F490521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1129 | 389 | 2258 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300035172|Ga0373955_0126172|Ga0373955_0126172_433_1452 |
| Length | 331 |
| Sequence | VSAVIEASGLGKRYRRQWALTDCTLSIPAGHVVGLVGPNGAGKTTLLNLAVGLLAPDAGTIEVLGGTPGAGQAELARVGFLAQDSPAYAGLSVADHLKLGAHLNPGWDPRLARGRVDRLDLDPGQKAGTLSGGQRAQLALTLAIAKRPELLILDEPVASLDPLARREFLQDLMEAVAEQELSVVLSSHLIADLERVCDYLIVLVGSRVRVAGPVDELLATHHRLTGPRRDPATLPDSLEVISASHTDVQTTLMVRTRGPVMDPAWTVSDVGLEDLALAYMSQAAPRPASSSAVPCPPWPPRWLCRCWSARTSSRPTGRSSPSRPRSWTTAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 178 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 232 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 347 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 350 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 351 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 359 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 363 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 364 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 365 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 366 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 367 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 368 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 369 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 370 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 371 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 372 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 373 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 374 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 375 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 376 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 377 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 378 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 379 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 380 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 381 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 382 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 383 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 384 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 385 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 386 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 387 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 388 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 389 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.08 |
| Metatranscriptomes | 0.35 |
| Isolates | 2.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 0.35 |
| Rhizoplane | 5.23 |
| Rhizosphere | 83.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373955_0126172 | 3300035172 | Bacteria | 1491 |
| 2 | JGI25406J46586_10027029 | 3300003203 | Bacteria | 2205 |
| 3 | rootH2_10017855 | 3300003320 | Bacteria | 3229 |
| 4 | rootH1_10084422 | 3300003323 | Bacteria | 4604 |
| 5 | Ga0070658_10001743 | 3300005327 | Bacteria | 18340 |
| 6 | Ga0070658_10027221 | 3300005327 | Bacteria | 4589 |
| 7 | Ga0070683_100141180 | 3300005329 | Bacteria | 2282 |
| 8 | Ga0070690_100041390 | 3300005330 | Bacteria | 2917 |
| 9 | Ga0068869_100075930 | 3300005334 | Bacteria | 2497 |
| 10 | Ga0068869_100163665 | 3300005334 | Bacteria | 1733 |
| 11 | Ga0070680_100000156 | 3300005336 | Bacteria | 42598 |
| 12 | Ga0070680_100155015 | 3300005336 | Bacteria | 1924 |
| 13 | Ga0070682_100026232 | 3300005337 | Bacteria | 3485 |
| 14 | Ga0068868_100084483 | 3300005338 | Bacteria | 2549 |
| 15 | Ga0068868_100222966 | 3300005338 | Bacteria | 1579 |
| 16 | Ga0070660_100079988 | 3300005339 | Bacteria | 2564 |
| 17 | Ga0070660_100085665 | 3300005339 | Bacteria | 2479 |
| 18 | Ga0070660_100148346 | 3300005339 | Bacteria | 1885 |
| 19 | Ga0070691_10011889 | 3300005341 | Bacteria | 3983 |
| 20 | Ga0070691_10040418 | 3300005341 | Bacteria | 2204 |
| 21 | Ga0070661_100002473 | 3300005344 | Bacteria | 12664 |
| 22 | Ga0070661_100023992 | 3300005344 | Bacteria | 4376 |
| 23 | Ga0070661_100153752 | 3300005344 | Bacteria | 1740 |
| 24 | Ga0070668_100003272 | 3300005347 | Bacteria | 11943 |
| 25 | Ga0070668_100011479 | 3300005347 | Bacteria | 6595 |
| 26 | Ga0070668_100053211 | 3300005347 | Bacteria | 3122 |
| 27 | Ga0070668_100256580 | 3300005347 | Bacteria | 1453 |
| 28 | Ga0070671_100424659 | 3300005355 | Bacteria | 1139 |
| 29 | Ga0070674_100026284 | 3300005356 | Bacteria | 3800 |
| 30 | Ga0070673_100300739 | 3300005364 | Bacteria | 1412 |
| 31 | Ga0070688_100048803 | 3300005365 | Bacteria | 2632 |
| 32 | Ga0070659_100074894 | 3300005366 | Bacteria | 2697 |
| 33 | Ga0070667_100012931 | 3300005367 | Bacteria | 6900 |
| 34 | Ga0070667_100141219 | 3300005367 | Bacteria | 2109 |
| 35 | Ga0070703_10020547 | 3300005406 | Bacteria | 1922 |
| 36 | Ga0070709_10001311 | 3300005434 | Bacteria | 13558 |
| 37 | Ga0070709_10028795 | 3300005434 | Bacteria | 3316 |
| 38 | Ga0070709_10077131 | 3300005434 | Bacteria | 2166 |
| 39 | Ga0070709_10137824 | 3300005434 | Bacteria | 1673 |
| 40 | Ga0070709_10236219 | 3300005434 | Bacteria | 1310 |
| 41 | Ga0070714_100007665 | 3300005435 | Bacteria | 8405 |
| 42 | Ga0070714_100013385 | 3300005435 | Bacteria | 6573 |
| 43 | Ga0070714_100015602 | 3300005435 | Bacteria | 6112 |
| 44 | Ga0070714_100074651 | 3300005435 | Bacteria | 2940 |
| 45 | Ga0070714_100121165 | 3300005435 | Bacteria | 2327 |
| 46 | Ga0070714_100352207 | 3300005435 | Bacteria | 1383 |
| 47 | Ga0070714_100397246 | 3300005435 | Bacteria | 1302 |
| 48 | Ga0070714_100426447 | 3300005435 | Bacteria | 1257 |
| 49 | Ga0070713_100002120 | 3300005436 | Bacteria | 12837 |
| 50 | Ga0070713_100015554 | 3300005436 | Bacteria | 5696 |
| 51 | Ga0070713_100037164 | 3300005436 | Bacteria | 3936 |
| 52 | Ga0070713_100069666 | 3300005436 | Bacteria | 2967 |
| 53 | Ga0070713_100172895 | 3300005436 | Bacteria | 1936 |
| 54 | Ga0070713_100394460 | 3300005436 | Bacteria | 1291 |
| 55 | Ga0070710_10002444 | 3300005437 | Bacteria | 8797 |
| 56 | Ga0070710_10040598 | 3300005437 | Bacteria | 2565 |
| 57 | Ga0070710_10043706 | 3300005437 | Bacteria | 2483 |
| 58 | Ga0070710_10088797 | 3300005437 | Bacteria | 1819 |
| 59 | Ga0070711_100004788 | 3300005439 | Bacteria | 8023 |
| 60 | Ga0070711_100075179 | 3300005439 | Bacteria | 2391 |
| 61 | Ga0070711_100093940 | 3300005439 | Bacteria | 2167 |
| 62 | Ga0070711_100211462 | 3300005439 | Bacteria | 1502 |
| 63 | Ga0070711_100229962 | 3300005439 | Bacteria | 1445 |
| 64 | Ga0070705_100061614 | 3300005440 | Bacteria | 2230 |
| 65 | Ga0070694_100223817 | 3300005444 | Bacteria | 1412 |
| 66 | Ga0070708_100002899 | 3300005445 | Bacteria | 13323 |
| 67 | Ga0070708_100026326 | 3300005445 | Bacteria | 4976 |
| 68 | Ga0070663_100171436 | 3300005455 | Bacteria | 1678 |
| 69 | Ga0070678_100047995 | 3300005456 | Bacteria | 3072 |
| 70 | Ga0070681_10000051 | 3300005458 | Bacteria | 82091 |
| 71 | Ga0070681_10006131 | 3300005458 | Bacteria | 11671 |
| 72 | Ga0070681_10006424 | 3300005458 | Bacteria | 11440 |
| 73 | Ga0070681_10176917 | 3300005458 | Bacteria | 2056 |
| 74 | Ga0070681_10289393 | 3300005458 | Bacteria | 1548 |
| 75 | Ga0070681_10404183 | 3300005458 | Bacteria | 1277 |
| 76 | Ga0070681_10418435 | 3300005458 | Bacteria | 1252 |
| 77 | Ga0070706_100003586 | 3300005467 | Bacteria | 15227 |
| 78 | Ga0070706_100005264 | 3300005467 | Bacteria | 12345 |
| 79 | Ga0070706_100006560 | 3300005467 | Bacteria | 10979 |
| 80 | Ga0070706_100022474 | 3300005467 | Bacteria | 5804 |
| 81 | Ga0070706_100083897 | 3300005467 | Bacteria | 2952 |
| 82 | Ga0070707_100023752 | 3300005468 | Bacteria | 5798 |
| 83 | Ga0070707_100025629 | 3300005468 | Bacteria | 5597 |
| 84 | Ga0070707_100195868 | 3300005468 | Bacteria | 1970 |
| 85 | Ga0070707_100444467 | 3300005468 | Bacteria | 1257 |
| 86 | Ga0070698_100017938 | 3300005471 | Bacteria | 7453 |
| 87 | Ga0070698_100038117 | 3300005471 | Bacteria | 4952 |
| 88 | Ga0070698_100188236 | 3300005471 | Bacteria | 2002 |
| 89 | Ga0070698_100226683 | 3300005471 | Bacteria | 1802 |
| 90 | Ga0070699_100000016 | 3300005518 | Bacteria | 206838 |
| 91 | Ga0070699_100002660 | 3300005518 | Bacteria | 15959 |
| 92 | Ga0070699_100054684 | 3300005518 | Bacteria | 3456 |
| 93 | Ga0070679_100000058 | 3300005530 | Bacteria | 82178 |
| 94 | Ga0070679_100022813 | 3300005530 | Bacteria | 6121 |
| 95 | Ga0070679_100301620 | 3300005530 | Bacteria | 1552 |
| 96 | Ga0070679_100466987 | 3300005530 | Bacteria | 1206 |
| 97 | Ga0070684_100002665 | 3300005535 | Bacteria | 13187 |
| 98 | Ga0070684_100060796 | 3300005535 | Bacteria | 3305 |
| 99 | Ga0070684_100394106 | 3300005535 | Bacteria | 1276 |
| 100 | Ga0070697_100001221 | 3300005536 | Bacteria | 19396 |
| 101 | Ga0070672_100122779 | 3300005543 | Bacteria | 2128 |
| 102 | Ga0070686_100200052 | 3300005544 | Bacteria | 1432 |
| 103 | Ga0070695_100074449 | 3300005545 | Bacteria | 2232 |
| 104 | Ga0070696_100022353 | 3300005546 | Bacteria | 4296 |
| 105 | Ga0070693_100059558 | 3300005547 | Bacteria | 2214 |
| 106 | Ga0070665_100322159 | 3300005548 | Bacteria | 1550 |
| 107 | Ga0070704_100046303 | 3300005549 | Bacteria | 3032 |
| 108 | Ga0068855_100120437 | 3300005563 | Bacteria | 3004 |
| 109 | Ga0068855_100128191 | 3300005563 | Bacteria | 2900 |
| 110 | Ga0068855_100185287 | 3300005563 | Bacteria | 2351 |
| 111 | Ga0068855_100270667 | 3300005563 | Bacteria | 1889 |
| 112 | Ga0070664_100037051 | 3300005564 | Bacteria | 4098 |
| 113 | Ga0070664_100127016 | 3300005564 | Bacteria | 2238 |
| 114 | Ga0070664_100269777 | 3300005564 | Bacteria | 1532 |
| 115 | Ga0070664_100444084 | 3300005564 | Bacteria | 1190 |
| 116 | Ga0068857_100045589 | 3300005577 | Bacteria | 3890 |
| 117 | Ga0068854_100116823 | 3300005578 | Bacteria | 2019 |
| 118 | Ga0068854_100150353 | 3300005578 | Bacteria | 1795 |
| 119 | Ga0068854_100164626 | 3300005578 | Bacteria | 1721 |
| 120 | Ga0068856_100018422 | 3300005614 | Bacteria | 6768 |
| 121 | Ga0068856_100037306 | 3300005614 | Bacteria | 4769 |
| 122 | Ga0068856_100068494 | 3300005614 | Bacteria | 3508 |
| 123 | Ga0068852_100028683 | 3300005616 | Bacteria | 4560 |
| 124 | Ga0068859_100451867 | 3300005617 | Bacteria | 1381 |
| 125 | Ga0068864_100040346 | 3300005618 | Bacteria | 3994 |
| 126 | Ga0068864_100052972 | 3300005618 | Bacteria | 3498 |
| 127 | Ga0068864_100164025 | 3300005618 | Bacteria | 2022 |
| 128 | Ga0068864_100234413 | 3300005618 | Bacteria | 1698 |
| 129 | Ga0068864_100310740 | 3300005618 | Bacteria | 1478 |
| 130 | Ga0068864_100462430 | 3300005618 | Bacteria | 1215 |
| 131 | Ga0068866_10036549 | 3300005718 | Bacteria | 2407 |
| 132 | Ga0068866_10084270 | 3300005718 | Bacteria | 1715 |
| 133 | Ga0068861_100023317 | 3300005719 | Bacteria | 4463 |
| 134 | Ga0068861_100135607 | 3300005719 | Bacteria | 2003 |
| 135 | Ga0068863_100043157 | 3300005841 | Bacteria | 4281 |
| 136 | Ga0068863_100065137 | 3300005841 | Bacteria | 3447 |
| 137 | Ga0068863_100110328 | 3300005841 | Bacteria | 2620 |
| 138 | Ga0068863_100366378 | 3300005841 | Bacteria | 1405 |
| 139 | Ga0068858_100053560 | 3300005842 | Bacteria | 3732 |
| 140 | Ga0068858_100207323 | 3300005842 | Bacteria | 1854 |
| 141 | Ga0068860_100000400 | 3300005843 | Bacteria | 56882 |
| 142 | Ga0068860_100094372 | 3300005843 | Bacteria | 2852 |
| 143 | Ga0068860_100156315 | 3300005843 | Bacteria | 2197 |
| 144 | Ga0081455_10032619 | 3300005937 | Bacteria | 4691 |
| 145 | Ga0081455_10051909 | 3300005937 | Bacteria | 3514 |
| 146 | Ga0081455_10075642 | 3300005937 | Bacteria | 2777 |
| 147 | Ga0081538_10002128 | 3300005981 | Bacteria | 19728 |
| 148 | Ga0081538_10004296 | 3300005981 | Bacteria | 13175 |
| 149 | Ga0081538_10025392 | 3300005981 | Bacteria | 4180 |
| 150 | Ga0081540_1001078 | 3300005983 | Bacteria | 24243 |
| 151 | Ga0081539_10000023 | 3300005985 | Bacteria | 356082 |
| 152 | Ga0081539_10000456 | 3300005985 | Bacteria | 86722 |
| 153 | Ga0081539_10002116 | 3300005985 | Bacteria | 29407 |
| 154 | Ga0081539_10057330 | 3300005985 | Bacteria | 2156 |
| 155 | Ga0070717_10011214 | 3300006028 | Bacteria | 6796 |
| 156 | Ga0070717_10028999 | 3300006028 | Bacteria | 4436 |
| 157 | Ga0070717_10083013 | 3300006028 | Bacteria | 2693 |
| 158 | Ga0070717_10089413 | 3300006028 | Bacteria | 2597 |
| 159 | Ga0070717_10130108 | 3300006028 | Bacteria | 2164 |
| 160 | Ga0070717_10238583 | 3300006028 | Bacteria | 1602 |
| 161 | Ga0070717_10283145 | 3300006028 | Bacteria | 1471 |
| 162 | Ga0070717_10300721 | 3300006028 | Bacteria | 1426 |
| 163 | Ga0070717_10362221 | 3300006028 | Bacteria | 1298 |
| 164 | Ga0075365_10003743 | 3300006038 | Bacteria | 7914 |
| 165 | Ga0075365_10016923 | 3300006038 | Bacteria | 4450 |
| 166 | Ga0075365_10033622 | 3300006038 | Bacteria | 3306 |
| 167 | Ga0075365_10046030 | 3300006038 | Bacteria | 2864 |
| 168 | Ga0075365_10052420 | 3300006038 | Bacteria | 2698 |
| 169 | Ga0075365_10181299 | 3300006038 | Bacteria | 1472 |
| 170 | Ga0075365_10270323 | 3300006038 | Bacteria | 1195 |
| 171 | Ga0075365_10319524 | 3300006038 | Bacteria | 1093 |
| 172 | Ga0075365_10350320 | 3300006038 | Bacteria | 1041 |
| 173 | Ga0075368_10012819 | 3300006042 | Bacteria | 3071 |
| 174 | Ga0075368_10060792 | 3300006042 | Bacteria | 1512 |
| 175 | Ga0075363_100014884 | 3300006048 | Bacteria | 3813 |
| 176 | Ga0075363_100041813 | 3300006048 | Bacteria | 2418 |
| 177 | Ga0075364_10067151 | 3300006051 | Bacteria | 2357 |
| 178 | Ga0075364_10130835 | 3300006051 | Bacteria | 1684 |
| 179 | Ga0070715_10000632 | 3300006163 | Bacteria | 9318 |
| 180 | Ga0070715_10149277 | 3300006163 | Bacteria | 1143 |
| 181 | Ga0070716_100000086 | 3300006173 | Bacteria | 36327 |
| 182 | Ga0070716_100004535 | 3300006173 | Bacteria | 6653 |
| 183 | Ga0070716_100024189 | 3300006173 | Bacteria | 3230 |
