 86
741 3300046522 Ga0495643_0011157 Ga0495643_0011157_628_888 86
742 3300046522 Ga0495643_0051294 Ga0495643_0051294_32_292 86
743 3300046523 Ga0495644_0009094 Ga0495644_0009094_3052_3312 86
744 3300046524 Ga0495648_0001818 Ga0495648_0001818_6036_6296 86
745 3300046524 Ga0495648_0006167 Ga0495648_0006167_3709_3969 86
746 3300046524 Ga0495648_0010821 Ga0495648_0010821_4789_5049 86
747 3300046524 Ga0495648_0047781 Ga0495648_0047781_1067_1327 86
748 3300046524 Ga0495648_0162581 Ga0495648_0162581_745_1005 86
749 3300046524 Ga0495648_0180743 Ga0495648_0180743_772_1047 86
750 3300046524 Ga0495648_0347450 Ga0495648_0347450_196_471 86
751 3300046528 Ga0495642_0003349 Ga0495642_0003349_45_305 86
752 3300046530 Ga0495654_0001624 Ga0495654_0001624_2907_3167 86
753 3300046530 Ga0495654_0002244 Ga0495654_0002244_11763_12023 86
754 3300046530 Ga0495654_0006263 Ga0495654_0006263_763_1023 86
755 3300046530 Ga0495654_0033252 Ga0495654_0033252_823_1083 86
756 3300046530 Ga0495654_0045705 Ga0495654_0045705_217_477 86
757 3300046530 Ga0495654_0131244 Ga0495654_0131244_837_1097 86
758 3300046530 Ga0495654_0194801 Ga0495654_0194801_178_453 86
759 3300046530 Ga0495654_0265897 Ga0495654_0265897_418_693 86
760 3300046538 Ga0495609_0000053 Ga0495609_0000053_87935_88195 86
761 3300046538 Ga0495609_0000102 Ga0495609_0000102_32421_32681 86
762 3300046538 Ga0495609_0000685 Ga0495609_0000685_22332_22592 86
763 3300046538 Ga0495609_0008822 Ga0495609_0008822_1879_2154 86
764 3300046538 Ga0495609_0010335 Ga0495609_0010335_3000_3260 86
765 3300046538 Ga0495609_0016172 Ga0495609_0016172_3041_3301 86
766 3300046538 Ga0495609_0267683 Ga0495609_0267683_223_483 86
767 3300046542 Ga0495597_0000186 Ga0495597_0000186_31676_31936 86
768 3300046542 Ga0495597_0003248 Ga0495597_0003248_4437_4697 86
769 3300046542 Ga0495597_0007861 Ga0495597_0007861_4944_5219 86
770 3300046542 Ga0495597_0266606 Ga0495597_0266606_214_474 86
771 3300046557 Ga0495622_0004508 Ga0495622_0004508_322_597 86
772 3300046557 Ga0495622_0014570 Ga0495622_0014570_2390_2650 86
773 3300046558 Ga0495633_0000366 Ga0495633_0000366_22052_22312 86
774 3300046558 Ga0495633_0008456 Ga0495633_0008456_489_764 86
775 3300046558 Ga0495633_0012245 Ga0495633_0012245_84_344 86
776 3300046615 Ga0495656_0005706 Ga0495656_0005706_3000_3260 86
777 3300046616 Ga0495668_0005631 Ga0495668_0005631_5761_6021 86
778 3300046616 Ga0495668_0006331 Ga0495668_0006331_2932_3192 86
779 3300046616 Ga0495668_0158296 Ga0495668_0158296_886_1146 86
780 3300046616 Ga0495668_0172624 Ga0495668_0172624_887_1147 86
781 3300046648 Ga0495611_0000193 Ga0495611_0000193_28188_28448 86
782 3300046648 Ga0495611_0000386 Ga0495611_0000386_5089_5349 86
783 3300046648 Ga0495611_0038256 Ga0495611_0038256_1347_1607 86
784 3300046660 Ga0495625_0000086 Ga0495625_0000086_119178_119438 86
785 3300046660 Ga0495625_0023064 Ga0495625_0023064_2667_2927 86
786 3300046660 Ga0495625_0172274 Ga0495625_0172274_745_1005 86
787 3300046660 Ga0495625_0919058 Ga0495625_0919058_18_278 86
788 3300046665 Ga0495661_0000058 Ga0495661_0000058_73474_73734 86
789 3300046665 Ga0495661_0000131 Ga0495661_0000131_40797_41057 86
790 3300046665 Ga0495661_0000171 Ga0495661_0000171_17994_18254 86
