F490521

General Info

Members Datasets Scaffolds Average Seq Length
1129 389 2258 294

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_0126172|Ga0373955_0126172_433_1452
Length 331
Sequence VSAVIEASGLGKRYRRQWALTDCTLSIPAGHVVGLVGPNGAGKTTLLNLAVGLLAPDAGTIEVLGGTPGAGQAELARVGFLAQDSPAYAGLSVADHLKLGAHLNPGWDPRLARGRVDRLDLDPGQKAGTLSGGQRAQLALTLAIAKRPELLILDEPVASLDPLARREFLQDLMEAVAEQELSVVLSSHLIADLERVCDYLIVLVGSRVRVAGPVDELLATHHRLTGPRRDPATLPDSLEVISASHTDVQTTLMVRTRGPVMDPAWTVSDVGLEDLALAYMSQAAPRPASSSAVPCPPWPPRWLCRCWSARTSSRPTGRSSPSRPRSWTTAT

Samples

Sample ID Description Type Environment
1 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
178 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
335 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
349 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
350 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
351 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
352 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
359 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
364 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
365 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
366 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
367 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
368 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
369 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
370 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
371 2858882152 Micromonospora noduli MED15 Isolate Nodule
372 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
373 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
374 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
375 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
376 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
377 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
378 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
379 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
380 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
381 2891562705 Microbispora tritici MT50 Isolate Unclassified
382 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
383 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
384 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
385 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
386 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
387 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
388 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
389 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.08
Metatranscriptomes 0.35
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.52
Nodule 0.35
Rhizoplane 5.23
Rhizosphere 83.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373955_0126172 3300035172 Bacteria 1491
2 JGI25406J46586_10027029 3300003203 Bacteria 2205
3 rootH2_10017855 3300003320 Bacteria 3229
4 rootH1_10084422 3300003323 Bacteria 4604
5 Ga0070658_10001743 3300005327 Bacteria 18340
6 Ga0070658_10027221 3300005327 Bacteria 4589
7 Ga0070683_100141180 3300005329 Bacteria 2282
8 Ga0070690_100041390 3300005330 Bacteria 2917
9 Ga0068869_100075930 3300005334 Bacteria 2497
10 Ga0068869_100163665 3300005334 Bacteria 1733
11 Ga0070680_100000156 3300005336 Bacteria 42598
12 Ga0070680_100155015 3300005336 Bacteria 1924
13 Ga0070682_100026232 3300005337 Bacteria 3485
14 Ga0068868_100084483 3300005338 Bacteria 2549
15 Ga0068868_100222966 3300005338 Bacteria 1579
16 Ga0070660_100079988 3300005339 Bacteria 2564
17 Ga0070660_100085665 3300005339 Bacteria 2479
18 Ga0070660_100148346 3300005339 Bacteria 1885
19 Ga0070691_10011889 3300005341 Bacteria 3983
20 Ga0070691_10040418 3300005341 Bacteria 2204
21 Ga0070661_100002473 3300005344 Bacteria 12664
22 Ga0070661_100023992 3300005344 Bacteria 4376
23 Ga0070661_100153752 3300005344 Bacteria 1740
24 Ga0070668_100003272 3300005347 Bacteria 11943
25 Ga0070668_100011479 3300005347 Bacteria 6595
26 Ga0070668_100053211 3300005347 Bacteria 3122
27 Ga0070668_100256580 3300005347 Bacteria 1453
28 Ga0070671_100424659 3300005355 Bacteria 1139
29 Ga0070674_100026284 3300005356 Bacteria 3800
30 Ga0070673_100300739 3300005364 Bacteria 1412
31 Ga0070688_100048803 3300005365 Bacteria 2632
32 Ga0070659_100074894 3300005366 Bacteria 2697
33 Ga0070667_100012931 3300005367 Bacteria 6900
34 Ga0070667_100141219 3300005367 Bacteria 2109
35 Ga0070703_10020547 3300005406 Bacteria 1922
36 Ga0070709_10001311 3300005434 Bacteria 13558
37 Ga0070709_10028795 3300005434 Bacteria 3316
38 Ga0070709_10077131 3300005434 Bacteria 2166
39 Ga0070709_10137824 3300005434 Bacteria 1673
40 Ga0070709_10236219 3300005434 Bacteria 1310
41 Ga0070714_100007665 3300005435 Bacteria 8405
42 Ga0070714_100013385 3300005435 Bacteria 6573
43 Ga0070714_100015602 3300005435 Bacteria 6112
44 Ga0070714_100074651 3300005435 Bacteria 2940
45 Ga0070714_100121165 3300005435 Bacteria 2327
46 Ga0070714_100352207 3300005435 Bacteria 1383
47 Ga0070714_100397246 3300005435 Bacteria 1302
48 Ga0070714_100426447 3300005435 Bacteria 1257
49 Ga0070713_100002120 3300005436 Bacteria 12837
50 Ga0070713_100015554 3300005436 Bacteria 5696
51 Ga0070713_100037164 3300005436 Bacteria 3936
52 Ga0070713_100069666 3300005436 Bacteria 2967
53 Ga0070713_100172895 3300005436 Bacteria 1936
54 Ga0070713_100394460 3300005436 Bacteria 1291
55 Ga0070710_10002444 3300005437 Bacteria 8797
56 Ga0070710_10040598 3300005437 Bacteria 2565
57 Ga0070710_10043706 3300005437 Bacteria 2483
58 Ga0070710_10088797 3300005437 Bacteria 1819
59 Ga0070711_100004788 3300005439 Bacteria 8023
60 Ga0070711_100075179 3300005439 Bacteria 2391
61 Ga0070711_100093940 3300005439 Bacteria 2167
62 Ga0070711_100211462 3300005439 Bacteria 1502
63 Ga0070711_100229962 3300005439 Bacteria 1445
64 Ga0070705_100061614 3300005440 Bacteria 2230
65 Ga0070694_100223817 3300005444 Bacteria 1412
66 Ga0070708_100002899 3300005445 Bacteria 13323
67 Ga0070708_100026326 3300005445 Bacteria 4976
68 Ga0070663_100171436 3300005455 Bacteria 1678
69 Ga0070678_100047995 3300005456 Bacteria 3072
70 Ga0070681_10000051 3300005458 Bacteria 82091
71 Ga0070681_10006131 3300005458 Bacteria 11671
72 Ga0070681_10006424 3300005458 Bacteria 11440
73 Ga0070681_10176917 3300005458 Bacteria 2056
74 Ga0070681_10289393 3300005458 Bacteria 1548
75 Ga0070681_10404183 3300005458 Bacteria 1277
76 Ga0070681_10418435 3300005458 Bacteria 1252
77 Ga0070706_100003586 3300005467 Bacteria 15227
78 Ga0070706_100005264 3300005467 Bacteria 12345
79 Ga0070706_100006560 3300005467 Bacteria 10979
80 Ga0070706_100022474 3300005467 Bacteria 5804
81 Ga0070706_100083897 3300005467 Bacteria 2952
82 Ga0070707_100023752 3300005468 Bacteria 5798
83 Ga0070707_100025629 3300005468 Bacteria 5597
84 Ga0070707_100195868 3300005468 Bacteria 1970
85 Ga0070707_100444467 3300005468 Bacteria 1257
86 Ga0070698_100017938 3300005471 Bacteria 7453
87 Ga0070698_100038117 3300005471 Bacteria 4952
88 Ga0070698_100188236 3300005471 Bacteria 2002
89 Ga0070698_100226683 3300005471 Bacteria 1802
90 Ga0070699_100000016 3300005518 Bacteria 206838
91 Ga0070699_100002660 3300005518 Bacteria 15959
92 Ga0070699_100054684 3300005518 Bacteria 3456
93 Ga0070679_100000058 3300005530 Bacteria 82178
94 Ga0070679_100022813 3300005530 Bacteria 6121
95 Ga0070679_100301620 3300005530 Bacteria 1552
96 Ga0070679_100466987 3300005530 Bacteria 1206
97 Ga0070684_100002665 3300005535 Bacteria 13187
98 Ga0070684_100060796 3300005535 Bacteria 3305
99 Ga0070684_100394106 3300005535 Bacteria 1276
100 Ga0070697_100001221 3300005536 Bacteria 19396
101 Ga0070672_100122779 3300005543 Bacteria 2128
102 Ga0070686_100200052 3300005544 Bacteria 1432
103 Ga0070695_100074449 3300005545 Bacteria 2232
104 Ga0070696_100022353 3300005546 Bacteria 4296
105 Ga0070693_100059558 3300005547 Bacteria 2214
106 Ga0070665_100322159 3300005548 Bacteria 1550
107 Ga0070704_100046303 3300005549 Bacteria 3032
108 Ga0068855_100120437 3300005563 Bacteria 3004
109 Ga0068855_100128191 3300005563 Bacteria 2900
110 Ga0068855_100185287 3300005563 Bacteria 2351
111 Ga0068855_100270667 3300005563 Bacteria 1889
112 Ga0070664_100037051 3300005564 Bacteria 4098
113 Ga0070664_100127016 3300005564 Bacteria 2238
114 Ga0070664_100269777 3300005564 Bacteria 1532
115 Ga0070664_100444084 3300005564 Bacteria 1190
116 Ga0068857_100045589 3300005577 Bacteria 3890
117 Ga0068854_100116823 3300005578 Bacteria 2019
118 Ga0068854_100150353 3300005578 Bacteria 1795
119 Ga0068854_100164626 3300005578 Bacteria 1721
120 Ga0068856_100018422 3300005614 Bacteria 6768
121 Ga0068856_100037306 3300005614 Bacteria 4769
122 Ga0068856_100068494 3300005614 Bacteria 3508
123 Ga0068852_100028683 3300005616 Bacteria 4560
124 Ga0068859_100451867 3300005617 Bacteria 1381
125 Ga0068864_100040346 3300005618 Bacteria 3994
126 Ga0068864_100052972 3300005618 Bacteria 3498
127 Ga0068864_100164025 3300005618 Bacteria 2022
128 Ga0068864_100234413 3300005618 Bacteria 1698
129 Ga0068864_100310740 3300005618 Bacteria 1478
130 Ga0068864_100462430 3300005618 Bacteria 1215
131 Ga0068866_10036549 3300005718 Bacteria 2407
132 Ga0068866_10084270 3300005718 Bacteria 1715
133 Ga0068861_100023317 3300005719 Bacteria 4463
134 Ga0068861_100135607 3300005719 Bacteria 2003
135 Ga0068863_100043157 3300005841 Bacteria 4281
136 Ga0068863_100065137 3300005841 Bacteria 3447
137 Ga0068863_100110328 3300005841 Bacteria 2620
138 Ga0068863_100366378 3300005841 Bacteria 1405
139 Ga0068858_100053560 3300005842 Bacteria 3732
140 Ga0068858_100207323 3300005842 Bacteria 1854
141 Ga0068860_100000400 3300005843 Bacteria 56882
142 Ga0068860_100094372 3300005843 Bacteria 2852
143 Ga0068860_100156315 3300005843 Bacteria 2197
144 Ga0081455_10032619 3300005937 Bacteria 4691
145 Ga0081455_10051909 3300005937 Bacteria 3514
146 Ga0081455_10075642 3300005937 Bacteria 2777
147 Ga0081538_10002128 3300005981 Bacteria 19728
148 Ga0081538_10004296 3300005981 Bacteria 13175
149 Ga0081538_10025392 3300005981 Bacteria 4180
150 Ga0081540_1001078 3300005983 Bacteria 24243
151 Ga0081539_10000023 3300005985 Bacteria 356082
152 Ga0081539_10000456 3300005985 Bacteria 86722
153 Ga0081539_10002116 3300005985 Bacteria 29407
154 Ga0081539_10057330 3300005985 Bacteria 2156
155 Ga0070717_10011214 3300006028 Bacteria 6796
156 Ga0070717_10028999 3300006028 Bacteria 4436
157 Ga0070717_10083013 3300006028 Bacteria 2693
158 Ga0070717_10089413 3300006028 Bacteria 2597
159 Ga0070717_10130108 3300006028 Bacteria 2164
160 Ga0070717_10238583 3300006028 Bacteria 1602
161 Ga0070717_10283145 3300006028 Bacteria 1471
162 Ga0070717_10300721 3300006028 Bacteria 1426
163 Ga0070717_10362221 3300006028 Bacteria 1298