| 184 | Ga0070716_100099115 | 3300006173 | Bacteria | 1782 |
| 185 | Ga0070712_100011408 | 3300006175 | Bacteria | 5633 |
| 186 | Ga0070712_100027651 | 3300006175 | Bacteria | 3788 |
| 187 | Ga0070712_100031346 | 3300006175 | Bacteria | 3581 |
| 188 | Ga0070712_100032446 | 3300006175 | Bacteria | 3527 |
| 189 | Ga0070712_100047564 | 3300006175 | Bacteria | 2969 |
| 190 | Ga0070712_100115963 | 3300006175 | Bacteria | 2008 |
| 191 | Ga0070712_100124750 | 3300006175 | Bacteria | 1943 |
| 192 | Ga0070712_100171501 | 3300006175 | Bacteria | 1684 |
| 193 | Ga0070712_100194666 | 3300006175 | Bacteria | 1589 |
| 194 | Ga0070712_100277979 | 3300006175 | Bacteria | 1347 |
| 195 | Ga0075362_10010148 | 3300006177 | Bacteria | 3669 |
| 196 | Ga0075367_10008972 | 3300006178 | Bacteria | 5206 |
| 197 | Ga0075367_10063540 | 3300006178 | Bacteria | 2207 |
| 198 | Ga0097621_100077800 | 3300006237 | Bacteria | 2754 |
| 199 | Ga0097621_100096846 | 3300006237 | Bacteria | 2476 |
| 200 | Ga0075370_10000475 | 3300006353 | Bacteria | 15085 |
| 201 | Ga0075370_10054358 | 3300006353 | Bacteria | 2274 |
| 202 | Ga0075370_10132278 | 3300006353 | Bacteria | 1456 |
| 203 | Ga0075370_10164182 | 3300006353 | Bacteria | 1304 |
| 204 | Ga0068871_100213807 | 3300006358 | Bacteria | 1668 |
| 205 | Ga0075428_100023722 | 3300006844 | Bacteria | 6790 |
| 206 | Ga0075428_100042373 | 3300006844 | Bacteria | 5005 |
| 207 | Ga0075428_100100145 | 3300006844 | Bacteria | 3160 |
| 208 | Ga0075428_100200875 | 3300006844 | Bacteria | 2155 |
| 209 | Ga0075430_100187557 | 3300006846 | Bacteria | 1719 |
| 210 | Ga0075430_100406298 | 3300006846 | Bacteria | 1124 |
| 211 | Ga0075431_100084292 | 3300006847 | Bacteria | 3281 |
| 212 | Ga0075431_100538423 | 3300006847 | Bacteria | 1156 |
| 213 | Ga0075433_10002889 | 3300006852 | Bacteria | 13169 |
| 214 | Ga0075433_10177271 | 3300006852 | Bacteria | 1896 |
| 215 | Ga0075434_100017026 | 3300006871 | Bacteria | 6994 |
| 216 | Ga0075434_100334583 | 3300006871 | Bacteria | 1534 |
| 217 | Ga0075434_100507521 | 3300006871 | Bacteria | 1227 |
| 218 | Ga0075429_100082811 | 3300006880 | Bacteria | 2797 |
| 219 | Ga0075429_100381554 | 3300006880 | Bacteria | 1234 |
| 220 | Ga0068865_100088483 | 3300006881 | Bacteria | 2241 |
| 221 | Ga0075436_100022621 | 3300006914 | Bacteria | 4318 |
| 222 | Ga0097620_100451863 | 3300006931 | Bacteria | 1381 |
| 223 | Ga0075435_100016390 | 3300007076 | Bacteria | 5587 |
| 224 | Ga0075435_100175909 | 3300007076 | Bacteria | 1807 |
| 225 | Ga0075435_100323108 | 3300007076 | Bacteria | 1321 |
| 226 | Ga0099795_10010554 | 3300007788 | Bacteria | 2724 |
| 227 | Ga0105251_10034597 | 3300009011 | Bacteria | 2498 |
| 228 | Ga0105240_10078146 | 3300009093 | Bacteria | 4076 |
| 229 | Ga0105240_10338952 | 3300009093 | Bacteria | 1708 |
| 230 | Ga0105240_10707314 | 3300009093 | Bacteria | 1099 |
| 231 | Ga0111539_10001058 | 3300009094 | Bacteria | 36236 |
| 232 | Ga0105245_10025702 | 3300009098 | Bacteria | 5178 |
| 233 | Ga0105245_10065679 | 3300009098 | Bacteria | 3281 |
| 234 | Ga0105245_10236770 | 3300009098 | Bacteria | 1768 |
| 235 | Ga0105247_10030440 | 3300009101 | Bacteria | 3272 |
| 236 | Ga0105247_10034604 | 3300009101 | Bacteria | 3077 |
| 237 | Ga0105247_10270440 | 3300009101 | Bacteria | 1169 |
| 238 | Ga0114129_10004838 | 3300009147 | Bacteria | 19018 |
| 239 | Ga0114129_10005759 | 3300009147 | Bacteria | 17559 |
| 240 | Ga0114129_10009287 | 3300009147 | Bacteria | 14022 |
| 241 | Ga0114129_10130516 | 3300009147 | Bacteria | 3451 |
| 242 | Ga0114129_10212899 | 3300009147 | Bacteria | 2612 |
| 243 | Ga0114129_10265112 | 3300009147 | Bacteria | 2300 |
| 244 | Ga0105243_10124404 | 3300009148 | Bacteria | 2179 |
| 245 | Ga0105243_10654835 | 3300009148 | Bacteria | 1018 |
| 246 | Ga0105241_10013422 | 3300009174 | Bacteria | 6005 |
| 247 | Ga0105241_10343392 | 3300009174 | Bacteria | 1294 |
| 248 | Ga0105242_10257997 | 3300009176 | Bacteria | 1573 |
| 249 | Ga0105248_10091709 | 3300009177 | Bacteria | 3421 |
| 250 | Ga0105248_10195350 | 3300009177 | Bacteria | 2280 |
| 251 | Ga0105248_10417632 | 3300009177 | Bacteria | 1511 |
| 252 | Ga0105237_10061495 | 3300009545 | Bacteria | 3755 |
| 253 | Ga0105237_10110498 | 3300009545 | Bacteria | 2741 |
| 254 | Ga0105238_10216115 | 3300009551 | Bacteria | 1893 |
| 255 | Ga0105249_10082549 | 3300009553 | Bacteria | 2990 |
| 256 | Ga0105249_10172429 | 3300009553 | Bacteria | 2099 |
| 257 | Ga0099796_10028374 | 3300010159 | Bacteria | 1796 |
| 258 | Ga0105239_10121457 | 3300010375 | Bacteria | 2901 |
| 259 | Ga0105239_10145840 | 3300010375 | Bacteria | 2639 |
| 260 | Ga0105239_10150059 | 3300010375 | Bacteria | 2601 |
| 261 | Ga0105246_10072893 | 3300011119 | Bacteria | 2422 |
| 262 | Ga0157371_10015196 | 3300013102 | Bacteria | 5780 |
| 263 | Ga0157369_10022043 | 3300013105 | Bacteria | 7117 |
| 264 | Ga0157369_10023115 | 3300013105 | Bacteria | 6927 |
| 265 | Ga0157369_10025091 | 3300013105 | Bacteria | 6621 |
| 266 | Ga0157369_10129147 | 3300013105 | Bacteria | 2679 |
| 267 | Ga0157369_10170231 | 3300013105 | Bacteria | 2295 |
| 268 | Ga0157369_10404429 | 3300013105 | Bacteria | 1416 |
| 269 | Ga0157374_10007847 | 3300013296 | Bacteria | 9112 |
| 270 | Ga0157374_10042957 | 3300013296 | Bacteria | 4173 |
| 271 | Ga0163162_10065097 | 3300013306 | Bacteria | 3691 |
| 272 | Ga0163162_10431083 | 3300013306 | Bacteria | 1450 |
| 273 | Ga0157372_10107671 | 3300013307 | Bacteria | 3189 |
| 274 | Ga0157372_10113351 | 3300013307 | Bacteria | 3107 |
| 275 | Ga0157372_10120180 | 3300013307 | Bacteria | 3017 |
| 276 | Ga0157372_10561479 | 3300013307 | Bacteria | 1330 |
| 277 | Ga0157375_10169041 | 3300013308 | Bacteria | 2333 |
| 278 | Ga0163163_10067111 | 3300014325 | Bacteria | 3565 |
| 279 | Ga0163163_10091359 | 3300014325 | Bacteria | 3059 |
| 280 | Ga0163163_10098579 | 3300014325 | Bacteria | 2944 |
| 281 | Ga0163163_10301849 | 3300014325 | Bacteria | 1654 |
| 282 | Ga0163163_10472456 | 3300014325 | Bacteria | 1315 |
| 283 | Ga0163163_10562401 | 3300014325 | Bacteria | 1203 |
| 284 | Ga0157380_10046809 | 3300014326 | Bacteria | 3399 |
| 285 | Ga0157377_10020514 | 3300014745 | Bacteria | 3463 |
| 286 | Ga0157379_10059210 | 3300014968 | Bacteria | 3425 |
| 287 | Ga0157379_10146176 | 3300014968 | Bacteria | 2132 |
| 288 | Ga0157379_10155511 | 3300014968 | Bacteria | 2063 |
| 289 | Ga0157376_10042670 | 3300014969 | Bacteria | 3719 |
| 290 | Ga0157376_10070850 | 3300014969 | Bacteria | 2960 |
| 291 | Ga0163161_10309312 | 3300017792 | Bacteria | 1246 |
| 292 | Ga0197907_11394660 | 3300020069 | Bacteria | 1548 |
| 293 | Ga0206353_10307624 | 3300020082 | Bacteria | 1344 |
| 294 | Ga0206353_11504755 | 3300020082 | Bacteria | 4879 |
| 295 | Ga0213875_10001035 | 3300021388 | Bacteria | 19625 |
| 296 | Ga0213875_10114548 | 3300021388 | Bacteria | 1260 |
| 297 | Ga0224712_10058186 | 3300022467 | Bacteria | 1530 |
| 298 | Ga0224572_1006021 | 3300024225 | Bacteria | 2181 |
| 299 | Ga0207692_10039747 | 3300025898 | Bacteria | 2317 |
| 300 | Ga0207688_10058594 | 3300025901 | Bacteria | 2167 |
| 301 | Ga0207647_10059361 | 3300025904 | Bacteria | 2341 |
| 302 | Ga0207685_10007393 | 3300025905 | Bacteria | 3059 |
| 303 | Ga0207685_10161393 | 3300025905 | Bacteria | 1024 |
| 304 | Ga0207699_10001009 | 3300025906 | Bacteria | 13328 |
| 305 | Ga0207699_10003233 | 3300025906 | Bacteria | 7757 |
| 306 | Ga0207699_10004873 | 3300025906 | Bacteria | 6424 |
| 307 | Ga0207699_10050625 | 3300025906 | Bacteria | 2451 |
| 308 | Ga0207699_10061143 | 3300025906 | Bacteria | 2265 |
| 309 | Ga0207699_10123174 | 3300025906 | Bacteria | 1680 |
| 310 | Ga0207699_10137392 | 3300025906 | Bacteria | 1602 |
| 311 | Ga0207699_10160117 | 3300025906 | Bacteria | 1498 |
| 312 | Ga0207699_10212862 | 3300025906 | Bacteria | 1315 |
| 313 | Ga0207699_10270632 | 3300025906 | Bacteria | 1177 |
| 314 | Ga0207705_10004368 | 3300025909 | Bacteria | 10690 |
| 315 | Ga0207705_10018370 | 3300025909 | Bacteria | 5001 |
| 316 | Ga0207705_10063535 | 3300025909 | Bacteria | 2667 |
| 317 | Ga0207705_10096344 | 3300025909 | Bacteria | 2172 |
| 318 | Ga0207705_10168987 | 3300025909 | Bacteria | 1646 |
| 319 | Ga0207684_10001075 | 3300025910 | Bacteria | 30597 |
| 320 | Ga0207684_10003723 | 3300025910 | Bacteria | 14767 |
| 321 | Ga0207684_10008754 | 3300025910 | Bacteria | 8985 |
| 322 | Ga0207684_10148622 | 3300025910 | Bacteria | 2015 |
| 323 | Ga0207654_10015932 | 3300025911 | Bacteria | 3909 |
| 324 | Ga0207707_10000113 | 3300025912 | Bacteria | 82066 |
| 325 | Ga0207707_10032935 | 3300025912 | Bacteria | 4536 |
| 326 | Ga0207707_10069465 | 3300025912 | Bacteria | 3070 |
| 327 | Ga0207707_10173675 | 3300025912 | Bacteria | 1883 |
| 328 | Ga0207695_10124753 | 3300025913 | Bacteria | 2539 |
| 329 | Ga0207671_10034166 | 3300025914 | Bacteria | 3780 |
| 330 | Ga0207671_10048833 | 3300025914 | Bacteria | 3132 |
| 331 | Ga0207693_10002169 | 3300025915 | Bacteria | 17108 |
| 332 | Ga0207693_10017192 | 3300025915 | Bacteria | 5767 |
| 333 | Ga0207693_10044596 | 3300025915 | Bacteria | 3485 |
| 334 | Ga0207693_10049955 | 3300025915 | Bacteria | 3285 |
| 335 | Ga0207693_10053514 | 3300025915 | Bacteria | 3167 |
| 336 | Ga0207693_10082926 | 3300025915 | Bacteria | 2511 |
| 337 | Ga0207693_10094502 | 3300025915 | Bacteria | 2343 |
| 338 | Ga0207693_10136210 | 3300025915 | Bacteria | 1931 |
| 339 | Ga0207693_10213878 | 3300025915 | Bacteria | 1515 |
| 340 | Ga0207693_10266872 | 3300025915 | Bacteria | 1341 |
| 341 | Ga0207663_10028288 | 3300025916 | Bacteria | 3279 |
| 342 | Ga0207663_10053484 | 3300025916 | Bacteria | 2523 |
| 343 | Ga0207663_10066681 | 3300025916 | Bacteria | 2305 |
| 344 | Ga0207663_10073052 | 3300025916 | Bacteria | 2219 |
| 345 | Ga0207663_10112202 | 3300025916 | Bacteria | 1852 |
| 346 | Ga0207663_10120415 | 3300025916 | Bacteria | 1796 |
| 347 | Ga0207660_10000574 | 3300025917 | Bacteria | 24712 |
| 348 | Ga0207660_10031843 | 3300025917 | Bacteria | 3636 |
| 349 | Ga0207660_10121287 | 3300025917 | Bacteria | 1980 |
| 350 | Ga0207660_10218021 | 3300025917 | Bacteria | 1496 |
| 351 | Ga0207660_10423400 | 3300025917 | Bacteria | 1074 |
| 352 | Ga0207662_10031909 | 3300025918 | Bacteria | 3063 |
| 353 | Ga0207657_10013454 | 3300025919 | Bacteria | 8027 |
| 354 | Ga0207657_10038361 | 3300025919 | Bacteria | 4266 |
| 355 | Ga0207649_10115204 | 3300025920 | Bacteria | 1803 |
| 356 | Ga0207652_10000123 | 3300025921 | Bacteria | 82875 |
| 357 | Ga0207652_10181877 | 3300025921 | Bacteria | 1889 |
| 358 | Ga0207646_10022995 | 3300025922 | Bacteria | 5732 |
| 359 | Ga0207646_10024077 | 3300025922 | Bacteria | 5581 |
| 360 | Ga0207646_10064578 | 3300025922 | Bacteria | 3268 |
| 361 | Ga0207646_10091209 | 3300025922 | Bacteria | 2727 |
| 362 | Ga0207694_10032643 | 3300025924 | Bacteria | 3986 |
| 363 | Ga0207694_10199109 | 3300025924 | Bacteria | 1629 |
| 364 | Ga0207687_10057896 | 3300025927 | Bacteria | 2724 |
| 365 | Ga0207687_10134855 | 3300025927 | Bacteria | 1866 |
| 366 | Ga0207687_10275228 | 3300025927 | Bacteria | 1347 |
| 367 | Ga0207700_10000250 | 3300025928 | Bacteria | 32146 |
| 368 | Ga0207700_10008331 | 3300025928 | Bacteria | 6414 |
| 369 | Ga0207700_10012420 | 3300025928 | Bacteria | 5493 |
| 370 | Ga0207700_10016928 | 3300025928 | Bacteria | 4855 |
| 371 | Ga0207700_10040931 | 3300025928 | Bacteria | 3386 |
| 372 | Ga0207700_10047464 | 3300025928 | Bacteria | 3183 |
| 373 | Ga0207700_10111244 | 3300025928 | Bacteria | 2204 |
| 374 | Ga0207700_10363844 | 3300025928 | Bacteria | 1262 |
| 375 | Ga0207700_10381201 | 3300025928 | Bacteria | 1233 |
| 376 | Ga0207664_10009910 | 3300025929 | Bacteria | 6710 |
| 377 | Ga0207664_10013316 | 3300025929 | Bacteria | 5900 |
| 378 | Ga0207664_10027025 | 3300025929 | Bacteria | 4346 |
| 379 | Ga0207664_10030247 | 3300025929 | Bacteria | 4134 |
| 380 | Ga0207664_10031743 | 3300025929 | Bacteria | 4043 |
| 381 | Ga0207664_10046340 | 3300025929 | Bacteria | 3412 |
| 382 | Ga0207664_10048484 | 3300025929 | Bacteria | 3340 |
| 383 | Ga0207664_10055076 | 3300025929 | Bacteria | 3154 |
| 384 | Ga0207664_10059817 | 3300025929 | Bacteria | 3036 |
| 385 | Ga0207664_10100165 | 3300025929 | Bacteria | 2392 |
| 386 | Ga0207664_10210036 | 3300025929 | Bacteria | 1684 |
| 387 | Ga0207664_10229145 | 3300025929 | Bacteria | 1614 |
| 388 | Ga0207664_10279350 | 3300025929 | Bacteria | 1465 |
| 389 | Ga0207664_10506625 | 3300025929 | Bacteria | 1081 |
| 390 | Ga0207664_10519123 | 3300025929 | Bacteria | 1068 |
| 391 | Ga0207644_10134895 | 3300025931 | Bacteria | 1894 |
| 392 | Ga0207690_10007866 | 3300025932 | Bacteria | 6331 |
| 393 | Ga0207690_10179123 | 3300025932 | Bacteria | 1594 |
| 394 | Ga0207665_10003587 | 3300025939 | Bacteria | 10371 |
| 395 | Ga0207665_10008173 | 3300025939 | Bacteria | 6907 |
| 396 | Ga0207665_10019793 | 3300025939 | Bacteria | 4422 |
| 397 | Ga0207665_10110736 | 3300025939 | Bacteria | 1929 |
| 398 | Ga0207665_10136748 | 3300025939 | Bacteria | 1744 |
| 399 | Ga0207665_10261480 | 3300025939 | Bacteria | 1282 |
| 400 | Ga0207691_10034962 | 3300025940 | Bacteria | 4669 |
| 401 | Ga0207691_10140161 | 3300025940 | Bacteria | 2131 |
| 402 | Ga0207711_10041265 | 3300025941 | Bacteria | 3929 |
| 403 | Ga0207711_10057403 | 3300025941 | Bacteria | 3347 |
| 404 | Ga0207711_10082167 | 3300025941 | Bacteria | 2816 |
| 405 | Ga0207711_10117851 | 3300025941 | Bacteria | 2368 |
| 406 | Ga0207689_10052882 | 3300025942 | Bacteria | 3346 |
| 407 | Ga0207661_10004179 | 3300025944 | Bacteria | 10104 |
| 408 | Ga0207661_10105555 | 3300025944 | Bacteria | 2374 |
| 409 | Ga0207661_10242117 | 3300025944 | Bacteria | 1601 |
| 410 | Ga0207661_10327123 | 3300025944 | Bacteria | 1379 |