791 3300046665 Ga0495661_0003488 Ga0495661_0003488_4225_4485 86
792 3300046665 Ga0495661_0029482 Ga0495661_0029482_755_1030 86
793 3300046674 Ga0495588_0561079 Ga0495588_0561079_76_336 86
794 3300046680 Ga0495646_0065160 Ga0495646_0065160_1801_2061 86
795 3300046684 Ga0495669_0000863 Ga0495669_0000863_12249_12509 86
796 3300046690 Ga0495624_0003730 Ga0495624_0003730_5716_5976 86
797 3300046691 Ga0495670_0001965 Ga0495670_0001965_5755_6015 86
798 3300046691 Ga0495670_0006959 Ga0495670_0006959_931_1191 86
799 3300046691 Ga0495670_0013963 Ga0495670_0013963_2899_3159 86
800 3300046691 Ga0495670_0152413 Ga0495670_0152413_483_743 86
801 3300046692 Ga0495671_0000157 Ga0495671_0000157_23410_23670 86
802 3300046692 Ga0495671_0010403 Ga0495671_0010403_906_1166 86
803 3300046692 Ga0495671_0021831 Ga0495671_0021831_3014_3274 86
804 3300046692 Ga0495671_0076155 Ga0495671_0076155_110_370 86
805 3300046692 Ga0495671_0268103 Ga0495671_0268103_468_743 86
806 3300046692 Ga0495671_0447179 Ga0495671_0447179_78_338 86
807 3300046694 Ga0495649_0000782 Ga0495649_0000782_3470_3730 86
808 3300046694 Ga0495649_0003415 Ga0495649_0003415_4009_4269 86
809 3300046694 Ga0495649_0005077 Ga0495649_0005077_5925_6185 86
810 3300046694 Ga0495649_0012685 Ga0495649_0012685_77_337 86
811 3300046794 Ga0495589_0000647 Ga0495589_0000647_6017_6277 86
812 3300046794 Ga0495589_0010462 Ga0495589_0010462_3407_3667 86
813 3300046794 Ga0495589_0136770 Ga0495589_0136770_601_861 86
814 3300046794 Ga0495589_0336653 Ga0495589_0336653_341_601 86
815 3300046810 Ga0495660_0000608 Ga0495660_0000608_20970_21230 86
816 3300046810 Ga0495660_0002259 Ga0495660_0002259_4700_4960 86
817 3300046810 Ga0495660_0003303 Ga0495660_0003303_4073_4333 86
818 3300046810 Ga0495660_0027555 Ga0495660_0027555_664_924 86
819 3300046810 Ga0495660_0027786 Ga0495660_0027786_823_1083 86
820 3300046810 Ga0495660_0040761 Ga0495660_0040761_1537_1797 86
821 3300046810 Ga0495660_0041094 Ga0495660_0041094_1968_2228 86
822 3300046810 Ga0495660_0052287 Ga0495660_0052287_1926_2201 86
823 3300047318 Ga0495636_0006323 Ga0495636_0006323_1279_1539 86
824 3300047320 Ga0495672_0001137 Ga0495672_0001137_6584_6844 86
825 3300047320 Ga0495672_0010862 Ga0495672_0010862_5956_6216 86
826 3300047320 Ga0495672_0035686 Ga0495672_0035686_56_316 86
827 3300047320 Ga0495672_0042589 Ga0495672_0042589_486_746 86
828 3300047320 Ga0495672_0053590 Ga0495672_0053590_83_343 86
829 3300047320 Ga0495672_0070587 Ga0495672_0070587_1071_1331 86
830 3300047320 Ga0495672_0075132 Ga0495672_0075132_202_462 86
831 3300047320 Ga0495672_0152416 Ga0495672_0152416_223_483 86
832 3300047320 Ga0495672_0202626 Ga0495672_0202626_88_348 86
833 3300047320 Ga0495672_0558684 Ga0495672_0558684_36_311 86
834 3300047321 Ga0495676_0000022 Ga0495676_0000022_130759_131019 86
835 3300047322 Ga0495680_0137993 Ga0495680_0137993_1407_1667 86
836 3300047323 Ga0495683_0000030 Ga0495683_0000030_66497_66757 86
837 3300047323 Ga0495683_0014226 Ga0495683_0014226_3817_4077 86
838 3300047323 Ga0495683_0026016 Ga0495683_0026016_2685_2945 86
839 3300047443 Ga0495687_003760 Ga0495687_003760_10286_10546 86