164 Ga0075365_10003743 3300006038 Bacteria 7914
165 Ga0075365_10016923 3300006038 Bacteria 4450
166 Ga0075365_10033622 3300006038 Bacteria 3306
167 Ga0075365_10046030 3300006038 Bacteria 2864
168 Ga0075365_10052420 3300006038 Bacteria 2698
169 Ga0075365_10181299 3300006038 Bacteria 1472
170 Ga0075365_10270323 3300006038 Bacteria 1195
171 Ga0075365_10319524 3300006038 Bacteria 1093
172 Ga0075365_10350320 3300006038 Bacteria 1041
173 Ga0075368_10012819 3300006042 Bacteria 3071
174 Ga0075368_10060792 3300006042 Bacteria 1512
175 Ga0075363_100014884 3300006048 Bacteria 3813
176 Ga0075363_100041813 3300006048 Bacteria 2418
177 Ga0075364_10067151 3300006051 Bacteria 2357
178 Ga0075364_10130835 3300006051 Bacteria 1684
179 Ga0070715_10000632 3300006163 Bacteria 9318
180 Ga0070715_10149277 3300006163 Bacteria 1143
181 Ga0070716_100000086 3300006173 Bacteria 36327
182 Ga0070716_100004535 3300006173 Bacteria 6653
183 Ga0070716_100024189 3300006173 Bacteria 3230
184 Ga0070716_100099115 3300006173 Bacteria 1782
185 Ga0070712_100011408 3300006175 Bacteria 5633
186 Ga0070712_100027651 3300006175 Bacteria 3788
187 Ga0070712_100031346 3300006175 Bacteria 3581
188 Ga0070712_100032446 3300006175 Bacteria 3527
189 Ga0070712_100047564 3300006175 Bacteria 2969
190 Ga0070712_100115963 3300006175 Bacteria 2008
191 Ga0070712_100124750 3300006175 Bacteria 1943
192 Ga0070712_100171501 3300006175 Bacteria 1684
193 Ga0070712_100194666 3300006175 Bacteria 1589
194 Ga0070712_100277979 3300006175 Bacteria 1347
195 Ga0075362_10010148 3300006177 Bacteria 3669
196 Ga0075367_10008972 3300006178 Bacteria 5206
197 Ga0075367_10063540 3300006178 Bacteria 2207
198 Ga0097621_100077800 3300006237 Bacteria 2754
199 Ga0097621_100096846 3300006237 Bacteria 2476
200 Ga0075370_10000475 3300006353 Bacteria 15085
201 Ga0075370_10054358 3300006353 Bacteria 2274
202 Ga0075370_10132278 3300006353 Bacteria 1456
203 Ga0075370_10164182 3300006353 Bacteria 1304
204 Ga0068871_100213807 3300006358 Bacteria 1668
205 Ga0075428_100023722 3300006844 Bacteria 6790
206 Ga0075428_100042373 3300006844 Bacteria 5005
207 Ga0075428_100100145 3300006844 Bacteria 3160
208 Ga0075428_100200875 3300006844 Bacteria 2155
209 Ga0075430_100187557 3300006846 Bacteria 1719
210 Ga0075430_100406298 3300006846 Bacteria 1124
211 Ga0075431_100084292 3300006847 Bacteria 3281
212 Ga0075431_100538423 3300006847 Bacteria 1156
213 Ga0075433_10002889 3300006852 Bacteria 13169
214 Ga0075433_10177271 3300006852 Bacteria 1896
215 Ga0075434_100017026 3300006871 Bacteria 6994
216 Ga0075434_100334583 3300006871 Bacteria 1534
217 Ga0075434_100507521 3300006871 Bacteria 1227
218 Ga0075429_100082811 3300006880 Bacteria 2797
219 Ga0075429_100381554 3300006880 Bacteria 1234
220 Ga0068865_100088483 3300006881 Bacteria 2241
221 Ga0075436_100022621 3300006914 Bacteria 4318
222 Ga0097620_100451863 3300006931 Bacteria 1381
223 Ga0075435_100016390 3300007076 Bacteria 5587
224 Ga0075435_100175909 3300007076 Bacteria 1807
225 Ga0075435_100323108 3300007076 Bacteria 1321
226 Ga0099795_10010554 3300007788 Bacteria 2724
227 Ga0105251_10034597 3300009011 Bacteria 2498
228 Ga0105240_10078146 3300009093 Bacteria 4076
229 Ga0105240_10338952 3300009093 Bacteria 1708
230 Ga0105240_10707314 3300009093 Bacteria 1099
231 Ga0111539_10001058 3300009094 Bacteria 36236
232 Ga0105245_10025702 3300009098 Bacteria 5178
233 Ga0105245_10065679 3300009098 Bacteria 3281
234 Ga0105245_10236770 3300009098 Bacteria 1768
235 Ga0105247_10030440 3300009101 Bacteria 3272
236 Ga0105247_10034604 3300009101 Bacteria 3077
237 Ga0105247_10270440 3300009101 Bacteria 1169
238 Ga0114129_10004838 3300009147 Bacteria 19018
239 Ga0114129_10005759 3300009147 Bacteria 17559
240 Ga0114129_10009287 3300009147 Bacteria 14022
241 Ga0114129_10130516 3300009147 Bacteria 3451
242 Ga0114129_10212899 3300009147 Bacteria 2612
243 Ga0114129_10265112 3300009147 Bacteria 2300
244 Ga0105243_10124404 3300009148 Bacteria 2179
245 Ga0105243_10654835 3300009148 Bacteria 1018
246 Ga0105241_10013422 3300009174 Bacteria 6005
247 Ga0105241_10343392 3300009174 Bacteria 1294
248 Ga0105242_10257997 3300009176 Bacteria 1573
249 Ga0105248_10091709 3300009177 Bacteria 3421
250 Ga0105248_10195350 3300009177 Bacteria 2280
251 Ga0105248_10417632 3300009177 Bacteria 1511
252 Ga0105237_10061495 3300009545 Bacteria 3755
253 Ga0105237_10110498 3300009545 Bacteria 2741
254 Ga0105238_10216115 3300009551 Bacteria 1893
255 Ga0105249_10082549 3300009553 Bacteria 2990
256 Ga0105249_10172429 3300009553 Bacteria 2099
257 Ga0099796_10028374 3300010159 Bacteria 1796
258 Ga0105239_10121457 3300010375 Bacteria 2901
259 Ga0105239_10145840 3300010375 Bacteria 2639
260 Ga0105239_10150059 3300010375 Bacteria 2601
261 Ga0105246_10072893 3300011119 Bacteria 2422
262 Ga0157371_10015196 3300013102 Bacteria 5780
263 Ga0157369_10022043 3300013105 Bacteria 7117
264 Ga0157369_10023115 3300013105 Bacteria 6927
265 Ga0157369_10025091 3300013105 Bacteria 6621
266 Ga0157369_10129147 3300013105 Bacteria 2679
267 Ga0157369_10170231 3300013105 Bacteria 2295
268 Ga0157369_10404429 3300013105 Bacteria 1416
269 Ga0157374_10007847 3300013296 Bacteria 9112
270 Ga0157374_10042957 3300013296 Bacteria 4173
271 Ga0163162_10065097 3300013306 Bacteria 3691
272 Ga0163162_10431083 3300013306 Bacteria 1450
273 Ga0157372_10107671 3300013307 Bacteria 3189
274 Ga0157372_10113351 3300013307 Bacteria 3107
275 Ga0157372_10120180 3300013307 Bacteria 3017
276 Ga0157372_10561479 3300013307 Bacteria 1330
277 Ga0157375_10169041 3300013308 Bacteria 2333
278 Ga0163163_10067111 3300014325 Bacteria 3565
279 Ga0163163_10091359 3300014325 Bacteria 3059
280 Ga0163163_10098579 3300014325 Bacteria 2944
281 Ga0163163_10301849 3300014325 Bacteria 1654
282 Ga0163163_10472456 3300014325 Bacteria 1315
283 Ga0163163_10562401 3300014325 Bacteria 1203
284 Ga0157380_10046809 3300014326 Bacteria 3399
285 Ga0157377_10020514 3300014745 Bacteria 3463
286 Ga0157379_10059210 3300014968 Bacteria 3425
287 Ga0157379_10146176 3300014968 Bacteria 2132
288 Ga0157379_10155511 3300014968 Bacteria 2063
289 Ga0157376_10042670 3300014969 Bacteria 3719
290 Ga0157376_10070850 3300014969 Bacteria 2960
291 Ga0163161_10309312 3300017792 Bacteria 1246
292 Ga0197907_11394660 3300020069 Bacteria 1548
293 Ga0206353_10307624 3300020082 Bacteria 1344
294 Ga0206353_11504755 3300020082 Bacteria 4879
295 Ga0213875_10001035 3300021388 Bacteria 19625
296 Ga0213875_10114548 3300021388 Bacteria 1260
297 Ga0224712_10058186 3300022467 Bacteria 1530
298 Ga0224572_1006021 3300024225 Bacteria 2181
299 Ga0207692_10039747 3300025898 Bacteria 2317
300 Ga0207688_10058594 3300025901 Bacteria 2167
301 Ga0207647_10059361 3300025904 Bacteria 2341
302 Ga0207685_10007393 3300025905 Bacteria 3059
303 Ga0207685_10161393 3300025905 Bacteria 1024
304 Ga0207699_10001009 3300025906 Bacteria 13328
305 Ga0207699_10003233 3300025906 Bacteria 7757
306 Ga0207699_10004873 3300025906 Bacteria 6424
307 Ga0207699_10050625 3300025906 Bacteria 2451
308 Ga0207699_10061143 3300025906 Bacteria 2265
309 Ga0207699_10123174 3300025906 Bacteria 1680
310 Ga0207699_10137392 3300025906 Bacteria 1602
311 Ga0207699_10160117 3300025906 Bacteria 1498
312 Ga0207699_10212862 3300025906 Bacteria 1315
313 Ga0207699_10270632 3300025906 Bacteria 1177
314 Ga0207705_10004368 3300025909 Bacteria 10690
315 Ga0207705_10018370 3300025909 Bacteria 5001
316 Ga0207705_10063535 3300025909 Bacteria 2667
317 Ga0207705_10096344 3300025909 Bacteria 2172
318 Ga0207705_10168987 3300025909 Bacteria 1646
319 Ga0207684_10001075 3300025910 Bacteria 30597
320 Ga0207684_10003723 3300025910 Bacteria 14767
321 Ga0207684_10008754 3300025910 Bacteria 8985
322 Ga0207684_10148622 3300025910 Bacteria 2015
323 Ga0207654_10015932 3300025911 Bacteria 3909
324 Ga0207707_10000113 3300025912 Bacteria 82066
325 Ga0207707_10032935 3300025912 Bacteria 4536
326 Ga0207707_10069465 3300025912 Bacteria 3070
327 Ga0207707_10173675 3300025912 Bacteria 1883
328 Ga0207695_10124753 3300025913 Bacteria 2539
329 Ga0207671_10034166 3300025914 Bacteria 3780
330 Ga0207671_10048833 3300025914 Bacteria 3132
331 Ga0207693_10002169 3300025915 Bacteria 17108
332 Ga0207693_10017192 3300025915 Bacteria 5767
333 Ga0207693_10044596 3300025915 Bacteria 3485
334 Ga0207693_10049955 3300025915 Bacteria 3285
335 Ga0207693_10053514 3300025915 Bacteria 3167
336 Ga0207693_10082926 3300025915 Bacteria 2511
337 Ga0207693_10094502 3300025915 Bacteria 2343
338 Ga0207693_10136210 3300025915 Bacteria 1931
339 Ga0207693_10213878 3300025915 Bacteria 1515
340 Ga0207693_10266872 3300025915 Bacteria 1341
341 Ga0207663_10028288 3300025916 Bacteria 3279
342 Ga0207663_10053484 3300025916 Bacteria 2523
343 Ga0207663_10066681 3300025916 Bacteria 2305
344 Ga0207663_10073052 3300025916 Bacteria 2219
345 Ga0207663_10112202 3300025916 Bacteria 1852
346 Ga0207663_10120415 3300025916 Bacteria 1796
347 Ga0207660_10000574 3300025917 Bacteria 24712
348 Ga0207660_10031843 3300025917 Bacteria 3636
349 Ga0207660_10121287 3300025917 Bacteria 1980
350 Ga0207660_10218021 3300025917 Bacteria 1496
351 Ga0207660_10423400 3300025917 Bacteria 1074
352 Ga0207662_10031909 3300025918 Bacteria 3063
353 Ga0207657_10013454 3300025919 Bacteria 8027
354 Ga0207657_10038361 3300025919 Bacteria 4266
355 Ga0207649_10115204 3300025920 Bacteria 1803
356 Ga0207652_10000123 3300025921 Bacteria 82875
357 Ga0207652_10181877 3300025921 Bacteria 1889
358 Ga0207646_10022995 3300025922 Bacteria 5732
359 Ga0207646_10024077 3300025922 Bacteria 5581
360 Ga0207646_10064578 3300025922 Bacteria 3268
361 Ga0207646_10091209 3300025922 Bacteria 2727
362 Ga0207694_10032643 3300025924 Bacteria 3986
363 Ga0207694_10199109 3300025924 Bacteria 1629
364 Ga0207687_10057896 3300025927 Bacteria 2724
365 Ga0207687_10134855 3300025927 Bacteria 1866
366 Ga0207687_10275228 3300025927 Bacteria 1347
367 Ga0207700_10000250 3300025928 Bacteria 32146
368 Ga0207700_10008331 3300025928 Bacteria 6414
369 Ga0207700_10012420 3300025928 Bacteria 5493
370 Ga0207700_10016928 3300025928 Bacteria 4855
371 Ga0207700_10040931 3300025928 Bacteria 3386
372 Ga0207700_10047464 3300025928 Bacteria 3183
373 Ga0207700_10111244 3300025928 Bacteria 2204
374 Ga0207700_10363844 3300025928 Bacteria 1262
375 Ga0207700_10381201 3300025928 Bacteria 1233
376 Ga0207664_10009910 3300025929 Bacteria 6710
377 Ga0207664_10013316 3300025929 Bacteria 5900
378 Ga0207664_10027025 3300025929 Bacteria 4346
379 Ga0207664_10030247 3300025929 Bacteria 4134
380 Ga0207664_10031743 3300025929 Bacteria 4043
381 Ga0207664_10046340 3300025929 Bacteria 3412
382 Ga0207664_10048484 3300025929 Bacteria 3340
383 Ga0207664_10055076 3300025929 Bacteria 3154
384 Ga0207664_10059817 3300025929 Bacteria 3036
385 Ga0207664_10100165 3300025929 Bacteria 2392
386 Ga0207664_10210036 3300025929 Bacteria 1684
387 Ga0207664_10229145 3300025929 Bacteria 1614
388 Ga0207664_10279350 3300025929 Bacteria 1465
389 Ga0207664_10506625 3300025929 Bacteria 1081
390 Ga0207664_10519123 3300025929 Bacteria 1068
391 Ga0207644_10134895 3300025931 Bacteria 1894
392 Ga0207690_10007866 3300025932 Bacteria 6331
393 Ga0207690_10179123 3300025932 Bacteria 1594
394 Ga0207665_10003587 3300025939 Bacteria 10371
395 Ga0207665_10008173 3300025939 Bacteria 6907
396 Ga0207665_10019793 3300025939 Bacteria 4422
397 Ga0207665_10110736 3300025939 Bacteria 1929
398 Ga0207665_10136748 3300025939 Bacteria 1744
399 Ga0207665_10261480 3300025939 Bacteria 1282
400 Ga0207691_10034962 3300025940 Bacteria 4669
401 Ga0207691_10140161 3300025940 Bacteria 2131
402 Ga0207711_10041265 3300025941 Bacteria 3929
403 Ga0207711_10057403 3300025941 Bacteria 3347
404 Ga0207711_10082167 3300025941 Bacteria 2816
405 Ga0207711_10117851 3300025941 Bacteria 2368
406 Ga0207689_10052882 3300025942 Bacteria 3346
407 Ga0207661_10004179 3300025944 Bacteria 10104
408 Ga0207661_10105555 3300025944 Bacteria 2374
409 Ga0207661_10242117 3300025944 Bacteria 1601
410 Ga0207661_10327123 3300025944 Bacteria 1379
411 Ga0207679_10052772 3300025945 Bacteria 2984
412 Ga0207679_10135333 3300025945 Bacteria 1983
413 Ga0207667_10075516 3300025949 Bacteria 3499
414 Ga0207667_10117020 3300025949 Bacteria 2747
415 Ga0207667_10181084 3300025949 Bacteria 2164
416 Ga0207667_10562865 3300025949 Bacteria 1152
417 Ga0207712_10035468 3300025961 Bacteria 3389
418 Ga0207668_10002158 3300025972 Bacteria 11474
419 Ga0207668_10003424 3300025972 Bacteria 9305
420 Ga0207668_10194397 3300025972 Bacteria 1611
421 Ga0207640_10045334 3300025981 Bacteria 2823
422 Ga0207640_10048838 3300025981 Bacteria 2738
423 Ga0207640_10091408 3300025981 Bacteria 2108
424 Ga0207658_10170504 3300025986 Bacteria 1792
425 Ga0207677_10051478 3300026023 Bacteria 2792
426 Ga0207703_10014554 3300026035 Bacteria 6138
427 Ga0207703_10063382 3300026035 Bacteria 3031
428 Ga0207703_10171590 3300026035 Bacteria 1908
429 Ga0207639_10319015 3300026041 Bacteria 1379
430 Ga0207678_10008408 3300026067 Bacteria 9104
431 Ga0207678_10010301 3300026067 Bacteria 8206
432 Ga0207678_10017807 3300026067 Bacteria 6237
433 Ga0207678_10214018 3300026067 Bacteria 1649
434 Ga0207702_10048344 3300026078 Bacteria 3587
435 Ga0207702_10086997 3300026078 Bacteria 2727
436 Ga0207702_10181199 3300026078 Bacteria 1940
437 Ga0207641_10037218 3300026088 Bacteria 4063
438 Ga0207641_10082803 3300026088 Bacteria 2788
439 Ga0207641_10536846 3300026088 Bacteria 1139
440 Ga0207676_10181364 3300026095 Bacteria 1844
441 Ga0207676_10208715 3300026095 Bacteria 1731
442 Ga0207676_10215560 3300026095 Bacteria 1706
443 Ga0207676_10615162 3300026095 Bacteria 1045
444 Ga0207674_10015384 3300026116 Bacteria 8405
445 Ga0207674_10224078 3300026116 Bacteria 1829
446 Ga0207674_10227069 3300026116 Bacteria 1815
447 Ga0207675_100126954 3300026118 Bacteria 2416
448 Ga0207698_10026742 3300026142 Bacteria 4085
449 Ga0207698_10271657 3300026142 Bacteria 1563
450 Ga0207428_10015742 3300027907 Bacteria 6530
451 Ga0207428_10248199 3300027907 Bacteria 1328
452 Ga0268265_10212155 3300028380 Bacteria 1688
453 Ga0268264_10000320 3300028381 Bacteria 75931
454 Ga0268264_10042454 3300028381 Bacteria 3764
455 Ga0268264_10045108 3300028381 Bacteria 3660
456 Ga0265326_10049878 3300028558 Bacteria 1186
457 Ga0265336_10009379 3300028666 Bacteria 3390
458 Ga0265336_10040047 3300028666 Bacteria 1435
459 Ga0307517_10098827 3300028786 Bacteria 2319
460 Ga0307515_10032992 3300028794 Bacteria 8547
461 Ga0307515_10051383 3300028794 Bacteria 6147
462 Ga0307515_10062958 3300028794 Bacteria 5225
463 Ga0307515_10090016 3300028794 Bacteria 3854
464 Ga0307515_10094590 3300028794 Bacteria 3689
465 Ga0307515_10154691 3300028794 Bacteria 2374
466 Ga0307515_10208266 3300028794 Bacteria 1808
467 Ga0307515_10323869 3300028794 Bacteria 1205
468 Ga0265338_10004964 3300028800 Bacteria 17622
469 Ga0265338_10005981 3300028800 Bacteria 15651
470 Ga0265338_10016877 3300028800 Bacteria 7904
471 Ga0265338_10132479 3300028800 Bacteria 1965
472 Ga0265338_10136972 3300028800 Bacteria 1923
473 Ga0265338_10206370 3300028800 Bacteria 1478
474 Ga0265338_10314117 3300028800 Bacteria 1136
475 Ga0307512_10001623 3300030522 Bacteria 31204
476 Ga0307512_10001742 3300030522 Bacteria 29690
477 Ga0307512_10005070 3300030522 Bacteria 13999
478 Ga0307512_10006152 3300030522 Bacteria 12265
479 Ga0307512_10122530 3300030522 Bacteria 1664
480 Ga0307512_10194430 3300030522 Bacteria 1112
481 Ga0316177_1218167 3300030731 Bacteria 4116
482 Ga0316180_1042311 3300030736 Bacteria 1857
483 Ga0265328_10032104 3300031239 Bacteria 1950
484 Ga0265325_10032446 3300031241 Bacteria 2788
485 Ga0265325_10106737 3300031241 Bacteria 1365
486 Ga0265340_10001093 3300031247 Bacteria 15451
487 Ga0265340_10022337 3300031247 Bacteria 3236
488 Ga0307513_10009283 3300031456 Bacteria 12456
489 Ga0307513_10041702 3300031456 Bacteria 5062
490 Ga0307513_10050922 3300031456 Bacteria 4472
491 Ga0307513_10137819 3300031456 Bacteria 2372
492 Ga0307513_10172230 3300031456 Bacteria 2041
493 Ga0307513_10334956 3300031456 Bacteria 1266
494 Ga0307509_10114201 3300031507 Bacteria 2696
495 Ga0307509_10194428 3300031507 Bacteria 1875
496 Ga0307509_10323583 3300031507 Bacteria 1277
497 Ga0307508_10025316 3300031616 Bacteria 5381
498 Ga0307508_10034034 3300031616 Bacteria 4594
499 Ga0307508_10059987 3300031616 Bacteria 3365
500 Ga0307514_10036163 3300031649 Bacteria 3926
501 Ga0307516_10004524 3300031730 Bacteria 17104
502 Ga0307516_10039117 3300031730 Bacteria 4729
503 Ga0307516_10168782 3300031730 Bacteria 1930
504 Ga0307518_10002222 3300031838 Bacteria 14195
505 Ga0307406_10128974 3300031901 Bacteria 1772
506 Ga0307406_10316184 3300031901 Bacteria 1206
507 Ga0307412_10454898 3300031911 Bacteria 1056
508 Ga0307409_100063046 3300031995 Bacteria 2905
509 Ga0307409_100191285 3300031995 Bacteria 1822
510 Ga0307416_100210103 3300032002 Bacteria 1855
511 Ga0307416_100545317 3300032002 Bacteria 1232
512 Ga0307411_10061392 3300032005 Bacteria 2502
513 Ga0307415_100003294 3300032126 Bacteria 8206
514 Ga0307415_100020631 3300032126 Bacteria 4028
515 Ga0307415_100020659 3300032126 Bacteria 4026
516 Ga0307415_100068988 3300032126 Bacteria 2477
517 Ga0307415_100140199 3300032126 Bacteria 1845
518 Ga0307507_10001339 3300033179 Bacteria 55047
519 Ga0307507_10011987 3300033179 Bacteria 10817
520 Ga0307507_10023117 3300033179 Bacteria 6838
521 Ga0307510_10076367 3300033180 Bacteria 3296
522 Ga0373938_0019920 3300034957 Bacteria 1346
523 Ga0373938_0025286 3300034957 Bacteria 1235
524 Ga0373926_0037031 3300035083 Bacteria 1735
525 Ga0373926_0045484 3300035083 Bacteria 1573
526 Ga0373934_0003787 3300035086 Bacteria 5570
527 Ga0373934_0006867 3300035086 Bacteria 4224
528 Ga0373934_0007109 3300035086 Bacteria 4154
529 Ga0373934_0018329 3300035086 Bacteria 2678
530 Ga0373934_0021597 3300035086 Bacteria 2479
531 Ga0373934_0075049 3300035086 Bacteria 1355
532 Ga0373944_0005495 3300035089 Bacteria 3340
533 Ga0373923_0003800 3300035111 Bacteria 4907
534 Ga0373923_0006352 3300035111 Bacteria 4080
535 Ga0373923_0013540 3300035111 Bacteria 3042
536 Ga0373923_0017924 3300035111 Bacteria 2716
537 Ga0373936_0002364 3300035113 Bacteria 7061
538 Ga0373936_0005328 3300035113 Bacteria 4842
539 Ga0373936_0097494 3300035113 Bacteria 1238
540 Ga0373936_0134464 3300035113 Bacteria 1064
541 Ga0373941_0024311 3300035115 Bacteria 1739
542 Ga0373953_0001265 3300035117 Bacteria 7224
543 Ga0373953_0002362 3300035117 Bacteria 5689
544 Ga0373953_0011249 3300035117 Bacteria 3137
545 Ga0373953_0053361 3300035117 Bacteria 1638
546 Ga0373954_0016471 3300035118 Bacteria 3309
547 Ga0373954_0072629 3300035118 Bacteria 1636
548 Ga0373954_0084502 3300035118 Bacteria 1519
549 Ga0373956_0004289 3300035119 Bacteria 5732
550 Ga0373956_0144324 3300035119 Bacteria 1118
551 Ga0373956_0223206 3300035119 Bacteria 895
552 Ga0373957_0000136 3300035120 Bacteria 18232
553 Ga0373957_0004227 3300035120 Bacteria 4350
554 Ga0373957_0025599 3300035120 Bacteria 2127
555 Ga0373957_0031882 3300035120 Bacteria 1938
556 Ga0373957_0037068 3300035120 Bacteria 1820
557 Ga0373957_0066928 3300035120 Bacteria 1400
558 Ga0373960_0026306 3300035121 Bacteria 1589
559 Ga0373943_0002872 3300035170 Bacteria 7822
560 Ga0373946_0107367 3300035171 Bacteria 1259
561 Ga0373955_0000680 3300035172 Bacteria 14527
562 Ga0373955_0002108 3300035172 Bacteria 8586
563 Ga0373955_0013424 3300035172 Bacteria 3962
564 Ga0373955_0050124 3300035172 Bacteria 2269
565 Ga0373955_0087328 3300035172 Bacteria 1772
566 Ga0373942_0004187 3300035207 Bacteria 3361
567 Ga0373924_0001950 3300035410 Bacteria 6868
568 Ga0373924_0005840 3300035410 Bacteria 4381
569 Ga0373924_0007664 3300035410 Bacteria 3902
570 Ga0373924_0034766 3300035410 Bacteria 2041
571 Ga0373924_0045563 3300035410 Bacteria 1804
572 Ga0373931_0063186 3300035691 Bacteria 2000
573 Ga0373935_0010688 3300035692 Bacteria 5512
574 Ga0373935_0097258 3300035692 Bacteria 1936
575 Ga0373935_0105996 3300035692 Bacteria 1859
576 Ga0373927_0364992 3300035695 Bacteria 952
577 Ga0373933_0000209 3300035724 Bacteria 38842
578 Ga0373933_0015772 3300035724 Bacteria 4214
579 Ga0373933_0018740 3300035724 Bacteria 3896
580 Ga0373933_0019628 3300035724 Bacteria 3821
581 Ga0373933_0036115 3300035724 Bacteria 2890
582 Ga0373933_0251646 3300035724 Bacteria 1138
583 Ga0373947_0067618 3300035725 Bacteria 2183
584 Ga0373947_0070233 3300035725 Bacteria 2145
585 Ga0373947_0142810 3300035725 Bacteria 1537
586 Ga0373937_0003535 3300036401 Bacteria 13154
587 Ga0373937_0010957 3300036401 Bacteria 7941
588 Ga0373937_0011377 3300036401 Bacteria 7809
589 Ga0373937_0027178 3300036401 Bacteria 5172
590 Ga0373937_0048312 3300036401 Bacteria 3895
591 Ga0373937_0068370 3300036401 Bacteria 3275
592 Ga0373937_0077067 3300036401 Bacteria 3080
593 Ga0373937_0112602 3300036401 Bacteria 2531
594 Ga0373937_0120044 3300036401 Bacteria 2449
595 Ga0373925_0000129 3300037068 Bacteria 80897
596 Ga0373925_0009261 3300037068 Bacteria 7166
597 Ga0373925_0016388 3300037068 Bacteria 5368
598 Ga0373925_0021664 3300037068 Bacteria 4684
599 Ga0373925_0030235 3300037068 Bacteria 3975
600 Ga0373925_0039183 3300037068 Bacteria 3505
601 Ga0373925_0046625 3300037068 Bacteria 3223
602 Ga0373925_0056904 3300037068 Bacteria 2929
603 Ga0373925_0113008 3300037068 Bacteria 2100
604 Ga0395900_0265396 3300037418 Bacteria 1713
605 Ga0395898_0186719 3300037466 Bacteria 1981
606 Ga0395898_0205954 3300037466 Bacteria 1877
607 Ga0436364_0464142 3300037853 Bacteria 2644
608 Ga0436364_0923522 3300037853 Bacteria 137390
609 Ga0395901_0039174 3300038443 Bacteria 4904
610 Ga0395901_0144378 3300038443 Bacteria 2502
611 Ga0436365_1218054 3300039437 Bacteria 5325
612 Ga0436363_1288270 3300039450 Bacteria 3122
613 Ga0439436_0000261 3300041404 Bacteria 12706
614 Ga0439439_0004200 3300041406 Bacteria 3229
615 Ga0451789_0766711 3300041443 Bacteria 1159
616 Ga0439433_0000810 3300041999 Bacteria 6185
617 Ga0439442_018316 3300042002 Bacteria 1448
618 Ga0439449_0009770 3300042007 Bacteria 3630
619 Ga0439449_0016973 3300042007 Bacteria 2733
620 Ga0439449_0019898 3300042007 Bacteria 2516
621 Ga0439457_002146 3300042014 Bacteria 5724
622 Ga0439462_0000798 3300042015 Bacteria 6544
623 Ga0466969_0050247 3300044656 Bacteria 2055
624 Ga0466965_0013001 3300044683 Bacteria 3922
625 Ga0466965_0065863 3300044683 Bacteria 1816
626 Ga0466966_0026789 3300044684 Bacteria 3762
627 Ga0466961_0134090 3300044693 Bacteria 1552
628 Ga0466963_0020237 3300044694 Bacteria 4184
629 Ga0466963_0044527 3300044694 Bacteria 2922
630 Ga0466963_0094488 3300044694 Bacteria 2039
631 Ga0466963_0131393 3300044694 Bacteria 1730
632 Ga0466957_0066833 3300044842 Bacteria 2217
633 Ga0466960_0233646 3300044901 Bacteria 1016
634 Ga0466959_0082731 3300045049 Bacteria 2312
635 Ga0466958_0006381 3300045836 Bacteria 6413
636 Ga0466958_0016170 3300045836 Bacteria 4293
637 Ga0466958_0121847 3300045836 Bacteria 1633
638 Ga0466967_0049793 3300045976 Bacteria 3666
639 Ga0466967_0061908 3300045976 Bacteria 3321
640 Ga0466967_0078434 3300045976 Bacteria 2975
641 Ga0466967_0570591 3300045976 Bacteria 1115
642 Ga0495592_0000391 3300046454 Bacteria 34105
643 Ga0495592_0001439 3300046454 Bacteria 16519
644 Ga0495592_0005743 3300046454 Bacteria 9185
645 Ga0495592_0008164 3300046454 Bacteria 7865
646 Ga0495592_0025688 3300046454 Bacteria 4470
647 Ga0495592_0028362 3300046454 Bacteria 4240
648 Ga0495592_0031017 3300046454 Bacteria 4042
649 Ga0495592_0145034 3300046454 Bacteria 1647
650 Ga0495592_0171259 3300046454 Bacteria 1487
651 Ga0495603_0002257 3300046455 Bacteria 11322
652 Ga0495603_0033713 3300046455 Bacteria 3080
653 Ga0495603_0064401 3300046455 Bacteria 2161
654 Ga0495629_0019291 3300046459 Bacteria 4874
655 Ga0495629_0034037 3300046459 Bacteria 3602
656 Ga0495629_0034137 3300046459 Bacteria 3596
657 Ga0495629_0237393 3300046459 Bacteria 1255
658 Ga0495638_0109982 3300046460 Bacteria 1638
659 Ga0495641_0014582 3300046461 Bacteria 4244
660 Ga0495641_0016695 3300046461 Bacteria 3857
661 Ga0495641_0025092 3300046461 Bacteria 2928
662 Ga0495641_0082917 3300046461 Bacteria 1436
663 Ga0495651_0001843 3300046462 Bacteria 16386
664 Ga0495651_0002274 3300046462 Bacteria 14826
665 Ga0495651_0002422 3300046462 Bacteria 14409
666 Ga0495651_0004360 3300046462 Bacteria 10827
667 Ga0495651_0015238 3300046462 Bacteria 5942
668 Ga0495651_0016279 3300046462 Bacteria 5757
669 Ga0495651_0034790 3300046462 Bacteria 3926
670 Ga0495651_0058282 3300046462 Bacteria 2963
671 Ga0495651_0100335 3300046462 Bacteria 2156
672 Ga0495651_0106215 3300046462 Bacteria 2082
673 Ga0495651_0145590 3300046462 Bacteria 1713
674 Ga0495653_0001532 3300046463 Bacteria 18076
675 Ga0495653_0009500 3300046463 Bacteria 7959
676 Ga0495653_0010278 3300046463 Bacteria 7658
677 Ga0495653_0011783 3300046463 Bacteria 7141
678 Ga0495653_0018487 3300046463 Bacteria 5658
679 Ga0495653_0021818 3300046463 Bacteria 5183
680 Ga0495653_0024137 3300046463 Bacteria 4904
681 Ga0495653_0052908 3300046463 Bacteria 3109
682 Ga0495653_0054519 3300046463 Bacteria 3054
683 Ga0495653_0214292 3300046463 Bacteria 1299
684 Ga0495653_0230871 3300046463 Bacteria 1238
685 Ga0495653_0241495 3300046463 Bacteria 1204
686 Ga0495653_0258795 3300046463 Bacteria 1151
687 Ga0495580_0038011 3300046472 Bacteria 3451
688 Ga0495582_0007389 3300046473 Bacteria 6085
689 Ga0495582_0016023 3300046473 Bacteria 4109
690 Ga0495639_0008424 3300046475 Bacteria 4422
691 Ga0495639_0012095 3300046475 Bacteria 3720
692 Ga0495662_0008206 3300046476 Bacteria 5145
693 Ga0495662_0011481 3300046476 Bacteria 4328
694 Ga0495662_0017538 3300046476 Bacteria 3464
695 Ga0495662_0040131 3300046476 Bacteria 2260
696 Ga0495662_0093604 3300046476 Bacteria 1467
697 Ga0495662_0109620 3300046476 Bacteria 1352
698 Ga0495664_0013432 3300046477 Bacteria 4644
699 Ga0495664_0013727 3300046477 Bacteria 4593
700 Ga0495664_0032113 3300046477 Bacteria 3079
701 Ga0495664_0038780 3300046477 Bacteria 2813
702 Ga0495664_0070846 3300046477 Bacteria 2082
703 Ga0495664_0080913 3300046477 Bacteria 1947
704 Ga0495608_0000254 3300046511 Bacteria 38679
705 Ga0495608_0000389 3300046511 Bacteria 30638
706 Ga0495608_0002992 3300046511 Bacteria 12074
707 Ga0495608_0008471 3300046511 Bacteria 7204
708 Ga0495608_0009469 3300046511 Bacteria 6805
709 Ga0495608_0015867 3300046511 Bacteria 5212
710 Ga0495608_0022442 3300046511 Bacteria 4326
711 Ga0495608_0030702 3300046511 Bacteria 3637
712 Ga0495608_0032375 3300046511 Bacteria 3534
713 Ga0495608_0048388 3300046511 Bacteria 2825
714 Ga0495608_0178643 3300046511 Bacteria 1344
715 Ga0495618_0046601 3300046514 Bacteria 2736
716 Ga0495618_0056682 3300046514 Bacteria 2480
717 Ga0495618_0086158 3300046514 Bacteria 2008
718 Ga0495618_0128720 3300046514 Bacteria 1620
719 Ga0495628_0004505 3300046516 Bacteria 12343
720 Ga0495628_0010905 3300046516 Bacteria 7694
721 Ga0495628_0020937 3300046516 Bacteria 5386
722 Ga0495628_0025630 3300046516 Bacteria 4817
723 Ga0495628_0037960 3300046516 Bacteria 3859
724 Ga0495628_0041095 3300046516 Bacteria 3692
725 Ga0495628_0114832 3300046516 Bacteria 2068
726 Ga0495628_0423725 3300046516 Bacteria 969
727 Ga0495630_0000522 3300046517 Bacteria 28354
728 Ga0495630_0009915 3300046517 Bacteria 6860
729 Ga0495630_0041846 3300046517 Bacteria 3421
730 Ga0495630_0042145 3300046517 Bacteria 3409
731 Ga0495630_0080161 3300046517 Bacteria 2462
732 Ga0495630_0091972 3300046517 Bacteria 2292
733 Ga0495666_0033325 3300046526 Bacteria 2516
734 Ga0495666_0084109 3300046526 Bacteria 1503
735 Ga0495652_0003494 3300046529 Bacteria 15476
736 Ga0495652_0004326 3300046529 Bacteria 13599
737 Ga0495652_0010063 3300046529 Bacteria 8574
738 Ga0495652_0012624 3300046529 Bacteria 7613
739 Ga0495652_0024106 3300046529 Bacteria 5388
740 Ga0495652_0029386 3300046529 Bacteria 4829
741 Ga0495652_0043908 3300046529 Bacteria 3850
742 Ga0495652_0073253 3300046529 Bacteria 2852
743 Ga0495652_0107791 3300046529 Bacteria 2247
744 Ga0495665_0003779 3300046531 Bacteria 8192
745 Ga0495665_0016598 3300046531 Bacteria 3966
746 Ga0495665_0036610 3300046531 Bacteria 2619
747 Ga0495640_0007107 3300046533 Bacteria 8808
748 Ga0495640_0014265 3300046533 Bacteria 6019
749 Ga0495640_0014380 3300046533 Bacteria 5992
750 Ga0495640_0033695 3300046533 Bacteria 3637
751 Ga0495640_0108121 3300046533 Bacteria 1819
752 Ga0495587_0000226 3300046536 Bacteria 42072
753 Ga0495587_0004967 3300046536 Bacteria 8710
754 Ga0495587_0006385 3300046536 Bacteria 7688
755 Ga0495587_0007459 3300046536 Bacteria 7084
756 Ga0495587_0009731 3300046536 Bacteria 6146
757 Ga0495587_0028382 3300046536 Bacteria 3402
758 Ga0495587_0032803 3300046536 Bacteria 3137
759 Ga0495587_0083330 3300046536 Bacteria 1852
760 Ga0495587_0169309 3300046536 Bacteria 1241
761 Ga0495645_0000853 3300046543 Bacteria 20756
762 Ga0495645_0019458 3300046543 Bacteria 4887
763 Ga0495645_0024527 3300046543 Bacteria 4377
764 Ga0495645_0051667 3300046543 Bacteria 2990
765 Ga0495645_0051712 3300046543 Bacteria 2989
766 Ga0495645_0066773 3300046543 Bacteria 2598
767 Ga0495667_0000242 3300046559 Bacteria 35503
768 Ga0495667_0001647 3300046559 Bacteria 14797
769 Ga0495667_0003869 3300046559 Bacteria 10042
770 Ga0495667_0006100 3300046559 Bacteria 8158
771 Ga0495667_0006514 3300046559 Bacteria 7927
772 Ga0495667_0010343 3300046559 Bacteria 6312
773 Ga0495667_0031145 3300046559 Bacteria 3581
774 Ga0495667_0046101 3300046559 Bacteria 2883
775 Ga0495667_0164027 3300046559 Bacteria 1428
776 Ga0495634_0004479 3300046642 Bacteria 10961
777 Ga0495634_0008157 3300046642 Bacteria 7803
778 Ga0495634_0012920 3300046642 Bacteria 6041
779 Ga0495634_0014732 3300046642 Bacteria 5626
780 Ga0495634_0018630 3300046642 Bacteria 4939
781 Ga0495634_0034352 3300046642 Bacteria 3480
782 Ga0495634_0039641 3300046642 Bacteria 3207
783 Ga0495634_0075709 3300046642 Bacteria 2210
784 Ga0495635_0000192 3300046663 Bacteria 38696
785 Ga0495635_0002786 3300046663 Bacteria 11980
786 Ga0495635_0003166 3300046663 Bacteria 11338
787 Ga0495635_0003546 3300046663 Bacteria 10800
788 Ga0495635_0009402 3300046663 Bacteria 6835
789 Ga0495635_0009954 3300046663 Bacteria 6645
790 Ga0495635_0011105 3300046663 Bacteria 6313
791 Ga0495635_0031531 3300046663 Bacteria 3679
792 Ga0495635_0050428 3300046663 Bacteria 2868
793 Ga0495635_0162915 3300046663 Bacteria 1517
794 Ga0495657_0000442 3300046675 Bacteria 38839
795 Ga0495657_0003088 3300046675 Bacteria 13749
796 Ga0495657_0005359 3300046675 Bacteria 10144
797 Ga0495657_0009671 3300046675 Bacteria 7294
798 Ga0495657_0019075 3300046675 Bacteria 4953
799 Ga0495657_0019391 3300046675 Bacteria 4906
800 Ga0495657_0020525 3300046675 Bacteria 4748
801 Ga0495657_0039576 3300046675 Bacteria 3238
802 Ga0495657_0158215 3300046675 Bacteria 1403
803 Ga0495657_0163460 3300046675 Bacteria 1376
804 Ga0495657_0229832 3300046675 Bacteria 1122
805 Ga0495599_0000265 3300046678 Bacteria 33014
806 Ga0495599_0000335 3300046678 Bacteria 28036
807 Ga0495599_0002415 3300046678 Bacteria 10872
808 Ga0495599_0003128 3300046678 Bacteria 9648
809 Ga0495599_0008728 3300046678 Bacteria 6173
810 Ga0495599_0030100 3300046678 Bacteria 3404
811 Ga0495599_0040022 3300046678 Bacteria 2944
812 Ga0495599_0041636 3300046678 Bacteria 2883
813 Ga0495599_0094356 3300046678 Bacteria 1866
814 Ga0495623_0000092 3300046679 Bacteria 53461
815 Ga0495623_0002870 3300046679 Bacteria 11368
816 Ga0495623_0006282 3300046679 Bacteria 7724
817 Ga0495623_0016057 3300046679 Bacteria 4838
818 Ga0495623_0027261 3300046679 Bacteria 3674
819 Ga0495623_0053854 3300046679 Bacteria 2540
820 Ga0495623_0065425 3300046679 Bacteria 2273
821 Ga0495623_0075235 3300046679 Bacteria 2097
822 Ga0495646_0000041 3300046680 Bacteria 69554
823 Ga0495646_0007331 3300046680 Bacteria 7007
824 Ga0495646_0010831 3300046680 Bacteria 5793
825 Ga0495646_0027256 3300046680 Bacteria 3584
826 Ga0495646_0040576 3300046680 Bacteria 2865
827 Ga0495646_0051885 3300046680 Bacteria 2480
828 Ga0495646_0090256 3300046680 Bacteria 1771
829 Ga0495647_0086678 3300046681 Bacteria 1277
830 Ga0495658_0010418 3300046683 Bacteria 4652
831 Ga0495658_0017260 3300046683 Bacteria 3726
832 Ga0495658_0116503 3300046683 Bacteria 1611
833 Ga0495613_0002022 3300046689 Bacteria 15403
834 Ga0495613_0003981 3300046689 Bacteria 11053
835 Ga0495613_0005750 3300046689 Bacteria 9288
836 Ga0495613_0011808 3300046689 Bacteria 6487
837 Ga0495613_0044725 3300046689 Bacteria 3275
838 Ga0495613_0067448 3300046689 Bacteria 2611
839 Ga0495613_0109635 3300046689 Bacteria 1990
840 Ga0495613_0130571 3300046689 Bacteria 1799
841 Ga0495624_0007464 3300046690 Bacteria 7673
842 Ga0495624_0021429 3300046690 Bacteria 4285
843 Ga0495624_0112167 3300046690 Bacteria 1676
844 Ga0495600_0000204 3300046809 Bacteria 34212
845 Ga0495600_0006275 3300046809 Bacteria 7221
846 Ga0495600_0007430 3300046809 Bacteria 6704
847 Ga0495600_0007614 3300046809 Bacteria 6634
848 Ga0495600_0011921 3300046809 Bacteria 5430
849 Ga0495600_0014774 3300046809 Bacteria 4924
850 Ga0495600_0024824 3300046809 Bacteria 3859
851 Ga0495600_0025766 3300046809 Bacteria 3790
852 Ga0495600_0039970 3300046809 Bacteria 3054
853 Ga0495600_0099688 3300046809 Bacteria 1894
854 Ga0495600_0112269 3300046809 Bacteria 1775
855 Ga0495600_0209516 3300046809 Bacteria 1249
856 Ga0495581_0017358 3300047315 Bacteria 4179
857 Ga0495581_0025667 3300047315 Bacteria 3416
858 Ga0495581_0047452 3300047315 Bacteria 2482
859 Ga0495581_0054848 3300047315 Bacteria 2301
860 Ga0495604_0000408 3300047317 Bacteria 38733
861 Ga0495604_0000411 3300047317 Bacteria 38665
862 Ga0495604_0009302 3300047317 Bacteria 7780
863 Ga0495604_0011000 3300047317 Bacteria 7184
864 Ga0495604_0012095 3300047317 Bacteria 6862
865 Ga0495604_0012809 3300047317 Bacteria 6678
866 Ga0495604_0042736 3300047317 Bacteria 3550
867 Ga0495604_0057694 3300047317 Bacteria 2984
868 Ga0495604_0070257 3300047317 Bacteria 2652
869 Ga0495604_0088769 3300047317 Bacteria 2299
870 Ga0495674_0000227 3300047319 Bacteria 47115
871 Ga0495674_0003012 3300047319 Bacteria 16410
872 Ga0495674_0005317 3300047319 Bacteria 12351
873 Ga0495674_0024389 3300047319 Bacteria 5557
874 Ga0495674_0030341 3300047319 Bacteria 4917
875 Ga0495674_0032222 3300047319 Bacteria 4755
876 Ga0495674_0055287 3300047319 Bacteria 3482
877 Ga0495674_0061326 3300047319 Bacteria 3278
878 Ga0495674_0073735 3300047319 Bacteria 2941
879 Ga0495674_0181348 3300047319 Bacteria 1753
880 Ga0495676_0052073 3300047321 Bacteria 3270
881 Ga0495676_0056671 3300047321 Bacteria 3097
882 Ga0495680_0001998 3300047322 Bacteria 21409
883 Ga0495680_0003785 3300047322 Bacteria 14709
884 Ga0495680_0008382 3300047322 Bacteria 9400
885 Ga0495680_0011107 3300047322 Bacteria 7994
886 Ga0495680_0012319 3300047322 Bacteria 7532
887 Ga0495680_0017482 3300047322 Bacteria 6122
888 Ga0495680_0024379 3300047322 Bacteria 5018
889 Ga0495680_0043984 3300047322 Bacteria 3533
890 Ga0495680_0047808 3300047322 Bacteria 3363
891 Ga0495680_0148067 3300047322 Bacteria 1713
892 Ga0495680_0297644 3300047322 Bacteria 1133
893 Ga0495675_0000136 3300047444 Bacteria 51368
894 Ga0495675_0001364 3300047444 Bacteria 14789
895 Ga0495675_0001590 3300047444 Bacteria 13674
896 Ga0495675_0013655 3300047444 Bacteria 5131
897 Ga0495675_0021536 3300047444 Bacteria 4105
898 Ga0495675_0107046 3300047444 Bacteria 1747
899 Ga0495684_0000323 3300047471 Bacteria 38826
900 Ga0495684_0003230 3300047471 Bacteria 12792
901 Ga0495684_0005492 3300047471 Bacteria 9866
902 Ga0495684_0008869 3300047471 Bacteria 7769
903 Ga0495684_0023744 3300047471 Bacteria 4715
904 Ga0495684_0024646 3300047471 Bacteria 4629
905 Ga0495684_0038008 3300047471 Bacteria 3692
906 Ga0495684_0079076 3300047471 Bacteria 2496
907 Ga0495684_0087353 3300047471 Bacteria 2363
908 Ga0495684_0310933 3300047471 Bacteria 1129
909 Ga0495593_0008890 3300047673 Bacteria 5829
910 Ga0495593_0044129 3300047673 Bacteria 2386
911 Ga0495602_0000528 3300048088 Bacteria 35647
912 Ga0495602_0002901 3300048088 Bacteria 17579
913 Ga0495602_0003747 3300048088 Bacteria 15784
914 Ga0495602_0004327 3300048088 Bacteria 14798
915 Ga0495602_0007841 3300048088 Bacteria 11165
916 Ga0495602_0013999 3300048088 Bacteria 8165
917 Ga0495602_0061569 3300048088 Bacteria 3262
918 Ga0495602_0071419 3300048088 Bacteria 2964
919 Ga0495602_0099009 3300048088 Bacteria 2398
920 Ga0495602_0104372 3300048088 Bacteria 2319
921 Ga0495602_0155734 3300048088 Bacteria 1789
922 Ga0495602_0202318 3300048088 Bacteria 1514
923 Ga0495614_0012804 3300048089 Bacteria 3681
924 Ga0496102_0047302 3300048905 Bacteria 3908
925 Ga0496102_0059595 3300048905 Bacteria 3491
926 Ga0496102_0405958 3300048905 Bacteria 1280
927 Ga0496103_0026797 3300048906 Bacteria 3489
928 Ga0496103_0038074 3300048906 Bacteria 2949
929 Ga0496103_0315855 3300048906 Bacteria 1005
930 Ga0496104_0004436 3300048907 Bacteria 12216
931 Ga0496104_0052341 3300048907 Bacteria 3856
932 Ga0496104_0071069 3300048907 Bacteria 3309
933 Ga0496104_0159841 3300048907 Bacteria 2161
934 Ga0496104_0186784 3300048907 Bacteria 1983
935 Ga0496104_0256474 3300048907 Bacteria 1661
936 Ga0496104_0414364 3300048907 Bacteria 1259
937 Ga0496105_0004641 3300048908 Bacteria 10357
938 Ga0496105_0011305 3300048908 Bacteria 7049
939 Ga0496105_0020726 3300048908 Bacteria 5314
940 Ga0496105_0032338 3300048908 Bacteria 4292
941 Ga0496105_0124787 3300048908 Bacteria 2122
942 Ga0496105_0151271 3300048908 Bacteria 1907
943 Ga0496106_0057493 3300048909 Bacteria 2941
944 Ga0496106_0186462 3300048909 Bacteria 1648
945 Ga0496106_0225240 3300048909 Bacteria 1496
946 Ga0496107_0060917 3300048910 Bacteria 2732
947 Ga0496108_0000044 3300048911 Bacteria 139925
948 Ga0496108_0030067 3300048911 Bacteria 4503
949 Ga0496108_0128643 3300048911 Bacteria 2176
950 Ga0496108_0181565 3300048911 Bacteria 1822
951 Ga0496108_0209141 3300048911 Bacteria 1693
952 Ga0496109_0018593 3300048912 Bacteria 6105
953 Ga0496109_0021728 3300048912 Bacteria 5679
954 Ga0496109_0054070 3300048912 Bacteria 3664
955 Ga0496109_0071825 3300048912 Bacteria 3179
956 Ga0496109_0076187 3300048912 Bacteria 3085
957 Ga0496109_0085976 3300048912 Bacteria 2904
958 Ga0496109_0278402 3300048912 Bacteria 1577
959 Ga0496110_0011075 3300048913 Bacteria 7364
960 Ga0496110_0011129 3300048913 Bacteria 7348
961 Ga0496110_0027338 3300048913 Bacteria 4890
962 Ga0496110_0064584 3300048913 Bacteria 3235
963 Ga0496110_0237800 3300048913 Bacteria 1657
964 Ga0496111_0017668 3300048914 Bacteria 4932
965 Ga0496111_0028076 3300048914 Bacteria 3986
966 Ga0496112_0018822 3300048915 Bacteria 6508
967 Ga0496112_0021596 3300048915 Bacteria 6123
968 Ga0496112_0126215 3300048915 Bacteria 2529
969 Ga0496112_0490879 3300048915 Bacteria 1164
970 Ga0496113_0049205 3300048916 Bacteria 3138
971 Ga0496113_0052433 3300048916 Bacteria 3046
972 Ga0496113_0100203 3300048916 Bacteria 2244
973 Ga0496114_0001749 3300048917 Bacteria 16473
974 Ga0496114_0083569 3300048917 Bacteria 2702
975 Ga0496114_0124898 3300048917 Bacteria 2217
976 Ga0496114_0170613 3300048917 Bacteria 1896
977 Ga0496115_0020308 3300048918 Bacteria 5124
978 Ga0496115_0029369 3300048918 Bacteria 4318
979 Ga0496115_0285036 3300048918 Bacteria 1356
980 Ga0496115_0320221 3300048918 Bacteria 1268
981 Ga0496115_0613218 3300048918 Bacteria 864
982 Ga0496126_0039778 3300048929 Bacteria 4361
983 Ga0496126_0048526 3300048929 Bacteria 3879
984 Ga0496126_0123367 3300048929 Bacteria 2244
985 Ga0496126_0187950 3300048929 Bacteria 1751
986 Ga0501032_0039247 3300049569 Bacteria 3221
987 Ga0501033_0084683 3300049570 Bacteria 2323
988 Ga0501034_0138405 3300049571 Bacteria 2415
989 Ga0501034_0173303 3300049571 Bacteria 2124
990 Ga0501036_0008710 3300049572 Bacteria 8322
991 Ga0501036_0411231 3300049572 Bacteria 1128
992 Ga0501037_0013074 3300049573 Bacteria 6119
993 Ga0501038_0004356 3300049574 Bacteria 13173
994 Ga0501039_0002568 3300049575 Bacteria 13557
995 Ga0501039_0259265 3300049575 Bacteria 1366
996 Ga0501040_0000638 3300049576 Bacteria 21462
997 Ga0501040_0022595 3300049576 Bacteria 4212
998 Ga0501041_0004180 3300049577 Bacteria 8358
999 Ga0501041_0071913 3300049577 Bacteria 2124
1000 Ga0501041_0142013 3300049577 Bacteria 1497
1001 Ga0501042_0001542 3300049578 Bacteria 13649
1002 Ga0501042_0106009 3300049578 Bacteria 2023
1003 Ga0501046_0003943 3300049580 Bacteria 13554
1004 Ga0501047_0043348 3300049581 Bacteria 4346
1005 Ga0501048_0001512 3300049582 Bacteria 17604
1006 Ga0501068_0010652 3300049584 Bacteria 5172
1007 Ga0501068_0264839 3300049584 Bacteria 1097
1008 Ga0501071_0058661 3300049587 Bacteria 2783
1009 Ga0501071_0062261 3300049587 Bacteria 2703
1010 Ga0501071_0123166 3300049587 Bacteria 1923
1011 Ga0501072_0007652 3300049588 Bacteria 8199
1012 Ga0501072_0018337 3300049588 Bacteria 5387
1013 Ga0501072_0039543 3300049588 Bacteria 3703
1014 Ga0501072_0102642 3300049588 Bacteria 2273
1015 Ga0501073_0099807 3300049589 Bacteria 2016
1016 Ga0501074_0003243 3300049590 Bacteria 11494
1017 Ga0501075_0000277 3300049591 Bacteria 28298
1018 Ga0501075_0112324 3300049591 Bacteria 2072
1019 Ga0501075_0158872 3300049591 Bacteria 1724
1020 Ga0501076_0001433 3300049592 Bacteria 16010
1021 Ga0501077_0023553 3300049593 Bacteria 3904
1022 Ga0501077_0088993 3300049593 Bacteria 1957
1023 Ga0501079_0001955 3300049741 Bacteria 14761
1024 Ga0501079_0102944 3300049741 Bacteria 2214
1025 Ga0501080_0095107 3300049742 Bacteria 2767
1026 Ga0501081_0001720 3300049743 Bacteria 13589
1027 Ga0501045_0001662 3300049824 Bacteria 14952
1028 Ga0501045_0112994 3300049824 Bacteria 2014
1029 nmdc:mga03683_5897_c1 3300050489 Bacteria 2392
1030 nmdc:mga03n38_172076_c1 3300050490 Bacteria 1104
1031 nmdc:mga00v17_133201_c1 3300050491 Bacteria 1590
1032 nmdc:mga00v17_160253_c1 3300050491 Bacteria 1448
1033 nmdc:mga0yw44_122806_c1 3300050492 Bacteria 1674
1034 nmdc:mga0yw44_187344_c1 3300050492 Bacteria 1364
1035 nmdc:mga0yw44_214514_c1 3300050492 Bacteria 1274
1036 nmdc:mga0yw44_24073_c1 3300050492 Bacteria 3440
1037 nmdc:mga0yw44_4224_c1 3300050492 Bacteria 6542
1038 nmdc:mga0yw44_51877_c1 3300050492 Bacteria 2485
1039 nmdc:mga0yw44_72649_c1 3300050492 Bacteria 2139
1040 nmdc:mga06z11_15296_c1 3300050494 Bacteria 3422
1041 nmdc:mga07m45_13133_c1 3300050496 Bacteria 4386
1042 nmdc:mga05p37_1301_c1 3300050507 Bacteria 29028
1043 nmdc:mga05p37_17636_c1 3300050507 Bacteria 8616
1044 nmdc:mga05p37_265356_c1 3300050507 Bacteria 2053
1045 nmdc:mga05p37_27313_c1 3300050507 Bacteria 6949
1046 nmdc:mga05p37_314410_c1 3300050507 Bacteria 1856
1047 nmdc:mga09592_24814_c1 3300050508 Bacteria 4957
1048 nmdc:mga09592_464738_c1 3300050508 Bacteria 1091
1049 nmdc:mga0qj67_276237_c1 3300050509 Bacteria 1362
1050 nmdc:mga0qj67_374893_c1 3300050509 Bacteria 1149
1051 nmdc:mga06r32_187681_c1 3300050510 Bacteria 2054
1052 nmdc:mga06r32_3234_c1 3300050510 Bacteria 14574
1053 nmdc:mga06r32_492819_c1 3300050510 Bacteria 1203
1054 nmdc:mga06r32_763465_c1 3300050510 Bacteria 929
1055 nmdc:mga08y16_58173_c1 3300050511 Bacteria 4039
1056 nmdc:mga08y16_68628_c1 3300050511 Bacteria 3696
1057 nmdc:mga0n895_156016_c1 3300050512 Bacteria 2313
1058 nmdc:mga0n895_200270_c1 3300050512 Bacteria 2028
1059 nmdc:mga0n895_492854_c1 3300050512 Bacteria 1235
1060 nmdc:mga08x19_12714_c1 3300050514 Bacteria 5076
1061 Ga0495601_0007723 3300053077 Bacteria 6323
1062 Ga0495601_0027150 3300053077 Bacteria 3539
1063 Ga0495601_0055859 3300053077 Bacteria 2500
1064 Ga0495601_0057977 3300053077 Bacteria 2453
1065 Ga0495601_0063250 3300053077 Bacteria 2352
1066 Ga0495612_0002340 3300053078 Bacteria 7810
1067 Ga0495612_0026559 3300053078 Bacteria 2327
1068 Ga0495612_0031027 3300053078 Bacteria 2154
1069 Ga0495612_0052743 3300053078 Bacteria 1674
1070 Ga0495595_0000861 3300053084 Bacteria 11656
1071 Ga0495595_0044956 3300053084 Bacteria 2030
1072 Ga0495619_0002260 3300053085 Bacteria 12724
1073 Ga0495619_0016253 3300053085 Bacteria 4711
1074 Ga0495619_0022429 3300053085 Bacteria 4041
1075 Ga0495619_0024254 3300053085 Bacteria 3890
1076 Ga0495619_0099169 3300053085 Bacteria 1981
1077 Ga0495619_0112386 3300053085 Bacteria 1862
1078 Ga0495619_0197012 3300053085 Bacteria 1395
1079 Ga0495619_0241774 3300053085 Bacteria 1251
1080 Ga0500578_0006866 3300053086 Bacteria 7554
1081 Ga0500644_0019789 3300053088 Bacteria 1992
1082 Ga0500646_0000384 3300053090 Bacteria 13266
1083 Ga0500641_0038611 3300053096 Bacteria 1920
1084 Ga0500650_0090131 3300053098 Bacteria 1435
1085 Ga0500553_018407 3300053101 Bacteria 3539
1086 Ga0500554_032619 3300053102 Bacteria 1547
1087 Ga0500560_061254 3300053107 Bacteria 1227
1088 Ga0500593_000263 3300053117 Bacteria 21458
1089 Ga0500594_0036492 3300053118 Bacteria 1323
1090 Ga0500652_024316 3300053131 Bacteria 2312
1091 Ga0500577_0000812 3300053142 Bacteria 8043
1092 Ga0500586_091487 3300053145 Bacteria 1068
1093 Ga0500616_0007079 3300053153 Bacteria 7195
1094 Ga0500630_038767 3300053159 Bacteria 2326
1095 Ga0500611_016981 3300053727 Bacteria 1317
1096 Ga0501084_0002917 3300054114 Bacteria 13845
1097 Ga0501084_0055480 3300054114 Bacteria 3315
1098 Ga0501082_0003080 3300060353 Bacteria 14544
1099 Ga0501082_0030428 3300060353 Bacteria 4652
1100 Ga0530510_0028627 3300061734 Bacteria 3995
1101 2586063783 2585427649 Bacteria 9053857
1102 2676486086 2675903059 Bacteria 8644972
1103 2795791568 2795385472 Bacteria 6627535
1104 2816420855 2816332119 Bacteria 8120218
1105 2855675852 2855670206 Bacteria 7120389
1106 2855678782 2855676851 Bacteria 7063653
1107 2857295203 2857288857 Bacteria 7189066
1108 2858853097 2858848962 Bacteria 6963058
1109 2858882964 2858882152 Bacteria 7230291
1110 2858891128 2858888857 Bacteria 7060307
1111 2858901788 2858895516 Bacteria 7378898
1112 2862516790 2862507626 Bacteria 9425308
1113 2869049870 2869048445 Bacteria 6875584
1114 2869067251 2869061728 Bacteria 7112407
1115 2869068868 2869068681 Bacteria 7205615
1116 2880490382 2880489317 Bacteria 7096270
1117 2880502152 2880495981 Bacteria 7340502
1118 2891398820 2891395885 Bacteria 9251614
1119 2891565978 2891562705 Bacteria 8039471
1120 2891567055 2891562705 Bacteria 8039471
1121 2895433352 2895427314 Bacteria 13147766
1122 2895438405 2895427314 Bacteria 13147766
1123 2895442974 2895442618 Bacteria 11027144
1124 2929230654 2929226422 Bacteria 7248583
1125 8003324090 8003314358 Bacteria 10575343
1126 8053945867 8053945823 Bacteria 8962862
1127 8054708612 8054704163 Bacteria 7247792
1128 8054735692 8054734606 Bacteria 6947278
1129 8057569480 8057568493 Bacteria 7221719
1130 Ga0373955_0126172
1131 JGI25406J46586_10027029
1132 rootH2_10017855
1133 rootH1_10084422
1134 Ga0070658_10001743
1135 Ga0070658_10027221
1136 Ga0070683_100141180
1137 Ga0070690_100041390
1138 Ga0068869_100075930
1139 Ga0068869_100163665
1140 Ga0070680_100000156
1141 Ga0070680_100155015
1142 Ga0070682_100026232
1143 Ga0068868_100084483
1144 Ga0068868_100222966
1145 Ga0070660_100079988
1146 Ga0070660_100085665
1147 Ga0070660_100148346
1148 Ga0070691_10011889
1149 Ga0070691_10040418
1150 Ga0070661_100002473
1151 Ga0070661_100023992
1152 Ga0070661_100153752
1153 Ga0070668_100003272
1154 Ga0070668_100011479
1155 Ga0070668_100053211
1156 Ga0070668_100256580
1157 Ga0070671_100424659
1158 Ga0070674_100026284
1159 Ga0070673_100300739
1160 Ga0070688_100048803
1161 Ga0070659_100074894
1162 Ga0070667_100012931
1163 Ga0070667_100141219
1164 Ga0070703_10020547
1165 Ga0070709_10001311
1166 Ga0070709_10028795
1167 Ga0070709_10077131
1168 Ga0070709_10137824
1169 Ga0070709_10236219
1170 Ga0070714_100007665
1171 Ga0070714_100013385
1172 Ga0070714_100015602
1173 Ga0070714_100074651
1174 Ga0070714_100121165
1175 Ga0070714_100352207
1176 Ga0070714_100397246
1177 Ga0070714_100426447
1178 Ga0070713_100002120
1179 Ga0070713_100015554
1180 Ga0070713_100037164
1181 Ga0070713_100069666
1182 Ga0070713_100172895
1183 Ga0070713_100394460
1184 Ga0070710_10002444
1185 Ga0070710_10040598
1186 Ga0070710_10043706
1187 Ga0070710_10088797
1188 Ga0070711_100004788
1189 Ga0070711_100075179
1190 Ga0070711_100093940
1191 Ga0070711_100211462
1192 Ga0070711_100229962
1193 Ga0070705_100061614
1194 Ga0070694_100223817
1195 Ga0070708_100002899
1196 Ga0070708_100026326
1197 Ga0070663_100171436
1198 Ga0070678_100047995
1199 Ga0070681_10000051
1200 Ga0070681_10006131
1201 Ga0070681_10006424
1202 Ga0070681_10176917
1203 Ga0070681_10289393
1204 Ga0070681_10404183
1205 Ga0070681_10418435
1206 Ga0070706_100003586
1207 Ga0070706_100005264
1208 Ga0070706_100006560
1209 Ga0070706_100022474
1210 Ga0070706_100083897
1211 Ga0070707_100023752
1212 Ga0070707_100025629
1213 Ga0070707_100195868
1214 Ga0070707_100444467
1215 Ga0070698_100017938
1216 Ga0070698_100038117
1217 Ga0070698_100188236
1218 Ga0070698_100226683
1219 Ga0070699_100000016
1220 Ga0070699_100002660
1221 Ga0070699_100054684
1222 Ga0070679_100000058
1223 Ga0070679_100022813
1224 Ga0070679_100301620
1225 Ga0070679_100466987
1226 Ga0070684_100002665
1227 Ga0070684_100060796
1228 Ga0070684_100394106
1229 Ga0070697_100001221
1230 Ga0070672_100122779
1231 Ga0070686_100200052
1232 Ga0070695_100074449
1233 Ga0070696_100022353
1234 Ga0070693_100059558
1235 Ga0070665_100322159
1236 Ga0070704_100046303
1237 Ga0068855_100120437
1238 Ga0068855_100128191
1239 Ga0068855_100185287
1240 Ga0068855_100270667
1241 Ga0070664_100037051
1242 Ga0070664_100127016
1243 Ga0070664_100269777
1244 Ga0070664_100444084
1245 Ga0068857_100045589
1246 Ga0068854_100116823
1247 Ga0068854_100150353
1248 Ga0068854_100164626
1249 Ga0068856_100018422
1250 Ga0068856_100037306
1251 Ga0068856_100068494
1252 Ga0068852_100028683
1253 Ga0068859_100451867
1254 Ga0068864_100040346
1255 Ga0068864_100052972
1256 Ga0068864_100164025
1257 Ga0068864_100234413
1258 Ga0068864_100310740
1259 Ga0068864_100462430
1260 Ga0068866_10036549
1261 Ga0068866_10084270
1262 Ga0068861_100023317
1263 Ga0068861_100135607
1264 Ga0068863_100043157
1265 Ga0068863_100065137
1266 Ga0068863_100110328
1267 Ga0068863_100366378
1268 Ga0068858_100053560
1269 Ga0068858_100207323
1270 Ga0068860_100000400
1271 Ga0068860_100094372
1272 Ga0068860_100156315
1273 Ga0081455_10032619
1274 Ga0081455_10051909
1275 Ga0081455_10075642
1276 Ga0081538_10002128
1277 Ga0081538_10004296
1278 Ga0081538_10025392
1279 Ga0081540_1001078
1280 Ga0081539_10000023
1281 Ga0081539_10000456
1282 Ga0081539_10002116
1283 Ga0081539_10057330
1284 Ga0070717_10011214
1285 Ga0070717_10028999
1286 Ga0070717_10083013
1287 Ga0070717_10089413
1288 Ga0070717_10130108
1289 Ga0070717_10238583
1290 Ga0070717_10283145
1291 Ga0070717_10300721
1292 Ga0070717_10362221
1293 Ga0075365_10003743
1294 Ga0075365_10016923
1295 Ga0075365_10033622
1296 Ga0075365_10046030
1297 Ga0075365_10052420
1298 Ga0075365_10181299
1299 Ga0075365_10270323
1300 Ga0075365_10319524
1301 Ga0075365_10350320
1302 Ga0075368_10012819
1303 Ga0075368_10060792
1304 Ga0075363_100014884
1305 Ga0075363_100041813
1306 Ga0075364_10067151
1307 Ga0075364_10130835
1308 Ga0070715_10000632
1309 Ga0070715_10149277
1310 Ga0070716_100000086
1311 Ga0070716_100004535
1312 Ga0070716_100024189
1313 Ga0070716_100099115
1314 Ga0070712_100011408
1315 Ga0070712_100027651
1316 Ga0070712_100031346
1317 Ga0070712_100032446
1318 Ga0070712_100047564
1319 Ga0070712_100115963
1320 Ga0070712_100124750
1321 Ga0070712_100171501
1322 Ga0070712_100194666
1323 Ga0070712_100277979
1324 Ga0075362_10010148
1325 Ga0075367_10008972
1326 Ga0075367_10063540
1327 Ga0097621_100077800
1328 Ga0097621_100096846
1329 Ga0075370_10000475
1330 Ga0075370_10054358
1331 Ga0075370_10132278
1332 Ga0075370_10164182
1333 Ga0068871_100213807
1334 Ga0075428_100023722
1335 Ga0075428_100042373
1336 Ga0075428_100100145
1337 Ga0075428_100200875
1338 Ga0075430_100187557
1339 Ga0075430_100406298
1340 Ga0075431_100084292
1341 Ga0075431_100538423
1342 Ga0075433_10002889
1343 Ga0075433_10177271
1344 Ga0075434_100017026
1345 Ga0075434_100334583
1346 Ga0075434_100507521
1347 Ga0075429_100082811
1348 Ga0075429_100381554
1349 Ga0068865_100088483
1350 Ga0075436_100022621
1351 Ga0097620_100451863
1352 Ga0075435_100016390
1353 Ga0075435_100175909
1354 Ga0075435_100323108
1355 Ga0099795_10010554
1356 Ga0105251_10034597
1357 Ga0105240_10078146
1358 Ga0105240_10338952
1359 Ga0105240_10707314
1360 Ga0111539_10001058
1361 Ga0105245_10025702
1362 Ga0105245_10065679
1363 Ga0105245_10236770
1364 Ga0105247_10030440
1365 Ga0105247_10034604
1366 Ga0105247_10270440
1367 Ga0114129_10004838
1368 Ga0114129_10005759
1369 Ga0114129_10009287
1370 Ga0114129_10130516
1371 Ga0114129_10212899
1372 Ga0114129_10265112
1373 Ga0105243_10124404
1374 Ga0105243_10654835
1375 Ga0105241_10013422
1376 Ga0105241_10343392
1377 Ga0105242_10257997
1378 Ga0105248_10091709
1379 Ga0105248_10195350
1380 Ga0105248_10417632
1381 Ga0105237_10061495
1382 Ga0105237_10110498
1383 Ga0105238_10216115
1384 Ga0105249_10082549
1385 Ga0105249_10172429
1386 Ga0099796_10028374
1387 Ga0105239_10121457
1388 Ga0105239_10145840
1389 Ga0105239_10150059
1390 Ga0105246_10072893
1391 Ga0157371_10015196
1392 Ga0157369_10022043
1393 Ga0157369_10023115
1394 Ga0157369_10025091
1395 Ga0157369_10129147
1396 Ga0157369_10170231
1397 Ga0157369_10404429
1398 Ga0157374_10007847
1399 Ga0157374_10042957
1400 Ga0163162_10065097
1401 Ga0163162_10431083
1402 Ga0157372_10107671
1403 Ga0157372_10113351
1404 Ga0157372_10120180
1405 Ga0157372_10561479
1406 Ga0157375_10169041
1407 Ga0163163_10067111
1408 Ga0163163_10091359
1409 Ga0163163_10098579
1410 Ga0163163_10301849
1411 Ga0163163_10472456
1412 Ga0163163_10562401
1413 Ga0157380_10046809
1414 Ga0157377_10020514
1415 Ga0157379_10059210
1416 Ga0157379_10146176
1417 Ga0157379_10155511
1418 Ga0157376_10042670
1419 Ga0157376_10070850
1420 Ga0163161_10309312
1421 Ga0197907_11394660
1422 Ga0206353_10307624
1423 Ga0206353_11504755
1424 Ga0213875_10001035
1425 Ga0213875_10114548
1426 Ga0224712_10058186
1427 Ga0224572_1006021
1428 Ga0207692_10039747
1429 Ga0207688_10058594
1430 Ga0207647_10059361
1431 Ga0207685_10007393
1432 Ga0207685_10161393
1433 Ga0207699_10001009
1434 Ga0207699_10003233
1435 Ga0207699_10004873
1436 Ga0207699_10050625
1437 Ga0207699_10061143
1438 Ga0207699_10123174
1439 Ga0207699_10137392
1440 Ga0207699_10160117
1441 Ga0207699_10212862
1442 Ga0207699_10270632
1443 Ga0207705_10004368
1444 Ga0207705_10018370
1445 Ga0207705_10063535
1446 Ga0207705_10096344
1447 Ga0207705_10168987
1448 Ga0207684_10001075
1449 Ga0207684_10003723
1450 Ga0207684_10008754
1451 Ga0207684_10148622
1452 Ga0207654_10015932
1453 Ga0207707_10000113
1454 Ga0207707_10032935
1455 Ga0207707_10069465
1456 Ga0207707_10173675
1457 Ga0207695_10124753
1458 Ga0207671_10034166
1459 Ga0207671_10048833
1460 Ga0207693_10002169
1461 Ga0207693_10017192
1462 Ga0207693_10044596
1463 Ga0207693_10049955
1464 Ga0207693_10053514
1465 Ga0207693_10082926
1466 Ga0207693_10094502
1467 Ga0207693_10136210
1468 Ga0207693_10213878
1469 Ga0207693_10266872
1470 Ga0207663_10028288
1471 Ga0207663_10053484
1472 Ga0207663_10066681
1473 Ga0207663_10073052
1474 Ga0207663_10112202
1475 Ga0207663_10120415
1476 Ga0207660_10000574
1477 Ga0207660_10031843
1478 Ga0207660_10121287
1479 Ga0207660_10218021
1480 Ga0207660_10423400
1481 Ga0207662_10031909
1482 Ga0207657_10013454
1483 Ga0207657_10038361
1484 Ga0207649_10115204
1485 Ga0207652_10000123
1486 Ga0207652_10181877
1487 Ga0207646_10022995
1488 Ga0207646_10024077
1489 Ga0207646_10064578
1490 Ga0207646_10091209
1491 Ga0207694_10032643
1492 Ga0207694_10199109
1493 Ga0207687_10057896
1494 Ga0207687_10134855
1495 Ga0207687_10275228
1496 Ga0207700_10000250
1497 Ga0207700_10008331
1498 Ga0207700_10012420
1499 Ga0207700_10016928
1500 Ga0207700_10040931
1501 Ga0207700_10047464
1502 Ga0207700_10111244
1503 Ga0207700_10363844
1504 Ga0207700_10381201
1505 Ga0207664_10009910
1506 Ga0207664_10013316
1507 Ga0207664_10027025
1508 Ga0207664_10030247
1509 Ga0207664_10031743
1510 Ga0207664_10046340
1511 Ga0207664_10048484
1512 Ga0207664_10055076
1513 Ga0207664_10059817
1514 Ga0207664_10100165
1515 Ga0207664_10210036
1516 Ga0207664_10229145
1517 Ga0207664_10279350
1518 Ga0207664_10506625
1519 Ga0207664_10519123
1520 Ga0207644_10134895
1521 Ga0207690_10007866
1522 Ga0207690_10179123
1523 Ga0207665_10003587
1524 Ga0207665_10008173
1525 Ga0207665_10019793
1526 Ga0207665_10110736
1527 Ga0207665_10136748
1528 Ga0207665_10261480
1529 Ga0207691_10034962
1530 Ga0207691_10140161
1531 Ga0207711_10041265
1532 Ga0207711_10057403
1533 Ga0207711_10082167
1534 Ga0207711_10117851
1535 Ga0207689_10052882
1536 Ga0207661_10004179
1537 Ga0207661_10105555
1538 Ga0207661_10242117
1539 Ga0207661_10327123
1540 Ga0207679_10052772
1541 Ga0207679_10135333
1542 Ga0207667_10075516
1543 Ga0207667_10117020
1544 Ga0207667_10181084
1545 Ga0207667_10562865
1546 Ga0207712_10035468
1547 Ga0207668_10002158
1548 Ga0207668_10003424
1549 Ga0207668_10194397
1550 Ga0207640_10045334
1551 Ga0207640_10048838
1552 Ga0207640_10091408
1553 Ga0207658_10170504
1554 Ga0207677_10051478
1555 Ga0207703_10014554
1556 Ga0207703_10063382
1557 Ga0207703_10171590
1558 Ga0207639_10319015
1559 Ga0207678_10008408
1560 Ga0207678_10010301
1561 Ga0207678_10017807
1562 Ga0207678_10214018
1563 Ga0207702_10048344
1564 Ga0207702_10086997
1565 Ga0207702_10181199
1566 Ga0207641_10037218
1567 Ga0207641_10082803
1568 Ga0207641_10536846
1569 Ga0207676_10181364
1570 Ga0207676_10208715
1571 Ga0207676_10215560
1572 Ga0207676_10615162
1573 Ga0207674_10015384
1574 Ga0207674_10224078
1575 Ga0207674_10227069
1576 Ga0207675_100126954
1577 Ga0207698_10026742
1578 Ga0207698_10271657
1579 Ga0207428_10015742
1580 Ga0207428_10248199
1581 Ga0268265_10212155
1582 Ga0268264_10000320
1583 Ga0268264_10042454
1584 Ga0268264_10045108
1585 Ga0265326_10049878
1586 Ga0265336_10009379
1587 Ga0265336_10040047
1588 Ga0307517_10098827
1589 Ga0307515_10032992
1590 Ga0307515_10051383
1591 Ga0307515_10062958
1592 Ga0307515_10090016
1593 Ga0307515_10094590
1594 Ga0307515_10154691
1595 Ga0307515_10208266
1596 Ga0307515_10323869
1597 Ga0265338_10004964
1598 Ga0265338_10005981
1599 Ga0265338_10016877
1600 Ga0265338_10132479
1601 Ga0265338_10136972
1602 Ga0265338_10206370
1603 Ga0265338_10314117
1604 Ga0307512_10001623
1605 Ga0307512_10001742
1606 Ga0307512_10005070
1607 Ga0307512_10006152
1608 Ga0307512_10122530
1609 Ga0307512_10194430
1610 Ga0316177_1218167
1611 Ga0316180_1042311
1612 Ga0265328_10032104
1613 Ga0265325_10032446
1614 Ga0265325_10106737
1615 Ga0265340_10001093
1616 Ga0265340_10022337
1617 Ga0307513_10009283
1618 Ga0307513_10041702
1619 Ga0307513_10050922
1620 Ga0307513_10137819
1621 Ga0307513_10172230
1622 Ga0307513_10334956
1623 Ga0307509_10114201
1624 Ga0307509_10194428
1625 Ga0307509_10323583
1626 Ga0307508_10025316
1627 Ga0307508_10034034
1628 Ga0307508_10059987
1629 Ga0307514_10036163
1630 Ga0307516_10004524
1631 Ga0307516_10039117
1632 Ga0307516_10168782
1633 Ga0307518_10002222
1634 Ga0307406_10128974
1635 Ga0307406_10316184
1636 Ga0307412_10454898
1637 Ga0307409_100063046
1638 Ga0307409_100191285
1639 Ga0307416_100210103
1640 Ga0307416_100545317
1641 Ga0307411_10061392
1642 Ga0307415_100003294
1643 Ga0307415_100020631
1644 Ga0307415_100020659
1645 Ga0307415_100068988
1646 Ga0307415_100140199
1647 Ga0307507_10001339
1648 Ga0307507_10011987
1649 Ga0307507_10023117
1650 Ga0307510_10076367
1651 Ga0373938_0019920
1652 Ga0373938_0025286
1653 Ga0373926_0037031
1654 Ga0373926_0045484
1655 Ga0373934_0003787
1656 Ga0373934_0006867
1657 Ga0373934_0007109
1658 Ga0373934_0018329
1659 Ga0373934_0021597
1660 Ga0373934_0075049
1661 Ga0373944_0005495
1662 Ga0373923_0003800
1663 Ga0373923_0006352
1664 Ga0373923_0013540
1665 Ga0373923_0017924
1666 Ga0373936_0002364
1667 Ga0373936_0005328
1668 Ga0373936_0097494
1669 Ga0373936_0134464
1670 Ga0373941_0024311
1671 Ga0373953_0001265
1672 Ga0373953_0002362
1673 Ga0373953_0011249
1674 Ga0373953_0053361
1675 Ga0373954_0016471
1676 Ga0373954_0072629
1677 Ga0373954_0084502
1678 Ga0373956_0004289
1679 Ga0373956_0144324
1680 Ga0373956_0223206
1681 Ga0373957_0000136
1682 Ga0373957_0004227
1683 Ga0373957_0025599
1684 Ga0373957_0031882
1685 Ga0373957_0037068
1686 Ga0373957_0066928
1687 Ga0373960_0026306
1688 Ga0373943_0002872
1689 Ga0373946_0107367
1690 Ga0373955_0000680
1691 Ga0373955_0002108
1692 Ga0373955_0013424
1693 Ga0373955_0050124
1694 Ga0373955_0087328
1695 Ga0373942_0004187
1696 Ga0373924_0001950
1697 Ga0373924_0005840
1698 Ga0373924_0007664
1699 Ga0373924_0034766
1700 Ga0373924_0045563
1701 Ga0373931_0063186
1702 Ga0373935_0010688
1703 Ga0373935_0097258
1704 Ga0373935_0105996
1705 Ga0373927_0364992
1706 Ga0373933_0000209
1707 Ga0373933_0015772
1708 Ga0373933_0018740
1709 Ga0373933_0019628
1710 Ga0373933_0036115
1711 Ga0373933_0251646
1712 Ga0373947_0067618
1713 Ga0373947_0070233
1714 Ga0373947_0142810
1715 Ga0373937_0003535
1716 Ga0373937_0010957
1717 Ga0373937_0011377
1718 Ga0373937_0027178
1719 Ga0373937_0048312
1720 Ga0373937_0068370
1721 Ga0373937_0077067
1722 Ga0373937_0112602
1723 Ga0373937_0120044
1724 Ga0373925_0000129
1725 Ga0373925_0009261
1726 Ga0373925_0016388
1727 Ga0373925_0021664
1728 Ga0373925_0030235
1729 Ga0373925_0039183
1730 Ga0373925_0046625
1731 Ga0373925_0056904
1732 Ga0373925_0113008
1733 Ga0395900_0265396
1734 Ga0395898_0186719
1735 Ga0395898_0205954
1736 Ga0436364_0464142
1737 Ga0436364_0923522
1738 Ga0395901_0039174
1739 Ga0395901_0144378
1740 Ga0436365_1218054
1741 Ga0436363_1288270
1742 Ga0439436_0000261
1743 Ga0439439_0004200
1744 Ga0451789_0766711
1745 Ga0439433_0000810
1746 Ga0439442_018316
1747 Ga0439449_0009770
1748 Ga0439449_0016973
1749 Ga0439449_0019898
1750 Ga0439457_002146
1751 Ga0439462_0000798
1752 Ga0466969_0050247
1753 Ga0466965_0013001
1754 Ga0466965_0065863
1755 Ga0466966_0026789
1756 Ga0466961_0134090
1757 Ga0466963_0020237
1758 Ga0466963_0044527
1759 Ga0466963_0094488
1760 Ga0466963_0131393
1761 Ga0466957_0066833
1762 Ga0466960_0233646
1763 Ga0466959_0082731
1764 Ga0466958_0006381
1765 Ga0466958_0016170
1766 Ga0466958_0121847
1767 Ga0466967_0049793
1768 Ga0466967_0061908
1769 Ga0466967_0078434
1770 Ga0466967_0570591
1771 Ga0495592_0000391
1772 Ga0495592_0001439
1773 Ga0495592_0005743
1774 Ga0495592_0008164
1775 Ga0495592_0025688
1776 Ga0495592_0028362
1777 Ga0495592_0031017
1778 Ga0495592_0145034
1779 Ga0495592_0171259
1780 Ga0495603_0002257
1781 Ga0495603_0033713
1782 Ga0495603_0064401
1783 Ga0495629_0019291
1784 Ga0495629_0034037
1785 Ga0495629_0034137
1786 Ga0495629_0237393
1787 Ga0495638_0109982
1788 Ga0495641_0014582
1789 Ga0495641_0016695
1790 Ga0495641_0025092
1791 Ga0495641_0082917
1792 Ga0495651_0001843
1793 Ga0495651_0002274
1794 Ga0495651_0002422
1795 Ga0495651_0004360
1796 Ga0495651_0015238
1797 Ga0495651_0016279
1798 Ga0495651_0034790
1799 Ga0495651_0058282
1800 Ga0495651_0100335
1801 Ga0495651_0106215
1802 Ga0495651_0145590
1803 Ga0495653_0001532
1804 Ga0495653_0009500
1805 Ga0495653_0010278
1806 Ga0495653_0011783
1807 Ga0495653_0018487
1808 Ga0495653_0021818
1809 Ga0495653_0024137
1810 Ga0495653_0052908
1811 Ga0495653_0054519
1812 Ga0495653_0214292
1813 Ga0495653_0230871
1814 Ga0495653_0241495
1815 Ga0495653_0258795
1816 Ga0495580_0038011
1817 Ga0495582_0007389
1818 Ga0495582_0016023
1819 Ga0495639_0008424
1820 Ga0495639_0012095
1821 Ga0495662_0008206
1822 Ga0495662_0011481
1823 Ga0495662_0017538
1824 Ga0495662_0040131
1825 Ga0495662_0093604
1826 Ga0495662_0109620
1827 Ga0495664_0013432
1828 Ga0495664_0013727
1829 Ga0495664_0032113
1830 Ga0495664_0038780
1831 Ga0495664_0070846
1832 Ga0495664_0080913
1833 Ga0495608_0000254
1834 Ga0495608_0000389
1835 Ga0495608_0002992
1836 Ga0495608_0008471
1837 Ga0495608_0009469
1838 Ga0495608_0015867
1839 Ga0495608_0022442
1840 Ga0495608_0030702
1841 Ga0495608_0032375
1842 Ga0495608_0048388
1843 Ga0495608_0178643
1844 Ga0495618_0046601
1845 Ga0495618_0056682
1846 Ga0495618_0086158
1847 Ga0495618_0128720
1848 Ga0495628_0004505
1849 Ga0495628_0010905
1850 Ga0495628_0020937
1851 Ga0495628_0025630
1852 Ga0495628_0037960
1853 Ga0495628_0041095
1854 Ga0495628_0114832
1855 Ga0495628_0423725
1856 Ga0495630_0000522
1857 Ga0495630_0009915
1858 Ga0495630_0041846
1859 Ga0495630_0042145
1860 Ga0495630_0080161
1861 Ga0495630_0091972
1862 Ga0495666_0033325
1863 Ga0495666_0084109
1864 Ga0495652_0003494
1865 Ga0495652_0004326
1866 Ga0495652_0010063
1867 Ga0495652_0012624
1868 Ga0495652_0024106
1869 Ga0495652_0029386
1870 Ga0495652_0043908
1871 Ga0495652_0073253
1872 Ga0495652_0107791
1873 Ga0495665_0003779
1874 Ga0495665_0016598
1875 Ga0495665_0036610
1876 Ga0495640_0007107
1877 Ga0495640_0014265
1878 Ga0495640_0014380
1879 Ga0495640_0033695
1880 Ga0495640_0108121
1881 Ga0495587_0000226
1882 Ga0495587_0004967
1883 Ga0495587_0006385
1884 Ga0495587_0007459
1885 Ga0495587_0009731
1886 Ga0495587_0028382
1887 Ga0495587_0032803
1888 Ga0495587_0083330
1889 Ga0495587_0169309
1890 Ga0495645_0000853
1891 Ga0495645_0019458
1892 Ga0495645_0024527
1893 Ga0495645_0051667
1894 Ga0495645_0051712
1895 Ga0495645_0066773
1896 Ga0495667_0000242
1897 Ga0495667_0001647
1898 Ga0495667_0003869
1899 Ga0495667_0006100
1900 Ga0495667_0006514
1901 Ga0495667_0010343
1902 Ga0495667_0031145
1903 Ga0495667_0046101
1904 Ga0495667_0164027
1905 Ga0495634_0004479
1906 Ga0495634_0008157
1907 Ga0495634_0012920
1908 Ga0495634_0014732
1909 Ga0495634_0018630
1910 Ga0495634_0034352
1911 Ga0495634_0039641
1912 Ga0495634_0075709
1913 Ga0495635_0000192
1914 Ga0495635_0002786
1915 Ga0495635_0003166
1916 Ga0495635_0003546
1917 Ga0495635_0009402
1918 Ga0495635_0009954
1919 Ga0495635_0011105
1920 Ga0495635_0031531
1921 Ga0495635_0050428
1922 Ga0495635_0162915
1923 Ga0495657_0000442
1924 Ga0495657_0003088
1925 Ga0495657_0005359
1926 Ga0495657_0009671
1927 Ga0495657_0019075
1928 Ga0495657_0019391
1929 Ga0495657_0020525
1930 Ga0495657_0039576
1931 Ga0495657_0158215
1932 Ga0495657_0163460
1933 Ga0495657_0229832
1934 Ga0495599_0000265
1935 Ga0495599_0000335
1936 Ga0495599_0002415
1937 Ga0495599_0003128
1938 Ga0495599_0008728
1939 Ga0495599_0030100
1940 Ga0495599_0040022
1941 Ga0495599_0041636
1942 Ga0495599_0094356
1943 Ga0495623_0000092
1944 Ga0495623_0002870
1945 Ga0495623_0006282
1946 Ga0495623_0016057
1947 Ga0495623_0027261
1948 Ga0495623_0053854
1949 Ga0495623_0065425
1950 Ga0495623_0075235
1951 Ga0495646_0000041
1952 Ga0495646_0007331
1953 Ga0495646_0010831
1954 Ga0495646_0027256
1955 Ga0495646_0040576
1956 Ga0495646_0051885
1957 Ga0495646_0090256
1958 Ga0495647_0086678
1959 Ga0495658_0010418
1960 Ga0495658_0017260
1961 Ga0495658_0116503
1962 Ga0495613_0002022
1963 Ga0495613_0003981
1964 Ga0495613_0005750
1965 Ga0495613_0011808
1966 Ga0495613_0044725
1967 Ga0495613_0067448
1968 Ga0495613_0109635
1969 Ga0495613_0130571
1970 Ga0495624_0007464
1971 Ga0495624_0021429
1972 Ga0495624_0112167
1973 Ga0495600_0000204
1974 Ga0495600_0006275
1975 Ga0495600_0007430
1976 Ga0495600_0007614
1977 Ga0495600_0011921
1978 Ga0495600_0014774
1979 Ga0495600_0024824
1980 Ga0495600_0025766
1981 Ga0495600_0039970
1982 Ga0495600_0099688
1983 Ga0495600_0112269
1984 Ga0495600_0209516
1985 Ga0495581_0017358
1986 Ga0495581_0025667
1987 Ga0495581_0047452
1988 Ga0495581_0054848
1989 Ga0495604_0000408
1990 Ga0495604_0000411
1991 Ga0495604_0009302
1992 Ga0495604_0011000
1993 Ga0495604_0012095
1994 Ga0495604_0012809
1995 Ga0495604_0042736
1996 Ga0495604_0057694
1997 Ga0495604_0070257
1998 Ga0495604_0088769
1999 Ga0495674_0000227
2000 Ga0495674_0003012
2001 Ga0495674_0005317
2002 Ga0495674_0024389
2003 Ga0495674_0030341
2004 Ga0495674_0032222
2005 Ga0495674_0055287
2006 Ga0495674_0061326
2007 Ga0495674_0073735
2008 Ga0495674_0181348
2009 Ga0495676_0052073
2010 Ga0495676_0056671
2011 Ga0495680_0001998
2012 Ga0495680_0003785
2013 Ga0495680_0008382
2014 Ga0495680_0011107
2015 Ga0495680_0012319
2016 Ga0495680_0017482
2017 Ga0495680_0024379
2018 Ga0495680_0043984
2019 Ga0495680_0047808
2020 Ga0495680_0148067
2021 Ga0495680_0297644
2022 Ga0495675_0000136
2023 Ga0495675_0001364
2024 Ga0495675_0001590
2025 Ga0495675_0013655
2026 Ga0495675_0021536
2027 Ga0495675_0107046
2028 Ga0495684_0000323
2029 Ga0495684_0003230
2030 Ga0495684_0005492
2031 Ga0495684_0008869
2032 Ga0495684_0023744
2033 Ga0495684_0024646
2034 Ga0495684_0038008
2035 Ga0495684_0079076
2036 Ga0495684_0087353
2037 Ga0495684_0310933
2038 Ga0495593_0008890
2039 Ga0495593_0044129
2040 Ga0495602_0000528
2041 Ga0495602_0002901
2042 Ga0495602_0003747
2043 Ga0495602_0004327
2044 Ga0495602_0007841
2045 Ga0495602_0013999
2046 Ga0495602_0061569
2047 Ga0495602_0071419
2048 Ga0495602_0099009
2049 Ga0495602_0104372
2050 Ga0495602_0155734
2051 Ga0495602_0202318
2052 Ga0495614_0012804
2053 Ga0496102_0047302
2054 Ga0496102_0059595
2055 Ga0496102_0405958
2056 Ga0496103_0026797
2057 Ga0496103_0038074
2058 Ga0496103_0315855
2059 Ga0496104_0004436
2060 Ga0496104_0052341
2061 Ga0496104_0071069
2062 Ga0496104_0159841
2063 Ga0496104_0186784
2064 Ga0496104_0256474
2065 Ga0496104_0414364
2066 Ga0496105_0004641
2067 Ga0496105_0011305
2068 Ga0496105_0020726
2069 Ga0496105_0032338
2070 Ga0496105_0124787
2071 Ga0496105_0151271
2072 Ga0496106_0057493
2073 Ga0496106_0186462
2074 Ga0496106_0225240
2075 Ga0496107_0060917
2076 Ga0496108_0000044
2077 Ga0496108_0030067
2078 Ga0496108_0128643
2079 Ga0496108_0181565
2080 Ga0496108_0209141
2081 Ga0496109_0018593
2082 Ga0496109_0021728
2083 Ga0496109_0054070
2084 Ga0496109_0071825
2085 Ga0496109_0076187
2086 Ga0496109_0085976
2087 Ga0496109_0278402
2088 Ga0496110_0011075
2089 Ga0496110_0011129
2090 Ga0496110_0027338
2091 Ga0496110_0064584
2092 Ga0496110_0237800
2093 Ga0496111_0017668
2094 Ga0496111_0028076
2095 Ga0496112_0018822
2096 Ga0496112_0021596
2097 Ga0496112_0126215
2098 Ga0496112_0490879
2099 Ga0496113_0049205
2100 Ga0496113_0052433
2101 Ga0496113_0100203
2102 Ga0496114_0001749
2103 Ga0496114_0083569
2104 Ga0496114_0124898
2105 Ga0496114_0170613
2106 Ga0496115_0020308
2107 Ga0496115_0029369
2108 Ga0496115_0285036
2109 Ga0496115_0320221
2110 Ga0496115_0613218
2111 Ga0496126_0039778
2112 Ga0496126_0048526
2113 Ga0496126_0123367
2114 Ga0496126_0187950
2115 Ga0501032_0039247
2116 Ga0501033_0084683
2117 Ga0501034_0138405
2118 Ga0501034_0173303
2119 Ga0501036_0008710
2120 Ga0501036_0411231
2121 Ga0501037_0013074
2122 Ga0501038_0004356
2123 Ga0501039_0002568
2124 Ga0501039_0259265
2125 Ga0501040_0000638
2126 Ga0501040_0022595
2127 Ga0501041_0004180
2128 Ga0501041_0071913
2129 Ga0501041_0142013
2130 Ga0501042_0001542
2131 Ga0501042_0106009
2132 Ga0501046_0003943
2133 Ga0501047_0043348
2134 Ga0501048_0001512
2135 Ga0501068_0010652
2136 Ga0501068_0264839
2137 Ga0501071_0058661
2138 Ga0501071_0062261
2139 Ga0501071_0123166
2140 Ga0501072_0007652
2141 Ga0501072_0018337
2142 Ga0501072_0039543
2143 Ga0501072_0102642
2144 Ga0501073_0099807
2145 Ga0501074_0003243
2146 Ga0501075_0000277
2147 Ga0501075_0112324
2148 Ga0501075_0158872
2149 Ga0501076_0001433
2150 Ga0501077_0023553
2151 Ga0501077_0088993
2152 Ga0501079_0001955
2153 Ga0501079_0102944
2154 Ga0501080_0095107
2155 Ga0501081_0001720
2156 Ga0501045_0001662
2157 Ga0501045_0112994
2158 nmdc:mga03683_5897_c1
2159 nmdc:mga03n38_172076_c1
2160 nmdc:mga00v17_133201_c1
2161 nmdc:mga00v17_160253_c1
2162 nmdc:mga0yw44_122806_c1
2163 nmdc:mga0yw44_187344_c1
2164 nmdc:mga0yw44_214514_c1
2165 nmdc:mga0yw44_24073_c1
2166 nmdc:mga0yw44_4224_c1
2167 nmdc:mga0yw44_51877_c1
2168 nmdc:mga0yw44_72649_c1
2169 nmdc:mga06z11_15296_c1
2170 nmdc:mga07m45_13133_c1
2171 nmdc:mga05p37_1301_c1
2172 nmdc:mga05p37_17636_c1
2173 nmdc:mga05p37_265356_c1
2174 nmdc:mga05p37_27313_c1
2175 nmdc:mga05p37_314410_c1
2176 nmdc:mga09592_24814_c1
2177 nmdc:mga09592_464738_c1
2178 nmdc:mga0qj67_276237_c1
2179 nmdc:mga0qj67_374893_c1
2180 nmdc:mga06r32_187681_c1
2181 nmdc:mga06r32_3234_c1
2182 nmdc:mga06r32_492819_c1
2183 nmdc:mga06r32_763465_c1
2184 nmdc:mga08y16_58173_c1
2185 nmdc:mga08y16_68628_c1
2186 nmdc:mga0n895_156016_c1
2187 nmdc:mga0n895_200270_c1
2188 nmdc:mga0n895_492854_c1
2189 nmdc:mga08x19_12714_c1
2190 Ga0495601_0007723
2191 Ga0495601_0027150
2192 Ga0495601_0055859
2193 Ga0495601_0057977
2194 Ga0495601_0063250
2195 Ga0495612_0002340
2196 Ga0495612_0026559
2197 Ga0495612_0031027
2198 Ga0495612_0052743
2199 Ga0495595_0000861
2200 Ga0495595_0044956
2201 Ga0495619_0002260
2202 Ga0495619_0016253
2203 Ga0495619_0022429
2204 Ga0495619_0024254
2205 Ga0495619_0099169
2206 Ga0495619_0112386
2207 Ga0495619_0197012
2208 Ga0495619_0241774
2209 Ga0500578_0006866
2210 Ga0500644_0019789
2211 Ga0500646_0000384
2212 Ga0500641_0038611
2213 Ga0500650_0090131
2214 Ga0500553_018407
2215 Ga0500554_032619
2216 Ga0500560_061254
2217 Ga0500593_000263
2218 Ga0500594_0036492
2219 Ga0500652_024316
2220 Ga0500577_0000812
2221 Ga0500586_091487
2222 Ga0500616_0007079
2223 Ga0500630_038767
2224 Ga0500611_016981
2225 Ga0501084_0002917
2226 Ga0501084_0055480
2227 Ga0501082_0003080
2228 Ga0501082_0030428
2229 Ga0530510_0028627
2230 2586063783
2231 2676486086
2232 2795791568
2233 2816420855
2234 2855675852
2235 2855678782
2236 2857295203
2237 2858853097
2238 2858882964
2239 2858891128
2240 2858901788
2241 2862516790
2242 2869049870
2243 2869067251
2244 2869068868
2245 2880490382
2246 2880502152
2247 2891398820
2248 2891565978
2249 2891567055
2250 2895433352
2251 2895438405
2252 2895442974
2253 2929230654
2254 8003324090
2255 8053945867
2256 8054708612
2257 8054735692
2258 8057569480

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

158

0.85

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

120

191

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9044 2 218
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9036 3 217
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.897 1 219
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.8951 3 218
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8941 2 218
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9268 1 218 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9197 1 212 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9188 2 218 3.40.50.300
af_Q2FZR0_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.915 1 219 3.40.50.300
af_P37624_8_264_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9145 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1C5ZNW8-F1-model_v4 Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) 0.9508 3 215 GO:0005524
GO:0016887
AF-A0A520NVZ7-F1-model_v4 ABC transporter ATP-binding protein 0.9369 2 218 GO:0005524
GO:0016887
AF-A0A1G6BNS4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9345 4 218 GO:0005524
GO:0016887
AF-A0A3M1J999-F1-model_v4 ABC transporter ATP-binding protein 0.9328 2 218 GO:0005524
GO:0016887
AF-A0A269XWW6-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9286 2 212 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map