| 411 | Ga0207679_10052772 | 3300025945 | Bacteria | 2984 |
| 412 | Ga0207679_10135333 | 3300025945 | Bacteria | 1983 |
| 413 | Ga0207667_10075516 | 3300025949 | Bacteria | 3499 |
| 414 | Ga0207667_10117020 | 3300025949 | Bacteria | 2747 |
| 415 | Ga0207667_10181084 | 3300025949 | Bacteria | 2164 |
| 416 | Ga0207667_10562865 | 3300025949 | Bacteria | 1152 |
| 417 | Ga0207712_10035468 | 3300025961 | Bacteria | 3389 |
| 418 | Ga0207668_10002158 | 3300025972 | Bacteria | 11474 |
| 419 | Ga0207668_10003424 | 3300025972 | Bacteria | 9305 |
| 420 | Ga0207668_10194397 | 3300025972 | Bacteria | 1611 |
| 421 | Ga0207640_10045334 | 3300025981 | Bacteria | 2823 |
| 422 | Ga0207640_10048838 | 3300025981 | Bacteria | 2738 |
| 423 | Ga0207640_10091408 | 3300025981 | Bacteria | 2108 |
| 424 | Ga0207658_10170504 | 3300025986 | Bacteria | 1792 |
| 425 | Ga0207677_10051478 | 3300026023 | Bacteria | 2792 |
| 426 | Ga0207703_10014554 | 3300026035 | Bacteria | 6138 |
| 427 | Ga0207703_10063382 | 3300026035 | Bacteria | 3031 |
| 428 | Ga0207703_10171590 | 3300026035 | Bacteria | 1908 |
| 429 | Ga0207639_10319015 | 3300026041 | Bacteria | 1379 |
| 430 | Ga0207678_10008408 | 3300026067 | Bacteria | 9104 |
| 431 | Ga0207678_10010301 | 3300026067 | Bacteria | 8206 |
| 432 | Ga0207678_10017807 | 3300026067 | Bacteria | 6237 |
| 433 | Ga0207678_10214018 | 3300026067 | Bacteria | 1649 |
| 434 | Ga0207702_10048344 | 3300026078 | Bacteria | 3587 |
| 435 | Ga0207702_10086997 | 3300026078 | Bacteria | 2727 |
| 436 | Ga0207702_10181199 | 3300026078 | Bacteria | 1940 |
| 437 | Ga0207641_10037218 | 3300026088 | Bacteria | 4063 |
| 438 | Ga0207641_10082803 | 3300026088 | Bacteria | 2788 |
| 439 | Ga0207641_10536846 | 3300026088 | Bacteria | 1139 |
| 440 | Ga0207676_10181364 | 3300026095 | Bacteria | 1844 |
| 441 | Ga0207676_10208715 | 3300026095 | Bacteria | 1731 |
| 442 | Ga0207676_10215560 | 3300026095 | Bacteria | 1706 |
| 443 | Ga0207676_10615162 | 3300026095 | Bacteria | 1045 |
| 444 | Ga0207674_10015384 | 3300026116 | Bacteria | 8405 |
| 445 | Ga0207674_10224078 | 3300026116 | Bacteria | 1829 |
| 446 | Ga0207674_10227069 | 3300026116 | Bacteria | 1815 |
| 447 | Ga0207675_100126954 | 3300026118 | Bacteria | 2416 |
| 448 | Ga0207698_10026742 | 3300026142 | Bacteria | 4085 |
| 449 | Ga0207698_10271657 | 3300026142 | Bacteria | 1563 |
| 450 | Ga0207428_10015742 | 3300027907 | Bacteria | 6530 |
| 451 | Ga0207428_10248199 | 3300027907 | Bacteria | 1328 |
| 452 | Ga0268265_10212155 | 3300028380 | Bacteria | 1688 |
| 453 | Ga0268264_10000320 | 3300028381 | Bacteria | 75931 |
| 454 | Ga0268264_10042454 | 3300028381 | Bacteria | 3764 |
| 455 | Ga0268264_10045108 | 3300028381 | Bacteria | 3660 |
| 456 | Ga0265326_10049878 | 3300028558 | Bacteria | 1186 |
| 457 | Ga0265336_10009379 | 3300028666 | Bacteria | 3390 |
| 458 | Ga0265336_10040047 | 3300028666 | Bacteria | 1435 |
| 459 | Ga0307517_10098827 | 3300028786 | Bacteria | 2319 |
| 460 | Ga0307515_10032992 | 3300028794 | Bacteria | 8547 |
| 461 | Ga0307515_10051383 | 3300028794 | Bacteria | 6147 |
| 462 | Ga0307515_10062958 | 3300028794 | Bacteria | 5225 |
| 463 | Ga0307515_10090016 | 3300028794 | Bacteria | 3854 |
| 464 | Ga0307515_10094590 | 3300028794 | Bacteria | 3689 |
| 465 | Ga0307515_10154691 | 3300028794 | Bacteria | 2374 |
| 466 | Ga0307515_10208266 | 3300028794 | Bacteria | 1808 |
| 467 | Ga0307515_10323869 | 3300028794 | Bacteria | 1205 |
| 468 | Ga0265338_10004964 | 3300028800 | Bacteria | 17622 |
| 469 | Ga0265338_10005981 | 3300028800 | Bacteria | 15651 |
| 470 | Ga0265338_10016877 | 3300028800 | Bacteria | 7904 |
| 471 | Ga0265338_10132479 | 3300028800 | Bacteria | 1965 |
| 472 | Ga0265338_10136972 | 3300028800 | Bacteria | 1923 |
| 473 | Ga0265338_10206370 | 3300028800 | Bacteria | 1478 |
| 474 | Ga0265338_10314117 | 3300028800 | Bacteria | 1136 |
| 475 | Ga0307512_10001623 | 3300030522 | Bacteria | 31204 |
| 476 | Ga0307512_10001742 | 3300030522 | Bacteria | 29690 |
| 477 | Ga0307512_10005070 | 3300030522 | Bacteria | 13999 |
| 478 | Ga0307512_10006152 | 3300030522 | Bacteria | 12265 |
| 479 | Ga0307512_10122530 | 3300030522 | Bacteria | 1664 |
| 480 | Ga0307512_10194430 | 3300030522 | Bacteria | 1112 |
| 481 | Ga0316177_1218167 | 3300030731 | Bacteria | 4116 |
| 482 | Ga0316180_1042311 | 3300030736 | Bacteria | 1857 |
| 483 | Ga0265328_10032104 | 3300031239 | Bacteria | 1950 |
| 484 | Ga0265325_10032446 | 3300031241 | Bacteria | 2788 |
| 485 | Ga0265325_10106737 | 3300031241 | Bacteria | 1365 |
| 486 | Ga0265340_10001093 | 3300031247 | Bacteria | 15451 |
| 487 | Ga0265340_10022337 | 3300031247 | Bacteria | 3236 |
| 488 | Ga0307513_10009283 | 3300031456 | Bacteria | 12456 |
| 489 | Ga0307513_10041702 | 3300031456 | Bacteria | 5062 |
| 490 | Ga0307513_10050922 | 3300031456 | Bacteria | 4472 |
| 491 | Ga0307513_10137819 | 3300031456 | Bacteria | 2372 |
| 492 | Ga0307513_10172230 | 3300031456 | Bacteria | 2041 |
| 493 | Ga0307513_10334956 | 3300031456 | Bacteria | 1266 |
| 494 | Ga0307509_10114201 | 3300031507 | Bacteria | 2696 |
| 495 | Ga0307509_10194428 | 3300031507 | Bacteria | 1875 |
| 496 | Ga0307509_10323583 | 3300031507 | Bacteria | 1277 |
| 497 | Ga0307508_10025316 | 3300031616 | Bacteria | 5381 |
| 498 | Ga0307508_10034034 | 3300031616 | Bacteria | 4594 |
| 499 | Ga0307508_10059987 | 3300031616 | Bacteria | 3365 |
| 500 | Ga0307514_10036163 | 3300031649 | Bacteria | 3926 |
| 501 | Ga0307516_10004524 | 3300031730 | Bacteria | 17104 |
| 502 | Ga0307516_10039117 | 3300031730 | Bacteria | 4729 |
| 503 | Ga0307516_10168782 | 3300031730 | Bacteria | 1930 |
| 504 | Ga0307518_10002222 | 3300031838 | Bacteria | 14195 |
| 505 | Ga0307406_10128974 | 3300031901 | Bacteria | 1772 |
| 506 | Ga0307406_10316184 | 3300031901 | Bacteria | 1206 |
| 507 | Ga0307412_10454898 | 3300031911 | Bacteria | 1056 |
| 508 | Ga0307409_100063046 | 3300031995 | Bacteria | 2905 |
| 509 | Ga0307409_100191285 | 3300031995 | Bacteria | 1822 |
| 510 | Ga0307416_100210103 | 3300032002 | Bacteria | 1855 |
| 511 | Ga0307416_100545317 | 3300032002 | Bacteria | 1232 |
| 512 | Ga0307411_10061392 | 3300032005 | Bacteria | 2502 |
| 513 | Ga0307415_100003294 | 3300032126 | Bacteria | 8206 |
| 514 | Ga0307415_100020631 | 3300032126 | Bacteria | 4028 |
| 515 | Ga0307415_100020659 | 3300032126 | Bacteria | 4026 |
| 516 | Ga0307415_100068988 | 3300032126 | Bacteria | 2477 |
| 517 | Ga0307415_100140199 | 3300032126 | Bacteria | 1845 |
| 518 | Ga0307507_10001339 | 3300033179 | Bacteria | 55047 |
| 519 | Ga0307507_10011987 | 3300033179 | Bacteria | 10817 |
| 520 | Ga0307507_10023117 | 3300033179 | Bacteria | 6838 |
| 521 | Ga0307510_10076367 | 3300033180 | Bacteria | 3296 |
| 522 | Ga0373938_0019920 | 3300034957 | Bacteria | 1346 |
| 523 | Ga0373938_0025286 | 3300034957 | Bacteria | 1235 |
| 524 | Ga0373926_0037031 | 3300035083 | Bacteria | 1735 |
| 525 | Ga0373926_0045484 | 3300035083 | Bacteria | 1573 |
| 526 | Ga0373934_0003787 | 3300035086 | Bacteria | 5570 |
| 527 | Ga0373934_0006867 | 3300035086 | Bacteria | 4224 |
| 528 | Ga0373934_0007109 | 3300035086 | Bacteria | 4154 |
| 529 | Ga0373934_0018329 | 3300035086 | Bacteria | 2678 |
| 530 | Ga0373934_0021597 | 3300035086 | Bacteria | 2479 |
| 531 | Ga0373934_0075049 | 3300035086 | Bacteria | 1355 |
| 532 | Ga0373944_0005495 | 3300035089 | Bacteria | 3340 |
| 533 | Ga0373923_0003800 | 3300035111 | Bacteria | 4907 |
| 534 | Ga0373923_0006352 | 3300035111 | Bacteria | 4080 |
| 535 | Ga0373923_0013540 | 3300035111 | Bacteria | 3042 |
| 536 | Ga0373923_0017924 | 3300035111 | Bacteria | 2716 |
| 537 | Ga0373936_0002364 | 3300035113 | Bacteria | 7061 |
| 538 | Ga0373936_0005328 | 3300035113 | Bacteria | 4842 |
| 539 | Ga0373936_0097494 | 3300035113 | Bacteria | 1238 |
| 540 | Ga0373936_0134464 | 3300035113 | Bacteria | 1064 |
| 541 | Ga0373941_0024311 | 3300035115 | Bacteria | 1739 |
| 542 | Ga0373953_0001265 | 3300035117 | Bacteria | 7224 |
| 543 | Ga0373953_0002362 | 3300035117 | Bacteria | 5689 |
| 544 | Ga0373953_0011249 | 3300035117 | Bacteria | 3137 |
| 545 | Ga0373953_0053361 | 3300035117 | Bacteria | 1638 |
| 546 | Ga0373954_0016471 | 3300035118 | Bacteria | 3309 |
| 547 | Ga0373954_0072629 | 3300035118 | Bacteria | 1636 |
| 548 | Ga0373954_0084502 | 3300035118 | Bacteria | 1519 |
| 549 | Ga0373956_0004289 | 3300035119 | Bacteria | 5732 |
| 550 | Ga0373956_0144324 | 3300035119 | Bacteria | 1118 |
| 551 | Ga0373956_0223206 | 3300035119 | Bacteria | 895 |
| 552 | Ga0373957_0000136 | 3300035120 | Bacteria | 18232 |
| 553 | Ga0373957_0004227 | 3300035120 | Bacteria | 4350 |
| 554 | Ga0373957_0025599 | 3300035120 | Bacteria | 2127 |
| 555 | Ga0373957_0031882 | 3300035120 | Bacteria | 1938 |
| 556 | Ga0373957_0037068 | 3300035120 | Bacteria | 1820 |
| 557 | Ga0373957_0066928 | 3300035120 | Bacteria | 1400 |
| 558 | Ga0373960_0026306 | 3300035121 | Bacteria | 1589 |
| 559 | Ga0373943_0002872 | 3300035170 | Bacteria | 7822 |
| 560 | Ga0373946_0107367 | 3300035171 | Bacteria | 1259 |
| 561 | Ga0373955_0000680 | 3300035172 | Bacteria | 14527 |
| 562 | Ga0373955_0002108 | 3300035172 | Bacteria | 8586 |
| 563 | Ga0373955_0013424 | 3300035172 | Bacteria | 3962 |
| 564 | Ga0373955_0050124 | 3300035172 | Bacteria | 2269 |
| 565 | Ga0373955_0087328 | 3300035172 | Bacteria | 1772 |
| 566 | Ga0373942_0004187 | 3300035207 | Bacteria | 3361 |
| 567 | Ga0373924_0001950 | 3300035410 | Bacteria | 6868 |
| 568 | Ga0373924_0005840 | 3300035410 | Bacteria | 4381 |
| 569 | Ga0373924_0007664 | 3300035410 | Bacteria | 3902 |
| 570 | Ga0373924_0034766 | 3300035410 | Bacteria | 2041 |
| 571 | Ga0373924_0045563 | 3300035410 | Bacteria | 1804 |
| 572 | Ga0373931_0063186 | 3300035691 | Bacteria | 2000 |
| 573 | Ga0373935_0010688 | 3300035692 | Bacteria | 5512 |
| 574 | Ga0373935_0097258 | 3300035692 | Bacteria | 1936 |
| 575 | Ga0373935_0105996 | 3300035692 | Bacteria | 1859 |
| 576 | Ga0373927_0364992 | 3300035695 | Bacteria | 952 |
| 577 | Ga0373933_0000209 | 3300035724 | Bacteria | 38842 |
| 578 | Ga0373933_0015772 | 3300035724 | Bacteria | 4214 |
| 579 | Ga0373933_0018740 | 3300035724 | Bacteria | 3896 |
| 580 | Ga0373933_0019628 | 3300035724 | Bacteria | 3821 |
| 581 | Ga0373933_0036115 | 3300035724 | Bacteria | 2890 |
| 582 | Ga0373933_0251646 | 3300035724 | Bacteria | 1138 |
| 583 | Ga0373947_0067618 | 3300035725 | Bacteria | 2183 |
| 584 | Ga0373947_0070233 | 3300035725 | Bacteria | 2145 |
| 585 | Ga0373947_0142810 | 3300035725 | Bacteria | 1537 |
| 586 | Ga0373937_0003535 | 3300036401 | Bacteria | 13154 |
| 587 | Ga0373937_0010957 | 3300036401 | Bacteria | 7941 |
| 588 | Ga0373937_0011377 | 3300036401 | Bacteria | 7809 |
| 589 | Ga0373937_0027178 | 3300036401 | Bacteria | 5172 |
| 590 | Ga0373937_0048312 | 3300036401 | Bacteria | 3895 |
| 591 | Ga0373937_0068370 | 3300036401 | Bacteria | 3275 |
| 592 | Ga0373937_0077067 | 3300036401 | Bacteria | 3080 |
| 593 | Ga0373937_0112602 | 3300036401 | Bacteria | 2531 |
| 594 | Ga0373937_0120044 | 3300036401 | Bacteria | 2449 |
| 595 | Ga0373925_0000129 | 3300037068 | Bacteria | 80897 |
| 596 | Ga0373925_0009261 | 3300037068 | Bacteria | 7166 |
| 597 | Ga0373925_0016388 | 3300037068 | Bacteria | 5368 |
| 598 | Ga0373925_0021664 | 3300037068 | Bacteria | 4684 |
| 599 | Ga0373925_0030235 | 3300037068 | Bacteria | 3975 |
| 600 | Ga0373925_0039183 | 3300037068 | Bacteria | 3505 |
| 601 | Ga0373925_0046625 | 3300037068 | Bacteria | 3223 |
| 602 | Ga0373925_0056904 | 3300037068 | Bacteria | 2929 |
| 603 | Ga0373925_0113008 | 3300037068 | Bacteria | 2100 |
| 604 | Ga0395900_0265396 | 3300037418 | Bacteria | 1713 |
| 605 | Ga0395898_0186719 | 3300037466 | Bacteria | 1981 |
| 606 | Ga0395898_0205954 | 3300037466 | Bacteria | 1877 |
| 607 | Ga0436364_0464142 | 3300037853 | Bacteria | 2644 |
| 608 | Ga0436364_0923522 | 3300037853 | Bacteria | 137390 |
| 609 | Ga0395901_0039174 | 3300038443 | Bacteria | 4904 |
| 610 | Ga0395901_0144378 | 3300038443 | Bacteria | 2502 |
| 611 | Ga0436365_1218054 | 3300039437 | Bacteria | 5325 |
| 612 | Ga0436363_1288270 | 3300039450 | Bacteria | 3122 |
| 613 | Ga0439436_0000261 | 3300041404 | Bacteria | 12706 |
| 614 | Ga0439439_0004200 | 3300041406 | Bacteria | 3229 |
| 615 | Ga0451789_0766711 | 3300041443 | Bacteria | 1159 |
| 616 | Ga0439433_0000810 | 3300041999 | Bacteria | 6185 |
| 617 | Ga0439442_018316 | 3300042002 | Bacteria | 1448 |
| 618 | Ga0439449_0009770 | 3300042007 | Bacteria | 3630 |
| 619 | Ga0439449_0016973 | 3300042007 | Bacteria | 2733 |
| 620 | Ga0439449_0019898 | 3300042007 | Bacteria | 2516 |
| 621 | Ga0439457_002146 | 3300042014 | Bacteria | 5724 |
| 622 | Ga0439462_0000798 | 3300042015 | Bacteria | 6544 |
| 623 | Ga0466969_0050247 | 3300044656 | Bacteria | 2055 |
| 624 | Ga0466965_0013001 | 3300044683 | Bacteria | 3922 |
| 625 | Ga0466965_0065863 | 3300044683 | Bacteria | 1816 |
| 626 | Ga0466966_0026789 | 3300044684 | Bacteria | 3762 |
| 627 | Ga0466961_0134090 | 3300044693 | Bacteria | 1552 |
| 628 | Ga0466963_0020237 | 3300044694 | Bacteria | 4184 |
| 629 | Ga0466963_0044527 | 3300044694 | Bacteria | 2922 |
| 630 | Ga0466963_0094488 | 3300044694 | Bacteria | 2039 |
| 631 | Ga0466963_0131393 | 3300044694 | Bacteria | 1730 |
| 632 | Ga0466957_0066833 | 3300044842 | Bacteria | 2217 |
| 633 | Ga0466960_0233646 | 3300044901 | Bacteria | 1016 |
| 634 | Ga0466959_0082731 | 3300045049 | Bacteria | 2312 |
| 635 | Ga0466958_0006381 | 3300045836 | Bacteria | 6413 |
| 636 | Ga0466958_0016170 | 3300045836 | Bacteria | 4293 |
| 637 | Ga0466958_0121847 | 3300045836 | Bacteria | 1633 |
| 638 | Ga0466967_0049793 | 3300045976 | Bacteria | 3666 |
| 639 | Ga0466967_0061908 | 3300045976 | Bacteria | 3321 |
| 640 | Ga0466967_0078434 | 3300045976 | Bacteria | 2975 |