840 3300047444 Ga0495675_0088676 Ga0495675_0088676_909_1184 86
841 3300047446 Ga0495679_000218 Ga0495679_000218_32620_32880 86
842 3300047446 Ga0495679_000558 Ga0495679_000558_24337_24597 86
843 3300047446 Ga0495679_053350 Ga0495679_053350_808_1068 86
844 3300047469 Ga0495673_0000544 Ga0495673_0000544_24816_25076 86
845 3300047469 Ga0495673_0002696 Ga0495673_0002696_5493_5753 86
846 3300047469 Ga0495673_0004063 Ga0495673_0004063_8101_8361 86
847 3300047469 Ga0495673_0004098 Ga0495673_0004098_3880_4140 86
848 3300047469 Ga0495673_0005033 Ga0495673_0005033_2125_2385 86
849 3300047469 Ga0495673_0009378 Ga0495673_0009378_4416_4676 86
850 3300047469 Ga0495673_0056021 Ga0495673_0056021_676_936 86
851 3300047469 Ga0495673_0065626 Ga0495673_0065626_559_819 86
852 3300047469 Ga0495673_0079042 Ga0495673_0079042_288_563 86
853 3300047469 Ga0495673_0118531 Ga0495673_0118531_226_486 86
854 3300047470 Ga0495681_0000534 Ga0495681_0000534_5610_5870 86
855 3300047470 Ga0495681_0004365 Ga0495681_0004365_5326_5586 86
856 3300047470 Ga0495681_0005274 Ga0495681_0005274_2242_2502 86
857 3300047470 Ga0495681_0007510 Ga0495681_0007510_6041_6301 86
858 3300047470 Ga0495681_0030258 Ga0495681_0030258_38_298 86
859 3300047470 Ga0495681_0042116 Ga0495681_0042116_29_304 86
860 3300047472 Ga0495686_0067717 Ga0495686_0067717_961_1221 86
861 3300048091 Ga0495626_0000039 Ga0495626_0000039_32344_32604 86
862 3300048091 Ga0495626_0000391 Ga0495626_0000391_31528_31788 86
863 3300048091 Ga0495626_0001894 Ga0495626_0001894_15316_15576 86
864 3300048091 Ga0495626_0006428 Ga0495626_0006428_5269_5529 86
865 3300048091 Ga0495626_0024216 Ga0495626_0024216_2452_2712 86
866 3300048091 Ga0495626_0250501 Ga0495626_0250501_11_286 86
867 3300048905 Ga0496102_0814629 Ga0496102_0814629_435_695 86
868 3300048915 Ga0496112_0103806 Ga0496112_0103806_1605_1865 86
869 3300048919 Ga0496116_0004841 Ga0496116_0004841_6860_7120 86
870 3300048919 Ga0496116_0223921 Ga0496116_0223921_586_846 86
871 3300048920 Ga0496117_0017466 Ga0496117_0017466_22_282 86
872 3300048920 Ga0496117_0025304 Ga0496117_0025304_105_365 86
873 3300048921 Ga0496118_0027663 Ga0496118_0027663_3181_3453 86
874 3300048921 Ga0496118_0207822 Ga0496118_0207822_867_1127 86
875 3300048922 Ga0496119_0000082 Ga0496119_0000082_16984_17256 86
876 3300048923 Ga0496120_0118188 Ga0496120_0118188_397_669 86
877 3300048924 Ga0496121_0001119 Ga0496121_0001119_22403_22675 86
878 3300048924 Ga0496121_0001386 Ga0496121_0001386_18665_18925 86
879 3300048924 Ga0496121_0133328 Ga0496121_0133328_314_574 86
880 3300048925 Ga0496122_0012580 Ga0496122_0012580_3694_3954 86
881 3300048925 Ga0496122_0015370 Ga0496122_0015370_2582_2842 86
882 3300048925 Ga0496122_0294135 Ga0496122_0294135_243_503 86
883 3300048926 Ga0496123_0005103 Ga0496123_0005103_12619_12879 86
884 3300048926 Ga0496123_0030648 Ga0496123_0030648_1883_2143 86
885 3300048926 Ga0496123_0234062 Ga0496123_0234062_353_613 86
886 3300048927 Ga0496124_0000120 Ga0496124_0000120_99794_100054 86
887 3300048927 Ga0496124_0023214 Ga0496124_0023214_5107_5367 86
888 3300048927 Ga0496124_0069948 Ga0496124_0069948_2333_2593 86
889 3300048927 Ga0496124_0468855 Ga0496124_0468855_35_295 86