| 641 | Ga0466967_0570591 | 3300045976 | Bacteria | 1115 |
| 642 | Ga0495592_0000391 | 3300046454 | Bacteria | 34105 |
| 643 | Ga0495592_0001439 | 3300046454 | Bacteria | 16519 |
| 644 | Ga0495592_0005743 | 3300046454 | Bacteria | 9185 |
| 645 | Ga0495592_0008164 | 3300046454 | Bacteria | 7865 |
| 646 | Ga0495592_0025688 | 3300046454 | Bacteria | 4470 |
| 647 | Ga0495592_0028362 | 3300046454 | Bacteria | 4240 |
| 648 | Ga0495592_0031017 | 3300046454 | Bacteria | 4042 |
| 649 | Ga0495592_0145034 | 3300046454 | Bacteria | 1647 |
| 650 | Ga0495592_0171259 | 3300046454 | Bacteria | 1487 |
| 651 | Ga0495603_0002257 | 3300046455 | Bacteria | 11322 |
| 652 | Ga0495603_0033713 | 3300046455 | Bacteria | 3080 |
| 653 | Ga0495603_0064401 | 3300046455 | Bacteria | 2161 |
| 654 | Ga0495629_0019291 | 3300046459 | Bacteria | 4874 |
| 655 | Ga0495629_0034037 | 3300046459 | Bacteria | 3602 |
| 656 | Ga0495629_0034137 | 3300046459 | Bacteria | 3596 |
| 657 | Ga0495629_0237393 | 3300046459 | Bacteria | 1255 |
| 658 | Ga0495638_0109982 | 3300046460 | Bacteria | 1638 |
| 659 | Ga0495641_0014582 | 3300046461 | Bacteria | 4244 |
| 660 | Ga0495641_0016695 | 3300046461 | Bacteria | 3857 |
| 661 | Ga0495641_0025092 | 3300046461 | Bacteria | 2928 |
| 662 | Ga0495641_0082917 | 3300046461 | Bacteria | 1436 |
| 663 | Ga0495651_0001843 | 3300046462 | Bacteria | 16386 |
| 664 | Ga0495651_0002274 | 3300046462 | Bacteria | 14826 |
| 665 | Ga0495651_0002422 | 3300046462 | Bacteria | 14409 |
| 666 | Ga0495651_0004360 | 3300046462 | Bacteria | 10827 |
| 667 | Ga0495651_0015238 | 3300046462 | Bacteria | 5942 |
| 668 | Ga0495651_0016279 | 3300046462 | Bacteria | 5757 |
| 669 | Ga0495651_0034790 | 3300046462 | Bacteria | 3926 |
| 670 | Ga0495651_0058282 | 3300046462 | Bacteria | 2963 |
| 671 | Ga0495651_0100335 | 3300046462 | Bacteria | 2156 |
| 672 | Ga0495651_0106215 | 3300046462 | Bacteria | 2082 |
| 673 | Ga0495651_0145590 | 3300046462 | Bacteria | 1713 |
| 674 | Ga0495653_0001532 | 3300046463 | Bacteria | 18076 |
| 675 | Ga0495653_0009500 | 3300046463 | Bacteria | 7959 |
| 676 | Ga0495653_0010278 | 3300046463 | Bacteria | 7658 |
| 677 | Ga0495653_0011783 | 3300046463 | Bacteria | 7141 |
| 678 | Ga0495653_0018487 | 3300046463 | Bacteria | 5658 |
| 679 | Ga0495653_0021818 | 3300046463 | Bacteria | 5183 |
| 680 | Ga0495653_0024137 | 3300046463 | Bacteria | 4904 |
| 681 | Ga0495653_0052908 | 3300046463 | Bacteria | 3109 |
| 682 | Ga0495653_0054519 | 3300046463 | Bacteria | 3054 |
| 683 | Ga0495653_0214292 | 3300046463 | Bacteria | 1299 |
| 684 | Ga0495653_0230871 | 3300046463 | Bacteria | 1238 |
| 685 | Ga0495653_0241495 | 3300046463 | Bacteria | 1204 |
| 686 | Ga0495653_0258795 | 3300046463 | Bacteria | 1151 |
| 687 | Ga0495580_0038011 | 3300046472 | Bacteria | 3451 |
| 688 | Ga0495582_0007389 | 3300046473 | Bacteria | 6085 |
| 689 | Ga0495582_0016023 | 3300046473 | Bacteria | 4109 |
| 690 | Ga0495639_0008424 | 3300046475 | Bacteria | 4422 |
| 691 | Ga0495639_0012095 | 3300046475 | Bacteria | 3720 |
| 692 | Ga0495662_0008206 | 3300046476 | Bacteria | 5145 |
| 693 | Ga0495662_0011481 | 3300046476 | Bacteria | 4328 |
| 694 | Ga0495662_0017538 | 3300046476 | Bacteria | 3464 |
| 695 | Ga0495662_0040131 | 3300046476 | Bacteria | 2260 |
| 696 | Ga0495662_0093604 | 3300046476 | Bacteria | 1467 |
| 697 | Ga0495662_0109620 | 3300046476 | Bacteria | 1352 |
| 698 | Ga0495664_0013432 | 3300046477 | Bacteria | 4644 |
| 699 | Ga0495664_0013727 | 3300046477 | Bacteria | 4593 |
| 700 | Ga0495664_0032113 | 3300046477 | Bacteria | 3079 |
| 701 | Ga0495664_0038780 | 3300046477 | Bacteria | 2813 |
| 702 | Ga0495664_0070846 | 3300046477 | Bacteria | 2082 |
| 703 | Ga0495664_0080913 | 3300046477 | Bacteria | 1947 |
| 704 | Ga0495608_0000254 | 3300046511 | Bacteria | 38679 |
| 705 | Ga0495608_0000389 | 3300046511 | Bacteria | 30638 |
| 706 | Ga0495608_0002992 | 3300046511 | Bacteria | 12074 |
| 707 | Ga0495608_0008471 | 3300046511 | Bacteria | 7204 |
| 708 | Ga0495608_0009469 | 3300046511 | Bacteria | 6805 |
| 709 | Ga0495608_0015867 | 3300046511 | Bacteria | 5212 |
| 710 | Ga0495608_0022442 | 3300046511 | Bacteria | 4326 |
| 711 | Ga0495608_0030702 | 3300046511 | Bacteria | 3637 |
| 712 | Ga0495608_0032375 | 3300046511 | Bacteria | 3534 |
| 713 | Ga0495608_0048388 | 3300046511 | Bacteria | 2825 |
| 714 | Ga0495608_0178643 | 3300046511 | Bacteria | 1344 |
| 715 | Ga0495618_0046601 | 3300046514 | Bacteria | 2736 |
| 716 | Ga0495618_0056682 | 3300046514 | Bacteria | 2480 |
| 717 | Ga0495618_0086158 | 3300046514 | Bacteria | 2008 |
| 718 | Ga0495618_0128720 | 3300046514 | Bacteria | 1620 |
| 719 | Ga0495628_0004505 | 3300046516 | Bacteria | 12343 |
| 720 | Ga0495628_0010905 | 3300046516 | Bacteria | 7694 |
| 721 | Ga0495628_0020937 | 3300046516 | Bacteria | 5386 |
| 722 | Ga0495628_0025630 | 3300046516 | Bacteria | 4817 |
| 723 | Ga0495628_0037960 | 3300046516 | Bacteria | 3859 |
| 724 | Ga0495628_0041095 | 3300046516 | Bacteria | 3692 |
| 725 | Ga0495628_0114832 | 3300046516 | Bacteria | 2068 |
| 726 | Ga0495628_0423725 | 3300046516 | Bacteria | 969 |
| 727 | Ga0495630_0000522 | 3300046517 | Bacteria | 28354 |
| 728 | Ga0495630_0009915 | 3300046517 | Bacteria | 6860 |
| 729 | Ga0495630_0041846 | 3300046517 | Bacteria | 3421 |
| 730 | Ga0495630_0042145 | 3300046517 | Bacteria | 3409 |
| 731 | Ga0495630_0080161 | 3300046517 | Bacteria | 2462 |
| 732 | Ga0495630_0091972 | 3300046517 | Bacteria | 2292 |
| 733 | Ga0495666_0033325 | 3300046526 | Bacteria | 2516 |
| 734 | Ga0495666_0084109 | 3300046526 | Bacteria | 1503 |
| 735 | Ga0495652_0003494 | 3300046529 | Bacteria | 15476 |
| 736 | Ga0495652_0004326 | 3300046529 | Bacteria | 13599 |
| 737 | Ga0495652_0010063 | 3300046529 | Bacteria | 8574 |
| 738 | Ga0495652_0012624 | 3300046529 | Bacteria | 7613 |
| 739 | Ga0495652_0024106 | 3300046529 | Bacteria | 5388 |
| 740 | Ga0495652_0029386 | 3300046529 | Bacteria | 4829 |
| 741 | Ga0495652_0043908 | 3300046529 | Bacteria | 3850 |
| 742 | Ga0495652_0073253 | 3300046529 | Bacteria | 2852 |
| 743 | Ga0495652_0107791 | 3300046529 | Bacteria | 2247 |
| 744 | Ga0495665_0003779 | 3300046531 | Bacteria | 8192 |
| 745 | Ga0495665_0016598 | 3300046531 | Bacteria | 3966 |
| 746 | Ga0495665_0036610 | 3300046531 | Bacteria | 2619 |
| 747 | Ga0495640_0007107 | 3300046533 | Bacteria | 8808 |
| 748 | Ga0495640_0014265 | 3300046533 | Bacteria | 6019 |
| 749 | Ga0495640_0014380 | 3300046533 | Bacteria | 5992 |
| 750 | Ga0495640_0033695 | 3300046533 | Bacteria | 3637 |
| 751 | Ga0495640_0108121 | 3300046533 | Bacteria | 1819 |
| 752 | Ga0495587_0000226 | 3300046536 | Bacteria | 42072 |
| 753 | Ga0495587_0004967 | 3300046536 | Bacteria | 8710 |
| 754 | Ga0495587_0006385 | 3300046536 | Bacteria | 7688 |
| 755 | Ga0495587_0007459 | 3300046536 | Bacteria | 7084 |
| 756 | Ga0495587_0009731 | 3300046536 | Bacteria | 6146 |
| 757 | Ga0495587_0028382 | 3300046536 | Bacteria | 3402 |
| 758 | Ga0495587_0032803 | 3300046536 | Bacteria | 3137 |
| 759 | Ga0495587_0083330 | 3300046536 | Bacteria | 1852 |
| 760 | Ga0495587_0169309 | 3300046536 | Bacteria | 1241 |
| 761 | Ga0495645_0000853 | 3300046543 | Bacteria | 20756 |
| 762 | Ga0495645_0019458 | 3300046543 | Bacteria | 4887 |
| 763 | Ga0495645_0024527 | 3300046543 | Bacteria | 4377 |
| 764 | Ga0495645_0051667 | 3300046543 | Bacteria | 2990 |
| 765 | Ga0495645_0051712 | 3300046543 | Bacteria | 2989 |
| 766 | Ga0495645_0066773 | 3300046543 | Bacteria | 2598 |
| 767 | Ga0495667_0000242 | 3300046559 | Bacteria | 35503 |
| 768 | Ga0495667_0001647 | 3300046559 | Bacteria | 14797 |
| 769 | Ga0495667_0003869 | 3300046559 | Bacteria | 10042 |
| 770 | Ga0495667_0006100 | 3300046559 | Bacteria | 8158 |
| 771 | Ga0495667_0006514 | 3300046559 | Bacteria | 7927 |
| 772 | Ga0495667_0010343 | 3300046559 | Bacteria | 6312 |
| 773 | Ga0495667_0031145 | 3300046559 | Bacteria | 3581 |
| 774 | Ga0495667_0046101 | 3300046559 | Bacteria | 2883 |
| 775 | Ga0495667_0164027 | 3300046559 | Bacteria | 1428 |
| 776 | Ga0495634_0004479 | 3300046642 | Bacteria | 10961 |
| 777 | Ga0495634_0008157 | 3300046642 | Bacteria | 7803 |
| 778 | Ga0495634_0012920 | 3300046642 | Bacteria | 6041 |
| 779 | Ga0495634_0014732 | 3300046642 | Bacteria | 5626 |
| 780 | Ga0495634_0018630 | 3300046642 | Bacteria | 4939 |
| 781 | Ga0495634_0034352 | 3300046642 | Bacteria | 3480 |
| 782 | Ga0495634_0039641 | 3300046642 | Bacteria | 3207 |
| 783 | Ga0495634_0075709 | 3300046642 | Bacteria | 2210 |
| 784 | Ga0495635_0000192 | 3300046663 | Bacteria | 38696 |
| 785 | Ga0495635_0002786 | 3300046663 | Bacteria | 11980 |
| 786 | Ga0495635_0003166 | 3300046663 | Bacteria | 11338 |
| 787 | Ga0495635_0003546 | 3300046663 | Bacteria | 10800 |
| 788 | Ga0495635_0009402 | 3300046663 | Bacteria | 6835 |
| 789 | Ga0495635_0009954 | 3300046663 | Bacteria | 6645 |
| 790 | Ga0495635_0011105 | 3300046663 | Bacteria | 6313 |
| 791 | Ga0495635_0031531 | 3300046663 | Bacteria | 3679 |
| 792 | Ga0495635_0050428 | 3300046663 | Bacteria | 2868 |
| 793 | Ga0495635_0162915 | 3300046663 | Bacteria | 1517 |
| 794 | Ga0495657_0000442 | 3300046675 | Bacteria | 38839 |
| 795 | Ga0495657_0003088 | 3300046675 | Bacteria | 13749 |
| 796 | Ga0495657_0005359 | 3300046675 | Bacteria | 10144 |
| 797 | Ga0495657_0009671 | 3300046675 | Bacteria | 7294 |
| 798 | Ga0495657_0019075 | 3300046675 | Bacteria | 4953 |
| 799 | Ga0495657_0019391 | 3300046675 | Bacteria | 4906 |
| 800 | Ga0495657_0020525 | 3300046675 | Bacteria | 4748 |
| 801 | Ga0495657_0039576 | 3300046675 | Bacteria | 3238 |
| 802 | Ga0495657_0158215 | 3300046675 | Bacteria | 1403 |
| 803 | Ga0495657_0163460 | 3300046675 | Bacteria | 1376 |
| 804 | Ga0495657_0229832 | 3300046675 | Bacteria | 1122 |
| 805 | Ga0495599_0000265 | 3300046678 | Bacteria | 33014 |
| 806 | Ga0495599_0000335 | 3300046678 | Bacteria | 28036 |
| 807 | Ga0495599_0002415 | 3300046678 | Bacteria | 10872 |
| 808 | Ga0495599_0003128 | 3300046678 | Bacteria | 9648 |
| 809 | Ga0495599_0008728 | 3300046678 | Bacteria | 6173 |
| 810 | Ga0495599_0030100 | 3300046678 | Bacteria | 3404 |
| 811 | Ga0495599_0040022 | 3300046678 | Bacteria | 2944 |
| 812 | Ga0495599_0041636 | 3300046678 | Bacteria | 2883 |
| 813 | Ga0495599_0094356 | 3300046678 | Bacteria | 1866 |
| 814 | Ga0495623_0000092 | 3300046679 | Bacteria | 53461 |
| 815 | Ga0495623_0002870 | 3300046679 | Bacteria | 11368 |
| 816 | Ga0495623_0006282 | 3300046679 | Bacteria | 7724 |
| 817 | Ga0495623_0016057 | 3300046679 | Bacteria | 4838 |
| 818 | Ga0495623_0027261 | 3300046679 | Bacteria | 3674 |
| 819 | Ga0495623_0053854 | 3300046679 | Bacteria | 2540 |
| 820 | Ga0495623_0065425 | 3300046679 | Bacteria | 2273 |
| 821 | Ga0495623_0075235 | 3300046679 | Bacteria | 2097 |
| 822 | Ga0495646_0000041 | 3300046680 | Bacteria | 69554 |
| 823 | Ga0495646_0007331 | 3300046680 | Bacteria | 7007 |
| 824 | Ga0495646_0010831 | 3300046680 | Bacteria | 5793 |
| 825 | Ga0495646_0027256 | 3300046680 | Bacteria | 3584 |
| 826 | Ga0495646_0040576 | 3300046680 | Bacteria | 2865 |
| 827 | Ga0495646_0051885 | 3300046680 | Bacteria | 2480 |
| 828 | Ga0495646_0090256 | 3300046680 | Bacteria | 1771 |
| 829 | Ga0495647_0086678 | 3300046681 | Bacteria | 1277 |
| 830 | Ga0495658_0010418 | 3300046683 | Bacteria | 4652 |
| 831 | Ga0495658_0017260 | 3300046683 | Bacteria | 3726 |
| 832 | Ga0495658_0116503 | 3300046683 | Bacteria | 1611 |
| 833 | Ga0495613_0002022 | 3300046689 | Bacteria | 15403 |
| 834 | Ga0495613_0003981 | 3300046689 | Bacteria | 11053 |
| 835 | Ga0495613_0005750 | 3300046689 | Bacteria | 9288 |
| 836 | Ga0495613_0011808 | 3300046689 | Bacteria | 6487 |
| 837 | Ga0495613_0044725 | 3300046689 | Bacteria | 3275 |
| 838 | Ga0495613_0067448 | 3300046689 | Bacteria | 2611 |
| 839 | Ga0495613_0109635 | 3300046689 | Bacteria | 1990 |
| 840 | Ga0495613_0130571 | 3300046689 | Bacteria | 1799 |
| 841 | Ga0495624_0007464 | 3300046690 | Bacteria | 7673 |
| 842 | Ga0495624_0021429 | 3300046690 | Bacteria | 4285 |
| 843 | Ga0495624_0112167 | 3300046690 | Bacteria | 1676 |
| 844 | Ga0495600_0000204 | 3300046809 | Bacteria | 34212 |
| 845 | Ga0495600_0006275 | 3300046809 | Bacteria | 7221 |
| 846 | Ga0495600_0007430 | 3300046809 | Bacteria | 6704 |
| 847 | Ga0495600_0007614 | 3300046809 | Bacteria | 6634 |
| 848 | Ga0495600_0011921 | 3300046809 | Bacteria | 5430 |
| 849 | Ga0495600_0014774 | 3300046809 | Bacteria | 4924 |
| 850 | Ga0495600_0024824 | 3300046809 | Bacteria | 3859 |
| 851 | Ga0495600_0025766 | 3300046809 | Bacteria | 3790 |
| 852 | Ga0495600_0039970 | 3300046809 | Bacteria | 3054 |
| 853 | Ga0495600_0099688 | 3300046809 | Bacteria | 1894 |
| 854 | Ga0495600_0112269 | 3300046809 | Bacteria | 1775 |
| 855 | Ga0495600_0209516 | 3300046809 | Bacteria | 1249 |
| 856 | Ga0495581_0017358 | 3300047315 | Bacteria | 4179 |
| 857 | Ga0495581_0025667 | 3300047315 | Bacteria | 3416 |
| 858 | Ga0495581_0047452 | 3300047315 | Bacteria | 2482 |
| 859 | Ga0495581_0054848 | 3300047315 | Bacteria | 2301 |
| 860 | Ga0495604_0000408 | 3300047317 | Bacteria | 38733 |
| 861 | Ga0495604_0000411 | 3300047317 | Bacteria | 38665 |
| 862 | Ga0495604_0009302 | 3300047317 | Bacteria | 7780 |
| 863 | Ga0495604_0011000 | 3300047317 | Bacteria | 7184 |
| 864 | Ga0495604_0012095 | 3300047317 | Bacteria | 6862 |
| 865 | Ga0495604_0012809 | 3300047317 | Bacteria | 6678 |
| 866 | Ga0495604_0042736 | 3300047317 | Bacteria | 3550 |
| 867 | Ga0495604_0057694 | 3300047317 | Bacteria | 2984 |
| 868 | Ga0495604_0070257 | 3300047317 | Bacteria | 2652 |
| 869 | Ga0495604_0088769 | 3300047317 | Bacteria | 2299 |
| 870 | Ga0495674_0000227 | 3300047319 | Bacteria | 47115 |
| 871 | Ga0495674_0003012 | 3300047319 | Bacteria | 16410 |
| 872 | Ga0495674_0005317 | 3300047319 | Bacteria | 12351 |