890 3300049459 Ga0495678_000017 Ga0495678_000017_135092_135352 86
891 3300049459 Ga0495678_000693 Ga0495678_000693_17453_17713 86
892 3300049459 Ga0495678_006583 Ga0495678_006583_5117_5392 86
893 3300049459 Ga0495678_007899 Ga0495678_007899_5167_5427 86
894 3300049459 Ga0495678_009818 Ga0495678_009818_4351_4611 86
895 3300049459 Ga0495678_170849 Ga0495678_170849_293_553 86
896 3300049460 Ga0495682_0000182 Ga0495682_0000182_20819_21079 86
897 3300049460 Ga0495682_0003690 Ga0495682_0003690_5709_5984 86
898 3300049460 Ga0495682_0009136 Ga0495682_0009136_2347_2607 86
899 3300049460 Ga0495682_0055576 Ga0495682_0055576_1017_1277 86
900 3300049579 Ga0501043_0015187 Ga0501043_0015187_1278_1541 86
901 3300050516 nmdc:mga0sz30_482368_c1 nmdc:mga0sz30_482368_c1_222_482 86
902 3300053111 Ga0500572_159648 Ga0500572_159648_113_388 86
903 3300053140 Ga0500573_0032704 Ga0500573_0032704_1099_1359 86
904 3300053142 Ga0500577_0109599 Ga0500577_0109599_725_985 86
905 iso_pu_bacteria 2554235341 2555667424 86
906 iso_pu_bacteria 2599185160 2599356647 86
907 iso_pu_bacteria 2599185161 2599363323 86
908 iso_pu_bacteria 2599185162 2599369725 86
909 iso_pu_bacteria 2599185163 2599376432 86
910 iso_pu_bacteria 2599185164 2599381752 86
911 iso_pu_bacteria 2599185165 2599388104 86
912 iso_pu_bacteria 2599185166 2599395372 86
913 iso_pu_bacteria 2599185168 2599407137 86
914 iso_pu_bacteria 2599185181 2599463480 86
915 iso_pu_bacteria 2599185182 2599469170 86
916 iso_pu_bacteria 2599185186 2599492497 86
917 iso_pu_bacteria 2599185356 2600216109 86
918 iso_pu_bacteria 2600255313 2601776276 86
919 iso_pu_bacteria 2667528171 2671099963 86
920 iso_pu_bacteria 2818991464 2819705221 86
921 iso_pu_bacteria 2844665904 2844667904 86
922 iso_pu_bacteria 2912963787 2912964091 86
923 iso_pu_bacteria 2917070673 2917071175 86
924 iso_pu_bacteria 2935353572 2935359003 86
925 iso_pu_bacteria 2939651529 2939654975 86
926 iso_pu_bacteria 3007419365 3007420030 86
927 iso_pu_bacteria 637000220 637317821 86
928 iso_pu_bacteria 8019769354 8019770313 86
929 iso_pu_bacteria 8057798959 8057802715 86
930 iso_pu_bacteria 2511231007 2511271047 87
931 iso_pu_bacteria 2511231008 2511278974 87
932 iso_pu_bacteria 2511231012 2511300346 87
933 iso_pu_bacteria 2511231014 2511316710 87
934 iso_pu_bacteria 2511231015 2511317624 87
935 iso_pu_bacteria 2511231017 2511330981 87
936 iso_pu_bacteria 2623620446 2624489768 87
937 iso_pu_bacteria 2713897148 2715749214 87
938 iso_pu_bacteria 2738543015 2739260290 87
939 iso_pu_bacteria 2808606445 2809217984 87
940 iso_pu_bacteria 2818991456 2819657238 87
941 iso_pu_bacteria 2842832357 2842834166 87
942 iso_pu_bacteria 2842843487 2842846357 87
943 iso_pu_bacteria 2904550169 2904552152 87
944 iso_pu_bacteria 2919385768 2919389770 87
945 iso_pu_bacteria 2919487758 2919488697 87
946 iso_pu_bacteria 2919697872 2919698955 87
947 iso_pu_bacteria 2939636861 2939641120 87
948 iso_pu_bacteria 2974289157 2974293343 87
949 iso_pu_bacteria 2998139840 2998140468 87
950 iso_pu_bacteria 3007614139 3007618648 87
951 iso_pu_bacteria 3007855910 3007859708 87
952 iso_pu_bacteria 8019775933 8019777341 87
953 iso_pu_bacteria 8029995093 8030000270 87
954 iso_pu_bacteria 8056125926 8056126481 87
955 iso_pu_bacteria 8056166840 8056170583 87
956 iso_pu_bacteria 8056569372 8056572327 87
957 2162886007 SwRhRL2b_contig_3562642 SwRhRL2b_0489.00004540 89
958 3300005289 Ga0065704_10014750 Ga0065704_100147503 89
959 3300005290 Ga0065712_10115636 Ga0065712_101156363 89
960 3300005331 Ga0070670_100005149 Ga0070670_1000051492 89
961 3300005548 Ga0070665_100299641 Ga0070665_1002996413 89
962 3300005548 Ga0070665_101797481 Ga0070665_1017974812 89
963 3300006051 Ga0075364_11220035 Ga0075364_112200352 89
964 3300009092 Ga0105250_10000189 Ga0105250_1000018922 89
965 3300009545 Ga0105237_10098823 Ga0105237_100988234 89
966 3300017792 Ga0163161_10006622 Ga0163161_100066227 89
967 3300025711 Ga0207696_1000084 Ga0207696_100008423 89
968 3300025735 Ga0207713_1000434 Ga0207713_100043418 89
969 3300025914 Ga0207671_10000015 Ga0207671_10000015267 89
970 3300025925 Ga0207650_10000273 Ga0207650_1000027322 89
971 3300028379 Ga0268266_10337223 Ga0268266_103372233 89
972 3300041441 Ga0451787_107608 Ga0451787_107608_356_625 89
973 3300041498 Ga0451841_0079951 Ga0451841_0079951_332_601 89
974 3300041509 Ga0451843_1121095 Ga0451843_1121095_185_454 89
975 3300048928 Ga0496125_0224131 Ga0496125_0224131_386_655 89
976 3300009092 Ga0105250_10040789 Ga0105250_100407892 90
977 3300025711 Ga0207696_1033741 Ga0207696_10337412 90
978 3300046453 Ga0495627_000535 Ga0495627_000535_25660_25932 90
979 3300046458 Ga0495591_058227 Ga0495591_058227_737_1009 90
980 3300046501 Ga0495607_0003337 Ga0495607_0003337_7597_7869 90
981 3300046501 Ga0495607_0089962 Ga0495607_0089962_594_866 90
982 3300046507 Ga0495606_0069590 Ga0495606_0069590_28_300 90
983 3300046518 Ga0495631_0006774 Ga0495631_0006774_5439_5711 90
984 3300046519 Ga0495632_0024290 Ga0495632_0024290_342_614 90
985 3300046520 Ga0495637_0033302 Ga0495637_0033302_1934_2206 90
986 3300046530 Ga0495654_0000992 Ga0495654_0000992_15175_15447 90
987 3300046665 Ga0495661_0064607 Ga0495661_0064607_1778_2050 90
988 3300046692 Ga0495671_0030560 Ga0495671_0030560_305_577 90
989 3300046692 Ga0495671_0365737 Ga0495671_0365737_73_345 90
990 3300047320 Ga0495672_0001678 Ga0495672_0001678_5446_5718 90
991 3300048928 Ga0496125_0027012 Ga0496125_0027012_50_322 90
992 2124908027 MRS2a_Contig_519 MRS2a_00399670 91
993 3300003759 Ga0055525_1017391 Ga0055525_10173912 91
994 3300003781 Ga0055536_1000624 Ga0055536_100062420 91
995 3300005288 Ga0065714_10003191 Ga0065714_100031917 91
996 3300005288 Ga0065714_10004288 Ga0065714_1000428811 91
997 3300005288 Ga0065714_10066972 Ga0065714_100669722 91
998 3300005288 Ga0065714_10096624 Ga0065714_100966244 91
999 3300005293 Ga0065715_10256124 Ga0065715_102561242 91
1000 3300006058 Ga0075432_10000629 Ga0075432_100006299 91
1001 3300006058 Ga0075432_10006240 Ga0075432_100062404 91
1002 3300006058 Ga0075432_10012550 Ga0075432_100125505 91
1003 3300006058 Ga0075432_10070614 Ga0075432_100706142 91
1004 3300006058 Ga0075432_10240039 Ga0075432_102400392 91
1005 3300006177 Ga0075362_10547845 Ga0075362_105478452 91
1006 3300006914 Ga0075436_100082129 Ga0075436_1000821293 91
1007 3300006914 Ga0075436_100088941 Ga0075436_1000889413 91