| 873 | Ga0495674_0024389 | 3300047319 | Bacteria | 5557 |
| 874 | Ga0495674_0030341 | 3300047319 | Bacteria | 4917 |
| 875 | Ga0495674_0032222 | 3300047319 | Bacteria | 4755 |
| 876 | Ga0495674_0055287 | 3300047319 | Bacteria | 3482 |
| 877 | Ga0495674_0061326 | 3300047319 | Bacteria | 3278 |
| 878 | Ga0495674_0073735 | 3300047319 | Bacteria | 2941 |
| 879 | Ga0495674_0181348 | 3300047319 | Bacteria | 1753 |
| 880 | Ga0495676_0052073 | 3300047321 | Bacteria | 3270 |
| 881 | Ga0495676_0056671 | 3300047321 | Bacteria | 3097 |
| 882 | Ga0495680_0001998 | 3300047322 | Bacteria | 21409 |
| 883 | Ga0495680_0003785 | 3300047322 | Bacteria | 14709 |
| 884 | Ga0495680_0008382 | 3300047322 | Bacteria | 9400 |
| 885 | Ga0495680_0011107 | 3300047322 | Bacteria | 7994 |
| 886 | Ga0495680_0012319 | 3300047322 | Bacteria | 7532 |
| 887 | Ga0495680_0017482 | 3300047322 | Bacteria | 6122 |
| 888 | Ga0495680_0024379 | 3300047322 | Bacteria | 5018 |
| 889 | Ga0495680_0043984 | 3300047322 | Bacteria | 3533 |
| 890 | Ga0495680_0047808 | 3300047322 | Bacteria | 3363 |
| 891 | Ga0495680_0148067 | 3300047322 | Bacteria | 1713 |
| 892 | Ga0495680_0297644 | 3300047322 | Bacteria | 1133 |
| 893 | Ga0495675_0000136 | 3300047444 | Bacteria | 51368 |
| 894 | Ga0495675_0001364 | 3300047444 | Bacteria | 14789 |
| 895 | Ga0495675_0001590 | 3300047444 | Bacteria | 13674 |
| 896 | Ga0495675_0013655 | 3300047444 | Bacteria | 5131 |
| 897 | Ga0495675_0021536 | 3300047444 | Bacteria | 4105 |
| 898 | Ga0495675_0107046 | 3300047444 | Bacteria | 1747 |
| 899 | Ga0495684_0000323 | 3300047471 | Bacteria | 38826 |
| 900 | Ga0495684_0003230 | 3300047471 | Bacteria | 12792 |
| 901 | Ga0495684_0005492 | 3300047471 | Bacteria | 9866 |
| 902 | Ga0495684_0008869 | 3300047471 | Bacteria | 7769 |
| 903 | Ga0495684_0023744 | 3300047471 | Bacteria | 4715 |
| 904 | Ga0495684_0024646 | 3300047471 | Bacteria | 4629 |
| 905 | Ga0495684_0038008 | 3300047471 | Bacteria | 3692 |
| 906 | Ga0495684_0079076 | 3300047471 | Bacteria | 2496 |
| 907 | Ga0495684_0087353 | 3300047471 | Bacteria | 2363 |
| 908 | Ga0495684_0310933 | 3300047471 | Bacteria | 1129 |
| 909 | Ga0495593_0008890 | 3300047673 | Bacteria | 5829 |
| 910 | Ga0495593_0044129 | 3300047673 | Bacteria | 2386 |
| 911 | Ga0495602_0000528 | 3300048088 | Bacteria | 35647 |
| 912 | Ga0495602_0002901 | 3300048088 | Bacteria | 17579 |
| 913 | Ga0495602_0003747 | 3300048088 | Bacteria | 15784 |
| 914 | Ga0495602_0004327 | 3300048088 | Bacteria | 14798 |
| 915 | Ga0495602_0007841 | 3300048088 | Bacteria | 11165 |
| 916 | Ga0495602_0013999 | 3300048088 | Bacteria | 8165 |
| 917 | Ga0495602_0061569 | 3300048088 | Bacteria | 3262 |
| 918 | Ga0495602_0071419 | 3300048088 | Bacteria | 2964 |
| 919 | Ga0495602_0099009 | 3300048088 | Bacteria | 2398 |
| 920 | Ga0495602_0104372 | 3300048088 | Bacteria | 2319 |
| 921 | Ga0495602_0155734 | 3300048088 | Bacteria | 1789 |
| 922 | Ga0495602_0202318 | 3300048088 | Bacteria | 1514 |
| 923 | Ga0495614_0012804 | 3300048089 | Bacteria | 3681 |
| 924 | Ga0496102_0047302 | 3300048905 | Bacteria | 3908 |
| 925 | Ga0496102_0059595 | 3300048905 | Bacteria | 3491 |
| 926 | Ga0496102_0405958 | 3300048905 | Bacteria | 1280 |
| 927 | Ga0496103_0026797 | 3300048906 | Bacteria | 3489 |
| 928 | Ga0496103_0038074 | 3300048906 | Bacteria | 2949 |
| 929 | Ga0496103_0315855 | 3300048906 | Bacteria | 1005 |
| 930 | Ga0496104_0004436 | 3300048907 | Bacteria | 12216 |
| 931 | Ga0496104_0052341 | 3300048907 | Bacteria | 3856 |
| 932 | Ga0496104_0071069 | 3300048907 | Bacteria | 3309 |
| 933 | Ga0496104_0159841 | 3300048907 | Bacteria | 2161 |
| 934 | Ga0496104_0186784 | 3300048907 | Bacteria | 1983 |
| 935 | Ga0496104_0256474 | 3300048907 | Bacteria | 1661 |
| 936 | Ga0496104_0414364 | 3300048907 | Bacteria | 1259 |
| 937 | Ga0496105_0004641 | 3300048908 | Bacteria | 10357 |
| 938 | Ga0496105_0011305 | 3300048908 | Bacteria | 7049 |
| 939 | Ga0496105_0020726 | 3300048908 | Bacteria | 5314 |
| 940 | Ga0496105_0032338 | 3300048908 | Bacteria | 4292 |
| 941 | Ga0496105_0124787 | 3300048908 | Bacteria | 2122 |
| 942 | Ga0496105_0151271 | 3300048908 | Bacteria | 1907 |
| 943 | Ga0496106_0057493 | 3300048909 | Bacteria | 2941 |
| 944 | Ga0496106_0186462 | 3300048909 | Bacteria | 1648 |
| 945 | Ga0496106_0225240 | 3300048909 | Bacteria | 1496 |
| 946 | Ga0496107_0060917 | 3300048910 | Bacteria | 2732 |
| 947 | Ga0496108_0000044 | 3300048911 | Bacteria | 139925 |
| 948 | Ga0496108_0030067 | 3300048911 | Bacteria | 4503 |
| 949 | Ga0496108_0128643 | 3300048911 | Bacteria | 2176 |
| 950 | Ga0496108_0181565 | 3300048911 | Bacteria | 1822 |
| 951 | Ga0496108_0209141 | 3300048911 | Bacteria | 1693 |
| 952 | Ga0496109_0018593 | 3300048912 | Bacteria | 6105 |
| 953 | Ga0496109_0021728 | 3300048912 | Bacteria | 5679 |
| 954 | Ga0496109_0054070 | 3300048912 | Bacteria | 3664 |
| 955 | Ga0496109_0071825 | 3300048912 | Bacteria | 3179 |
| 956 | Ga0496109_0076187 | 3300048912 | Bacteria | 3085 |
| 957 | Ga0496109_0085976 | 3300048912 | Bacteria | 2904 |
| 958 | Ga0496109_0278402 | 3300048912 | Bacteria | 1577 |
| 959 | Ga0496110_0011075 | 3300048913 | Bacteria | 7364 |
| 960 | Ga0496110_0011129 | 3300048913 | Bacteria | 7348 |
| 961 | Ga0496110_0027338 | 3300048913 | Bacteria | 4890 |
| 962 | Ga0496110_0064584 | 3300048913 | Bacteria | 3235 |
| 963 | Ga0496110_0237800 | 3300048913 | Bacteria | 1657 |
| 964 | Ga0496111_0017668 | 3300048914 | Bacteria | 4932 |
| 965 | Ga0496111_0028076 | 3300048914 | Bacteria | 3986 |
| 966 | Ga0496112_0018822 | 3300048915 | Bacteria | 6508 |
| 967 | Ga0496112_0021596 | 3300048915 | Bacteria | 6123 |
| 968 | Ga0496112_0126215 | 3300048915 | Bacteria | 2529 |
| 969 | Ga0496112_0490879 | 3300048915 | Bacteria | 1164 |
| 970 | Ga0496113_0049205 | 3300048916 | Bacteria | 3138 |
| 971 | Ga0496113_0052433 | 3300048916 | Bacteria | 3046 |
| 972 | Ga0496113_0100203 | 3300048916 | Bacteria | 2244 |
| 973 | Ga0496114_0001749 | 3300048917 | Bacteria | 16473 |
| 974 | Ga0496114_0083569 | 3300048917 | Bacteria | 2702 |
| 975 | Ga0496114_0124898 | 3300048917 | Bacteria | 2217 |
| 976 | Ga0496114_0170613 | 3300048917 | Bacteria | 1896 |
| 977 | Ga0496115_0020308 | 3300048918 | Bacteria | 5124 |
| 978 | Ga0496115_0029369 | 3300048918 | Bacteria | 4318 |
| 979 | Ga0496115_0285036 | 3300048918 | Bacteria | 1356 |
| 980 | Ga0496115_0320221 | 3300048918 | Bacteria | 1268 |
| 981 | Ga0496115_0613218 | 3300048918 | Bacteria | 864 |
| 982 | Ga0496126_0039778 | 3300048929 | Bacteria | 4361 |
| 983 | Ga0496126_0048526 | 3300048929 | Bacteria | 3879 |
| 984 | Ga0496126_0123367 | 3300048929 | Bacteria | 2244 |
| 985 | Ga0496126_0187950 | 3300048929 | Bacteria | 1751 |
| 986 | Ga0501032_0039247 | 3300049569 | Bacteria | 3221 |
| 987 | Ga0501033_0084683 | 3300049570 | Bacteria | 2323 |
| 988 | Ga0501034_0138405 | 3300049571 | Bacteria | 2415 |
| 989 | Ga0501034_0173303 | 3300049571 | Bacteria | 2124 |
| 990 | Ga0501036_0008710 | 3300049572 | Bacteria | 8322 |
| 991 | Ga0501036_0411231 | 3300049572 | Bacteria | 1128 |
| 992 | Ga0501037_0013074 | 3300049573 | Bacteria | 6119 |
| 993 | Ga0501038_0004356 | 3300049574 | Bacteria | 13173 |
| 994 | Ga0501039_0002568 | 3300049575 | Bacteria | 13557 |
| 995 | Ga0501039_0259265 | 3300049575 | Bacteria | 1366 |
| 996 | Ga0501040_0000638 | 3300049576 | Bacteria | 21462 |
| 997 | Ga0501040_0022595 | 3300049576 | Bacteria | 4212 |
| 998 | Ga0501041_0004180 | 3300049577 | Bacteria | 8358 |
| 999 | Ga0501041_0071913 | 3300049577 | Bacteria | 2124 |
| 1000 | Ga0501041_0142013 | 3300049577 | Bacteria | 1497 |
| 1001 | Ga0501042_0001542 | 3300049578 | Bacteria | 13649 |
| 1002 | Ga0501042_0106009 | 3300049578 | Bacteria | 2023 |
| 1003 | Ga0501046_0003943 | 3300049580 | Bacteria | 13554 |
| 1004 | Ga0501047_0043348 | 3300049581 | Bacteria | 4346 |
| 1005 | Ga0501048_0001512 | 3300049582 | Bacteria | 17604 |
| 1006 | Ga0501068_0010652 | 3300049584 | Bacteria | 5172 |
| 1007 | Ga0501068_0264839 | 3300049584 | Bacteria | 1097 |
| 1008 | Ga0501071_0058661 | 3300049587 | Bacteria | 2783 |
| 1009 | Ga0501071_0062261 | 3300049587 | Bacteria | 2703 |
| 1010 | Ga0501071_0123166 | 3300049587 | Bacteria | 1923 |
| 1011 | Ga0501072_0007652 | 3300049588 | Bacteria | 8199 |
| 1012 | Ga0501072_0018337 | 3300049588 | Bacteria | 5387 |
| 1013 | Ga0501072_0039543 | 3300049588 | Bacteria | 3703 |
| 1014 | Ga0501072_0102642 | 3300049588 | Bacteria | 2273 |
| 1015 | Ga0501073_0099807 | 3300049589 | Bacteria | 2016 |
| 1016 | Ga0501074_0003243 | 3300049590 | Bacteria | 11494 |
| 1017 | Ga0501075_0000277 | 3300049591 | Bacteria | 28298 |
| 1018 | Ga0501075_0112324 | 3300049591 | Bacteria | 2072 |
| 1019 | Ga0501075_0158872 | 3300049591 | Bacteria | 1724 |
| 1020 | Ga0501076_0001433 | 3300049592 | Bacteria | 16010 |
| 1021 | Ga0501077_0023553 | 3300049593 | Bacteria | 3904 |
| 1022 | Ga0501077_0088993 | 3300049593 | Bacteria | 1957 |
| 1023 | Ga0501079_0001955 | 3300049741 | Bacteria | 14761 |
| 1024 | Ga0501079_0102944 | 3300049741 | Bacteria | 2214 |
| 1025 | Ga0501080_0095107 | 3300049742 | Bacteria | 2767 |
| 1026 | Ga0501081_0001720 | 3300049743 | Bacteria | 13589 |
| 1027 | Ga0501045_0001662 | 3300049824 | Bacteria | 14952 |
| 1028 | Ga0501045_0112994 | 3300049824 | Bacteria | 2014 |
| 1029 | nmdc:mga03683_5897_c1 | 3300050489 | Bacteria | 2392 |
| 1030 | nmdc:mga03n38_172076_c1 | 3300050490 | Bacteria | 1104 |
| 1031 | nmdc:mga00v17_133201_c1 | 3300050491 | Bacteria | 1590 |
| 1032 | nmdc:mga00v17_160253_c1 | 3300050491 | Bacteria | 1448 |
| 1033 | nmdc:mga0yw44_122806_c1 | 3300050492 | Bacteria | 1674 |
| 1034 | nmdc:mga0yw44_187344_c1 | 3300050492 | Bacteria | 1364 |
| 1035 | nmdc:mga0yw44_214514_c1 | 3300050492 | Bacteria | 1274 |
| 1036 | nmdc:mga0yw44_24073_c1 | 3300050492 | Bacteria | 3440 |
| 1037 | nmdc:mga0yw44_4224_c1 | 3300050492 | Bacteria | 6542 |
| 1038 | nmdc:mga0yw44_51877_c1 | 3300050492 | Bacteria | 2485 |
| 1039 | nmdc:mga0yw44_72649_c1 | 3300050492 | Bacteria | 2139 |
| 1040 | nmdc:mga06z11_15296_c1 | 3300050494 | Bacteria | 3422 |
| 1041 | nmdc:mga07m45_13133_c1 | 3300050496 | Bacteria | 4386 |
| 1042 | nmdc:mga05p37_1301_c1 | 3300050507 | Bacteria | 29028 |
| 1043 | nmdc:mga05p37_17636_c1 | 3300050507 | Bacteria | 8616 |
| 1044 | nmdc:mga05p37_265356_c1 | 3300050507 | Bacteria | 2053 |
| 1045 | nmdc:mga05p37_27313_c1 | 3300050507 | Bacteria | 6949 |
| 1046 | nmdc:mga05p37_314410_c1 | 3300050507 | Bacteria | 1856 |
| 1047 | nmdc:mga09592_24814_c1 | 3300050508 | Bacteria | 4957 |
| 1048 | nmdc:mga09592_464738_c1 | 3300050508 | Bacteria | 1091 |
| 1049 | nmdc:mga0qj67_276237_c1 | 3300050509 | Bacteria | 1362 |
| 1050 | nmdc:mga0qj67_374893_c1 | 3300050509 | Bacteria | 1149 |
| 1051 | nmdc:mga06r32_187681_c1 | 3300050510 | Bacteria | 2054 |
| 1052 | nmdc:mga06r32_3234_c1 | 3300050510 | Bacteria | 14574 |
| 1053 | nmdc:mga06r32_492819_c1 | 3300050510 | Bacteria | 1203 |
| 1054 | nmdc:mga06r32_763465_c1 | 3300050510 | Bacteria | 929 |
| 1055 | nmdc:mga08y16_58173_c1 | 3300050511 | Bacteria | 4039 |
| 1056 | nmdc:mga08y16_68628_c1 | 3300050511 | Bacteria | 3696 |
| 1057 | nmdc:mga0n895_156016_c1 | 3300050512 | Bacteria | 2313 |
| 1058 | nmdc:mga0n895_200270_c1 | 3300050512 | Bacteria | 2028 |
| 1059 | nmdc:mga0n895_492854_c1 | 3300050512 | Bacteria | 1235 |
| 1060 | nmdc:mga08x19_12714_c1 | 3300050514 | Bacteria | 5076 |
| 1061 | Ga0495601_0007723 | 3300053077 | Bacteria | 6323 |
| 1062 | Ga0495601_0027150 | 3300053077 | Bacteria | 3539 |
| 1063 | Ga0495601_0055859 | 3300053077 | Bacteria | 2500 |
| 1064 | Ga0495601_0057977 | 3300053077 | Bacteria | 2453 |
| 1065 | Ga0495601_0063250 | 3300053077 | Bacteria | 2352 |
| 1066 | Ga0495612_0002340 | 3300053078 | Bacteria | 7810 |
| 1067 | Ga0495612_0026559 | 3300053078 | Bacteria | 2327 |
| 1068 | Ga0495612_0031027 | 3300053078 | Bacteria | 2154 |
| 1069 | Ga0495612_0052743 | 3300053078 | Bacteria | 1674 |
| 1070 | Ga0495595_0000861 | 3300053084 | Bacteria | 11656 |
| 1071 | Ga0495595_0044956 | 3300053084 | Bacteria | 2030 |
| 1072 | Ga0495619_0002260 | 3300053085 | Bacteria | 12724 |
| 1073 | Ga0495619_0016253 | 3300053085 | Bacteria | 4711 |
| 1074 | Ga0495619_0022429 | 3300053085 | Bacteria | 4041 |
| 1075 | Ga0495619_0024254 | 3300053085 | Bacteria | 3890 |
| 1076 | Ga0495619_0099169 | 3300053085 | Bacteria | 1981 |
| 1077 | Ga0495619_0112386 | 3300053085 | Bacteria | 1862 |
| 1078 | Ga0495619_0197012 | 3300053085 | Bacteria | 1395 |
| 1079 | Ga0495619_0241774 | 3300053085 | Bacteria | 1251 |
| 1080 | Ga0500578_0006866 | 3300053086 | Bacteria | 7554 |
| 1081 | Ga0500644_0019789 | 3300053088 | Bacteria | 1992 |
| 1082 | Ga0500646_0000384 | 3300053090 | Bacteria | 13266 |
| 1083 | Ga0500641_0038611 | 3300053096 | Bacteria | 1920 |
| 1084 | Ga0500650_0090131 | 3300053098 | Bacteria | 1435 |
| 1085 | Ga0500553_018407 | 3300053101 | Bacteria | 3539 |
| 1086 | Ga0500554_032619 | 3300053102 | Bacteria | 1547 |
| 1087 | Ga0500560_061254 | 3300053107 | Bacteria | 1227 |
| 1088 | Ga0500593_000263 | 3300053117 | Bacteria | 21458 |
| 1089 | Ga0500594_0036492 | 3300053118 | Bacteria | 1323 |
| 1090 | Ga0500652_024316 | 3300053131 | Bacteria | 2312 |
| 1091 | Ga0500577_0000812 | 3300053142 | Bacteria | 8043 |
| 1092 | Ga0500586_091487 | 3300053145 | Bacteria | 1068 |
| 1093 | Ga0500616_0007079 | 3300053153 | Bacteria | 7195 |
| 1094 | Ga0500630_038767 | 3300053159 | Bacteria | 2326 |
| 1095 | Ga0500611_016981 | 3300053727 | Bacteria | 1317 |
| 1096 | Ga0501084_0002917 | 3300054114 | Bacteria | 13845 |
| 1097 | Ga0501084_0055480 | 3300054114 | Bacteria | 3315 |
| 1098 | Ga0501082_0003080 | 3300060353 | Bacteria | 14544 |
| 1099 | Ga0501082_0030428 | 3300060353 | Bacteria | 4652 |