1008 3300006914 Ga0075436_100819400 Ga0075436_1008194001 91
1009 3300009036 Ga0105244_10005115 Ga0105244_100051158 91
1010 3300009036 Ga0105244_10056038 Ga0105244_100560383 91
1011 3300009036 Ga0105244_10167578 Ga0105244_101675781 91
1012 3300011119 Ga0105246_10143127 Ga0105246_101431274 91
1013 3300013100 Ga0157373_10005678 Ga0157373_100056787 91
1014 3300013100 Ga0157373_10045654 Ga0157373_100456543 91
1015 3300013102 Ga0157371_10011701 Ga0157371_100117016 91
1016 3300013104 Ga0157370_10286829 Ga0157370_102868291 91
1017 3300013105 Ga0157369_10546563 Ga0157369_105465632 91
1018 3300013306 Ga0163162_10000737 Ga0163162_1000073725 91
1019 3300014497 Ga0182008_10002891 Ga0182008_100028919 91
1020 3300014497 Ga0182008_10003251 Ga0182008_100032518 91
1021 3300015261 Ga0182006_1000786 Ga0182006_10007869 91
1022 3300015261 Ga0182006_1003146 Ga0182006_10031464 91
1023 3300015262 Ga0182007_10000194 Ga0182007_1000019416 91
1024 3300015262 Ga0182007_10423366 Ga0182007_104233662 91
1025 3300015265 Ga0182005_1000459 Ga0182005_10004599 91
1026 3300015265 Ga0182005_1018158 Ga0182005_10181584 91
1027 3300017792 Ga0163161_10001156 Ga0163161_100011569 91
1028 3300025230 Ga0209563_101330 Ga0209563_1013307 91
1029 3300025292 Ga0209676_1000318 Ga0209676_100031854 91
1030 3300025711 Ga0207696_1023018 Ga0207696_10230183 91
1031 3300025711 Ga0207696_1088559 Ga0207696_10885591 91
1032 3300025728 Ga0207655_1001697 Ga0207655_10016975 91
1033 3300025728 Ga0207655_1041144 Ga0207655_10411443 91
1034 3300025728 Ga0207655_1057145 Ga0207655_10571452 91
1035 3300027111 Ga0209281_1001786 Ga0209281_10017869 91
1036 3300027907 Ga0207428_10031873 Ga0207428_100318735 91
1037 3300027907 Ga0207428_10111409 Ga0207428_101114092 91
1038 3300027907 Ga0207428_10142279 Ga0207428_101422794 91
1039 3300027907 Ga0207428_10220566 Ga0207428_102205662 91
1040 3300028786 Ga0307517_10401466 Ga0307517_104014661 91
1041 3300030734 Ga0316179_1032179 Ga0316179_10321794 91
1042 3300030735 Ga0316178_1048724 Ga0316178_10487249 91
1043 3300031548 Ga0307408_100730530 Ga0307408_1007305302 91
1044 3300031731 Ga0307405_10191228 Ga0307405_101912282 91
1045 3300031731 Ga0307405_10497367 Ga0307405_104973672 91
1046 3300031824 Ga0307413_10720932 Ga0307413_107209322 91
1047 3300032002 Ga0307416_102427497 Ga0307416_1024274972 91
1048 3300032004 Ga0307414_10474370 Ga0307414_104743703 91
1049 3300032004 Ga0307414_10922040 Ga0307414_109220402 91
1050 3300032005 Ga0307411_10233000 Ga0307411_102330003 91
1051 3300041405 Ga0439438_000895 Ga0439438_000895_12912_13187 91
1052 3300041405 Ga0439438_041283 Ga0439438_041283_646_921 91
1053 3300041407 Ga0439447_044075 Ga0439447_044075_760_1035 91
1054 3300041411 Ga0439466_0020412 Ga0439466_0020412_34_309 91
1055 3300041411 Ga0439466_0137561 Ga0439466_0137561_270_545 91
1056 3300042006 Ga0439432_010204 Ga0439432_010204_2867_3142 91
1057 3300042010 Ga0439452_000245 Ga0439452_000245_21655_21930 91
1058 3300042013 Ga0439456_007003 Ga0439456_007003_1893_2168 91
1059 3300042115 Ga0450911_000158 Ga0450911_000158_5784_6059 91
1060 3300042115 Ga0450911_002532 Ga0450911_002532_320_595 91
1061 3300042122 Ga0450920_001497 Ga0450920_001497_1957_2232 91
1062 3300042124 Ga0450922_000113 Ga0450922_000113_3809_4084 91
1063 3300042145 Ga0450906_001928 Ga0450906_001928_4048_4323 91
1064 3300042146 Ga0450907_052794 Ga0450907_052794_275_550 91
1065 3300042147 Ga0450910_006884 Ga0450910_006884_541_816 91
1066 3300042184 Ga0450908_019721 Ga0450908_019721_760_1035 91
1067 3300042531 Ga0450918_049832 Ga0450918_049832_431_706 91
1068 3300046452 Ga0495617_011375 Ga0495617_011375_219_494 91
1069 3300046452 Ga0495617_049237 Ga0495617_049237_197_472 91
1070 3300046453 Ga0495627_014667 Ga0495627_014667_2077_2352 91
1071 3300046455 Ga0495603_0020970 Ga0495603_0020970_1131_1406 91
1072 3300046455 Ga0495603_0064146 Ga0495603_0064146_1573_1848 91
1073 3300046457 Ga0495590_0004906 Ga0495590_0004906_3915_4190 91
1074 3300046458 Ga0495591_051068 Ga0495591_051068_789_1064 91
1075 3300046460 Ga0495638_0013481 Ga0495638_0013481_170_445 91
1076 3300046460 Ga0495638_0036944 Ga0495638_0036944_790_1065 91
1077 3300046460 Ga0495638_0058487 Ga0495638_0058487_2056_2331 91
1078 3300046460 Ga0495638_0300914 Ga0495638_0300914_572_847 91
1079 3300046474 Ga0495605_0002025 Ga0495605_0002025_10745_11020 91
1080 3300046474 Ga0495605_0024999 Ga0495605_0024999_2775_3050 91
1081 3300046475 Ga0495639_0000238 Ga0495639_0000238_5976_6251 91
1082 3300046491 Ga0495584_0550072 Ga0495584_0550072_103_378 91
1083 3300046492 Ga0495585_0048896 Ga0495585_0048896_1874_2149 91
1084 3300046492 Ga0495585_0057220 Ga0495585_0057220_1863_2138 91
1085 3300046492 Ga0495585_0146964 Ga0495585_0146964_460_735 91
1086 3300046499 Ga0495594_0046054 Ga0495594_0046054_20_295 91
1087 3300046506 Ga0495583_0367152 Ga0495583_0367152_59_334 91
1088 3300046512 Ga0495610_0028792 Ga0495610_0028792_2447_2722 91
1089 3300046512 Ga0495610_0086714 Ga0495610_0086714_629_904 91
1090 3300046512 Ga0495610_0101242 Ga0495610_0101242_225_500 91
1091 3300046513 Ga0495616_0033883 Ga0495616_0033883_1676_1951 91
1092 3300046519 Ga0495632_0011187 Ga0495632_0011187_3179_3454 91
1093 3300046520 Ga0495637_0002683 Ga0495637_0002683_5757_6032 91
1094 3300046520 Ga0495637_0003016 Ga0495637_0003016_3675_3950 91
1095 3300046520 Ga0495637_0014677 Ga0495637_0014677_257_532 91
1096 3300046520 Ga0495637_0018276 Ga0495637_0018276_2903_3178 91
1097 3300046523 Ga0495644_0001530 Ga0495644_0001530_667_942 91
1098 3300046523 Ga0495644_0419171 Ga0495644_0419171_12_287 91
1099 3300046524 Ga0495648_0014424 Ga0495648_0014424_5469_5744 91
1100 3300046528 Ga0495642_0000088 Ga0495642_0000088_16102_16377 91
1101 3300046530 Ga0495654_0007205 Ga0495654_0007205_104_379 91
1102 3300046530 Ga0495654_0069871 Ga0495654_0069871_148_423 91
1103 3300046530 Ga0495654_0411999 Ga0495654_0411999_161_436 91
1104 3300046542 Ga0495597_0129242 Ga0495597_0129242_229_504 91
1105 3300046557 Ga0495622_0006910 Ga0495622_0006910_3202_3477 91
1106 3300046616 Ga0495668_0038164 Ga0495668_0038164_2343_2618 91
1107 3300046660 Ga0495625_0047562 Ga0495625_0047562_115_390 91
1108 3300046664 Ga0495659_0000084 Ga0495659_0000084_20511_20786 91
1109 3300046665 Ga0495661_0032435 Ga0495661_0032435_667_942 91
1110 3300046665 Ga0495661_0478205 Ga0495661_0478205_307_582 91
1111 3300046691 Ga0495670_0001330 Ga0495670_0001330_142_417 91
1112 3300046692 Ga0495671_0048014 Ga0495671_0048014_829_1104 91
1113 3300046694 Ga0495649_0044142 Ga0495649_0044142_641_916 91
1114 3300046694 Ga0495649_0149004 Ga0495649_0149004_250_525 91
1115 3300046694 Ga0495649_0238120 Ga0495649_0238120_34_309 91
1116 3300046794 Ga0495589_0089693 Ga0495589_0089693_178_453 91
1117 3300046794 Ga0495589_0324325 Ga0495589_0324325_138_413 91
1118 3300046810 Ga0495660_0025137 Ga0495660_0025137_1446_1721 91
1119 3300047315 Ga0495581_0056830 Ga0495581_0056830_73_348 91
1120 3300047320 Ga0495672_0006904 Ga0495672_0006904_4401_4676 91
1121 3300047320 Ga0495672_0010588 Ga0495672_0010588_335_610 91
1122 3300047320 Ga0495672_0232738 Ga0495672_0232738_573_848 91
1123 3300047320 Ga0495672_0418758 Ga0495672_0418758_135_410 91
1124 3300047323 Ga0495683_0004987 Ga0495683_0004987_6347_6622 91
1125 3300047323 Ga0495683_0006671 Ga0495683_0006671_5971_6246 91
1126 3300047323 Ga0495683_0080881 Ga0495683_0080881_232_507 91
1127 3300047323 Ga0495683_0285285 Ga0495683_0285285_40_315 91
1128 3300047443 Ga0495687_058858 Ga0495687_058858_240_515 91
1129 3300047469 Ga0495673_0014764 Ga0495673_0014764_2711_2986 91
1130 3300047470 Ga0495681_0000351 Ga0495681_0000351_3608_3883 91
1131 3300047470 Ga0495681_0005015 Ga0495681_0005015_4502_4777 91
1132 3300047470 Ga0495681_0192004 Ga0495681_0192004_494_769 91
1133 3300048091 Ga0495626_0000876 Ga0495626_0000876_6372_6647 91
1134 3300048919 Ga0496116_0001403 Ga0496116_0001403_6345_6620 91
1135 3300048924 Ga0496121_0064432 Ga0496121_0064432_1078_1353 91
1136 3300048925 Ga0496122_0003673 Ga0496122_0003673_1930_2205 91
1137 3300049673 Ga0501240_007996 Ga0501240_007996_114_389 91
1138 3300059641 Ga0587068_073501 Ga0587068_073501_187_462 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

5

80

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qnw-assembly1.cif.gz_A toxoplasma gondii apicoplast-targeted acyl carrier protein 0.9091 6 89
7pdi-assembly1.cif.gz_A crystal structure of the holo-acyl carrier protein (holo-acpp) from pseudomonas putida kt2440. produced as an apo/holo mixture. 0.9039 9 89
4ihg-assembly1.cif.gz_H chasing acyl carrier protein through a catalytic cycle of lipid a production 0.8986 10 86
1f80-assembly1.cif.gz_F holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein) 0.8984 8 85
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8967 7 87
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9151 1 91 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9118 9 89 1.10.1200.10
1f80F00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8984 8 85 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8966 6 87 1.10.1200.10
3ejeA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8962 9 86 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A7V1D1J3-F1-model_v4 Acyl carrier protein 0.9984 7 89
AF-A0A176XNU5-F1-model_v4 Acyl carrier protein 0.9935 9 89
AF-A0A370XBL6-F1-model_v4 Carrier domain-containing protein 0.9934 9 91
AF-A0A447MIQ7-F1-model_v4 deleted 0.9922 8 59
AF-A0A1H1J893-F1-model_v4 Acyl carrier protein 0.9918 1 91

Feature Viewer

pLDDT pTM Quality
87.34 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map