| 1100 | Ga0530510_0028627 | 3300061734 | Bacteria | 3995 |
| 1101 | 2586063783 | 2585427649 | Bacteria | 9053857 |
| 1102 | 2676486086 | 2675903059 | Bacteria | 8644972 |
| 1103 | 2795791568 | 2795385472 | Bacteria | 6627535 |
| 1104 | 2816420855 | 2816332119 | Bacteria | 8120218 |
| 1105 | 2855675852 | 2855670206 | Bacteria | 7120389 |
| 1106 | 2855678782 | 2855676851 | Bacteria | 7063653 |
| 1107 | 2857295203 | 2857288857 | Bacteria | 7189066 |
| 1108 | 2858853097 | 2858848962 | Bacteria | 6963058 |
| 1109 | 2858882964 | 2858882152 | Bacteria | 7230291 |
| 1110 | 2858891128 | 2858888857 | Bacteria | 7060307 |
| 1111 | 2858901788 | 2858895516 | Bacteria | 7378898 |
| 1112 | 2862516790 | 2862507626 | Bacteria | 9425308 |
| 1113 | 2869049870 | 2869048445 | Bacteria | 6875584 |
| 1114 | 2869067251 | 2869061728 | Bacteria | 7112407 |
| 1115 | 2869068868 | 2869068681 | Bacteria | 7205615 |
| 1116 | 2880490382 | 2880489317 | Bacteria | 7096270 |
| 1117 | 2880502152 | 2880495981 | Bacteria | 7340502 |
| 1118 | 2891398820 | 2891395885 | Bacteria | 9251614 |
| 1119 | 2891565978 | 2891562705 | Bacteria | 8039471 |
| 1120 | 2891567055 | 2891562705 | Bacteria | 8039471 |
| 1121 | 2895433352 | 2895427314 | Bacteria | 13147766 |
| 1122 | 2895438405 | 2895427314 | Bacteria | 13147766 |
| 1123 | 2895442974 | 2895442618 | Bacteria | 11027144 |
| 1124 | 2929230654 | 2929226422 | Bacteria | 7248583 |
| 1125 | 8003324090 | 8003314358 | Bacteria | 10575343 |
| 1126 | 8053945867 | 8053945823 | Bacteria | 8962862 |
| 1127 | 8054708612 | 8054704163 | Bacteria | 7247792 |
| 1128 | 8054735692 | 8054734606 | Bacteria | 6947278 |
| 1129 | 8057569480 | 8057568493 | Bacteria | 7221719 |
| 1130 | Ga0373955_0126172 | |||
| 1131 | JGI25406J46586_10027029 | |||
| 1132 | rootH2_10017855 | |||
| 1133 | rootH1_10084422 | |||
| 1134 | Ga0070658_10001743 | |||
| 1135 | Ga0070658_10027221 | |||
| 1136 | Ga0070683_100141180 | |||
| 1137 | Ga0070690_100041390 | |||
| 1138 | Ga0068869_100075930 | |||
| 1139 | Ga0068869_100163665 | |||
| 1140 | Ga0070680_100000156 | |||
| 1141 | Ga0070680_100155015 | |||
| 1142 | Ga0070682_100026232 | |||
| 1143 | Ga0068868_100084483 | |||
| 1144 | Ga0068868_100222966 | |||
| 1145 | Ga0070660_100079988 | |||
| 1146 | Ga0070660_100085665 | |||
| 1147 | Ga0070660_100148346 | |||
| 1148 | Ga0070691_10011889 | |||
| 1149 | Ga0070691_10040418 | |||
| 1150 | Ga0070661_100002473 | |||
| 1151 | Ga0070661_100023992 | |||
| 1152 | Ga0070661_100153752 | |||
| 1153 | Ga0070668_100003272 | |||
| 1154 | Ga0070668_100011479 | |||
| 1155 | Ga0070668_100053211 | |||
| 1156 | Ga0070668_100256580 | |||
| 1157 | Ga0070671_100424659 | |||
| 1158 | Ga0070674_100026284 | |||
| 1159 | Ga0070673_100300739 | |||
| 1160 | Ga0070688_100048803 | |||
| 1161 | Ga0070659_100074894 | |||
| 1162 | Ga0070667_100012931 | |||
| 1163 | Ga0070667_100141219 | |||
| 1164 | Ga0070703_10020547 | |||
| 1165 | Ga0070709_10001311 | |||
| 1166 | Ga0070709_10028795 | |||
| 1167 | Ga0070709_10077131 | |||
| 1168 | Ga0070709_10137824 | |||
| 1169 | Ga0070709_10236219 | |||
| 1170 | Ga0070714_100007665 | |||
| 1171 | Ga0070714_100013385 | |||
| 1172 | Ga0070714_100015602 | |||
| 1173 | Ga0070714_100074651 | |||
| 1174 | Ga0070714_100121165 | |||
| 1175 | Ga0070714_100352207 | |||
| 1176 | Ga0070714_100397246 | |||
| 1177 | Ga0070714_100426447 | |||
| 1178 | Ga0070713_100002120 | |||
| 1179 | Ga0070713_100015554 | |||
| 1180 | Ga0070713_100037164 | |||
| 1181 | Ga0070713_100069666 | |||
| 1182 | Ga0070713_100172895 | |||
| 1183 | Ga0070713_100394460 | |||
| 1184 | Ga0070710_10002444 | |||
| 1185 | Ga0070710_10040598 | |||
| 1186 | Ga0070710_10043706 | |||
| 1187 | Ga0070710_10088797 | |||
| 1188 | Ga0070711_100004788 | |||
| 1189 | Ga0070711_100075179 | |||
| 1190 | Ga0070711_100093940 | |||
| 1191 | Ga0070711_100211462 | |||
| 1192 | Ga0070711_100229962 | |||
| 1193 | Ga0070705_100061614 | |||
| 1194 | Ga0070694_100223817 | |||
| 1195 | Ga0070708_100002899 | |||
| 1196 | Ga0070708_100026326 | |||
| 1197 | Ga0070663_100171436 | |||
| 1198 | Ga0070678_100047995 | |||
| 1199 | Ga0070681_10000051 | |||
| 1200 | Ga0070681_10006131 | |||
| 1201 | Ga0070681_10006424 | |||
| 1202 | Ga0070681_10176917 | |||
| 1203 | Ga0070681_10289393 | |||
| 1204 | Ga0070681_10404183 | |||
| 1205 | Ga0070681_10418435 | |||
| 1206 | Ga0070706_100003586 | |||
| 1207 | Ga0070706_100005264 | |||
| 1208 | Ga0070706_100006560 | |||
| 1209 | Ga0070706_100022474 | |||
| 1210 | Ga0070706_100083897 | |||
| 1211 | Ga0070707_100023752 | |||
| 1212 | Ga0070707_100025629 | |||
| 1213 | Ga0070707_100195868 | |||
| 1214 | Ga0070707_100444467 | |||
| 1215 | Ga0070698_100017938 | |||
| 1216 | Ga0070698_100038117 | |||
| 1217 | Ga0070698_100188236 | |||
| 1218 | Ga0070698_100226683 | |||
| 1219 | Ga0070699_100000016 | |||
| 1220 | Ga0070699_100002660 | |||
| 1221 | Ga0070699_100054684 | |||
| 1222 | Ga0070679_100000058 | |||
| 1223 | Ga0070679_100022813 | |||
| 1224 | Ga0070679_100301620 | |||
| 1225 | Ga0070679_100466987 | |||
| 1226 | Ga0070684_100002665 | |||
| 1227 | Ga0070684_100060796 | |||
| 1228 | Ga0070684_100394106 | |||
| 1229 | Ga0070697_100001221 | |||
| 1230 | Ga0070672_100122779 | |||
| 1231 | Ga0070686_100200052 | |||
| 1232 | Ga0070695_100074449 | |||
| 1233 | Ga0070696_100022353 | |||
| 1234 | Ga0070693_100059558 | |||
| 1235 | Ga0070665_100322159 | |||
| 1236 | Ga0070704_100046303 | |||
| 1237 | Ga0068855_100120437 | |||
| 1238 | Ga0068855_100128191 | |||
| 1239 | Ga0068855_100185287 | |||
| 1240 | Ga0068855_100270667 | |||
| 1241 | Ga0070664_100037051 | |||
| 1242 | Ga0070664_100127016 | |||
| 1243 | Ga0070664_100269777 | |||
| 1244 | Ga0070664_100444084 | |||
| 1245 | Ga0068857_100045589 | |||
| 1246 | Ga0068854_100116823 | |||
| 1247 | Ga0068854_100150353 | |||
| 1248 | Ga0068854_100164626 | |||
| 1249 | Ga0068856_100018422 | |||
| 1250 | Ga0068856_100037306 | |||
| 1251 | Ga0068856_100068494 | |||
| 1252 | Ga0068852_100028683 | |||
| 1253 | Ga0068859_100451867 | |||
| 1254 | Ga0068864_100040346 | |||
| 1255 | Ga0068864_100052972 | |||
| 1256 | Ga0068864_100164025 | |||
| 1257 | Ga0068864_100234413 | |||
| 1258 | Ga0068864_100310740 | |||
| 1259 | Ga0068864_100462430 | |||
| 1260 | Ga0068866_10036549 | |||
| 1261 | Ga0068866_10084270 | |||
| 1262 | Ga0068861_100023317 | |||
| 1263 | Ga0068861_100135607 | |||
| 1264 | Ga0068863_100043157 | |||
| 1265 | Ga0068863_100065137 | |||
| 1266 | Ga0068863_100110328 | |||
| 1267 | Ga0068863_100366378 | |||
| 1268 | Ga0068858_100053560 | |||
| 1269 | Ga0068858_100207323 | |||
| 1270 | Ga0068860_100000400 | |||
| 1271 | Ga0068860_100094372 | |||
| 1272 | Ga0068860_100156315 | |||
| 1273 | Ga0081455_10032619 | |||
| 1274 | Ga0081455_10051909 | |||
| 1275 | Ga0081455_10075642 | |||
| 1276 | Ga0081538_10002128 | |||
| 1277 | Ga0081538_10004296 | |||
| 1278 | Ga0081538_10025392 | |||
| 1279 | Ga0081540_1001078 | |||
| 1280 | Ga0081539_10000023 | |||
| 1281 | Ga0081539_10000456 | |||
| 1282 | Ga0081539_10002116 | |||
| 1283 | Ga0081539_10057330 | |||
| 1284 | Ga0070717_10011214 | |||
| 1285 | Ga0070717_10028999 | |||
| 1286 | Ga0070717_10083013 | |||
| 1287 | Ga0070717_10089413 | |||
| 1288 | Ga0070717_10130108 | |||
| 1289 | Ga0070717_10238583 | |||
| 1290 | Ga0070717_10283145 | |||
| 1291 | Ga0070717_10300721 | |||
| 1292 | Ga0070717_10362221 | |||
| 1293 | Ga0075365_10003743 | |||
| 1294 | Ga0075365_10016923 | |||
| 1295 | Ga0075365_10033622 | |||
| 1296 | Ga0075365_10046030 | |||
| 1297 | Ga0075365_10052420 | |||
| 1298 | Ga0075365_10181299 | |||
| 1299 | Ga0075365_10270323 | |||
| 1300 | Ga0075365_10319524 | |||
| 1301 | Ga0075365_10350320 | |||
| 1302 | Ga0075368_10012819 | |||
| 1303 | Ga0075368_10060792 | |||
| 1304 | Ga0075363_100014884 | |||
| 1305 | Ga0075363_100041813 | |||
| 1306 | Ga0075364_10067151 | |||
| 1307 | Ga0075364_10130835 | |||
| 1308 | Ga0070715_10000632 | |||
| 1309 | Ga0070715_10149277 | |||
| 1310 | Ga0070716_100000086 | |||
| 1311 | Ga0070716_100004535 | |||
| 1312 | Ga0070716_100024189 | |||
| 1313 | Ga0070716_100099115 | |||
| 1314 | Ga0070712_100011408 | |||
| 1315 | Ga0070712_100027651 | |||
| 1316 | Ga0070712_100031346 | |||
| 1317 | Ga0070712_100032446 | |||
| 1318 | Ga0070712_100047564 | |||
| 1319 | Ga0070712_100115963 | |||
| 1320 | Ga0070712_100124750 | |||
| 1321 | Ga0070712_100171501 | |||
| 1322 | Ga0070712_100194666 | |||
| 1323 | Ga0070712_100277979 | |||
| 1324 | Ga0075362_10010148 | |||
| 1325 | Ga0075367_10008972 | |||
| 1326 | Ga0075367_10063540 | |||
| 1327 | Ga0097621_100077800 | |||
| 1328 | Ga0097621_100096846 | |||
| 1329 | Ga0075370_10000475 | |||
| 1330 | Ga0075370_10054358 | |||
| 1331 | Ga0075370_10132278 | |||
| 1332 | Ga0075370_10164182 | |||
| 1333 | Ga0068871_100213807 | |||
| 1334 | Ga0075428_100023722 | |||
| 1335 | Ga0075428_100042373 | |||
| 1336 | Ga0075428_100100145 | |||
| 1337 | Ga0075428_100200875 | |||
| 1338 | Ga0075430_100187557 | |||
| 1339 | Ga0075430_100406298 | |||
| 1340 | Ga0075431_100084292 | |||
| 1341 | Ga0075431_100538423 | |||
| 1342 | Ga0075433_10002889 | |||
| 1343 | Ga0075433_10177271 | |||
| 1344 | Ga0075434_100017026 | |||
| 1345 | Ga0075434_100334583 | |||
| 1346 | Ga0075434_100507521 | |||
| 1347 | Ga0075429_100082811 | |||
| 1348 | Ga0075429_100381554 | |||
| 1349 | Ga0068865_100088483 | |||
| 1350 | Ga0075436_100022621 | |||
| 1351 | Ga0097620_100451863 | |||
| 1352 | Ga0075435_100016390 | |||
| 1353 | Ga0075435_100175909 | |||
| 1354 | Ga0075435_100323108 | |||
| 1355 | Ga0099795_10010554 | |||
| 1356 | Ga0105251_10034597 | |||
| 1357 | Ga0105240_10078146 | |||
| 1358 | Ga0105240_10338952 | |||
| 1359 | Ga0105240_10707314 | |||
| 1360 | Ga0111539_10001058 | |||
| 1361 | Ga0105245_10025702 | |||
| 1362 | Ga0105245_10065679 | |||
| 1363 | Ga0105245_10236770 | |||
| 1364 | Ga0105247_10030440 | |||
| 1365 | Ga0105247_10034604 | |||
| 1366 | Ga0105247_10270440 | |||
| 1367 | Ga0114129_10004838 | |||
| 1368 | Ga0114129_10005759 | |||
| 1369 | Ga0114129_10009287 | |||
| 1370 | Ga0114129_10130516 | |||
| 1371 | Ga0114129_10212899 | |||
| 1372 | Ga0114129_10265112 | |||
| 1373 | Ga0105243_10124404 | |||
| 1374 | Ga0105243_10654835 | |||
| 1375 | Ga0105241_10013422 | |||
| 1376 | Ga0105241_10343392 | |||
| 1377 | Ga0105242_10257997 | |||
| 1378 | Ga0105248_10091709 | |||
| 1379 | Ga0105248_10195350 | |||
| 1380 | Ga0105248_10417632 | |||
| 1381 | Ga0105237_10061495 | |||
| 1382 | Ga0105237_10110498 | |||
| 1383 | Ga0105238_10216115 | |||
| 1384 | Ga0105249_10082549 | |||
| 1385 | Ga0105249_10172429 | |||
| 1386 | Ga0099796_10028374 | |||
| 1387 | Ga0105239_10121457 | |||
| 1388 | Ga0105239_10145840 | |||
| 1389 | Ga0105239_10150059 | |||
| 1390 | Ga0105246_10072893 | |||
| 1391 | Ga0157371_10015196 | |||
| 1392 | Ga0157369_10022043 | |||
| 1393 | Ga0157369_10023115 | |||
| 1394 | Ga0157369_10025091 | |||
| 1395 | Ga0157369_10129147 | |||
| 1396 | Ga0157369_10170231 | |||
| 1397 | Ga0157369_10404429 | |||
| 1398 | Ga0157374_10007847 | |||
| 1399 | Ga0157374_10042957 | |||
| 1400 | Ga0163162_10065097 | |||
| 1401 | Ga0163162_10431083 | |||
| 1402 | Ga0157372_10107671 | |||
| 1403 | Ga0157372_10113351 | |||
| 1404 | Ga0157372_10120180 | |||
| 1405 | Ga0157372_10561479 | |||
| 1406 | Ga0157375_10169041 | |||
| 1407 | Ga0163163_10067111 | |||
| 1408 | Ga0163163_10091359 | |||
| 1409 | Ga0163163_10098579 | |||
| 1410 | Ga0163163_10301849 | |||
| 1411 | Ga0163163_10472456 | |||
| 1412 | Ga0163163_10562401 | |||
| 1413 | Ga0157380_10046809 | |||
| 1414 | Ga0157377_10020514 | |||
| 1415 | Ga0157379_10059210 | |||
| 1416 | Ga0157379_10146176 | |||
| 1417 | Ga0157379_10155511 | |||
| 1418 | Ga0157376_10042670 | |||
| 1419 | Ga0157376_10070850 | |||
| 1420 | Ga0163161_10309312 | |||
| 1421 | Ga0197907_11394660 | |||
| 1422 | Ga0206353_10307624 | |||
| 1423 | Ga0206353_11504755 | |||
| 1424 | Ga0213875_10001035 | |||
| 1425 | Ga0213875_10114548 | |||
| 1426 | Ga0224712_10058186 | |||
| 1427 | Ga0224572_1006021 | |||
| 1428 | Ga0207692_10039747 | |||
| 1429 | Ga0207688_10058594 | |||
| 1430 | Ga0207647_10059361 | |||
| 1431 | Ga0207685_10007393 | |||
| 1432 | Ga0207685_10161393 | |||
| 1433 | Ga0207699_10001009 | |||
| 1434 | Ga0207699_10003233 | |||
| 1435 | Ga0207699_10004873 | |||
| 1436 | Ga0207699_10050625 | |||
| 1437 | Ga0207699_10061143 | |||
| 1438 | Ga0207699_10123174 | |||
| 1439 | Ga0207699_10137392 | |||
| 1440 | Ga0207699_10160117 | |||
| 1441 | Ga0207699_10212862 | |||
| 1442 | Ga0207699_10270632 | |||
| 1443 | Ga0207705_10004368 | |||
| 1444 | Ga0207705_10018370 | |||
| 1445 | Ga0207705_10063535 | |||
| 1446 | Ga0207705_10096344 | |||
| 1447 | Ga0207705_10168987 | |||
| 1448 | Ga0207684_10001075 | |||
| 1449 | Ga0207684_10003723 | |||
| 1450 | Ga0207684_10008754 | |||
| 1451 | Ga0207684_10148622 | |||
| 1452 | Ga0207654_10015932 | |||
| 1453 | Ga0207707_10000113 | |||
| 1454 | Ga0207707_10032935 | |||
| 1455 | Ga0207707_10069465 | |||
| 1456 | Ga0207707_10173675 | |||
| 1457 | Ga0207695_10124753 | |||
| 1458 | Ga0207671_10034166 | |||
| 1459 | Ga0207671_10048833 | |||
| 1460 | Ga0207693_10002169 | |||
| 1461 | Ga0207693_10017192 | |||
| 1462 | Ga0207693_10044596 | |||
| 1463 | Ga0207693_10049955 | |||
| 1464 | Ga0207693_10053514 | |||
| 1465 | Ga0207693_10082926 | |||
| 1466 | Ga0207693_10094502 | |||
| 1467 | Ga0207693_10136210 | |||
| 1468 | Ga0207693_10213878 | |||
| 1469 | Ga0207693_10266872 | |||
| 1470 | Ga0207663_10028288 | |||
| 1471 | Ga0207663_10053484 | |||
| 1472 | Ga0207663_10066681 | |||
| 1473 | Ga0207663_10073052 | |||
| 1474 | Ga0207663_10112202 | |||
| 1475 | Ga0207663_10120415 | |||
| 1476 | Ga0207660_10000574 | |||
| 1477 | Ga0207660_10031843 | |||
| 1478 | Ga0207660_10121287 | |||
| 1479 | Ga0207660_10218021 | |||
| 1480 | Ga0207660_10423400 | |||
| 1481 | Ga0207662_10031909 | |||
| 1482 | Ga0207657_10013454 | |||
| 1483 | Ga0207657_10038361 | |||
| 1484 | Ga0207649_10115204 | |||
| 1485 | Ga0207652_10000123 | |||
| 1486 | Ga0207652_10181877 | |||
| 1487 | Ga0207646_10022995 | |||
| 1488 | Ga0207646_10024077 | |||
| 1489 | Ga0207646_10064578 | |||
| 1490 | Ga0207646_10091209 | |||
| 1491 | Ga0207694_10032643 | |||
| 1492 | Ga0207694_10199109 | |||
| 1493 | Ga0207687_10057896 | |||
| 1494 | Ga0207687_10134855 | |||
| 1495 | Ga0207687_10275228 | |||
| 1496 | Ga0207700_10000250 | |||
| 1497 | Ga0207700_10008331 | |||
| 1498 | Ga0207700_10012420 | |||
| 1499 | Ga0207700_10016928 | |||
| 1500 | Ga0207700_10040931 | |||
| 1501 | Ga0207700_10047464 | |||
| 1502 | Ga0207700_10111244 | |||
| 1503 | Ga0207700_10363844 | |||
| 1504 | Ga0207700_10381201 | |||
| 1505 | Ga0207664_10009910 | |||
| 1506 | Ga0207664_10013316 | |||
| 1507 | Ga0207664_10027025 | |||
| 1508 | Ga0207664_10030247 | |||
| 1509 | Ga0207664_10031743 | |||
| 1510 | Ga0207664_10046340 | |||
| 1511 | Ga0207664_10048484 | |||
| 1512 | Ga0207664_10055076 | |||
| 1513 | Ga0207664_10059817 | |||
| 1514 | Ga0207664_10100165 | |||
| 1515 | Ga0207664_10210036 | |||
| 1516 | Ga0207664_10229145 | |||
| 1517 | Ga0207664_10279350 | |||
| 1518 | Ga0207664_10506625 | |||
| 1519 | Ga0207664_10519123 | |||
| 1520 | Ga0207644_10134895 | |||
| 1521 | Ga0207690_10007866 | |||
| 1522 | Ga0207690_10179123 | |||
| 1523 | Ga0207665_10003587 | |||
| 1524 | Ga0207665_10008173 | |||
| 1525 | Ga0207665_10019793 | |||
| 1526 | Ga0207665_10110736 | |||
| 1527 | Ga0207665_10136748 | |||
| 1528 | Ga0207665_10261480 | |||
| 1529 | Ga0207691_10034962 | |||
| 1530 | Ga0207691_10140161 | |||
| 1531 | Ga0207711_10041265 | |||
| 1532 | Ga0207711_10057403 | |||
| 1533 | Ga0207711_10082167 | |||
| 1534 | Ga0207711_10117851 | |||
| 1535 | Ga0207689_10052882 | |||
| 1536 | Ga0207661_10004179 | |||
| 1537 | Ga0207661_10105555 | |||
| 1538 | Ga0207661_10242117 | |||
| 1539 | Ga0207661_10327123 | |||
| 1540 | Ga0207679_10052772 | |||
| 1541 | Ga0207679_10135333 | |||
| 1542 | Ga0207667_10075516 | |||
| 1543 | Ga0207667_10117020 | |||
| 1544 | Ga0207667_10181084 | |||
| 1545 | Ga0207667_10562865 | |||
| 1546 | Ga0207712_10035468 | |||
| 1547 | Ga0207668_10002158 | |||
| 1548 | Ga0207668_10003424 | |||
| 1549 | Ga0207668_10194397 | |||
| 1550 | Ga0207640_10045334 | |||
| 1551 | Ga0207640_10048838 | |||
| 1552 | Ga0207640_10091408 | |||
| 1553 | Ga0207658_10170504 | |||
| 1554 | Ga0207677_10051478 | |||
| 1555 | Ga0207703_10014554 | |||
| 1556 | Ga0207703_10063382 | |||
| 1557 | Ga0207703_10171590 | |||
| 1558 | Ga0207639_10319015 | |||
| 1559 | Ga0207678_10008408 | |||
| 1560 | Ga0207678_10010301 | |||
| 1561 | Ga0207678_10017807 | |||
| 1562 | Ga0207678_10214018 | |||
| 1563 | Ga0207702_10048344 | |||
| 1564 | Ga0207702_10086997 | |||
| 1565 | Ga0207702_10181199 | |||
| 1566 | Ga0207641_10037218 | |||
| 1567 | Ga0207641_10082803 | |||
| 1568 | Ga0207641_10536846 | |||
| 1569 | Ga0207676_10181364 | |||
| 1570 | Ga0207676_10208715 | |||
| 1571 | Ga0207676_10215560 | |||
| 1572 | Ga0207676_10615162 | |||
| 1573 | Ga0207674_10015384 | |||
| 1574 | Ga0207674_10224078 | |||
| 1575 | Ga0207674_10227069 | |||
| 1576 | Ga0207675_100126954 | |||
| 1577 | Ga0207698_10026742 | |||
| 1578 | Ga0207698_10271657 | |||
| 1579 | Ga0207428_10015742 | |||
| 1580 | Ga0207428_10248199 | |||
| 1581 | Ga0268265_10212155 | |||
| 1582 | Ga0268264_10000320 | |||
| 1583 | Ga0268264_10042454 | |||
| 1584 | Ga0268264_10045108 | |||
| 1585 | Ga0265326_10049878 | |||
| 1586 | Ga0265336_10009379 | |||
| 1587 | Ga0265336_10040047 | |||
| 1588 | Ga0307517_10098827 | |||
| 1589 | Ga0307515_10032992 | |||
| 1590 | Ga0307515_10051383 | |||
| 1591 | Ga0307515_10062958 | |||
| 1592 | Ga0307515_10090016 | |||
| 1593 | Ga0307515_10094590 | |||
| 1594 | Ga0307515_10154691 | |||
| 1595 | Ga0307515_10208266 | |||
| 1596 | Ga0307515_10323869 | |||
| 1597 | Ga0265338_10004964 | |||
| 1598 | Ga0265338_10005981 | |||
| 1599 | Ga0265338_10016877 | |||
| 1600 | Ga0265338_10132479 | |||
| 1601 | Ga0265338_10136972 | |||
| 1602 | Ga0265338_10206370 | |||
| 1603 | Ga0265338_10314117 | |||
| 1604 | Ga0307512_10001623 | |||
| 1605 | Ga0307512_10001742 | |||
| 1606 | Ga0307512_10005070 | |||
| 1607 | Ga0307512_10006152 | |||
| 1608 | Ga0307512_10122530 | |||
| 1609 | Ga0307512_10194430 | |||
| 1610 | Ga0316177_1218167 | |||
| 1611 | Ga0316180_1042311 | |||
| 1612 | Ga0265328_10032104 | |||
| 1613 | Ga0265325_10032446 | |||
| 1614 | Ga0265325_10106737 | |||
| 1615 | Ga0265340_10001093 | |||
| 1616 | Ga0265340_10022337 | |||
| 1617 | Ga0307513_10009283 | |||
| 1618 | Ga0307513_10041702 | |||
| 1619 | Ga0307513_10050922 | |||
| 1620 | Ga0307513_10137819 | |||
| 1621 | Ga0307513_10172230 | |||
| 1622 | Ga0307513_10334956 | |||
| 1623 | Ga0307509_10114201 | |||
| 1624 | Ga0307509_10194428 | |||
| 1625 | Ga0307509_10323583 | |||
| 1626 | Ga0307508_10025316 | |||
| 1627 | Ga0307508_10034034 | |||
| 1628 | Ga0307508_10059987 | |||
| 1629 | Ga0307514_10036163 | |||
| 1630 | Ga0307516_10004524 | |||
| 1631 | Ga0307516_10039117 | |||
| 1632 | Ga0307516_10168782 | |||
| 1633 | Ga0307518_10002222 | |||
| 1634 | Ga0307406_10128974 | |||
| 1635 | Ga0307406_10316184 | |||
| 1636 | Ga0307412_10454898 | |||
| 1637 | Ga0307409_100063046 | |||
| 1638 | Ga0307409_100191285 | |||
| 1639 | Ga0307416_100210103 | |||
| 1640 | Ga0307416_100545317 | |||
| 1641 | Ga0307411_10061392 | |||
| 1642 | Ga0307415_100003294 | |||
| 1643 | Ga0307415_100020631 | |||
| 1644 | Ga0307415_100020659 | |||
| 1645 | Ga0307415_100068988 | |||
| 1646 | Ga0307415_100140199 | |||
| 1647 | Ga0307507_10001339 | |||
| 1648 | Ga0307507_10011987 | |||
| 1649 | Ga0307507_10023117 | |||
| 1650 | Ga0307510_10076367 | |||
| 1651 | Ga0373938_0019920 | |||
| 1652 | Ga0373938_0025286 | |||
| 1653 | Ga0373926_0037031 | |||
| 1654 | Ga0373926_0045484 | |||
| 1655 | Ga0373934_0003787 | |||
| 1656 | Ga0373934_0006867 | |||
| 1657 | Ga0373934_0007109 | |||
| 1658 | Ga0373934_0018329 | |||
| 1659 | Ga0373934_0021597 | |||
| 1660 | Ga0373934_0075049 | |||
| 1661 | Ga0373944_0005495 | |||
| 1662 | Ga0373923_0003800 | |||
| 1663 | Ga0373923_0006352 | |||
| 1664 | Ga0373923_0013540 | |||
| 1665 | Ga0373923_0017924 | |||
| 1666 | Ga0373936_0002364 | |||
| 1667 | Ga0373936_0005328 | |||
| 1668 | Ga0373936_0097494 | |||
| 1669 | Ga0373936_0134464 | |||
| 1670 | Ga0373941_0024311 | |||
| 1671 | Ga0373953_0001265 | |||
| 1672 | Ga0373953_0002362 | |||
| 1673 | Ga0373953_0011249 | |||
| 1674 | Ga0373953_0053361 | |||
| 1675 | Ga0373954_0016471 | |||
| 1676 | Ga0373954_0072629 | |||
| 1677 | Ga0373954_0084502 | |||
| 1678 | Ga0373956_0004289 | |||
| 1679 | Ga0373956_0144324 | |||
| 1680 | Ga0373956_0223206 | |||
| 1681 | Ga0373957_0000136 | |||
| 1682 | Ga0373957_0004227 | |||
| 1683 | Ga0373957_0025599 | |||
| 1684 | Ga0373957_0031882 | |||
| 1685 | Ga0373957_0037068 | |||
| 1686 | Ga0373957_0066928 | |||
| 1687 | Ga0373960_0026306 | |||
| 1688 | Ga0373943_0002872 | |||
| 1689 | Ga0373946_0107367 | |||
| 1690 | Ga0373955_0000680 | |||
| 1691 | Ga0373955_0002108 | |||
| 1692 | Ga0373955_0013424 | |||
| 1693 | Ga0373955_0050124 | |||
| 1694 | Ga0373955_0087328 | |||
| 1695 | Ga0373942_0004187 | |||
| 1696 | Ga0373924_0001950 | |||
| 1697 | Ga0373924_0005840 | |||
| 1698 | Ga0373924_0007664 | |||
| 1699 | Ga0373924_0034766 | |||
| 1700 | Ga0373924_0045563 | |||
| 1701 | Ga0373931_0063186 | |||
| 1702 | Ga0373935_0010688 | |||
| 1703 | Ga0373935_0097258 | |||
| 1704 | Ga0373935_0105996 | |||
| 1705 | Ga0373927_0364992 | |||
| 1706 | Ga0373933_0000209 | |||
| 1707 | Ga0373933_0015772 | |||
| 1708 | Ga0373933_0018740 | |||
| 1709 | Ga0373933_0019628 | |||
| 1710 | Ga0373933_0036115 | |||
| 1711 | Ga0373933_0251646 | |||
| 1712 | Ga0373947_0067618 | |||
| 1713 | Ga0373947_0070233 | |||
| 1714 | Ga0373947_0142810 | |||
| 1715 | Ga0373937_0003535 | |||
| 1716 | Ga0373937_0010957 | |||
| 1717 | Ga0373937_0011377 | |||
| 1718 | Ga0373937_0027178 | |||
| 1719 | Ga0373937_0048312 | |||
| 1720 | Ga0373937_0068370 | |||
| 1721 | Ga0373937_0077067 | |||
| 1722 | Ga0373937_0112602 | |||
| 1723 | Ga0373937_0120044 | |||
| 1724 | Ga0373925_0000129 | |||
| 1725 | Ga0373925_0009261 | |||
| 1726 | Ga0373925_0016388 | |||
| 1727 | Ga0373925_0021664 | |||
| 1728 | Ga0373925_0030235 | |||
| 1729 | Ga0373925_0039183 | |||
| 1730 | Ga0373925_0046625 | |||
| 1731 | Ga0373925_0056904 | |||
| 1732 | Ga0373925_0113008 | |||
| 1733 | Ga0395900_0265396 | |||
| 1734 | Ga0395898_0186719 | |||
| 1735 | Ga0395898_0205954 | |||
| 1736 | Ga0436364_0464142 | |||
| 1737 | Ga0436364_0923522 | |||
| 1738 | Ga0395901_0039174 | |||
| 1739 | Ga0395901_0144378 | |||
| 1740 | Ga0436365_1218054 | |||
| 1741 | Ga0436363_1288270 | |||
| 1742 | Ga0439436_0000261 | |||
| 1743 | Ga0439439_0004200 | |||
| 1744 | Ga0451789_0766711 | |||
| 1745 | Ga0439433_0000810 | |||
| 1746 | Ga0439442_018316 | |||
| 1747 | Ga0439449_0009770 | |||
| 1748 | Ga0439449_0016973 | |||
| 1749 | Ga0439449_0019898 | |||
| 1750 | Ga0439457_002146 | |||
| 1751 | Ga0439462_0000798 | |||
| 1752 | Ga0466969_0050247 | |||
| 1753 | Ga0466965_0013001 | |||
| 1754 | Ga0466965_0065863 | |||
| 1755 | Ga0466966_0026789 | |||
| 1756 | Ga0466961_0134090 | |||
| 1757 | Ga0466963_0020237 | |||
| 1758 | Ga0466963_0044527 | |||
| 1759 | Ga0466963_0094488 | |||
| 1760 | Ga0466963_0131393 | |||
| 1761 | Ga0466957_0066833 | |||
| 1762 | Ga0466960_0233646 | |||
| 1763 | Ga0466959_0082731 | |||
| 1764 | Ga0466958_0006381 | |||
| 1765 | Ga0466958_0016170 | |||
| 1766 | Ga0466958_0121847 | |||
| 1767 | Ga0466967_0049793 | |||
| 1768 | Ga0466967_0061908 | |||
| 1769 | Ga0466967_0078434 | |||
| 1770 | Ga0466967_0570591 | |||
| 1771 | Ga0495592_0000391 | |||
| 1772 | Ga0495592_0001439 | |||
| 1773 | Ga0495592_0005743 | |||
| 1774 | Ga0495592_0008164 | |||
| 1775 | Ga0495592_0025688 | |||
| 1776 | Ga0495592_0028362 | |||
| 1777 | Ga0495592_0031017 | |||
| 1778 | Ga0495592_0145034 | |||
| 1779 | Ga0495592_0171259 | |||
| 1780 | Ga0495603_0002257 | |||
| 1781 | Ga0495603_0033713 | |||
| 1782 | Ga0495603_0064401 | |||
| 1783 | Ga0495629_0019291 | |||
| 1784 | Ga0495629_0034037 | |||
| 1785 | Ga0495629_0034137 | |||
| 1786 | Ga0495629_0237393 | |||
| 1787 | Ga0495638_0109982 | |||
| 1788 | Ga0495641_0014582 | |||
| 1789 | Ga0495641_0016695 | |||
| 1790 | Ga0495641_0025092 | |||
| 1791 | Ga0495641_0082917 | |||
| 1792 | Ga0495651_0001843 | |||
| 1793 | Ga0495651_0002274 | |||
| 1794 | Ga0495651_0002422 | |||
| 1795 | Ga0495651_0004360 | |||
| 1796 | Ga0495651_0015238 | |||
| 1797 | Ga0495651_0016279 | |||
| 1798 | Ga0495651_0034790 | |||
| 1799 | Ga0495651_0058282 | |||
| 1800 | Ga0495651_0100335 | |||
| 1801 | Ga0495651_0106215 | |||
| 1802 | Ga0495651_0145590 | |||
| 1803 | Ga0495653_0001532 | |||
| 1804 | Ga0495653_0009500 | |||
| 1805 | Ga0495653_0010278 | |||
| 1806 | Ga0495653_0011783 | |||
| 1807 | Ga0495653_0018487 | |||
| 1808 | Ga0495653_0021818 | |||
| 1809 | Ga0495653_0024137 | |||
| 1810 | Ga0495653_0052908 | |||
| 1811 | Ga0495653_0054519 | |||
| 1812 | Ga0495653_0214292 | |||
| 1813 | Ga0495653_0230871 | |||
| 1814 | Ga0495653_0241495 | |||
| 1815 | Ga0495653_0258795 | |||
| 1816 | Ga0495580_0038011 | |||
| 1817 | Ga0495582_0007389 | |||
| 1818 | Ga0495582_0016023 | |||
| 1819 | Ga0495639_0008424 | |||
| 1820 | Ga0495639_0012095 | |||
| 1821 | Ga0495662_0008206 | |||
| 1822 | Ga0495662_0011481 | |||
| 1823 | Ga0495662_0017538 | |||
| 1824 | Ga0495662_0040131 | |||
| 1825 | Ga0495662_0093604 | |||
| 1826 | Ga0495662_0109620 | |||
| 1827 | Ga0495664_0013432 | |||
| 1828 | Ga0495664_0013727 | |||
| 1829 | Ga0495664_0032113 | |||
| 1830 | Ga0495664_0038780 | |||
| 1831 | Ga0495664_0070846 | |||
| 1832 | Ga0495664_0080913 | |||
| 1833 | Ga0495608_0000254 | |||
| 1834 | Ga0495608_0000389 | |||
| 1835 | Ga0495608_0002992 | |||
| 1836 | Ga0495608_0008471 | |||
| 1837 | Ga0495608_0009469 | |||
| 1838 | Ga0495608_0015867 | |||
| 1839 | Ga0495608_0022442 | |||
| 1840 | Ga0495608_0030702 | |||
| 1841 | Ga0495608_0032375 | |||
| 1842 | Ga0495608_0048388 | |||
| 1843 | Ga0495608_0178643 | |||
| 1844 | Ga0495618_0046601 | |||
| 1845 | Ga0495618_0056682 | |||
| 1846 | Ga0495618_0086158 | |||
| 1847 | Ga0495618_0128720 | |||
| 1848 | Ga0495628_0004505 | |||
| 1849 | Ga0495628_0010905 | |||
| 1850 | Ga0495628_0020937 | |||
| 1851 | Ga0495628_0025630 | |||
| 1852 | Ga0495628_0037960 | |||
| 1853 | Ga0495628_0041095 | |||
| 1854 | Ga0495628_0114832 | |||
| 1855 | Ga0495628_0423725 | |||
| 1856 | Ga0495630_0000522 | |||
| 1857 | Ga0495630_0009915 | |||
| 1858 | Ga0495630_0041846 | |||
| 1859 | Ga0495630_0042145 | |||
| 1860 | Ga0495630_0080161 | |||
| 1861 | Ga0495630_0091972 | |||
| 1862 | Ga0495666_0033325 | |||
| 1863 | Ga0495666_0084109 | |||
| 1864 | Ga0495652_0003494 | |||
| 1865 | Ga0495652_0004326 | |||
| 1866 | Ga0495652_0010063 | |||
| 1867 | Ga0495652_0012624 | |||
| 1868 | Ga0495652_0024106 | |||
| 1869 | Ga0495652_0029386 | |||
| 1870 | Ga0495652_0043908 | |||
| 1871 | Ga0495652_0073253 | |||
| 1872 | Ga0495652_0107791 | |||
| 1873 | Ga0495665_0003779 | |||
| 1874 | Ga0495665_0016598 | |||
| 1875 | Ga0495665_0036610 | |||
| 1876 | Ga0495640_0007107 | |||
| 1877 | Ga0495640_0014265 | |||
| 1878 | Ga0495640_0014380 | |||
| 1879 | Ga0495640_0033695 | |||
| 1880 | Ga0495640_0108121 | |||
| 1881 | Ga0495587_0000226 | |||
| 1882 | Ga0495587_0004967 | |||
| 1883 | Ga0495587_0006385 | |||
| 1884 | Ga0495587_0007459 | |||
| 1885 | Ga0495587_0009731 | |||
| 1886 | Ga0495587_0028382 | |||
| 1887 | Ga0495587_0032803 | |||
| 1888 | Ga0495587_0083330 | |||
| 1889 | Ga0495587_0169309 | |||
| 1890 | Ga0495645_0000853 | |||
| 1891 | Ga0495645_0019458 | |||
| 1892 | Ga0495645_0024527 | |||
| 1893 | Ga0495645_0051667 | |||
| 1894 | Ga0495645_0051712 | |||
| 1895 | Ga0495645_0066773 | |||
| 1896 | Ga0495667_0000242 | |||
| 1897 | Ga0495667_0001647 | |||
| 1898 | Ga0495667_0003869 | |||
| 1899 | Ga0495667_0006100 | |||
| 1900 | Ga0495667_0006514 | |||
| 1901 | Ga0495667_0010343 | |||
| 1902 | Ga0495667_0031145 | |||
| 1903 | Ga0495667_0046101 | |||
| 1904 | Ga0495667_0164027 | |||
| 1905 | Ga0495634_0004479 | |||
| 1906 | Ga0495634_0008157 | |||
| 1907 | Ga0495634_0012920 | |||
| 1908 | Ga0495634_0014732 | |||
| 1909 | Ga0495634_0018630 | |||
| 1910 | Ga0495634_0034352 | |||
| 1911 | Ga0495634_0039641 | |||
| 1912 | Ga0495634_0075709 | |||
| 1913 | Ga0495635_0000192 | |||
| 1914 | Ga0495635_0002786 | |||
| 1915 | Ga0495635_0003166 | |||
| 1916 | Ga0495635_0003546 | |||
| 1917 | Ga0495635_0009402 | |||
| 1918 | Ga0495635_0009954 | |||
| 1919 | Ga0495635_0011105 | |||
| 1920 | Ga0495635_0031531 | |||
| 1921 | Ga0495635_0050428 | |||
| 1922 | Ga0495635_0162915 | |||
| 1923 | Ga0495657_0000442 | |||
| 1924 | Ga0495657_0003088 | |||
| 1925 | Ga0495657_0005359 | |||
| 1926 | Ga0495657_0009671 | |||
| 1927 | Ga0495657_0019075 | |||
| 1928 | Ga0495657_0019391 | |||
| 1929 | Ga0495657_0020525 | |||
| 1930 | Ga0495657_0039576 | |||
| 1931 | Ga0495657_0158215 | |||
| 1932 | Ga0495657_0163460 | |||
| 1933 | Ga0495657_0229832 | |||
| 1934 | Ga0495599_0000265 | |||
| 1935 | Ga0495599_0000335 | |||
| 1936 | Ga0495599_0002415 | |||
| 1937 | Ga0495599_0003128 | |||
| 1938 | Ga0495599_0008728 | |||
| 1939 | Ga0495599_0030100 | |||
| 1940 | Ga0495599_0040022 | |||
| 1941 | Ga0495599_0041636 | |||
| 1942 | Ga0495599_0094356 | |||
| 1943 | Ga0495623_0000092 | |||
| 1944 | Ga0495623_0002870 | |||
| 1945 | Ga0495623_0006282 | |||
| 1946 | Ga0495623_0016057 | |||
| 1947 | Ga0495623_0027261 | |||
| 1948 | Ga0495623_0053854 | |||
| 1949 | Ga0495623_0065425 | |||
| 1950 | Ga0495623_0075235 | |||
| 1951 | Ga0495646_0000041 | |||
| 1952 | Ga0495646_0007331 | |||
| 1953 | Ga0495646_0010831 | |||
| 1954 | Ga0495646_0027256 | |||
| 1955 | Ga0495646_0040576 | |||
| 1956 | Ga0495646_0051885 | |||
| 1957 | Ga0495646_0090256 | |||
| 1958 | Ga0495647_0086678 | |||
| 1959 | Ga0495658_0010418 | |||
| 1960 | Ga0495658_0017260 | |||
| 1961 | Ga0495658_0116503 | |||
| 1962 | Ga0495613_0002022 | |||
| 1963 | Ga0495613_0003981 | |||
| 1964 | Ga0495613_0005750 | |||
| 1965 | Ga0495613_0011808 | |||
| 1966 | Ga0495613_0044725 | |||
| 1967 | Ga0495613_0067448 | |||
| 1968 | Ga0495613_0109635 | |||
| 1969 | Ga0495613_0130571 | |||
| 1970 | Ga0495624_0007464 | |||
| 1971 | Ga0495624_0021429 | |||
| 1972 | Ga0495624_0112167 | |||
| 1973 | Ga0495600_0000204 | |||
| 1974 | Ga0495600_0006275 | |||
| 1975 | Ga0495600_0007430 | |||
| 1976 | Ga0495600_0007614 | |||
| 1977 | Ga0495600_0011921 | |||
| 1978 | Ga0495600_0014774 | |||
| 1979 | Ga0495600_0024824 | |||
| 1980 | Ga0495600_0025766 | |||
| 1981 | Ga0495600_0039970 | |||
| 1982 | Ga0495600_0099688 | |||
| 1983 | Ga0495600_0112269 | |||
| 1984 | Ga0495600_0209516 | |||
| 1985 | Ga0495581_0017358 | |||
| 1986 | Ga0495581_0025667 | |||
| 1987 | Ga0495581_0047452 | |||
| 1988 | Ga0495581_0054848 | |||
| 1989 | Ga0495604_0000408 | |||
| 1990 | Ga0495604_0000411 | |||
| 1991 | Ga0495604_0009302 | |||
| 1992 | Ga0495604_0011000 | |||
| 1993 | Ga0495604_0012095 | |||
| 1994 | Ga0495604_0012809 | |||
| 1995 | Ga0495604_0042736 | |||
| 1996 | Ga0495604_0057694 | |||
| 1997 | Ga0495604_0070257 | |||
| 1998 | Ga0495604_0088769 | |||
| 1999 | Ga0495674_0000227 | |||
| 2000 | Ga0495674_0003012 | |||
| 2001 | Ga0495674_0005317 | |||
| 2002 | Ga0495674_0024389 | |||
| 2003 | Ga0495674_0030341 | |||
| 2004 | Ga0495674_0032222 | |||
| 2005 | Ga0495674_0055287 | |||
| 2006 | Ga0495674_0061326 | |||
| 2007 | Ga0495674_0073735 | |||
| 2008 | Ga0495674_0181348 | |||
| 2009 | Ga0495676_0052073 | |||
| 2010 | Ga0495676_0056671 | |||
| 2011 | Ga0495680_0001998 | |||
| 2012 | Ga0495680_0003785 | |||
| 2013 | Ga0495680_0008382 | |||
| 2014 | Ga0495680_0011107 | |||
| 2015 | Ga0495680_0012319 | |||
| 2016 | Ga0495680_0017482 | |||
| 2017 | Ga0495680_0024379 | |||
| 2018 | Ga0495680_0043984 | |||
| 2019 | Ga0495680_0047808 | |||
| 2020 | Ga0495680_0148067 | |||
| 2021 | Ga0495680_0297644 | |||
| 2022 | Ga0495675_0000136 | |||
| 2023 | Ga0495675_0001364 | |||
| 2024 | Ga0495675_0001590 | |||
| 2025 | Ga0495675_0013655 | |||
| 2026 | Ga0495675_0021536 | |||
| 2027 | Ga0495675_0107046 | |||
| 2028 | Ga0495684_0000323 | |||
| 2029 | Ga0495684_0003230 | |||
| 2030 | Ga0495684_0005492 | |||
| 2031 | Ga0495684_0008869 | |||
| 2032 | Ga0495684_0023744 | |||
| 2033 | Ga0495684_0024646 | |||
| 2034 | Ga0495684_0038008 | |||
| 2035 | Ga0495684_0079076 | |||
| 2036 | Ga0495684_0087353 | |||
| 2037 | Ga0495684_0310933 | |||
| 2038 | Ga0495593_0008890 | |||
| 2039 | Ga0495593_0044129 | |||
| 2040 | Ga0495602_0000528 | |||
| 2041 | Ga0495602_0002901 | |||
| 2042 | Ga0495602_0003747 | |||
| 2043 | Ga0495602_0004327 | |||
| 2044 | Ga0495602_0007841 | |||
| 2045 | Ga0495602_0013999 | |||
| 2046 | Ga0495602_0061569 | |||
| 2047 | Ga0495602_0071419 | |||
| 2048 | Ga0495602_0099009 | |||
| 2049 | Ga0495602_0104372 | |||
| 2050 | Ga0495602_0155734 | |||
| 2051 | Ga0495602_0202318 | |||
| 2052 | Ga0495614_0012804 | |||
| 2053 | Ga0496102_0047302 | |||
| 2054 | Ga0496102_0059595 | |||
| 2055 | Ga0496102_0405958 | |||
| 2056 | Ga0496103_0026797 | |||
| 2057 | Ga0496103_0038074 | |||
| 2058 | Ga0496103_0315855 | |||
| 2059 | Ga0496104_0004436 | |||
| 2060 | Ga0496104_0052341 | |||
| 2061 | Ga0496104_0071069 | |||
| 2062 | Ga0496104_0159841 | |||
| 2063 | Ga0496104_0186784 | |||
| 2064 | Ga0496104_0256474 | |||
| 2065 | Ga0496104_0414364 | |||
| 2066 | Ga0496105_0004641 | |||
| 2067 | Ga0496105_0011305 | |||
| 2068 | Ga0496105_0020726 | |||
| 2069 | Ga0496105_0032338 | |||
| 2070 | Ga0496105_0124787 | |||
| 2071 | Ga0496105_0151271 | |||
| 2072 | Ga0496106_0057493 | |||
| 2073 | Ga0496106_0186462 | |||
| 2074 | Ga0496106_0225240 | |||
| 2075 | Ga0496107_0060917 | |||
| 2076 | Ga0496108_0000044 | |||
| 2077 | Ga0496108_0030067 | |||
| 2078 | Ga0496108_0128643 | |||
| 2079 | Ga0496108_0181565 | |||
| 2080 | Ga0496108_0209141 | |||
| 2081 | Ga0496109_0018593 | |||
| 2082 | Ga0496109_0021728 | |||
| 2083 | Ga0496109_0054070 | |||
| 2084 | Ga0496109_0071825 | |||
| 2085 | Ga0496109_0076187 | |||
| 2086 | Ga0496109_0085976 | |||
| 2087 | Ga0496109_0278402 | |||
| 2088 | Ga0496110_0011075 | |||
| 2089 | Ga0496110_0011129 | |||
| 2090 | Ga0496110_0027338 | |||
| 2091 | Ga0496110_0064584 | |||
| 2092 | Ga0496110_0237800 | |||
| 2093 | Ga0496111_0017668 | |||
| 2094 | Ga0496111_0028076 | |||
| 2095 | Ga0496112_0018822 | |||
| 2096 | Ga0496112_0021596 | |||
| 2097 | Ga0496112_0126215 | |||
| 2098 | Ga0496112_0490879 | |||
| 2099 | Ga0496113_0049205 | |||
| 2100 | Ga0496113_0052433 | |||
| 2101 | Ga0496113_0100203 | |||
| 2102 | Ga0496114_0001749 | |||
| 2103 | Ga0496114_0083569 | |||
| 2104 | Ga0496114_0124898 | |||
| 2105 | Ga0496114_0170613 | |||
| 2106 | Ga0496115_0020308 | |||
| 2107 | Ga0496115_0029369 | |||
| 2108 | Ga0496115_0285036 | |||
| 2109 | Ga0496115_0320221 | |||
| 2110 | Ga0496115_0613218 | |||
| 2111 | Ga0496126_0039778 | |||
| 2112 | Ga0496126_0048526 | |||
| 2113 | Ga0496126_0123367 | |||
| 2114 | Ga0496126_0187950 | |||
| 2115 | Ga0501032_0039247 | |||
| 2116 | Ga0501033_0084683 | |||
| 2117 | Ga0501034_0138405 | |||
| 2118 | Ga0501034_0173303 | |||
| 2119 | Ga0501036_0008710 | |||
| 2120 | Ga0501036_0411231 | |||
| 2121 | Ga0501037_0013074 | |||
| 2122 | Ga0501038_0004356 | |||
| 2123 | Ga0501039_0002568 | |||
| 2124 | Ga0501039_0259265 | |||
| 2125 | Ga0501040_0000638 | |||
| 2126 | Ga0501040_0022595 | |||
| 2127 | Ga0501041_0004180 | |||
| 2128 | Ga0501041_0071913 | |||
| 2129 | Ga0501041_0142013 | |||
| 2130 | Ga0501042_0001542 | |||
| 2131 | Ga0501042_0106009 | |||
| 2132 | Ga0501046_0003943 | |||
| 2133 | Ga0501047_0043348 | |||
| 2134 | Ga0501048_0001512 | |||
| 2135 | Ga0501068_0010652 | |||
| 2136 | Ga0501068_0264839 | |||
| 2137 | Ga0501071_0058661 | |||
| 2138 | Ga0501071_0062261 | |||
| 2139 | Ga0501071_0123166 | |||
| 2140 | Ga0501072_0007652 | |||
| 2141 | Ga0501072_0018337 | |||
| 2142 | Ga0501072_0039543 | |||
| 2143 | Ga0501072_0102642 | |||
| 2144 | Ga0501073_0099807 | |||
| 2145 | Ga0501074_0003243 | |||
| 2146 | Ga0501075_0000277 | |||
| 2147 | Ga0501075_0112324 | |||
| 2148 | Ga0501075_0158872 | |||
| 2149 | Ga0501076_0001433 | |||
| 2150 | Ga0501077_0023553 | |||
| 2151 | Ga0501077_0088993 | |||
| 2152 | Ga0501079_0001955 | |||
| 2153 | Ga0501079_0102944 | |||
| 2154 | Ga0501080_0095107 | |||
| 2155 | Ga0501081_0001720 | |||
| 2156 | Ga0501045_0001662 | |||
| 2157 | Ga0501045_0112994 | |||
| 2158 | nmdc:mga03683_5897_c1 | |||
| 2159 | nmdc:mga03n38_172076_c1 | |||
| 2160 | nmdc:mga00v17_133201_c1 | |||
| 2161 | nmdc:mga00v17_160253_c1 | |||
| 2162 | nmdc:mga0yw44_122806_c1 | |||
| 2163 | nmdc:mga0yw44_187344_c1 | |||
| 2164 | nmdc:mga0yw44_214514_c1 | |||
| 2165 | nmdc:mga0yw44_24073_c1 | |||
| 2166 | nmdc:mga0yw44_4224_c1 | |||
| 2167 | nmdc:mga0yw44_51877_c1 | |||
| 2168 | nmdc:mga0yw44_72649_c1 | |||
| 2169 | nmdc:mga06z11_15296_c1 | |||
| 2170 | nmdc:mga07m45_13133_c1 | |||
| 2171 | nmdc:mga05p37_1301_c1 | |||
| 2172 | nmdc:mga05p37_17636_c1 | |||
| 2173 | nmdc:mga05p37_265356_c1 | |||
| 2174 | nmdc:mga05p37_27313_c1 | |||
| 2175 | nmdc:mga05p37_314410_c1 | |||
| 2176 | nmdc:mga09592_24814_c1 | |||
| 2177 | nmdc:mga09592_464738_c1 | |||
| 2178 | nmdc:mga0qj67_276237_c1 | |||
| 2179 | nmdc:mga0qj67_374893_c1 | |||
| 2180 | nmdc:mga06r32_187681_c1 | |||
| 2181 | nmdc:mga06r32_3234_c1 | |||
| 2182 | nmdc:mga06r32_492819_c1 | |||
| 2183 | nmdc:mga06r32_763465_c1 | |||
| 2184 | nmdc:mga08y16_58173_c1 | |||
| 2185 | nmdc:mga08y16_68628_c1 | |||
| 2186 | nmdc:mga0n895_156016_c1 | |||
| 2187 | nmdc:mga0n895_200270_c1 | |||
| 2188 | nmdc:mga0n895_492854_c1 | |||
| 2189 | nmdc:mga08x19_12714_c1 | |||
| 2190 | Ga0495601_0007723 | |||
| 2191 | Ga0495601_0027150 | |||
| 2192 | Ga0495601_0055859 | |||
| 2193 | Ga0495601_0057977 | |||
| 2194 | Ga0495601_0063250 | |||
| 2195 | Ga0495612_0002340 | |||
| 2196 | Ga0495612_0026559 | |||
| 2197 | Ga0495612_0031027 | |||
| 2198 | Ga0495612_0052743 | |||
| 2199 | Ga0495595_0000861 | |||
| 2200 | Ga0495595_0044956 | |||
| 2201 | Ga0495619_0002260 | |||
| 2202 | Ga0495619_0016253 | |||
| 2203 | Ga0495619_0022429 | |||
| 2204 | Ga0495619_0024254 | |||
| 2205 | Ga0495619_0099169 | |||
| 2206 | Ga0495619_0112386 | |||
| 2207 | Ga0495619_0197012 | |||
| 2208 | Ga0495619_0241774 | |||
| 2209 | Ga0500578_0006866 | |||
| 2210 | Ga0500644_0019789 | |||
| 2211 | Ga0500646_0000384 | |||
| 2212 | Ga0500641_0038611 | |||
| 2213 | Ga0500650_0090131 | |||
| 2214 | Ga0500553_018407 | |||
| 2215 | Ga0500554_032619 | |||
| 2216 | Ga0500560_061254 | |||
| 2217 | Ga0500593_000263 | |||
| 2218 | Ga0500594_0036492 | |||
| 2219 | Ga0500652_024316 | |||
| 2220 | Ga0500577_0000812 | |||
| 2221 | Ga0500586_091487 | |||
| 2222 | Ga0500616_0007079 | |||
| 2223 | Ga0500630_038767 | |||
| 2224 | Ga0500611_016981 | |||
| 2225 | Ga0501084_0002917 | |||
| 2226 | Ga0501084_0055480 | |||
| 2227 | Ga0501082_0003080 | |||
| 2228 | Ga0501082_0030428 | |||
| 2229 | Ga0530510_0028627 | |||
| 2230 | 2586063783 | |||
| 2231 | 2676486086 | |||
| 2232 | 2795791568 | |||
| 2233 | 2816420855 | |||
| 2234 | 2855675852 | |||
| 2235 | 2855678782 | |||
| 2236 | 2857295203 | |||
| 2237 | 2858853097 | |||
| 2238 | 2858882964 | |||
| 2239 | 2858891128 | |||
| 2240 | 2858901788 | |||
| 2241 | 2862516790 | |||
| 2242 | 2869049870 | |||
| 2243 | 2869067251 | |||
| 2244 | 2869068868 | |||
| 2245 | 2880490382 | |||
| 2246 | 2880502152 | |||
| 2247 | 2891398820 | |||
| 2248 | 2891565978 | |||
| 2249 | 2891567055 | |||
| 2250 | 2895433352 | |||
| 2251 | 2895438405 | |||
| 2252 | 2895442974 | |||
| 2253 | 2929230654 | |||
| 2254 | 8003324090 | |||
| 2255 | 8053945867 | |||
| 2256 | 8054708612 | |||
| 2257 | 8054735692 | |||
| 2258 | 8057569480 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d06-assembly1.cif.gz_B | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.9044 | 2 | 218 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9036 | 3 | 217 |
| 8fee-assembly1.cif.gz_H | structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) | 0.897 | 1 | 219 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.8951 | 3 | 218 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.8941 | 2 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9268 | 1 | 218 | 3.40.50.300 |
| af_Q2G1L8_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9197 | 1 | 212 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9188 | 2 | 218 | 3.40.50.300 |
| af_Q2FZR0_1_324_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.915 | 1 | 219 | 3.40.50.300 |
| af_P37624_8_264_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9145 | 2 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C5ZNW8-F1-model_v4 | Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-) | 0.9508 | 3 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A520NVZ7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9369 | 2 | 218 |
GO:0005524
GO:0016887 |
| AF-A0A1G6BNS4-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9345 | 4 | 218 |
GO:0005524
GO:0016887 |
| AF-A0A3M1J999-F1-model_v4 | ABC transporter ATP-binding protein | 0.9328 | 2 | 218 |
GO:0005524
GO:0016887 |
| AF-A0A269XWW6-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 0.9286 | 2 | 212 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |