F490421

General Info

Members Datasets Scaffolds Average Seq Length
1122 398 944 169

Family's Representative Sequence

Representative Sequence 3300042530|Ga0450916_051235|Ga0450916_051235_63_620
Length 185
Sequence MVSIIENHSQKGRHAMSAAHPLHALYSHHHGWLQSWLRRRLGCADDAADLAQDTFVRLLARPTAIAPDAMREPRAYLTTVARGLLVDFWRRGELERAYLADLALQPEVLQPSPEERLAAVQMLHAVDALLQGLTPKTRAAWLMNRLDGLTHAEIAEQLQVSVPRVRQYLANAMRHAYHLRFGGAA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231018 Pseudomonas sp. GM60 Isolate Nodule
13 2511231019 Pseudomonas sp. GM67 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
19 2547132374 Acidovorax radicis N35 Isolate Unclassified
20 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
21 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
22 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
23 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
26 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
27 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
28 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
29 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
30 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
31 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
32 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
33 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
34 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
35 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
36 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
37 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
38 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
39 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
40 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
41 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
42 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
43 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
44 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
45 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
46 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
47 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
48 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
49 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
50 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
51 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
52 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
53 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
54 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
55 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
56 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
57 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
58 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
59 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
60 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
61 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
62 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
63 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
64 2643221569 Achromobacter sp. Root565 Isolate Unclassified
65 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
66 2643221594 Achromobacter sp. Root170 Isolate Unclassified
67 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
68 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
69 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
70 2643221717 Acidovorax sp. Root267 Isolate Unclassified
71 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
72 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
73 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
74 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
75 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
76 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
77 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
78 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
79 2738541277 Variovorax sp. GV051 Isolate Unclassified
80 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
81 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
82 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
83 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
84 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
85 2738543019 Variovorax sp. GV040 Isolate Unclassified
86 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
87 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
88 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
89 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
90 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
91 2773857670 Pseudomonas sp. 478 Isolate Unclassified
92 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
93 2773857673 Pseudomonas sp. 443 Isolate Unclassified
94 2784132063 Pseudomonas sp. 424 Isolate Unclassified
95 2784132072 Pseudomonas sp. 460 Isolate Unclassified
96 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
97 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
98 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
99 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
100 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
101 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
102 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
103 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
104 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
105 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
106 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
107 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
108 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
109 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
110 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
111 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
112 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
113 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
114 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
115 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
116 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
117 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
118 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
119 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
120 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
121 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
122 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
123 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
124 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
125 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
126 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
127 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
128 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
129 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
130 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
131 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
132 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
133 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
134 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
135 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
136 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
137 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
138 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
139 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
140 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
141 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
142 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
143 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
144 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
145 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
146 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
147 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
148 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
149 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
150 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
151 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
152 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
153 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
154 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
155 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
156 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
157 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
158 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
159 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
160 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
161 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
162 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
163 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
164 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
165 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
166 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
167 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
168 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
169 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
170 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
171 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
172 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
173 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
174 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
175 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
176 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
177 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
178 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
179 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
180 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
181 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
182 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
183 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
184 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
185 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
186 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
187 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
188 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
189 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
190 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
191 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
192 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
193 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
194 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
195 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
196 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
199 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
200 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
201 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
202 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
203 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
204 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
205 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
206 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
207 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
208 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
209 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
210 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
211 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
212 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
215 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
216 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
217 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
237 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
238 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
239 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
240 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
241 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
242 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
262 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
263 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
264 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
265 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
266 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
267 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
268 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
271 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
274 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
275 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
276 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
277 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
278 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
279 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
280 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
287 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
288 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
293 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
296 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
297 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
304 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
305 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
308 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
354 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
365 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
371 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
372 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
373 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
374 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
375 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
376 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
377 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
378 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
379 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
384 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
385 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
386 8052494512 Pseudomonas putida LD6 Isolate Unclassified
387 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
388 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
389 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
390 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
391 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
392 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
393 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
394 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
395 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
396 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
397 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
398 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 0
Isolates 15.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 2.67
Nodule 1.6
Rhizoplane 4.99
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 14.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_31 2124908027 Bacteria 35538
2 SwRhRL2b_contig_1674408 2162886007 Bacteria 910
3 SwRhRL2b_contig_2676426 2162886007 Bacteria 1702
4 SwRhRL2b_contig_458982 2162886007 Bacteria 983
5 MRS1b_contig_2142372 2162886011 Bacteria 2746
6 MBSR1b_contig_12539687 2162886012 Bacteria 878
7 JGI25155J39150_1000070 3300002704 Bacteria 64434
8 JGI25156J39149_1000039 3300002705 Bacteria 107108
9 JGI25154J39366_1000059 3300002738 Bacteria 107114
10 JGI25157J39369_1000057 3300002741 Bacteria 107108
11 JGI25151J46595_10001744 3300003187 Bacteria 14100
12 rootH2_10071751 3300003320 Bacteria 5412
13 rootH2_10084601 3300003320 Bacteria 2108
14 rootH1_10010008 3300003323 Bacteria 19315
15 rootH1_10255410 3300003323 Bacteria 3732
16 Ga0055532_1000018 3300003758 Bacteria 305466
17 Ga0055535_1009981 3300003761 Bacteria 1592
18 Ga0055536_1000005 3300003781 Bacteria 383598
19 Ga0055536_1000184 3300003781 Bacteria 51874
20 Ga0055536_1003982 3300003781 Bacteria 7730
21 Ga0055530_10000001 3300003791 Bacteria 383067
22 Ga0055540_1000034 3300003792 Bacteria 170218
23 Ga0055540_1000389 3300003792 Bacteria 36345
24 Ga0058692_1027976 3300003856 Bacteria 1092
25 Ga0065714_10002392 3300005288 Bacteria 32693
26 Ga0065714_10064652 3300005288 Bacteria 25776
27 Ga0065714_10166152 3300005288 Bacteria 1027
28 Ga0065704_10000856 3300005289 Bacteria 13196
29 Ga0065704_10070988 3300005289 Bacteria 13962
30 Ga0065704_10185354 3300005289 Bacteria 1207
31 Ga0065704_10261789 3300005289 Bacteria 963
32 Ga0065704_10386714 3300005289 Bacteria 767
33 Ga0065712_10010277 3300005290 Bacteria 1975
34 Ga0065712_10067849 3300005290 Bacteria 25993
35 Ga0065715_10133180 3300005293 Bacteria 1970
36 Ga0070670_100000746 3300005331 Bacteria 25279
37 Ga0070670_100002551 3300005331 Bacteria 15031
38 Ga0070661_100000040 3300005344 Bacteria 99921
39 Ga0070669_100003617 3300005353 Bacteria 11156
40 Ga0070662_100001826 3300005457 Bacteria 13055
41 Ga0070664_100000270 3300005564 Bacteria 37349
42 Ga0068851_10000234 3300005834 Bacteria 26299
43 Ga0075432_10003842 3300006058 Bacteria 5120
44 Ga0075432_10005844 3300006058 Bacteria 4187
45 Ga0075432_10190804 3300006058 Bacteria 806
46 Ga0079104_1000342 3300006946 Bacteria 56194
47 Ga0079104_1000375 3300006946 Bacteria 52652
48 Ga0079104_1048079 3300006946 Bacteria 962
49 Ga0099826_10049123 3300006948 Bacteria 2848
50 Ga0105251_10001171 3300009011 Bacteria 22761
51 Ga0105251_10001766 3300009011 Bacteria 18001
52 Ga0105251_10014975 3300009011 Bacteria 4257
53 Ga0105251_10022139 3300009011 Bacteria 3307
54 Ga0105251_10025213 3300009011 Bacteria 3045
55 Ga0105251_10043968 3300009011 Bacteria 2160
56 Ga0105251_10073272 3300009011 Bacteria 1591
57 Ga0105251_10186648 3300009011 Bacteria 934
58 Ga0105251_10205721 3300009011 Bacteria 886
59 Ga0105251_10224399 3300009011 Bacteria 846
60 Ga0105251_10254079 3300009011 Bacteria 792
61 Ga0105244_10000855 3300009036 Bacteria 25655
62 Ga0105244_10001212 3300009036 Bacteria 21140
63 Ga0105244_10001892 3300009036 Bacteria 16271
64 Ga0105244_10002180 3300009036 Bacteria 15010
65 Ga0105244_10002386 3300009036 Bacteria 14232
66 Ga0105244_10002471 3300009036 Bacteria 13912
67 Ga0105244_10019232 3300009036 Bacteria 3819
68 Ga0105244_10074339 3300009036 Bacteria 1691
69 Ga0105250_10000190 3300009092 Bacteria 52445
70 Ga0105250_10000219 3300009092 Bacteria 47630
71 Ga0105250_10022505 3300009092 Bacteria 2541
72 Ga0105250_10069122 3300009092 Bacteria 1426
73 Ga0105242_10013822 3300009176 Bacteria 6247
74 Ga0105237_10000742 3300009545 Bacteria 44973
75 Ga0105246_10005440 3300011119 Bacteria 7759
76 Ga0105246_10180108 3300011119 Bacteria 1626
77 Ga0157373_10000060 3300013100 Bacteria 95775
78 Ga0157373_10001831 3300013100 Bacteria 16198
79 Ga0157373_10003112 3300013100 Bacteria 12538
80 Ga0157373_10006039 3300013100 Bacteria 9054
81 Ga0157373_10014344 3300013100 Bacteria 5806
82 Ga0157373_10015017 3300013100 Bacteria 5664
83 Ga0157373_10026170 3300013100 Bacteria 4217
84 Ga0157373_10034043 3300013100 Bacteria 3660
85 Ga0157373_10132878 3300013100 Bacteria 1750
86 Ga0157373_10378720 3300013100 Bacteria 1012
87 Ga0157371_10000202 3300013102 Bacteria 87749
88 Ga0157371_10002980 3300013102 Bacteria 15722
89 Ga0157371_10033137 3300013102 Bacteria 3713
90 Ga0157371_10070724 3300013102 Bacteria 2470
91 Ga0157371_10120287 3300013102 Bacteria 1867
92 Ga0157371_10217087 3300013102 Bacteria 1373
93 Ga0157371_10557546 3300013102 Bacteria 850
94 Ga0157370_10001055 3300013104 Bacteria 34671
95 Ga0157370_10001618 3300013104 Bacteria 27831
96 Ga0157370_10008371 3300013104 Bacteria 11157
97 Ga0157370_10031246 3300013104 Bacteria 5211
98 Ga0157370_10037073 3300013104 Bacteria 4728
99 Ga0157370_10074299 3300013104 Bacteria 3206
100 Ga0157370_10097094 3300013104 Bacteria 2764
101 Ga0157370_10112096 3300013104 Bacteria 2550
102 Ga0157370_10351707 3300013104 Bacteria 1358
103 Ga0157370_10369563 3300013104 Bacteria 1321
104 Ga0157370_10426056 3300013104 Bacteria 1220
105 Ga0157370_11002634 3300013104 Bacteria 756
106 Ga0157369_10000564 3300013105 Bacteria 48711
107 Ga0157369_10003476 3300013105 Bacteria 18686
108 Ga0157369_10006663 3300013105 Bacteria 13347
109 Ga0157369_10006921 3300013105 Bacteria 13083
110 Ga0157369_10008854 3300013105 Bacteria 11526
111 Ga0157369_10099091 3300013105 Bacteria 3107
112 Ga0157369_10347273 3300013105 Bacteria 1541
113 Ga0157369_10592230 3300013105 Bacteria 1145
114 Ga0157369_10690107 3300013105 Bacteria 1052
115 Ga0157369_10848655 3300013105 Bacteria 938
116 Ga0157369_10912025 3300013105 Bacteria 901
117 Ga0157369_11192834 3300013105 Bacteria 777
118 Ga0163162_10000169 3300013306 Bacteria 60285
119 Ga0163162_10055581 3300013306 Bacteria 3986
120 Ga0163162_10477072 3300013306 Bacteria 1379
121 Ga0163162_11209038 3300013306 Bacteria 858
122 Ga0157372_10006228 3300013307 Bacteria 12684
123 Ga0157372_10099416 3300013307 Bacteria 3319
124 Ga0157372_10217717 3300013307 Bacteria 2213
125 Ga0157375_10000335 3300013308 Bacteria 42492
126 Ga0157375_10031646 3300013308 Bacteria 5006
127 Ga0157375_10100891 3300013308 Bacteria 2968
128 Ga0157375_10276316 3300013308 Bacteria 1842
129 Ga0182008_10000767 3300014497 Bacteria 22525
130 Ga0182008_10001183 3300014497 Bacteria 17993
131 Ga0182008_10001207 3300014497 Bacteria 17812
132 Ga0182008_10008493 3300014497 Bacteria 5608
133 Ga0182008_10080027 3300014497 Bacteria 1607
134 Ga0182008_10108385 3300014497 Bacteria 1375
135 Ga0182006_1000481 3300015261 Bacteria 31265
136 Ga0182006_1001078 3300015261 Bacteria 17501
137 Ga0182006_1002896 3300015261 Bacteria 9112
138 Ga0182006_1007025 3300015261 Bacteria 5182
139 Ga0182006_1007365 3300015261 Bacteria 5042
140 Ga0182006_1010097 3300015261 Bacteria 4206
141 Ga0182006_1016738 3300015261 Bacteria 3124
142 Ga0182006_1036657 3300015261 Bacteria 1949
143 Ga0182006_1070604 3300015261 Bacteria 1296
144 Ga0182006_1155308 3300015261 Bacteria 774
145 Ga0182007_10000913 3300015262 Bacteria 16330
146 Ga0182007_10004723 3300015262 Bacteria 6129
147 Ga0182005_1001512 3300015265 Bacteria 9275
148 Ga0182005_1027713 3300015265 Bacteria 1544
149 Ga0163161_10070143 3300017792 Bacteria 2562
150 Ga0163161_10078763 3300017792 Bacteria 2422
151 Ga0163161_10084117 3300017792 Bacteria 2346
152 Ga0163161_10291029 3300017792 Bacteria 1284
153 Ga0163161_10311084 3300017792 Bacteria 1243
154 Ga0163161_11106420 3300017792 Bacteria 681
155 Ga0209435_100007 3300025206 Bacteria 516857
156 Ga0209147_100017 3300025229 Bacteria 516857
157 Ga0209258_100318 3300025242 Bacteria 74657
158 Ga0209646_1000096 3300025246 Bacteria 182388
159 Ga0209026_1000052 3300025250 Bacteria 248897
160 Ga0209759_1000174 3300025256 Bacteria 107149
161 Ga0209455_1005973 3300025272 Bacteria 3666
162 Ga0209676_1000003 3300025292 Bacteria 1454178
163 Ga0209676_1000158 3300025292 Bacteria 162469
164 Ga0209676_1000852 3300025292 Bacteria 39349
165 Ga0209676_1004254 3300025292 Bacteria 8081
166 Ga0209676_1004572 3300025292 Bacteria 7657
167 Ga0209025_1000244 3300025294 Bacteria 127938
168 Ga0209050_1000004 3300025298 Bacteria 1600040
169 Ga0209050_1000013 3300025298 Bacteria 811408
170 Ga0209050_1024709 3300025298 Bacteria 2068
171 Ga0209051_1000006 3300025303 Bacteria 1015785
172 Ga0209051_1000007 3300025303 Bacteria 811408
173 Ga0209257_1011005 3300025304 Bacteria 4442
174 Ga0207696_1000002 3300025711 Bacteria 1098043
175 Ga0207696_1000186 3300025711 Bacteria 96544
176 Ga0207696_1005345 3300025711 Bacteria 5339
177 Ga0207696_1065657 3300025711 Bacteria 1015
178 Ga0207655_1000100 3300025728 Bacteria 186348
179 Ga0207655_1000143 3300025728 Bacteria 137102
180 Ga0207655_1000207 3300025728 Bacteria 102951
181 Ga0207655_1000338 3300025728 Bacteria 68161
182 Ga0207655_1006514 3300025728 Bacteria 7721
183 Ga0207655_1026158 3300025728 Bacteria 2808
184 Ga0207655_1035368 3300025728 Bacteria 2231
185 Ga0207655_1053412 3300025728 Bacteria 1616
186 Ga0207655_1069289 3300025728 Bacteria 1319
187 Ga0207655_1214997 3300025728 Bacteria 564
188 Ga0207713_1001164 3300025735 Bacteria 22239
189 Ga0207713_1002610 3300025735 Bacteria 12984
190 Ga0207713_1013743 3300025735 Bacteria 4249
191 Ga0207713_1083131 3300025735 Bacteria 1146
192 Ga0207713_1086808 3300025735 Bacteria 1110
193 Ga0207713_1110979 3300025735 Bacteria 932
194 Ga0207713_1130759 3300025735 Bacteria 831
195 Ga0207713_1137655 3300025735 Bacteria 800
196 Ga0207713_1164143 3300025735 Bacteria 706
197 Ga0207671_10002339 3300025914 Bacteria 20442
198 Ga0207649_10000116 3300025920 Bacteria 67931
199 Ga0207650_10001235 3300025925 Bacteria 18606
200 Ga0207650_10001827 3300025925 Bacteria 15044
201 Ga0207706_10004210 3300025933 Bacteria 13549
202 Ga0207686_10007625 3300025934 Bacteria 5829
203 Ga0207679_10000054 3300025945 Bacteria 108733
204 Ga0209281_1000009 3300027111 Bacteria 771717
205 Ga0209281_1000391 3300027111 Bacteria 68959
206 Ga0209281_1014649 3300027111 Bacteria 1654
207 Ga0209371_1000310 3300027312 Bacteria 54149
208 Ga0209371_1029496 3300027312 Bacteria 1211
209 Ga0209974_10039317 3300027876 Bacteria 1573
210 Ga0209974_10075546 3300027876 Bacteria 1154
211 Ga0207428_10020471 3300027907 Bacteria 5620
212 Ga0207428_10047658 3300027907 Bacteria 3441
213 Ga0268256_1000267 3300030500 Bacteria 54149
214 Ga0307511_10132818 3300030521 Bacteria 1493
215 Ga0307511_10148653 3300030521 Bacteria 1352
216 Ga0314311_1008575 3300030733 Bacteria 1611
217 Ga0316179_1048387 3300030734 Bacteria 1404
218 Ga0316183_1085981 3300030742 Bacteria 1079
219 Ga0316183_1191527 3300030742 Bacteria 2380
220 Ga0265316_10263490 3300031344 Bacteria 1263
221 Ga0307509_10126936 3300031507 Bacteria 2515
222 Ga0307408_100000085 3300031548 Bacteria 104335
223 Ga0307408_100001490 3300031548 Bacteria 17376
224 Ga0307408_100004849 3300031548 Bacteria 9060
225 Ga0307408_100144723 3300031548 Bacteria 1869
226 Ga0307405_10000090 3300031731 Bacteria 38827
227 Ga0307405_10003429 3300031731 Bacteria 7280
228 Ga0307405_10003770 3300031731 Bacteria 7041
229 Ga0307405_10310777 3300031731 Bacteria 1200
230 Ga0307405_10409759 3300031731 Bacteria 1063
231 Ga0307413_10012224 3300031824 Bacteria 4264
232 Ga0307413_10083407 3300031824 Bacteria 2056
233 Ga0307413_10405583 3300031824 Bacteria 1069
234 Ga0307406_10070526 3300031901 Bacteria 2288
235 Ga0307406_10379876 3300031901 Bacteria 1113
236 Ga0307406_10506009 3300031901 Bacteria 980
237 Ga0307407_10119123 3300031903 Bacteria 1670
238 Ga0307412_10001395 3300031911 Bacteria 13422
239 Ga0307412_10003640 3300031911 Bacteria 8563
240 Ga0307412_10067558 3300031911 Bacteria 2427
241 Ga0307412_10372683 3300031911 Bacteria 1153
242 Ga0307409_100211510 3300031995 Bacteria 1743
243 Ga0307414_10031507 3300032004 Bacteria 3479
244 Ga0307414_10094009 3300032004 Bacteria 2236
245 Ga0307414_10193898 3300032004 Bacteria 1646
246 Ga0307411_10015937 3300032005 Bacteria 4239
247 Ga0307411_10647690 3300032005 Bacteria 914
248 Ga0307510_10000175 3300033180 Bacteria 54436
249 Ga0439438_000022 3300041405 Bacteria 108022
250 Ga0439438_000041 3300041405 Bacteria 64880
251 Ga0439438_000583 3300041405 Bacteria 16569
252 Ga0439438_002119 3300041405 Bacteria 8560
253 Ga0439438_003103 3300041405 Bacteria 6834
254 Ga0439438_004708 3300041405 Bacteria 5173
255 Ga0439438_005441 3300041405 Bacteria 4683
256 Ga0439438_016989 3300041405 Bacteria 2105
257 Ga0439438_022058 3300041405 Bacteria 1770
258 Ga0439438_047591 3300041405 Bacteria 1098
259 Ga0439438_094930 3300041405 Bacteria 725
260 Ga0439438_137155 3300041405 Bacteria 586
261 Ga0439447_001918 3300041407 Bacteria 7606
262 Ga0439447_002864 3300041407 Bacteria 6188
263 Ga0439447_006253 3300041407 Bacteria 3879
264 Ga0439447_007186 3300041407 Bacteria 3553
265 Ga0439447_010507 3300041407 Bacteria 2742
266 Ga0439447_010957 3300041407 Bacteria 2669
267 Ga0439447_013661 3300041407 Bacteria 2298
268 Ga0439466_0000141 3300041411 Bacteria 28625
269 Ga0439466_0000266 3300041411 Bacteria 20203
270 Ga0439466_0002338 3300041411 Bacteria 7439
271 Ga0439466_0002671 3300041411 Bacteria 6970
272 Ga0439466_0004851 3300041411 Bacteria 5170
273 Ga0439466_0007536 3300041411 Bacteria 4116
274 Ga0439466_0010019 3300041411 Bacteria 3526
275 Ga0439466_0012180 3300041411 Bacteria 3173
276 Ga0439466_0015400 3300041411 Bacteria 2777
277 Ga0439466_0016689 3300041411 Bacteria 2651
278 Ga0439466_0053514 3300041411 Bacteria 1316
279 Ga0439466_0110551 3300041411 Bacteria 853
280 Ga0439465_0007044 3300041413 Bacteria 3573
281 Ga0439465_0074554 3300041413 Bacteria 1142
282 Ga0451807_0754821 3300041486 Bacteria 973
283 Ga0439441_056386 3300042001 Bacteria 819
284 Ga0439445_0010331 3300042004 Bacteria 2208
285 Ga0439445_0023619 3300042004 Bacteria 1558
286 Ga0439432_000021 3300042006 Bacteria 55465
287 Ga0439432_000170 3300042006 Bacteria 22723
288 Ga0439432_001425 3300042006 Bacteria 8999
289 Ga0439432_003763 3300042006 Bacteria 5602
290 Ga0439432_005214 3300042006 Bacteria 4694
291 Ga0439432_017653 3300042006 Bacteria 2393
292 Ga0439432_018172 3300042006 Bacteria 2353
293 Ga0439432_048198 3300042006 Bacteria 1335
294 Ga0439451_003852 3300042009 Bacteria 3049
295 Ga0439451_007999 3300042009 Bacteria 2145
296 Ga0439451_008766 3300042009 Bacteria 2048
297 Ga0439451_011062 3300042009 Bacteria 1819
298 Ga0439451_016969 3300042009 Bacteria 1466
299 Ga0439451_033133 3300042009 Bacteria 1039
300 Ga0439451_054517 3300042009 Bacteria 800
301 Ga0439452_000024 3300042010 Bacteria 230396
302 Ga0439452_000921 3300042010 Bacteria 13342
303 Ga0439452_001165 3300042010 Bacteria 11383
304 Ga0439452_001176 3300042010 Bacteria 11273
305 Ga0439452_003147 3300042010 Bacteria 5844
306 Ga0439452_014799 3300042010 Bacteria 2157
307 Ga0439452_026604 3300042010 Bacteria 1458
308 Ga0439452_026743 3300042010 Bacteria 1453
309 Ga0439452_050641 3300042010 Bacteria 952
310 Ga0439452_085073 3300042010 Bacteria 686
311 Ga0439456_000026 3300042013 Bacteria 54488
312 Ga0439456_003444 3300042013 Bacteria 3204
313 Ga0439456_003768 3300042013 Bacteria 3084
314 Ga0439456_012478 3300042013 Bacteria 1761
315 Ga0439456_014070 3300042013 Bacteria 1667
316 Ga0439456_041958 3300042013 Bacteria 992
317 Ga0439456_051438 3300042013 Bacteria 900
318 Ga0439456_064927 3300042013 Bacteria 805
319 Ga0439456_090482 3300042013 Bacteria 687
320 Ga0439463_000785 3300042016 Bacteria 8767
321 Ga0439463_007759 3300042016 Bacteria 2650
322 Ga0439463_022307 3300042016 Bacteria 1584
323 Ga0439463_036203 3300042016 Bacteria 1250
324 Ga0450911_000060 3300042115 Bacteria 44515
325 Ga0450911_001750 3300042115 Bacteria 4701
326 Ga0450911_003794 3300042115 Bacteria 2588
327 Ga0450911_005171 3300042115 Bacteria 2051
328 Ga0450911_007063 3300042115 Bacteria 1645
329 Ga0450911_016867 3300042115 Bacteria 964
330 Ga0450919_000326 3300042121 Bacteria 5694
331 Ga0450919_002434 3300042121 Bacteria 2409
332 Ga0450920_000150 3300042122 Bacteria 9685
333 Ga0450922_000954 3300042124 Bacteria 2933
334 Ga0450922_001121 3300042124 Bacteria 2657
335 Ga0450923_013522 3300042125 Bacteria 1501
336 Ga0450923_048094 3300042125 Bacteria 911
337 Ga0450890_001212 3300042127 Bacteria 3735
338 Ga0450900_044915 3300042136 Bacteria 667
339 Ga0450902_014411 3300042137 Bacteria 1278
340 Ga0450902_029411 3300042137 Bacteria 922
341 Ga0450903_001040 3300042138 Bacteria 5295
342 Ga0450903_004441 3300042138 Bacteria 2389
343 Ga0450903_018412 3300042138 Bacteria 1087
344 Ga0450903_018526 3300042138 Bacteria 1083
345 Ga0450905_000784 3300042142 Bacteria 3917
346 Ga0450905_002023 3300042142 Bacteria 2586
347 Ga0450905_013655 3300042142 Bacteria 1152
348 Ga0450906_000302 3300042145 Bacteria 9881
349 Ga0450906_000817 3300042145 Bacteria 6850
350 Ga0450906_003854 3300042145 Bacteria 3186
351 Ga0450906_028825 3300042145 Bacteria 983
352 Ga0450907_000066 3300042146 Bacteria 40668
353 Ga0450907_000757 3300042146 Bacteria 8164
354 Ga0450907_009804 3300042146 Bacteria 1588
355 Ga0450907_011468 3300042146 Bacteria 1471
356 Ga0450910_000126 3300042147 Bacteria 8154
357 Ga0450910_002340 3300042147 Bacteria 2482
358 Ga0439446_0007400 3300042156 Bacteria 2885
359 Ga0439446_0007771 3300042156 Bacteria 2826
360 Ga0439446_0073087 3300042156 Bacteria 1052
361 Ga0450908_002311 3300042184 Bacteria 3729
362 Ga0450908_011017 3300042184 Bacteria 1660
363 Ga0450908_060913 3300042184 Bacteria 663
364 Ga0450909_001077 3300042185 Bacteria 3760
365 Ga0450909_002130 3300042185 Bacteria 2793
366 Ga0450909_002444 3300042185 Bacteria 2630
367 Ga0439434_0000098 3300042435 Bacteria 22084
368 Ga0439464_0003538 3300042439 Bacteria 3950
369 Ga0439464_0015257 3300042439 Bacteria 2072
370 Ga0439460_0007827 3300042461 Bacteria 2683
371 Ga0439460_0038210 3300042461 Bacteria 1399
372 Ga0439460_0047252 3300042461 Bacteria 1281
373 Ga0439460_0163308 3300042461 Bacteria 747
374 Ga0450916_051235 3300042530 Bacteria 651
375 Ga0450918_005168 3300042531 Bacteria 2351
376 Ga0450918_018813 3300042531 Bacteria 1205
377 Ga0450918_022137 3300042531 Bacteria 1110
378 Ga0450893_0000869 3300042532 Bacteria 4492
379 Ga0450893_0004953 3300042532 Bacteria 2127
380 Ga0450901_001078 3300042533 Bacteria 3170
381 Ga0439440_0000929 3300042993 Bacteria 5131
382 Ga0439440_0022470 3300042993 Bacteria 1429
383 Ga0439440_0037054 3300042993 Bacteria 1176
384 Ga0495617_000370 3300046452 Bacteria 24894
385 Ga0495617_006062 3300046452 Bacteria 4258
386 Ga0495617_011746 3300046452 Bacteria 2986
387 Ga0495617_026561 3300046452 Bacteria 1949
388 Ga0495617_049688 3300046452 Bacteria 1395
389 Ga0495617_132525 3300046452 Bacteria 798
390 Ga0495627_000014 3300046453 Bacteria 326114
391 Ga0495627_002233 3300046453 Bacteria 9595
392 Ga0495627_003656 3300046453 Bacteria 6674
393 Ga0495627_007735 3300046453 Bacteria 4095
394 Ga0495627_020321 3300046453 Bacteria 2214
395 Ga0495627_027688 3300046453 Bacteria 1816
396 Ga0495627_031209 3300046453 Bacteria 1684
397 Ga0495627_032894 3300046453 Bacteria 1629
398 Ga0495627_040228 3300046453 Bacteria 1440
399 Ga0495627_105650 3300046453 Bacteria 801
400 Ga0495603_0015587 3300046455 Bacteria 4600
401 Ga0495590_0036562 3300046457 Bacteria 1713
402 Ga0495590_0085421 3300046457 Bacteria 1113
403 Ga0495591_000166 3300046458 Bacteria 70296
404 Ga0495591_001075 3300046458 Bacteria 18246
405 Ga0495591_001126 3300046458 Bacteria 17645
406 Ga0495591_001237 3300046458 Bacteria 16477
407 Ga0495591_002293 3300046458 Bacteria 10847
408 Ga0495591_005540 3300046458 Bacteria 5814
409 Ga0495591_005670 3300046458 Bacteria 5715
410 Ga0495591_009978 3300046458 Bacteria 3725
411 Ga0495591_013662 3300046458 Bacteria 2955
412 Ga0495591_015397 3300046458 Bacteria 2703
413 Ga0495591_053221 3300046458 Bacteria 1098
414 Ga0495638_0005164 3300046460 Bacteria 9761
415 Ga0495638_0014672 3300046460 Bacteria 5286
416 Ga0495638_0015295 3300046460 Bacteria 5155
417 Ga0495638_0020862 3300046460 Bacteria 4326
418 Ga0495638_0026080 3300046460 Bacteria 3792
419 Ga0495638_0044301 3300046460 Bacteria 2803
420 Ga0495638_0153236 3300046460 Bacteria 1335
421 Ga0495638_0218693 3300046460 Bacteria 1066
422 Ga0495653_0001600 3300046463 Bacteria 17789
423 Ga0495653_0030206 3300046463 Bacteria 4318
424 Ga0495650_0001532 3300046471 Bacteria 21952
425 Ga0495650_0001686 3300046471 Bacteria 20366
426 Ga0495650_0004647 3300046471 Bacteria 9288
427 Ga0495650_0006603 3300046471 Bacteria 7201
428 Ga0495650_0014010 3300046471 Bacteria 4203
429 Ga0495650_0015888 3300046471 Bacteria 3842
430 Ga0495650_0017742 3300046471 Bacteria 3559
431 Ga0495650_0058724 3300046471 Bacteria 1552
432 Ga0495650_0091852 3300046471 Bacteria 1153
433 Ga0495650_0104341 3300046471 Bacteria 1060
434 Ga0495605_0000008 3300046474 Bacteria 334602
435 Ga0495605_0011998 3300046474 Bacteria 4817
436 Ga0495605_0012707 3300046474 Bacteria 4663
437 Ga0495605_0019110 3300046474 Bacteria 3666
438 Ga0495605_0058017 3300046474 Bacteria 1861
439 Ga0495605_0090653 3300046474 Bacteria 1417
440 Ga0495605_0194350 3300046474 Bacteria 886
441 Ga0495605_0194357 3300046474 Bacteria 886
442 Ga0495605_0203246 3300046474 Bacteria 862
443 Ga0495605_0212657 3300046474 Bacteria 838
444 Ga0495605_0290690 3300046474 Bacteria 693
445 Ga0495639_0005976 3300046475 Bacteria 5235
446 Ga0495639_0121677 3300046475 Bacteria 1245
447 Ga0495584_0000620 3300046491 Bacteria 23755
448 Ga0495584_0000732 3300046491 Bacteria 21660
449 Ga0495584_0005495 3300046491 Bacteria 6709
450 Ga0495584_0009435 3300046491 Bacteria 5025
451 Ga0495584_0013106 3300046491 Bacteria 4228
452 Ga0495584_0016214 3300046491 Bacteria 3800
453 Ga0495584_0020892 3300046491 Bacteria 3323
454 Ga0495584_0050133 3300046491 Bacteria 2102
455 Ga0495585_0001659 3300046492 Bacteria 17026
456 Ga0495585_0002151 3300046492 Bacteria 14347
457 Ga0495585_0003088 3300046492 Bacteria 11452
458 Ga0495585_0003149 3300046492 Bacteria 11300
459 Ga0495585_0003868 3300046492 Bacteria 9953
460 Ga0495585_0004612 3300046492 Bacteria 8898
461 Ga0495585_0007568 3300046492 Bacteria 6639
462 Ga0495585_0007971 3300046492 Bacteria 6441
463 Ga0495585_0008783 3300046492 Bacteria 6104
464 Ga0495585_0015765 3300046492 Bacteria 4389
465 Ga0495585_0041765 3300046492 Bacteria 2571
466 Ga0495585_0060459 3300046492 Bacteria 2085
467 Ga0495585_0148397 3300046492 Bacteria 1224
468 Ga0495594_0001037 3300046499 Bacteria 14463
469 Ga0495594_0029340 3300046499 Bacteria 2972
470 Ga0495594_0052485 3300046499 Bacteria 2244
471 Ga0495596_0001433 3300046500 Bacteria 13662
472 Ga0495596_0018317 3300046500 Bacteria 2887
473 Ga0495596_0043965 3300046500 Bacteria 1759
474 Ga0495596_0098940 3300046500 Bacteria 1132
475 Ga0495607_0003315 3300046501 Bacteria 12362
476 Ga0495607_0004426 3300046501 Bacteria 10337
477 Ga0495607_0006168 3300046501 Bacteria 8473
478 Ga0495607_0011169 3300046501 Bacteria 5996
479 Ga0495607_0011393 3300046501 Bacteria 5921
480 Ga0495607_0016439 3300046501 Bacteria 4774
481 Ga0495607_0030067 3300046501 Bacteria 3338
482 Ga0495607_0041144 3300046501 Bacteria 2746
483 Ga0495607_0079607 3300046501 Bacteria 1804
484 Ga0495607_0085136 3300046501 Bacteria 1727
485 Ga0495607_0104241 3300046501 Bacteria 1513
486 Ga0495607_0121671 3300046501 Bacteria 1369
487 Ga0495607_0167637 3300046501 Bacteria 1111
488 Ga0495607_0204002 3300046501 Bacteria 976
489 Ga0495583_0000039 3300046506 Bacteria 241501
490 Ga0495583_0000674 3300046506 Bacteria 44453
491 Ga0495583_0002417 3300046506 Bacteria 16039
492 Ga0495606_0000027 3300046507 Bacteria 253573
493 Ga0495606_0000504 3300046507 Bacteria 63622
494 Ga0495606_0000683 3300046507 Bacteria 52962
495 Ga0495606_0001120 3300046507 Bacteria 38299
496 Ga0495606_0003468 3300046507 Bacteria 16723
497 Ga0495606_0004930 3300046507 Bacteria 13059
498 Ga0495606_0011657 3300046507 Bacteria 7141
499 Ga0495606_0019205 3300046507 Bacteria 5094
500 Ga0495606_0019679 3300046507 Bacteria 5009
501 Ga0495606_0024611 3300046507 Bacteria 4332
502 Ga0495606_0030548 3300046507 Bacteria 3763
503 Ga0495606_0090532 3300046507 Bacteria 1882
504 Ga0495606_0100830 3300046507 Bacteria 1758
505 Ga0495606_0268426 3300046507 Bacteria 938
506 Ga0495610_0002263 3300046512 Bacteria 16265
507 Ga0495610_0002453 3300046512 Bacteria 15594
508 Ga0495610_0004826 3300046512 Bacteria 9834
509 Ga0495610_0013764 3300046512 Bacteria 4787
510 Ga0495610_0030013 3300046512 Bacteria 2854
511 Ga0495610_0046054 3300046512 Bacteria 2154
512 Ga0495610_0046168 3300046512 Bacteria 2151
513 Ga0495610_0088748 3300046512 Bacteria 1404
514 Ga0495616_0000979 3300046513 Bacteria 20483
515 Ga0495616_0003385 3300046513 Bacteria 10223
516 Ga0495616_0008500 3300046513 Bacteria 6073
517 Ga0495616_0015842 3300046513 Bacteria 4182
518 Ga0495616_0017897 3300046513 Bacteria 3904
519 Ga0495616_0020460 3300046513 Bacteria 3598
520 Ga0495616_0029231 3300046513 Bacteria 2911
521 Ga0495616_0081502 3300046513 Bacteria 1548
522 Ga0495616_0103762 3300046513 Bacteria 1330
523 Ga0495616_0157510 3300046513 Bacteria 1023
524 Ga0495620_0000031 3300046515 Bacteria 120343
525 Ga0495620_0006106 3300046515 Bacteria 6653
526 Ga0495620_0013502 3300046515 Bacteria 4178
527 Ga0495620_0019629 3300046515 Bacteria 3319
528 Ga0495620_0020504 3300046515 Bacteria 3227
529 Ga0495620_0021689 3300046515 Bacteria 3113
530 Ga0495620_0022463 3300046515 Bacteria 3036
531 Ga0495620_0023223 3300046515 Bacteria 2970
532 Ga0495620_0026376 3300046515 Bacteria 2733
533 Ga0495620_0180467 3300046515 Bacteria 816
534 Ga0495631_0000493 3300046518 Bacteria 26285
535 Ga0495631_0000777 3300046518 Bacteria 20493
536 Ga0495631_0000958 3300046518 Bacteria 17978
537 Ga0495631_0029470 3300046518 Bacteria 2495
538 Ga0495631_0033430 3300046518 Bacteria 2310
539 Ga0495631_0052385 3300046518 Bacteria 1782
540 Ga0495631_0053257 3300046518 Bacteria 1766
541 Ga0495631_0200493 3300046518 Bacteria 853
542 Ga0495631_0232535 3300046518 Bacteria 786
543 Ga0495632_0000361 3300046519 Bacteria 43155
544 Ga0495632_0000415 3300046519 Bacteria 40433
545 Ga0495632_0000977 3300046519 Bacteria 24971
546 Ga0495632_0002675 3300046519 Bacteria 13361
547 Ga0495632_0003653 3300046519 Bacteria 10796
548 Ga0495632_0016611 3300046519 Bacteria 4087
549 Ga0495632_0031357 3300046519 Bacteria 2748
550 Ga0495632_0035304 3300046519 Bacteria 2552
551 Ga0495632_0035915 3300046519 Bacteria 2524
552 Ga0495632_0088462 3300046519 Bacteria 1471
553 Ga0495632_0126701 3300046519 Bacteria 1190
554 Ga0495632_0126702 3300046519 Bacteria 1190
555 Ga0495632_0188180 3300046519 Bacteria 943
556 Ga0495632_0371963 3300046519 Bacteria 626
557 Ga0495637_0002119 3300046520 Bacteria 11147
558 Ga0495637_0007702 3300046520 Bacteria 5327
559 Ga0495637_0009090 3300046520 Bacteria 4854
560 Ga0495637_0009930 3300046520 Bacteria 4630
561 Ga0495637_0010827 3300046520 Bacteria 4397
562 Ga0495637_0017275 3300046520 Bacteria 3366
563 Ga0495637_0071604 3300046520 Bacteria 1397
564 Ga0495637_0076824 3300046520 Bacteria 1337
565 Ga0495643_0000081 3300046522 Bacteria 160004
566 Ga0495643_0000152 3300046522 Bacteria 112556
567 Ga0495643_0008930 3300046522 Bacteria 6298
568 Ga0495643_0009634 3300046522 Bacteria 5985
569 Ga0495643_0016207 3300046522 Bacteria 4382
570 Ga0495643_0019471 3300046522 Bacteria 3926
571 Ga0495643_0028896 3300046522 Bacteria 3105
572 Ga0495643_0031795 3300046522 Bacteria 2934
573 Ga0495643_0042371 3300046522 Bacteria 2480
574 Ga0495643_0042572 3300046522 Bacteria 2474
575 Ga0495643_0064579 3300046522 Bacteria 1933
576 Ga0495643_0092966 3300046522 Bacteria 1553
577 Ga0495643_0116881 3300046522 Bacteria 1350
578 Ga0495644_0011278 3300046523 Bacteria 3441
579 Ga0495644_0059714 3300046523 Bacteria 1433
580 Ga0495644_0112131 3300046523 Bacteria 1035
581 Ga0495644_0122134 3300046523 Bacteria 991
582 Ga0495648_0004346 3300046524 Bacteria 12136
583 Ga0495648_0006826 3300046524 Bacteria 9219
584 Ga0495648_0013643 3300046524 Bacteria 5994
585 Ga0495648_0014965 3300046524 Bacteria 5651
586 Ga0495648_0017079 3300046524 Bacteria 5203
587 Ga0495648_0023156 3300046524 Bacteria 4260
588 Ga0495648_0027001 3300046524 Bacteria 3853
589 Ga0495648_0031859 3300046524 Bacteria 3468
590 Ga0495648_0071340 3300046524 Bacteria 2014
591 Ga0495648_0094150 3300046524 Bacteria 1669
592 Ga0495648_0151061 3300046524 Bacteria 1211
593 Ga0495648_0174021 3300046524 Bacteria 1100
594 Ga0495648_0273344 3300046524 Bacteria 804
595 Ga0495666_0101096 3300046526 Bacteria 1358
596 Ga0495642_0000138 3300046528 Bacteria 42510
597 Ga0495642_0002932 3300046528 Bacteria 6795
598 Ga0495654_0000220 3300046530 Bacteria 53505
599 Ga0495654_0000323 3300046530 Bacteria 42007
600 Ga0495654_0003812 3300046530 Bacteria 9117
601 Ga0495654_0004506 3300046530 Bacteria 8249
602 Ga0495654_0006021 3300046530 Bacteria 6959
603 Ga0495654_0006630 3300046530 Bacteria 6554
604 Ga0495654_0008025 3300046530 Bacteria 5859
605 Ga0495654_0012098 3300046530 Bacteria 4644
606 Ga0495654_0028514 3300046530 Bacteria 2855
607 Ga0495654_0029306 3300046530 Bacteria 2807
608 Ga0495654_0034765 3300046530 Bacteria 2541
609 Ga0495654_0035836 3300046530 Bacteria 2495
610 Ga0495654_0042914 3300046530 Bacteria 2243
611 Ga0495654_0043309 3300046530 Bacteria 2231
612 Ga0495654_0182388 3300046530 Bacteria 908
613 Ga0495609_0000031 3300046538 Bacteria 213813
614 Ga0495609_0000077 3300046538 Bacteria 119266
615 Ga0495609_0000104 3300046538 Bacteria 98657
616 Ga0495609_0019036 3300046538 Bacteria 3178
617 Ga0495609_0020843 3300046538 Bacteria 3025
618 Ga0495609_0022755 3300046538 Bacteria 2887
619 Ga0495609_0035741 3300046538 Bacteria 2247
620 Ga0495597_0010521 3300046542 Bacteria 4516
621 Ga0495597_0024428 3300046542 Bacteria 2789
622 Ga0495597_0035861 3300046542 Bacteria 2235
623 Ga0495597_0041892 3300046542 Bacteria 2043
624 Ga0495597_0041914 3300046542 Bacteria 2043
625 Ga0495597_0055472 3300046542 Bacteria 1737
626 Ga0495597_0128223 3300046542 Bacteria 1053
627 Ga0495622_0009921 3300046557 Bacteria 4405
628 Ga0495622_0013308 3300046557 Bacteria 3817
629 Ga0495622_0053427 3300046557 Bacteria 1874
630 Ga0495622_0126476 3300046557 Bacteria 1165
631 Ga0495633_0000011 3300046558 Bacteria 268237
632 Ga0495633_0006603 3300046558 Bacteria 6848
633 Ga0495633_0034751 3300046558 Bacteria 2423
634 Ga0495633_0038466 3300046558 Bacteria 2285
635 Ga0495633_0041069 3300046558 Bacteria 2201
636 Ga0495633_0123942 3300046558 Bacteria 1196
637 Ga0495633_0264969 3300046558 Bacteria 783
638 Ga0495656_0001483 3300046615 Bacteria 7676
639 Ga0495656_0400149 3300046615 Bacteria 718
640 Ga0495668_0002192 3300046616 Bacteria 16676
641 Ga0495668_0003612 3300046616 Bacteria 11463
642 Ga0495668_0005092 3300046616 Bacteria 9040
643 Ga0495668_0071049 3300046616 Bacteria 1913
644 Ga0495668_0230100 3300046616 Bacteria 1015
645 Ga0495611_0000863 3300046648 Bacteria 16615
646 Ga0495611_0006413 3300046648 Bacteria 5013
647 Ga0495611_0006961 3300046648 Bacteria 4803
648 Ga0495611_0047137 3300046648 Bacteria 1933
649 Ga0495611_0098874 3300046648 Bacteria 1353
650 Ga0495625_0001167 3300046660 Bacteria 33819
651 Ga0495625_0006860 3300046660 Bacteria 10057
652 Ga0495625_0011364 3300046660 Bacteria 7265
653 Ga0495625_0017975 3300046660 Bacteria 5526
654 Ga0495625_0026250 3300046660 Bacteria 4404
655 Ga0495625_0109981 3300046660 Bacteria 1884
656 Ga0495625_0110246 3300046660 Bacteria 1881
657 Ga0495625_0161254 3300046660 Bacteria 1502
658 Ga0495625_0184428 3300046660 Bacteria 1385
659 Ga0495625_0323952 3300046660 Bacteria 980
660 Ga0495659_0011527 3300046664 Bacteria 2848
661 Ga0495659_0014303 3300046664 Bacteria 2596
662 Ga0495661_0000014 3300046665 Bacteria 258915
663 Ga0495661_0000021 3300046665 Bacteria 194581
664 Ga0495661_0002252 3300046665 Bacteria 14940
665 Ga0495661_0003563 3300046665 Bacteria 11460
666 Ga0495661_0008906 3300046665 Bacteria 6910
667 Ga0495661_0050337 3300046665 Bacteria 2522
668 Ga0495661_0052944 3300046665 Bacteria 2443
669 Ga0495661_0065824 3300046665 Bacteria 2134
670 Ga0495661_0066129 3300046665 Bacteria 2128
671 Ga0495661_0078361 3300046665 Bacteria 1912
672 Ga0495661_0078459 3300046665 Bacteria 1910
673 Ga0495661_0106429 3300046665 Bacteria 1569
674 Ga0495661_0140678 3300046665 Bacteria 1313
675 Ga0495661_0171761 3300046665 Bacteria 1155
676 Ga0495661_0225682 3300046665 Bacteria 968
677 Ga0495661_0379649 3300046665 Bacteria 690
678 Ga0495588_0175461 3300046674 Bacteria 1133
679 Ga0495588_0211956 3300046674 Bacteria 1023
680 Ga0495670_0000046 3300046691 Bacteria 65784
681 Ga0495670_0000721 3300046691 Bacteria 15760
682 Ga0495670_0009127 3300046691 Bacteria 4876
683 Ga0495670_0024294 3300046691 Bacteria 2995
684 Ga0495670_0037737 3300046691 Bacteria 2408
685 Ga0495670_0073773 3300046691 Bacteria 1729
686 Ga0495670_0084092 3300046691 Bacteria 1623
687 Ga0495670_0093112 3300046691 Bacteria 1544
688 Ga0495670_0115113 3300046691 Bacteria 1394
689 Ga0495670_0140615 3300046691 Bacteria 1262
690 Ga0495670_0196956 3300046691 Bacteria 1066
691 Ga0495671_0003617 3300046692 Bacteria 9422
692 Ga0495671_0004970 3300046692 Bacteria 7831
693 Ga0495671_0005277 3300046692 Bacteria 7582
694 Ga0495671_0008308 3300046692 Bacteria 5847
695 Ga0495671_0018879 3300046692 Bacteria 3653
696 Ga0495671_0025002 3300046692 Bacteria 3106
697 Ga0495671_0028132 3300046692 Bacteria 2898
698 Ga0495671_0036771 3300046692 Bacteria 2479
699 Ga0495671_0057444 3300046692 Bacteria 1925
700 Ga0495671_0065445 3300046692 Bacteria 1789
701 Ga0495671_0118869 3300046692 Bacteria 1290
702 Ga0495649_0000833 3300046694 Bacteria 24802
703 Ga0495649_0001663 3300046694 Bacteria 16529
704 Ga0495649_0003911 3300046694 Bacteria 9848
705 Ga0495649_0011155 3300046694 Bacteria 5285
706 Ga0495649_0011768 3300046694 Bacteria 5119
707 Ga0495649_0028774 3300046694 Bacteria 3079
708 Ga0495649_0052493 3300046694 Bacteria 2209
709 Ga0495649_0065282 3300046694 Bacteria 1953
710 Ga0495649_0065797 3300046694 Bacteria 1945
711 Ga0495649_0071430 3300046694 Bacteria 1860
712 Ga0495649_0200816 3300046694 Bacteria 1035
713 Ga0495589_0000933 3300046794 Bacteria 17922
714 Ga0495589_0000960 3300046794 Bacteria 17602
715 Ga0495589_0009401 3300046794 Bacteria 5084
716 Ga0495589_0020069 3300046794 Bacteria 3418
717 Ga0495589_0038107 3300046794 Bacteria 2407
718 Ga0495589_0070831 3300046794 Bacteria 1704
719 Ga0495660_0002748 3300046810 Bacteria 11097
720 Ga0495660_0004061 3300046810 Bacteria 8937
721 Ga0495660_0005559 3300046810 Bacteria 7541
722 Ga0495660_0005966 3300046810 Bacteria 7252
723 Ga0495660_0008878 3300046810 Bacteria 5872
724 Ga0495660_0013314 3300046810 Bacteria 4766
725 Ga0495660_0014862 3300046810 Bacteria 4502
726 Ga0495660_0021175 3300046810 Bacteria 3725
727 Ga0495660_0025015 3300046810 Bacteria 3393
728 Ga0495660_0029059 3300046810 Bacteria 3120
729 Ga0495660_0029124 3300046810 Bacteria 3117
730 Ga0495660_0034920 3300046810 Bacteria 2811
731 Ga0495660_0061744 3300046810 Bacteria 2010
732 Ga0495660_0066529 3300046810 Bacteria 1921
733 Ga0495660_0068950 3300046810 Bacteria 1880
734 Ga0495660_0112351 3300046810 Bacteria 1388
735 Ga0495660_0130958 3300046810 Bacteria 1258
736 Ga0495660_0294047 3300046810 Bacteria 738
737 Ga0495636_0001023 3300047318 Bacteria 10481
738 Ga0495636_0034644 3300047318 Bacteria 2078
739 Ga0495672_0001293 3300047320 Bacteria 24976
740 Ga0495672_0003413 3300047320 Bacteria 13617
741 Ga0495672_0003716 3300047320 Bacteria 12868
742 Ga0495672_0010999 3300047320 Bacteria 6411
743 Ga0495672_0020045 3300047320 Bacteria 4392
744 Ga0495672_0024942 3300047320 Bacteria 3839
745 Ga0495672_0026521 3300047320 Bacteria 3697
746 Ga0495672_0056958 3300047320 Bacteria 2271
747 Ga0495672_0155053 3300047320 Bacteria 1184
748 Ga0495672_0156929 3300047320 Bacteria 1174
749 Ga0495676_0000043 3300047321 Bacteria 103066
750 Ga0495676_0001108 3300047321 Bacteria 22842
751 Ga0495683_0000008 3300047323 Bacteria 241577
752 Ga0495683_0000050 3300047323 Bacteria 122657
753 Ga0495683_0000398 3300047323 Bacteria 34936
754 Ga0495683_0009043 3300047323 Bacteria 5309
755 Ga0495683_0011180 3300047323 Bacteria 4730
756 Ga0495683_0011698 3300047323 Bacteria 4616
757 Ga0495683_0015939 3300047323 Bacteria 3903
758 Ga0495683_0021182 3300047323 Bacteria 3351
759 Ga0495683_0070427 3300047323 Bacteria 1717
760 Ga0495683_0251938 3300047323 Bacteria 774
761 Ga0495687_008541 3300047443 Bacteria 5852
762 Ga0495677_0008726 3300047445 Bacteria 3760
763 Ga0495677_0126574 3300047445 Bacteria 976
764 Ga0495679_000043 3300047446 Bacteria 142160
765 Ga0495679_000049 3300047446 Bacteria 127408
766 Ga0495679_000364 3300047446 Bacteria 35272
767 Ga0495679_001121 3300047446 Bacteria 16153
768 Ga0495679_001160 3300047446 Bacteria 15730
769 Ga0495679_001507 3300047446 Bacteria 13170
770 Ga0495679_002066 3300047446 Bacteria 10603
771 Ga0495679_007018 3300047446 Bacteria 4759
772 Ga0495679_022380 3300047446 Bacteria 2163
773 Ga0495679_030630 3300047446 Bacteria 1743
774 Ga0495685_005771 3300047447 Bacteria 4043
775 Ga0495685_032082 3300047447 Bacteria 1805
776 Ga0495673_0002361 3300047469 Bacteria 13404
777 Ga0495673_0004631 3300047469 Bacteria 8560
778 Ga0495673_0004892 3300047469 Bacteria 8265
779 Ga0495673_0011404 3300047469 Bacteria 4778
780 Ga0495673_0016361 3300047469 Bacteria 3792
781 Ga0495673_0022602 3300047469 Bacteria 3078
782 Ga0495673_0037976 3300047469 Bacteria 2194
783 Ga0495673_0048242 3300047469 Bacteria 1878
784 Ga0495673_0055885 3300047469 Bacteria 1710
785 Ga0495673_0064820 3300047469 Bacteria 1552
786 Ga0495673_0081171 3300047469 Bacteria 1343
787 Ga0495681_0001059 3300047470 Bacteria 20990
788 Ga0495681_0004373 3300047470 Bacteria 9651
789 Ga0495681_0012322 3300047470 Bacteria 5031
790 Ga0495681_0022787 3300047470 Bacteria 3342
791 Ga0495681_0025708 3300047470 Bacteria 3076
792 Ga0495681_0027867 3300047470 Bacteria 2917
793 Ga0495681_0027869 3300047470 Bacteria 2917
794 Ga0495681_0070314 3300047470 Bacteria 1587
795 Ga0495681_0121413 3300047470 Bacteria 1121
796 Ga0495681_0146912 3300047470 Bacteria 992
797 Ga0495681_0150071 3300047470 Bacteria 978
798 Ga0495681_0176161 3300047470 Bacteria 881
799 Ga0495686_0002463 3300047472 Bacteria 17459
800 Ga0495686_0027487 3300047472 Bacteria 3713
801 Ga0495686_0036846 3300047472 Bacteria 3138
802 Ga0495686_0047548 3300047472 Bacteria 2708
803 Ga0495686_0049213 3300047472 Bacteria 2653
804 Ga0495686_0053815 3300047472 Bacteria 2521
805 Ga0495686_0103026 3300047472 Bacteria 1719
806 Ga0495686_0177512 3300047472 Bacteria 1236
807 Ga0495686_0216498 3300047472 Bacteria 1092
808 Ga0495626_0000093 3300048091 Bacteria 116329
809 Ga0495626_0002267 3300048091 Bacteria 13709
810 Ga0495626_0002278 3300048091 Bacteria 13653
811 Ga0495626_0002398 3300048091 Bacteria 13056
812 Ga0495626_0004721 3300048091 Bacteria 8247
813 Ga0495626_0005009 3300048091 Bacteria 7911
814 Ga0495626_0007868 3300048091 Bacteria 5900
815 Ga0495626_0052850 3300048091 Bacteria 1871
816 Ga0496100_0273706 3300048903 Bacteria 1256
817 Ga0496100_0625439 3300048903 Bacteria 837
818 Ga0496100_1109944 3300048903 Bacteria 623
819 Ga0496102_0343757 3300048905 Bacteria 1405
820 Ga0496106_0000003 3300048909 Bacteria 305293
821 Ga0496106_0030309 3300048909 Bacteria 4035
822 Ga0496106_0110577 3300048909 Bacteria 2139
823 Ga0496106_1085744 3300048909 Bacteria 627
824 Ga0496108_1366467 3300048911 Bacteria 594
825 Ga0496110_0124242 3300048913 Bacteria 2327
826 Ga0496114_0002603 3300048917 Bacteria 13775
827 Ga0496115_0264884 3300048918 Bacteria 1413
828 Ga0496116_0000151 3300048919 Bacteria 141429
829 Ga0496116_0001307 3300048919 Bacteria 28424
830 Ga0496116_0020966 3300048919 Bacteria 4942
831 Ga0496117_0001557 3300048920 Bacteria 32569
832 Ga0496117_0003110 3300048920 Bacteria 19816
833 Ga0496117_0004055 3300048920 Bacteria 16456
834 Ga0496117_0019269 3300048920 Bacteria 5611
835 Ga0496117_0021162 3300048920 Bacteria 5274
836 Ga0496117_0030229 3300048920 Bacteria 4160
837 Ga0496118_0003144 3300048921 Bacteria 21124
838 Ga0496118_0006743 3300048921 Bacteria 12502
839 Ga0496118_0006817 3300048921 Bacteria 12395
840 Ga0496118_0118879 3300048921 Bacteria 1729
841 Ga0496119_0000683 3300048922 Bacteria 45351
842 Ga0496119_0015481 3300048922 Bacteria 5868
843 Ga0496119_0020465 3300048922 Bacteria 4829
844 Ga0496119_0080697 3300048922 Bacteria 1875
845 Ga0496119_0182513 3300048922 Bacteria 1099
846 Ga0496120_0000596 3300048923 Bacteria 54760
847 Ga0496120_0011309 3300048923 Bacteria 6144
848 Ga0496120_0014840 3300048923 Bacteria 5167
849 Ga0496120_0036209 3300048923 Bacteria 2940
850 Ga0496120_0044375 3300048923 Bacteria 2583
851 Ga0496120_0063559 3300048923 Bacteria 2052
852 Ga0496121_0002255 3300048924 Bacteria 30054
853 Ga0496121_0015050 3300048924 Bacteria 8141
854 Ga0496121_0016681 3300048924 Bacteria 7559
855 Ga0496121_0022912 3300048924 Bacteria 6036
856 Ga0496121_0023037 3300048924 Bacteria 6016
857 Ga0496121_0086229 3300048924 Bacteria 2468
858 Ga0496121_0188468 3300048924 Bacteria 1481
859 Ga0496121_0257111 3300048924 Bacteria 1208
860 Ga0496122_0002099 3300048925 Bacteria 29522
861 Ga0496122_0013610 3300048925 Bacteria 7943
862 Ga0496122_0020597 3300048925 Bacteria 5948
863 Ga0496122_0025307 3300048925 Bacteria 5157
864 Ga0496122_0041743 3300048925 Bacteria 3620
865 Ga0496122_0054002 3300048925 Bacteria 3022
866 Ga0496122_0070188 3300048925 Bacteria 2505
867 Ga0496122_0081533 3300048925 Bacteria 2251
868 Ga0496122_0112101 3300048925 Bacteria 1787
869 Ga0496122_0125652 3300048925 Bacteria 1642
870 Ga0496122_0323074 3300048925 Bacteria 819
871 Ga0496123_0000899 3300048926 Bacteria 47084
872 Ga0496123_0009384 3300048926 Bacteria 8818
873 Ga0496123_0009970 3300048926 Bacteria 8468
874 Ga0496123_0021903 3300048926 Bacteria 4948
875 Ga0496123_0048796 3300048926 Bacteria 2844
876 Ga0496123_0051177 3300048926 Bacteria 2752
877 Ga0496123_0065322 3300048926 Bacteria 2313
878 Ga0496123_0101022 3300048926 Bacteria 1678
879 Ga0496123_0287400 3300048926 Bacteria 791
880 Ga0496124_0002187 3300048927 Bacteria 26106
881 Ga0496124_0004118 3300048927 Bacteria 17182
882 Ga0496124_0015299 3300048927 Bacteria 7363
883 Ga0496124_0020612 3300048927 Bacteria 6085
884 Ga0496124_0034356 3300048927 Bacteria 4452
885 Ga0496124_0083840 3300048927 Bacteria 2614
886 Ga0496124_0105613 3300048927 Bacteria 2275
887 Ga0496124_0117852 3300048927 Bacteria 2126
888 Ga0496124_0129789 3300048927 Bacteria 2003
889 Ga0496124_0155715 3300048927 Bacteria 1787
890 Ga0496124_0218215 3300048927 Bacteria 1436
891 Ga0496125_0001584 3300048928 Bacteria 32295
892 Ga0496125_0003412 3300048928 Bacteria 19318
893 Ga0496125_0003587 3300048928 Bacteria 18660
894 Ga0496125_0012417 3300048928 Bacteria 8458
895 Ga0496125_0028559 3300048928 Bacteria 5034
896 Ga0496125_0039717 3300048928 Bacteria 4047
897 Ga0496125_0043333 3300048928 Bacteria 3821
898 Ga0496125_0078447 3300048928 Bacteria 2538
899 Ga0496125_0124960 3300048928 Bacteria 1825
900 Ga0496125_0164951 3300048928 Bacteria 1498
901 Ga0496125_0224897 3300048928 Bacteria 1205
902 Ga0496125_0390747 3300048928 Bacteria 816
903 Ga0496126_0002870 3300048929 Bacteria 22493
904 Ga0496126_0005675 3300048929 Bacteria 14164
905 Ga0496126_0173858 3300048929 Bacteria 1833
906 Ga0496126_0277316 3300048929 Bacteria 1390
907 Ga0496126_0511040 3300048929 Bacteria 959
908 Ga0496126_0620763 3300048929 Bacteria 849
909 Ga0495678_000018 3300049459 Bacteria 279747
910 Ga0495678_000886 3300049459 Bacteria 26599
911 Ga0495678_001463 3300049459 Bacteria 18521
912 Ga0495678_003005 3300049459 Bacteria 10729
913 Ga0495678_007497 3300049459 Bacteria 5641
914 Ga0495678_010196 3300049459 Bacteria 4580
915 Ga0495678_011068 3300049459 Bacteria 4337
916 Ga0495678_012290 3300049459 Bacteria 4064
917 Ga0495678_015282 3300049459 Bacteria 3538
918 Ga0495678_016352 3300049459 Bacteria 3395
919 Ga0495678_041316 3300049459 Bacteria 1846
920 Ga0495678_066814 3300049459 Bacteria 1330
921 Ga0495678_088216 3300049459 Bacteria 1098
922 Ga0495678_123833 3300049459 Bacteria 865
923 Ga0495678_162265 3300049459 Bacteria 713
924 Ga0495682_0007572 3300049460 Bacteria 4311
925 Ga0495682_0049495 3300049460 Bacteria 1531
926 Ga0495682_0132354 3300049460 Bacteria 892
927 Ga0501032_0024120 3300049569 Bacteria 4201
928 Ga0501034_0000685 3300049571 Bacteria 51551
929 Ga0501034_0187350 3300049571 Bacteria 2032
930 Ga0501037_0079747 3300049573 Bacteria 2376
931 Ga0501039_0064529 3300049575 Bacteria 2839
932 Ga0501209_000881 3300049656 Plasmid 3908
933 Ga0501222_000257 3300049662 Bacteria 8960
934 Ga0501223_008672 3300049663 Bacteria 2070
935 Ga0501240_005571 3300049673 Bacteria 1512
936 Ga0501259_092444 3300049688 Bacteria 682
937 Ga0501245_083655 3300049708 Bacteria 621
938 Ga0501226_002852 3300049853 Bacteria 2080
939 nmdc:mga03683_33110_c1 3300050489 Bacteria 2082
940 Ga0500618_017851 3300053125 Bacteria 1762
941 Ga0500659_0000721 3300053135 Bacteria 21335
942 Ga0500559_0027415 3300053136 Bacteria 2431
943 Ga0500568_0047419 3300053139 Bacteria 1702
944 Ga0500634_0000077 3300053161 Bacteria 37976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003187 JGI25151J46595_10001744 JGI25151J46595_100017442 153
2 3300025294 Ga0209025_1000244 Ga0209025_100024459 153
3 3300046507 Ga0495606_0000683 Ga0495606_0000683_25212_25688 158
4 3300046513 Ga0495616_0017897 Ga0495616_0017897_718_1194 158
5 3300049459 Ga0495678_016352 Ga0495678_016352_1354_1830 158
6 3300046491 Ga0495584_0050133 Ga0495584_0050133_1086_1565 159
7 iso_pu_bacteria 2643221717 2644645626 159
8 3300046507 Ga0495606_0019205 Ga0495606_0019205_1509_1991 160
9 3300047320 Ga0495672_0156929 Ga0495672_0156929_294_776 160
10 3300003320 rootH2_10084601 rootH2_100846012 161
11 3300003323 rootH1_10010008 rootH1_100100086 161
12 3300049656 Ga0501209_000881 Ga0501209_000881_894_1412 161
13 iso_pu_bacteria 2547132374 2548496871 161
14 3300015261 Ga0182006_1001078 Ga0182006_100107816 162
15 3300027876 Ga0209974_10039317 Ga0209974_100393172 162
16 3300049663 Ga0501223_008672 Ga0501223_008672_959_1471 162
17 iso_pu_bacteria 2643221569 2643860485 162
18 iso_pu_bacteria 2643221594 2643981650 162
19 iso_pu_bacteria 2738541277 2738723879 162
20 iso_pu_bacteria 2738543019 2739284610 162
21 iso_pu_bacteria 2808606395 2809035558 162
22 iso_pu_bacteria 2904541872 2904544151 162
23 iso_pu_bacteria 2929160207 2929162276 162
24 3300025292 Ga0209676_1004254 Ga0209676_10042542 163
25 3300025298 Ga0209050_1024709 Ga0209050_10247092 163
26 3300048927 Ga0496124_0015299 Ga0496124_0015299_75_587 163
27 3300049571 Ga0501034_0187350 Ga0501034_0187350_380_895 163
28 3300046492 Ga0495585_0003149 Ga0495585_0003149_6672_7166 164
29 3300046513 Ga0495616_0015842 Ga0495616_0015842_1752_2288 164
30 3300046518 Ga0495631_0000777 Ga0495631_0000777_5087_5581 164
31 3300046518 Ga0495631_0232535 Ga0495631_0232535_203_739 164
32 3300046665 Ga0495661_0140678 Ga0495661_0140678_488_1024 164
33 3300046810 Ga0495660_0014862 Ga0495660_0014862_453_947 164
34 3300047323 Ga0495683_0000050 Ga0495683_0000050_116060_116557 164
35 3300048905 Ga0496102_0343757 Ga0496102_0343757_832_1326 164
36 3300003781 Ga0055536_1003982 Ga0055536_10039822 165
37 3300048927 Ga0496124_0105613 Ga0496124_0105613_1504_2010 165
38 3300048929 Ga0496126_0277316 Ga0496126_0277316_265_771 165
39 3300049569 Ga0501032_0024120 Ga0501032_0024120_2043_2561 165
40 3300049573 Ga0501037_0079747 Ga0501037_0079747_1277_1795 165
41 3300049575 Ga0501039_0064529 Ga0501039_0064529_2115_2633 165
42 3300053136 Ga0500559_0027415 Ga0500559_0027415_1788_2291 165
43 iso_pu_bacteria 2510065053 2510282256 165
44 iso_pu_bacteria 2510065055 2510291559 165
45 iso_pu_bacteria 2510065058 2510310404 165
46 iso_pu_bacteria 2511231004 2511257587 165
47 iso_pu_bacteria 2511231006 2511265344 165
48 iso_pu_bacteria 2511231007 2511270248 165
49 iso_pu_bacteria 2511231016 2511324798 165
50 iso_pu_bacteria 2511231018 2511338001 165
51 iso_pu_bacteria 2511231019 2511342812 165
52 iso_pu_bacteria 2511231020 2511348782 165
53 iso_pu_bacteria 2511231021 2511354128 165
54 iso_pu_bacteria 2511231022 2511365884 165
55 iso_pu_bacteria 2511231023 2511371325 165
56 iso_pu_bacteria 2512047018 2512326156 165
57 iso_pu_bacteria 2582580891 2583792619 165
58 iso_pu_bacteria 2597489887 2597858262 165
59 iso_pu_bacteria 2599185155 2599329949 165
60 iso_pu_bacteria 2599185167 2599398182 165
61 iso_pu_bacteria 2599185179 2599450192 165
62 iso_pu_bacteria 2599185185 2599486242 165
63 iso_pu_bacteria 2599185188 2599500828 165
64 iso_pu_bacteria 2599185190 2599516131 165
65 iso_pu_bacteria 2599185191 2599521140 165
66 iso_pu_bacteria 2599185212 2599612418 165
67 iso_pu_bacteria 2599185248 2599771955 165
68 iso_pu_bacteria 2599185257 2599802867 165
69 iso_pu_bacteria 2599185288 2599883566 165
70 iso_pu_bacteria 2599185289 2599885198 165
71 iso_pu_bacteria 2599185290 2599895570 165
72 iso_pu_bacteria 2599185291 2599898865 165
73 iso_pu_bacteria 2599185300 2599932495 165
74 iso_pu_bacteria 2599185302 2599943322 165
75 iso_pu_bacteria 2599185303 2599950489 165
76 iso_pu_bacteria 2599185304 2599954433 165
77 iso_pu_bacteria 2599185305 2599959851 165
78 iso_pu_bacteria 2599185306 2599967039 165
79 iso_pu_bacteria 2599185308 2599978366 165
80 iso_pu_bacteria 2599185309 2599983746 165
81 iso_pu_bacteria 2599185310 2599988748 165
82 iso_pu_bacteria 2599185311 2599993602 165
83 iso_pu_bacteria 2599185312 2600001348 165
84 iso_pu_bacteria 2599185313 2600006247 165
85 iso_pu_bacteria 2599185314 2600012533 165
86 iso_pu_bacteria 2599185315 2600016359 165
87 iso_pu_bacteria 2599185316 2600024584 165
88 iso_pu_bacteria 2599185317 2600032389 165
89 iso_pu_bacteria 2599185318 2600035030 165
90 iso_pu_bacteria 2599185319 2600040674 165
91 iso_pu_bacteria 2599185320 2600048551 165
92 iso_pu_bacteria 2599185321 2600051565 165
93 iso_pu_bacteria 2599185322 2600059285 165
94 iso_pu_bacteria 2599185323 2600063011 165
95 iso_pu_bacteria 2599185324 2600072635 165
96 iso_pu_bacteria 2599185325 2600079279 165
97 iso_pu_bacteria 2600254930 2600361951 165
98 iso_pu_bacteria 2600254931 2600362864 165
99 iso_pu_bacteria 2619619299 2621299435 165
100 iso_pu_bacteria 2643221565 2643842558 165
101 iso_pu_bacteria 2643221589 2643952965 165
102 iso_pu_bacteria 2643221602 2644022727 165
103 iso_pu_bacteria 2643221633 2644188900 165
104 iso_pu_bacteria 2643221650 2644284380 165
105 iso_pu_bacteria 2651869719 2652543618 165
106 iso_pu_bacteria 2667528170 2671091705 165
107 iso_pu_bacteria 2667528176 2671126570 165
108 iso_pu_bacteria 2671180172 2671769511 165
109 iso_pu_bacteria 2675903515 2678263092 165
110 iso_pu_bacteria 2713897148 2715753207 165
111 iso_pu_bacteria 2738541265 2738669450 165
112 iso_pu_bacteria 2738541271 2738688065 165
113 iso_pu_bacteria 2738541282 2738747842 165
114 iso_pu_bacteria 2738541294 2738810779 165
115 iso_pu_bacteria 2738541303 2738856885 165
116 iso_pu_bacteria 2738541309 2738898139 165
117 iso_pu_bacteria 2738543016 2739263500 165
118 iso_pu_bacteria 2738543020 2739288466 165
119 iso_pu_bacteria 2738543021 2739293778 165
120 iso_pu_bacteria 2738543025 2739311807 165
121 iso_pu_bacteria 2740892503 2743737755 165
122 iso_pu_bacteria 2744054620 2745009427 165
123 iso_pu_bacteria 2773857670 2774120988 165
124 iso_pu_bacteria 2773857672 2774130942 165
125 iso_pu_bacteria 2773857673 2774133729 165
126 iso_pu_bacteria 2784132063 2784264504 165
127 iso_pu_bacteria 2784132072 2784314060 165
128 iso_pu_bacteria 2791355520 2794597321 165
129 iso_pu_bacteria 2808606361 2808857905 165
130 iso_pu_bacteria 2808606376 2808922477 165
131 iso_pu_bacteria 2808606377 2808927756 165
132 iso_pu_bacteria 2808606378 2808938148 165
133 iso_pu_bacteria 2808606380 2808948506 165
134 iso_pu_bacteria 2808606381 2808949704 165
135 iso_pu_bacteria 2808606382 2808960239 165
136 iso_pu_bacteria 2808606383 2808966400 165
137 iso_pu_bacteria 2808606385 2808980807 165
138 iso_pu_bacteria 2808606388 2808996686 165
139 iso_pu_bacteria 2808606389 2808996843 165
140 iso_pu_bacteria 2808606445 2809216723 165
141 iso_pu_bacteria 2816332298 2817490798 165
142 iso_pu_bacteria 2818991445 2819594183 165
143 iso_pu_bacteria 2825651385 2825651676 165
144 iso_pu_bacteria 2826581358 2826585062 165
145 iso_pu_bacteria 2834028612 2834030023 165
146 iso_pu_bacteria 2842815866 2842816133 165
147 iso_pu_bacteria 2842832357 2842834662 165
148 iso_pu_bacteria 2842843487 2842843691 165
149 iso_pu_bacteria 2842849001 2842851040 165
150 iso_pu_bacteria 2842854478 2842858076 165
151 iso_pu_bacteria 2852612431 2852614845 165
152 iso_pu_bacteria 2852657418 2852662078 165
153 iso_pu_bacteria 2852667396 2852667416 165
154 iso_pu_bacteria 2860339153 2860339612 165
155 iso_pu_bacteria 2880230671 2880233440 165
156 iso_pu_bacteria 2904518522 2904520204 165
157 iso_pu_bacteria 2908446538 2908449960 165
158 iso_pu_bacteria 2912963787 2912967044 165
159 iso_pu_bacteria 2913036834 2913039727 165
160 iso_pu_bacteria 2919155634 2919159016 165
161 iso_pu_bacteria 2919385768 2919387035 165
162 iso_pu_bacteria 2919481497 2919484825 165
163 iso_pu_bacteria 2919487758 2919492275 165
164 iso_pu_bacteria 2923153595 2923156800 165
165 iso_pu_bacteria 2923519811 2923522815 165
166 iso_pu_bacteria 2923586266 2923588565 165
167 iso_pu_bacteria 2929144301 2929147287 165
168 iso_pu_bacteria 2929189879 2929192341 165
169 iso_pu_bacteria 2931369376 2931375257 165
170 iso_pu_bacteria 2931390751 2931394154 165
171 iso_pu_bacteria 2931396565 2931400504 165
172 iso_pu_bacteria 2939636861 2939639254 165
173 iso_pu_bacteria 2939651529 2939656348 165
174 iso_pu_bacteria 2945928738 2945933697 165
175 iso_pu_bacteria 2945961074 2945963354 165
176 iso_pu_bacteria 2946006987 2946010109 165
177 iso_pu_bacteria 2969304461 2969307606 165
178 iso_pu_bacteria 2974289157 2974290903 165
179 iso_pu_bacteria 2974298342 2974299922 165
180 iso_pu_bacteria 2984286254 2984289291 165
181 iso_pu_bacteria 2984499530 2984502299 165
182 iso_pu_bacteria 2984504281 2984509078 165
183 iso_pu_bacteria 2988728565 2988728895 165
184 iso_pu_bacteria 2998139840 2998142916 165
185 iso_pu_bacteria 3007252601 3007252788 165
186 iso_pu_bacteria 3007315729 3007318557 165
187 iso_pu_bacteria 3007395558 3007396205 165
188 iso_pu_bacteria 3007419365 3007421811 165
189 iso_pu_bacteria 3007511990 3007513388 165
190 iso_pu_bacteria 3007614139 3007619017 165
191 iso_pu_bacteria 3007803356 3007809376 165
192 iso_pu_bacteria 3007866637 3007869203 165
193 iso_pu_bacteria 3007872151 3007875416 165
194 iso_pu_bacteria 8015687852 8015691025 165
195 iso_pu_bacteria 8016728285 8016728602 165
196 iso_pu_bacteria 8029995093 8029997878 165
197 iso_pu_bacteria 8052494512 8052496833 165
198 iso_pu_bacteria 8054285046 8054285388 165
199 iso_pu_bacteria 8054503363 8054506013 165
200 iso_pu_bacteria 8055770955 8055774166 165
201 iso_pu_bacteria 8055817908 8055820694 165
202 iso_pu_bacteria 8056125926 8056127934 165
203 iso_pu_bacteria 8056131705 8056134573 165
204 iso_pu_bacteria 8056137416 8056140734 165
205 iso_pu_bacteria 8056143049 8056146278 165
206 iso_pu_bacteria 8056155041 8056155966 165
207 iso_pu_bacteria 8056161164 8056165839 165
208 iso_pu_bacteria 8056166840 8056168278 165
209 iso_pu_bacteria 8056177738 8056183509 165
210 3300003320 rootH2_10071751 rootH2_100717512 166
211 3300003323 rootH1_10255410 rootH1_102554103 166
212 3300013102 Ga0157371_10002980 Ga0157371_1000298010 166
213 3300013102 Ga0157371_10070724 Ga0157371_100707243 166
214 3300013104 Ga0157370_10037073 Ga0157370_100370732 166
215 3300013105 Ga0157369_10003476 Ga0157369_100034764 166
216 3300031507 Ga0307509_10126936 Ga0307509_101269364 166
217 3300046515 Ga0495620_0021689 Ga0495620_0021689_1527_2060 166
218 3300047446 Ga0495679_001160 Ga0495679_001160_12398_12904 166
219 3300048903 Ga0496100_0625439 Ga0496100_0625439_130_636 166
220 3300048909 Ga0496106_0000003 Ga0496106_0000003_94652_95167 166
221 3300048924 Ga0496121_0023037 Ga0496121_0023037_4581_5096 166
222 3300048924 Ga0496121_0257111 Ga0496121_0257111_626_1129 166
223 3300048925 Ga0496122_0013610 Ga0496122_0013610_1147_1653 166
224 3300048926 Ga0496123_0009384 Ga0496123_0009384_6879_7385 166
225 3300048927 Ga0496124_0155715 Ga0496124_0155715_1247_1762 166
226 3300048928 Ga0496125_0003587 Ga0496125_0003587_1426_1932 166
227 iso_pu_bacteria 2842805378 2842806950 166
228 iso_pu_bacteria 2885080285 2885085452 166
229 3300009011 Ga0105251_10014975 Ga0105251_100149753 167
230 3300025735 Ga0207713_1164143 Ga0207713_11641431 167
231 3300046453 Ga0495627_000014 Ga0495627_000014_110084_110593 167
232 3300046463 Ga0495653_0001600 Ga0495653_0001600_8226_8732 167
233 3300046471 Ga0495650_0015888 Ga0495650_0015888_2944_3453 167
234 3300046492 Ga0495585_0002151 Ga0495585_0002151_1249_1755 167
235 3300046518 Ga0495631_0000493 Ga0495631_0000493_18998_19507 167
236 3300046519 Ga0495632_0002675 Ga0495632_0002675_646_1155 167
237 3300046519 Ga0495632_0031357 Ga0495632_0031357_974_1483 167
238 3300046530 Ga0495654_0004506 Ga0495654_0004506_4782_5291 167
239 3300046665 Ga0495661_0000014 Ga0495661_0000014_56520_57026 167
240 3300046692 Ga0495671_0028132 Ga0495671_0028132_2059_2568 167
241 3300047320 Ga0495672_0003716 Ga0495672_0003716_5844_6353 167
242 3300048928 Ga0496125_0224897 Ga0496125_0224897_247_777 167
243 3300048929 Ga0496126_0620763 Ga0496126_0620763_32_562 167
244 3300014497 Ga0182008_10001207 Ga0182008_100012071 168
245 3300042530 Ga0450916_051235 Ga0450916_051235_63_620 168
246 2124908027 MRS2a_Contig_31 MRS2a_00209290 169
247 2162886007 SwRhRL2b_contig_1674408 SwRhRL2b_0421.00001280 169
248 2162886007 SwRhRL2b_contig_2676426 SwRhRL2b_0851.00001090 169
249 2162886007 SwRhRL2b_contig_458982 SwRhRL2b_0782.00001020 169
250 2162886011 MRS1b_contig_2142372 MRS1b_0911.00001210 169
251 2162886012 MBSR1b_contig_12539687 MBSR1b_0922.00001780 169
252 3300002704 JGI25155J39150_1000070 JGI25155J39150_100007011 169
253 3300002705 JGI25156J39149_1000039 JGI25156J39149_100003918 169
254 3300002738 JGI25154J39366_1000059 JGI25154J39366_100005918 169
255 3300002741 JGI25157J39369_1000057 JGI25157J39369_100005783 169
256 3300003758 Ga0055532_1000018 Ga0055532_1000018199 169
257 3300003761 Ga0055535_1009981 Ga0055535_10099812 169
258 3300003781 Ga0055536_1000005 Ga0055536_1000005219 169
259 3300003781 Ga0055536_1000184 Ga0055536_100018440 169
260 3300003791 Ga0055530_10000001 Ga0055530_10000001112 169
261 3300003792 Ga0055540_1000034 Ga0055540_100003474 169
262 3300003792 Ga0055540_1000389 Ga0055540_100038917 169
263 3300003856 Ga0058692_1027976 Ga0058692_10279762 169
264 3300005288 Ga0065714_10002392 Ga0065714_100023922 169
265 3300005288 Ga0065714_10064652 Ga0065714_100646523 169
266 3300005288 Ga0065714_10166152 Ga0065714_101661522 169
267 3300005289 Ga0065704_10000856 Ga0065704_1000085613 169
268 3300005289 Ga0065704_10070988 Ga0065704_100709884 169
269 3300005289 Ga0065704_10185354 Ga0065704_101853542 169
270 3300005289 Ga0065704_10261789 Ga0065704_102617892 169
271 3300005289 Ga0065704_10386714 Ga0065704_103867141 169
272 3300005290 Ga0065712_10010277 Ga0065712_100102772 169
273 3300005290 Ga0065712_10067849 Ga0065712_100678496 169
274 3300005293 Ga0065715_10133180 Ga0065715_101331804 169
275 3300005331 Ga0070670_100000746 Ga0070670_1000007468 169
276 3300005331 Ga0070670_100002551 Ga0070670_1000025515 169
277 3300005344 Ga0070661_100000040 Ga0070661_10000004081 169
278 3300005353 Ga0070669_100003617 Ga0070669_1000036176 169
279 3300005457 Ga0070662_100001826 Ga0070662_10000182612 169
280 3300005564 Ga0070664_100000270 Ga0070664_1000002705 169
281 3300005834 Ga0068851_10000234 Ga0068851_1000023422 169
282 3300006058 Ga0075432_10003842 Ga0075432_100038422 169
283 3300006058 Ga0075432_10005844 Ga0075432_100058443 169
284 3300006058 Ga0075432_10190804 Ga0075432_101908042 169
285 3300006946 Ga0079104_1000342 Ga0079104_10003423 169
286 3300006946 Ga0079104_1000375 Ga0079104_100037531 169
287 3300006946 Ga0079104_1048079 Ga0079104_10480792 169
288 3300006948 Ga0099826_10049123 Ga0099826_100491233 169
289 3300009011 Ga0105251_10001171 Ga0105251_1000117116 169
290 3300009011 Ga0105251_10001766 Ga0105251_1000176610 169
291 3300009011 Ga0105251_10022139 Ga0105251_100221392 169
292 3300009011 Ga0105251_10025213 Ga0105251_100252132 169
293 3300009011 Ga0105251_10043968 Ga0105251_100439682 169
294 3300009011 Ga0105251_10073272 Ga0105251_100732722 169
295 3300009011 Ga0105251_10186648 Ga0105251_101866482 169
296 3300009011 Ga0105251_10205721 Ga0105251_102057212 169
297 3300009011 Ga0105251_10224399 Ga0105251_102243991 169
298 3300009011 Ga0105251_10254079 Ga0105251_102540792 169
299 3300009036 Ga0105244_10000855 Ga0105244_1000085512 169
300 3300009036 Ga0105244_10001212 Ga0105244_1000121214 169
301 3300009036 Ga0105244_10001892 Ga0105244_100018925 169
302 3300009036 Ga0105244_10002180 Ga0105244_100021803 169
303 3300009036 Ga0105244_10002386 Ga0105244_100023866 169
304 3300009036 Ga0105244_10002471 Ga0105244_100024717 169
305 3300009036 Ga0105244_10019232 Ga0105244_100192323 169
306 3300009036 Ga0105244_10074339 Ga0105244_100743392 169
307 3300009092 Ga0105250_10000190 Ga0105250_1000019011 169
308 3300009092 Ga0105250_10000219 Ga0105250_100002193 169
309 3300009092 Ga0105250_10022505 Ga0105250_100225052 169
310 3300009092 Ga0105250_10069122 Ga0105250_100691221 169
311 3300009176 Ga0105242_10013822 Ga0105242_100138224 169
312 3300009545 Ga0105237_10000742 Ga0105237_100007425 169
313 3300011119 Ga0105246_10005440 Ga0105246_100054408 169
314 3300011119 Ga0105246_10180108 Ga0105246_101801085 169
315 3300013100 Ga0157373_10000060 Ga0157373_100000603 169
316 3300013100 Ga0157373_10001831 Ga0157373_100018317 169
317 3300013100 Ga0157373_10003112 Ga0157373_100031123 169
318 3300013100 Ga0157373_10006039 Ga0157373_100060392 169
319 3300013100 Ga0157373_10014344 Ga0157373_100143443 169
320 3300013100 Ga0157373_10015017 Ga0157373_100150172 169
321 3300013100 Ga0157373_10026170 Ga0157373_100261704 169
322 3300013100 Ga0157373_10034043 Ga0157373_100340432 169
323 3300013100 Ga0157373_10132878 Ga0157373_101328782 169
324 3300013100 Ga0157373_10378720 Ga0157373_103787202 169
325 3300013102 Ga0157371_10000202 Ga0157371_1000020259 169
326 3300013102 Ga0157371_10033137 Ga0157371_100331374 169
327 3300013102 Ga0157371_10120287 Ga0157371_101202873 169
328 3300013102 Ga0157371_10217087 Ga0157371_102170872 169
329 3300013102 Ga0157371_10557546 Ga0157371_105575462 169
330 3300013104 Ga0157370_10001055 Ga0157370_1000105525 169
331 3300013104 Ga0157370_10001618 Ga0157370_1000161821 169
332 3300013104 Ga0157370_10008371 Ga0157370_100083711 169
333 3300013104 Ga0157370_10031246 Ga0157370_100312462 169
334 3300013104 Ga0157370_10074299 Ga0157370_100742992 169
335 3300013104 Ga0157370_10097094 Ga0157370_100970943 169
336 3300013104 Ga0157370_10112096 Ga0157370_101120964 169
337 3300013104 Ga0157370_10351707 Ga0157370_103517072 169
338 3300013104 Ga0157370_10369563 Ga0157370_103695632 169
339 3300013104 Ga0157370_10426056 Ga0157370_104260562 169
340 3300013104 Ga0157370_11002634 Ga0157370_110026341 169
341 3300013105 Ga0157369_10000564 Ga0157369_100005643 169
342 3300013105 Ga0157369_10006663 Ga0157369_1000666312 169
343 3300013105 Ga0157369_10006921 Ga0157369_1000692115 169
344 3300013105 Ga0157369_10008854 Ga0157369_100088547 169
345 3300013105 Ga0157369_10099091 Ga0157369_100990913 169
346 3300013105 Ga0157369_10347273 Ga0157369_103472732 169
347 3300013105 Ga0157369_10592230 Ga0157369_105922301 169
348 3300013105 Ga0157369_10690107 Ga0157369_106901072 169
349 3300013105 Ga0157369_10848655 Ga0157369_108486551 169
350 3300013105 Ga0157369_10912025 Ga0157369_109120252 169
351 3300013105 Ga0157369_11192834 Ga0157369_111928341 169
352 3300013306 Ga0163162_10000169 Ga0163162_100001696 169
353 3300013306 Ga0163162_10055581 Ga0163162_100555813 169
354 3300013306 Ga0163162_10477072 Ga0163162_104770722 169
355 3300013306 Ga0163162_11209038 Ga0163162_112090381 169
356 3300013307 Ga0157372_10006228 Ga0157372_100062288 169
357 3300013307 Ga0157372_10099416 Ga0157372_100994163 169
358 3300013307 Ga0157372_10217717 Ga0157372_102177173 169
359 3300013308 Ga0157375_10000335 Ga0157375_1000033513 169
360 3300013308 Ga0157375_10031646 Ga0157375_100316462 169
361 3300013308 Ga0157375_10100891 Ga0157375_101008913 169
362 3300013308 Ga0157375_10276316 Ga0157375_102763162 169
363 3300014497 Ga0182008_10000767 Ga0182008_100007676 169
364 3300014497 Ga0182008_10001183 Ga0182008_1000118314 169
365 3300014497 Ga0182008_10008493 Ga0182008_100084932 169
366 3300014497 Ga0182008_10080027 Ga0182008_100800272 169
367 3300014497 Ga0182008_10108385 Ga0182008_101083852 169
368 3300015261 Ga0182006_1000481 Ga0182006_10004813 169
369 3300015261 Ga0182006_1002896 Ga0182006_10028962 169
370 3300015261 Ga0182006_1007025 Ga0182006_10070254 169
371 3300015261 Ga0182006_1007365 Ga0182006_10073653 169
372 3300015261 Ga0182006_1010097 Ga0182006_10100973 169
373 3300015261 Ga0182006_1016738 Ga0182006_10167382 169
374 3300015261 Ga0182006_1036657 Ga0182006_10366572 169
375 3300015261 Ga0182006_1070604 Ga0182006_10706042 169
376 3300015261 Ga0182006_1155308 Ga0182006_11553082 169
377 3300015262 Ga0182007_10000913 Ga0182007_1000091313 169
378 3300015262 Ga0182007_10004723 Ga0182007_100047232 169
379 3300015265 Ga0182005_1001512 Ga0182005_10015122 169
380 3300015265 Ga0182005_1027713 Ga0182005_10277131 169
381 3300017792 Ga0163161_10070143 Ga0163161_100701432 169
382 3300017792 Ga0163161_10078763 Ga0163161_100787631 169
383 3300017792 Ga0163161_10084117 Ga0163161_100841172 169
384 3300017792 Ga0163161_10291029 Ga0163161_102910292 169
385 3300017792 Ga0163161_10311084 Ga0163161_103110842 169
386 3300017792 Ga0163161_11106420 Ga0163161_111064202 169
387 3300025206 Ga0209435_100007 Ga0209435_100007389 169
388 3300025229 Ga0209147_100017 Ga0209147_10001784 169
389 3300025242 Ga0209258_100318 Ga0209258_1003186 169
390 3300025246 Ga0209646_1000096 Ga0209646_100009677 169
391 3300025250 Ga0209026_1000052 Ga0209026_1000052142 169
392 3300025256 Ga0209759_1000174 Ga0209759_100017484 169
393 3300025272 Ga0209455_1005973 Ga0209455_10059732 169
394 3300025292 Ga0209676_1000003 Ga0209676_1000003430 169
395 3300025292 Ga0209676_1000158 Ga0209676_1000158118 169
396 3300025292 Ga0209676_1000852 Ga0209676_10008525 169
397 3300025292 Ga0209676_1004572 Ga0209676_10045722 169
398 3300025298 Ga0209050_1000004 Ga0209050_1000004412 169
399 3300025298 Ga0209050_1000013 Ga0209050_1000013317 169
400 3300025303 Ga0209051_1000006 Ga0209051_1000006562 169
401 3300025303 Ga0209051_1000007 Ga0209051_1000007317 169
402 3300025304 Ga0209257_1011005 Ga0209257_10110054 169
403 3300025711 Ga0207696_1000002 Ga0207696_1000002903 169
404 3300025711 Ga0207696_1000186 Ga0207696_100018672 169
405 3300025711 Ga0207696_1005345 Ga0207696_10053453 169
406 3300025711 Ga0207696_1065657 Ga0207696_10656571 169
407 3300025728 Ga0207655_1000100 Ga0207655_100010060 169
408 3300025728 Ga0207655_1000143 Ga0207655_100014336 169
409 3300025728 Ga0207655_1000207 Ga0207655_100020783 169
410 3300025728 Ga0207655_1000338 Ga0207655_100033814 169
411 3300025728 Ga0207655_1006514 Ga0207655_10065143 169
412 3300025728 Ga0207655_1026158 Ga0207655_10261583 169
413 3300025728 Ga0207655_1035368 Ga0207655_10353683 169
414 3300025728 Ga0207655_1053412 Ga0207655_10534122 169
415 3300025728 Ga0207655_1069289 Ga0207655_10692892 169
416 3300025728 Ga0207655_1214997 Ga0207655_12149971 169
417 3300025735 Ga0207713_1001164 Ga0207713_10011646 169
418 3300025735 Ga0207713_1002610 Ga0207713_10026106 169
419 3300025735 Ga0207713_1013743 Ga0207713_10137432 169
420 3300025735 Ga0207713_1083131 Ga0207713_10831311 169
421 3300025735 Ga0207713_1086808 Ga0207713_10868082 169
422 3300025735 Ga0207713_1110979 Ga0207713_11109792 169
423 3300025735 Ga0207713_1130759 Ga0207713_11307592 169
424 3300025735 Ga0207713_1137655 Ga0207713_11376552 169
425 3300025914 Ga0207671_10002339 Ga0207671_1000233917 169
426 3300025920 Ga0207649_10000116 Ga0207649_1000011655 169
427 3300025925 Ga0207650_10001235 Ga0207650_100012358 169
428 3300025925 Ga0207650_10001827 Ga0207650_1000182713 169
429 3300025933 Ga0207706_10004210 Ga0207706_100042104 169
430 3300025934 Ga0207686_10007625 Ga0207686_100076256 169
431 3300025945 Ga0207679_10000054 Ga0207679_100000545 169
432 3300027111 Ga0209281_1000009 Ga0209281_100000999 169
433 3300027111 Ga0209281_1000391 Ga0209281_100039132 169
434 3300027111 Ga0209281_1014649 Ga0209281_10146491 169
435 3300027312 Ga0209371_1000310 Ga0209371_100031058 169
436 3300027312 Ga0209371_1029496 Ga0209371_10294962 169
437 3300027876 Ga0209974_10075546 Ga0209974_100755461 169
438 3300027907 Ga0207428_10020471 Ga0207428_100204713 169
439 3300027907 Ga0207428_10047658 Ga0207428_100476581 169
440 3300030500 Ga0268256_1000267 Ga0268256_100026758 169
441 3300030521 Ga0307511_10132818 Ga0307511_101328181 169
442 3300030521 Ga0307511_10148653 Ga0307511_101486532 169
443 3300030733 Ga0314311_1008575 Ga0314311_10085751 169
444 3300030734 Ga0316179_1048387 Ga0316179_10483872 169
445 3300030742 Ga0316183_1085981 Ga0316183_10859812 169
446 3300030742 Ga0316183_1191527 Ga0316183_11915272 169
447 3300031344 Ga0265316_10263490 Ga0265316_102634902 169
448 3300031548 Ga0307408_100000085 Ga0307408_10000008540 169
449 3300031548 Ga0307408_100001490 Ga0307408_1000014903 169
450 3300031548 Ga0307408_100004849 Ga0307408_1000048496 169
451 3300031548 Ga0307408_100144723 Ga0307408_1001447231 169
452 3300031731 Ga0307405_10000090 Ga0307405_1000009018 169
453 3300031731 Ga0307405_10003429 Ga0307405_100034295 169
454 3300031731 Ga0307405_10003770 Ga0307405_100037703 169
455 3300031731 Ga0307405_10310777 Ga0307405_103107772 169
456 3300031731 Ga0307405_10409759 Ga0307405_104097591 169
457 3300031824 Ga0307413_10012224 Ga0307413_100122242 169
458 3300031824 Ga0307413_10083407 Ga0307413_100834072 169
459 3300031824 Ga0307413_10405583 Ga0307413_104055832 169
460 3300031901 Ga0307406_10070526 Ga0307406_100705262 169
461 3300031901 Ga0307406_10379876 Ga0307406_103798761 169
462 3300031901 Ga0307406_10506009 Ga0307406_105060092 169
463 3300031903 Ga0307407_10119123 Ga0307407_101191232 169
464 3300031911 Ga0307412_10001395 Ga0307412_100013956 169
465 3300031911 Ga0307412_10003640 Ga0307412_100036403 169
466 3300031911 Ga0307412_10067558 Ga0307412_100675582 169
467 3300031911 Ga0307412_10372683 Ga0307412_103726832 169
468 3300031995 Ga0307409_100211510 Ga0307409_1002115102 169
469 3300032004 Ga0307414_10031507 Ga0307414_100315072 169
470 3300032004 Ga0307414_10094009 Ga0307414_100940092 169
471 3300032004 Ga0307414_10193898 Ga0307414_101938983 169
472 3300032005 Ga0307411_10015937 Ga0307411_100159374 169
473 3300032005 Ga0307411_10647690 Ga0307411_106476902 169
474 3300033180 Ga0307510_10000175 Ga0307510_100001752 169
475 3300041405 Ga0439438_000022 Ga0439438_000022_106434_106943 169
476 3300041405 Ga0439438_000041 Ga0439438_000041_63292_63801 169
477 3300041405 Ga0439438_000583 Ga0439438_000583_12904_13413 169
478 3300041405 Ga0439438_002119 Ga0439438_002119_6953_7462 169
479 3300041405 Ga0439438_003103 Ga0439438_003103_2752_3261 169
480 3300041405 Ga0439438_004708 Ga0439438_004708_4197_4706 169
481 3300041405 Ga0439438_005441 Ga0439438_005441_1038_1547 169
482 3300041405 Ga0439438_016989 Ga0439438_016989_291_800 169
483 3300041405 Ga0439438_022058 Ga0439438_022058_790_1299 169
484 3300041405 Ga0439438_047591 Ga0439438_047591_479_988 169
485 3300041405 Ga0439438_094930 Ga0439438_094930_28_537 169
486 3300041405 Ga0439438_137155 Ga0439438_137155_59_568 169
487 3300041407 Ga0439447_001918 Ga0439447_001918_6619_7128 169
488 3300041407 Ga0439447_002864 Ga0439447_002864_536_1045 169
489 3300041407 Ga0439447_006253 Ga0439447_006253_2703_3212 169
490 3300041407 Ga0439447_007186 Ga0439447_007186_2699_3208 169
491 3300041407 Ga0439447_010507 Ga0439447_010507_674_1189 169
492 3300041407 Ga0439447_010957 Ga0439447_010957_1063_1572 169
493 3300041407 Ga0439447_013661 Ga0439447_013661_1473_1982 169
494 3300041411 Ga0439466_0000141 Ga0439466_0000141_21534_22043 169
495 3300041411 Ga0439466_0000266 Ga0439466_0000266_19216_19725 169
496 3300041411 Ga0439466_0002338 Ga0439466_0002338_3034_3543 169
497 3300041411 Ga0439466_0002671 Ga0439466_0002671_334_843 169
498 3300041411 Ga0439466_0004851 Ga0439466_0004851_1308_1823 169
499 3300041411 Ga0439466_0007536 Ga0439466_0007536_2952_3461 169
500 3300041411 Ga0439466_0010019 Ga0439466_0010019_1981_2490 169
501 3300041411 Ga0439466_0012180 Ga0439466_0012180_1178_1687 169
502 3300041411 Ga0439466_0015400 Ga0439466_0015400_1581_2090 169
503 3300041411 Ga0439466_0016689 Ga0439466_0016689_1745_2254 169
504 3300041411 Ga0439466_0053514 Ga0439466_0053514_546_1055 169
505 3300041411 Ga0439466_0110551 Ga0439466_0110551_52_564 169
506 3300041413 Ga0439465_0007044 Ga0439465_0007044_1652_2161 169
507 3300041413 Ga0439465_0074554 Ga0439465_0074554_73_582 169
508 3300041486 Ga0451807_0754821 Ga0451807_0754821_76_594 169
509 3300042001 Ga0439441_056386 Ga0439441_056386_218_727 169
510 3300042004 Ga0439445_0010331 Ga0439445_0010331_1671_2180 169
511 3300042004 Ga0439445_0023619 Ga0439445_0023619_721_1230 169
512 3300042006 Ga0439432_000021 Ga0439432_000021_53822_54331 169
513 3300042006 Ga0439432_000170 Ga0439432_000170_8456_8974 169
514 3300042006 Ga0439432_001425 Ga0439432_001425_4405_4914 169
515 3300042006 Ga0439432_003763 Ga0439432_003763_2579_3088 169
516 3300042006 Ga0439432_005214 Ga0439432_005214_3827_4336 169
517 3300042006 Ga0439432_017653 Ga0439432_017653_1421_1930 169
518 3300042006 Ga0439432_018172 Ga0439432_018172_785_1294 169
519 3300042006 Ga0439432_048198 Ga0439432_048198_474_983 169
520 3300042009 Ga0439451_003852 Ga0439451_003852_1880_2389 169
521 3300042009 Ga0439451_007999 Ga0439451_007999_424_933 169
522 3300042009 Ga0439451_008766 Ga0439451_008766_716_1225 169
523 3300042009 Ga0439451_011062 Ga0439451_011062_472_981 169
524 3300042009 Ga0439451_016969 Ga0439451_016969_387_896 169
525 3300042009 Ga0439451_033133 Ga0439451_033133_147_656 169
526 3300042009 Ga0439451_054517 Ga0439451_054517_218_727 169
527 3300042010 Ga0439452_000024 Ga0439452_000024_224670_225179 169
528 3300042010 Ga0439452_000921 Ga0439452_000921_12121_12630 169
529 3300042010 Ga0439452_001165 Ga0439452_001165_10439_10948 169
530 3300042010 Ga0439452_001176 Ga0439452_001176_7276_7791 169
531 3300042010 Ga0439452_003147 Ga0439452_003147_536_1045 169
532 3300042010 Ga0439452_014799 Ga0439452_014799_194_703 169
533 3300042010 Ga0439452_026604 Ga0439452_026604_521_1030 169
534 3300042010 Ga0439452_026743 Ga0439452_026743_412_921 169
535 3300042010 Ga0439452_050641 Ga0439452_050641_82_591 169
536 3300042010 Ga0439452_085073 Ga0439452_085073_136_645 169
537 3300042013 Ga0439456_000026 Ga0439456_000026_25482_25991 169
538 3300042013 Ga0439456_003444 Ga0439456_003444_1454_1963 169
539 3300042013 Ga0439456_003768 Ga0439456_003768_692_1201 169
540 3300042013 Ga0439456_012478 Ga0439456_012478_669_1178 169
541 3300042013 Ga0439456_014070 Ga0439456_014070_803_1312 169
542 3300042013 Ga0439456_041958 Ga0439456_041958_131_640 169
543 3300042013 Ga0439456_051438 Ga0439456_051438_110_619 169
544 3300042013 Ga0439456_064927 Ga0439456_064927_125_634 169
545 3300042013 Ga0439456_090482 Ga0439456_090482_28_537 169
546 3300042016 Ga0439463_000785 Ga0439463_000785_6560_7069 169
547 3300042016 Ga0439463_007759 Ga0439463_007759_932_1441 169
548 3300042016 Ga0439463_022307 Ga0439463_022307_222_731 169
549 3300042016 Ga0439463_036203 Ga0439463_036203_586_1095 169
550 3300042115 Ga0450911_000060 Ga0450911_000060_1214_1723 169
551 3300042115 Ga0450911_001750 Ga0450911_001750_1132_1641 169
552 3300042115 Ga0450911_003794 Ga0450911_003794_321_830 169
553 3300042115 Ga0450911_005171 Ga0450911_005171_333_842 169
554 3300042115 Ga0450911_007063 Ga0450911_007063_461_970 169
555 3300042115 Ga0450911_016867 Ga0450911_016867_67_576 169
556 3300042121 Ga0450919_000326 Ga0450919_000326_4002_4511 169
557 3300042121 Ga0450919_002434 Ga0450919_002434_582_1091 169
558 3300042122 Ga0450920_000150 Ga0450920_000150_1409_1918 169
559 3300042124 Ga0450922_000954 Ga0450922_000954_1827_2336 169
560 3300042124 Ga0450922_001121 Ga0450922_001121_1803_2312 169
561 3300042125 Ga0450923_013522 Ga0450923_013522_356_865 169
562 3300042125 Ga0450923_048094 Ga0450923_048094_235_744 169
563 3300042127 Ga0450890_001212 Ga0450890_001212_1700_2209 169
564 3300042136 Ga0450900_044915 Ga0450900_044915_114_623 169
565 3300042137 Ga0450902_014411 Ga0450902_014411_446_955 169
566 3300042137 Ga0450902_029411 Ga0450902_029411_286_795 169
567 3300042138 Ga0450903_001040 Ga0450903_001040_2002_2511 169
568 3300042138 Ga0450903_004441 Ga0450903_004441_1394_1903 169
569 3300042138 Ga0450903_018412 Ga0450903_018412_472_981 169
570 3300042138 Ga0450903_018526 Ga0450903_018526_485_994 169
571 3300042142 Ga0450905_000784 Ga0450905_000784_2697_3209 169
572 3300042142 Ga0450905_002023 Ga0450905_002023_359_868 169
573 3300042142 Ga0450905_013655 Ga0450905_013655_482_991 169
574 3300042145 Ga0450906_000302 Ga0450906_000302_7462_7971 169
575 3300042145 Ga0450906_000817 Ga0450906_000817_5264_5773 169
576 3300042145 Ga0450906_003854 Ga0450906_003854_1498_2007 169
577 3300042145 Ga0450906_028825 Ga0450906_028825_201_710 169
578 3300042146 Ga0450907_000066 Ga0450907_000066_35743_36252 169
579 3300042146 Ga0450907_000757 Ga0450907_000757_5748_6257 169
580 3300042146 Ga0450907_009804 Ga0450907_009804_181_690 169
581 3300042146 Ga0450907_011468 Ga0450907_011468_345_854 169
582 3300042147 Ga0450910_000126 Ga0450910_000126_4705_5214 169
583 3300042147 Ga0450910_002340 Ga0450910_002340_156_665 169
584 3300042156 Ga0439446_0007400 Ga0439446_0007400_1967_2476 169
585 3300042156 Ga0439446_0007771 Ga0439446_0007771_1776_2285 169
586 3300042156 Ga0439446_0073087 Ga0439446_0073087_498_1007 169
587 3300042184 Ga0450908_002311 Ga0450908_002311_2608_3117 169
588 3300042184 Ga0450908_011017 Ga0450908_011017_156_665 169
589 3300042184 Ga0450908_060913 Ga0450908_060913_61_570 169
590 3300042185 Ga0450909_001077 Ga0450909_001077_1680_2189 169
591 3300042185 Ga0450909_002130 Ga0450909_002130_584_1093 169
592 3300042185 Ga0450909_002444 Ga0450909_002444_1634_2143 169
593 3300042435 Ga0439434_0000098 Ga0439434_0000098_20988_21497 169
594 3300042439 Ga0439464_0003538 Ga0439464_0003538_1072_1584 169
595 3300042439 Ga0439464_0015257 Ga0439464_0015257_1039_1551 169
596 3300042461 Ga0439460_0007827 Ga0439460_0007827_1767_2276 169
597 3300042461 Ga0439460_0038210 Ga0439460_0038210_616_1125 169
598 3300042461 Ga0439460_0047252 Ga0439460_0047252_355_864 169
599 3300042461 Ga0439460_0163308 Ga0439460_0163308_207_716 169
600 3300042531 Ga0450918_005168 Ga0450918_005168_600_1109 169
601 3300042531 Ga0450918_018813 Ga0450918_018813_60_569 169
602 3300042531 Ga0450918_022137 Ga0450918_022137_178_687 169
603 3300042532 Ga0450893_0000869 Ga0450893_0000869_875_1384 169
604 3300042532 Ga0450893_0004953 Ga0450893_0004953_402_911 169
605 3300042533 Ga0450901_001078 Ga0450901_001078_1996_2505 169
606 3300042993 Ga0439440_0000929 Ga0439440_0000929_334_843 169
607 3300042993 Ga0439440_0022470 Ga0439440_0022470_235_744 169
608 3300042993 Ga0439440_0037054 Ga0439440_0037054_281_790 169
609 3300046452 Ga0495617_000370 Ga0495617_000370_4248_4757 169
610 3300046452 Ga0495617_006062 Ga0495617_006062_216_725 169
611 3300046452 Ga0495617_011746 Ga0495617_011746_1399_1908 169
612 3300046452 Ga0495617_026561 Ga0495617_026561_844_1353 169
613 3300046452 Ga0495617_049688 Ga0495617_049688_833_1342 169
614 3300046452 Ga0495617_132525 Ga0495617_132525_42_551 169
615 3300046453 Ga0495627_002233 Ga0495627_002233_9060_9569 169
616 3300046453 Ga0495627_003656 Ga0495627_003656_1566_2084 169
617 3300046453 Ga0495627_007735 Ga0495627_007735_1420_1929 169
618 3300046453 Ga0495627_020321 Ga0495627_020321_100_609 169
619 3300046453 Ga0495627_027688 Ga0495627_027688_154_663 169
620 3300046453 Ga0495627_031209 Ga0495627_031209_367_876 169
621 3300046453 Ga0495627_032894 Ga0495627_032894_1003_1521 169
622 3300046453 Ga0495627_040228 Ga0495627_040228_590_1099 169
623 3300046453 Ga0495627_105650 Ga0495627_105650_43_552 169
624 3300046455 Ga0495603_0015587 Ga0495603_0015587_3374_3883 169
625 3300046457 Ga0495590_0036562 Ga0495590_0036562_263_772 169
626 3300046457 Ga0495590_0085421 Ga0495590_0085421_251_760 169
627 3300046458 Ga0495591_000166 Ga0495591_000166_15925_16434 169
628 3300046458 Ga0495591_001075 Ga0495591_001075_16635_17144 169
629 3300046458 Ga0495591_001126 Ga0495591_001126_16810_17319 169
630 3300046458 Ga0495591_001237 Ga0495591_001237_9126_9635 169
631 3300046458 Ga0495591_002293 Ga0495591_002293_1088_1606 169
632 3300046458 Ga0495591_005540 Ga0495591_005540_1123_1632 169
633 3300046458 Ga0495591_005670 Ga0495591_005670_3579_4088 169
634 3300046458 Ga0495591_009978 Ga0495591_009978_2888_3397 169
635 3300046458 Ga0495591_013662 Ga0495591_013662_1917_2426 169
636 3300046458 Ga0495591_015397 Ga0495591_015397_1106_1615 169
637 3300046458 Ga0495591_053221 Ga0495591_053221_384_893 169
638 3300046460 Ga0495638_0005164 Ga0495638_0005164_292_801 169
639 3300046460 Ga0495638_0014672 Ga0495638_0014672_485_994 169
640 3300046460 Ga0495638_0015295 Ga0495638_0015295_4091_4600 169
641 3300046460 Ga0495638_0020862 Ga0495638_0020862_3461_3970 169
642 3300046460 Ga0495638_0026080 Ga0495638_0026080_103_612 169
643 3300046460 Ga0495638_0044301 Ga0495638_0044301_1748_2257 169
644 3300046460 Ga0495638_0153236 Ga0495638_0153236_339_848 169
645 3300046460 Ga0495638_0218693 Ga0495638_0218693_155_664 169
646 3300046463 Ga0495653_0030206 Ga0495653_0030206_388_897 169
647 3300046471 Ga0495650_0001532 Ga0495650_0001532_20976_21485 169
648 3300046471 Ga0495650_0001686 Ga0495650_0001686_11512_12021 169
649 3300046471 Ga0495650_0004647 Ga0495650_0004647_2086_2595 169
650 3300046471 Ga0495650_0006603 Ga0495650_0006603_4012_4521 169
651 3300046471 Ga0495650_0014010 Ga0495650_0014010_2589_3098 169
652 3300046471 Ga0495650_0017742 Ga0495650_0017742_2647_3156 169
653 3300046471 Ga0495650_0058724 Ga0495650_0058724_55_564 169
654 3300046471 Ga0495650_0091852 Ga0495650_0091852_55_564 169
655 3300046471 Ga0495650_0104341 Ga0495650_0104341_253_762 169
656 3300046474 Ga0495605_0000008 Ga0495605_0000008_240570_241079 169
657 3300046474 Ga0495605_0011998 Ga0495605_0011998_833_1342 169
658 3300046474 Ga0495605_0012707 Ga0495605_0012707_211_720 169
659 3300046474 Ga0495605_0019110 Ga0495605_0019110_932_1441 169
660 3300046474 Ga0495605_0058017 Ga0495605_0058017_1049_1558 169
661 3300046474 Ga0495605_0090653 Ga0495605_0090653_494_1003 169
662 3300046474 Ga0495605_0194350 Ga0495605_0194350_298_807 169
663 3300046474 Ga0495605_0194357 Ga0495605_0194357_298_807 169
664 3300046474 Ga0495605_0203246 Ga0495605_0203246_46_555 169
665 3300046474 Ga0495605_0212657 Ga0495605_0212657_300_809 169
666 3300046474 Ga0495605_0290690 Ga0495605_0290690_44_553 169
667 3300046475 Ga0495639_0005976 Ga0495639_0005976_4363_4872 169
668 3300046475 Ga0495639_0121677 Ga0495639_0121677_444_953 169
669 3300046491 Ga0495584_0000620 Ga0495584_0000620_777_1286 169
670 3300046491 Ga0495584_0000732 Ga0495584_0000732_655_1164 169
671 3300046491 Ga0495584_0005495 Ga0495584_0005495_1149_1658 169
672 3300046491 Ga0495584_0009435 Ga0495584_0009435_3479_3988 169
673 3300046491 Ga0495584_0013106 Ga0495584_0013106_821_1330 169
674 3300046491 Ga0495584_0016214 Ga0495584_0016214_2174_2692 169
675 3300046491 Ga0495584_0020892 Ga0495584_0020892_489_998 169
676 3300046492 Ga0495585_0001659 Ga0495585_0001659_15429_15941 169
677 3300046492 Ga0495585_0003088 Ga0495585_0003088_8013_8522 169
678 3300046492 Ga0495585_0003868 Ga0495585_0003868_7500_8018 169
679 3300046492 Ga0495585_0004612 Ga0495585_0004612_8300_8809 169
680 3300046492 Ga0495585_0007568 Ga0495585_0007568_383_892 169
681 3300046492 Ga0495585_0007971 Ga0495585_0007971_5843_6352 169
682 3300046492 Ga0495585_0008783 Ga0495585_0008783_1100_1609 169
683 3300046492 Ga0495585_0015765 Ga0495585_0015765_2997_3506 169
684 3300046492 Ga0495585_0041765 Ga0495585_0041765_1633_2142 169
685 3300046492 Ga0495585_0060459 Ga0495585_0060459_1290_1799 169
686 3300046492 Ga0495585_0148397 Ga0495585_0148397_62_571 169
687 3300046499 Ga0495594_0001037 Ga0495594_0001037_7534_8043 169
688 3300046499 Ga0495594_0029340 Ga0495594_0029340_2023_2532 169
689 3300046499 Ga0495594_0052485 Ga0495594_0052485_37_546 169
690 3300046500 Ga0495596_0001433 Ga0495596_0001433_12465_12974 169
691 3300046500 Ga0495596_0018317 Ga0495596_0018317_2198_2707 169
692 3300046500 Ga0495596_0043965 Ga0495596_0043965_489_998 169
693 3300046500 Ga0495596_0098940 Ga0495596_0098940_227_736 169
694 3300046501 Ga0495607_0003315 Ga0495607_0003315_6070_6582 169
695 3300046501 Ga0495607_0004426 Ga0495607_0004426_8479_8988 169
696 3300046501 Ga0495607_0006168 Ga0495607_0006168_1079_1588 169
697 3300046501 Ga0495607_0011169 Ga0495607_0011169_379_888 169
698 3300046501 Ga0495607_0011393 Ga0495607_0011393_5033_5542 169
699 3300046501 Ga0495607_0016439 Ga0495607_0016439_30_548 169
700 3300046501 Ga0495607_0030067 Ga0495607_0030067_2584_3093 169
701 3300046501 Ga0495607_0041144 Ga0495607_0041144_1060_1578 169
702 3300046501 Ga0495607_0079607 Ga0495607_0079607_190_699 169
703 3300046501 Ga0495607_0085136 Ga0495607_0085136_1029_1538 169
704 3300046501 Ga0495607_0104241 Ga0495607_0104241_481_990 169
705 3300046501 Ga0495607_0121671 Ga0495607_0121671_400_909 169
706 3300046501 Ga0495607_0167637 Ga0495607_0167637_73_582 169
707 3300046501 Ga0495607_0204002 Ga0495607_0204002_394_903 169
708 3300046506 Ga0495583_0000039 Ga0495583_0000039_104876_105385 169
709 3300046506 Ga0495583_0000674 Ga0495583_0000674_32442_32960 169
710 3300046506 Ga0495583_0002417 Ga0495583_0002417_15110_15619 169
711 3300046507 Ga0495606_0000027 Ga0495606_0000027_198508_199020 169
712 3300046507 Ga0495606_0000504 Ga0495606_0000504_58035_58544 169
713 3300046507 Ga0495606_0001120 Ga0495606_0001120_3165_3683 169
714 3300046507 Ga0495606_0003468 Ga0495606_0003468_15147_15656 169
715 3300046507 Ga0495606_0004930 Ga0495606_0004930_12057_12566 169
716 3300046507 Ga0495606_0011657 Ga0495606_0011657_3035_3544 169
717 3300046507 Ga0495606_0019679 Ga0495606_0019679_1109_1618 169
718 3300046507 Ga0495606_0024611 Ga0495606_0024611_1664_2182 169
719 3300046507 Ga0495606_0030548 Ga0495606_0030548_2187_2696 169
720 3300046507 Ga0495606_0090532 Ga0495606_0090532_103_612 169
721 3300046507 Ga0495606_0100830 Ga0495606_0100830_995_1504 169
722 3300046507 Ga0495606_0268426 Ga0495606_0268426_248_757 169
723 3300046512 Ga0495610_0002263 Ga0495610_0002263_14261_14779 169
724 3300046512 Ga0495610_0002453 Ga0495610_0002453_2669_3178 169
725 3300046512 Ga0495610_0004826 Ga0495610_0004826_1726_2235 169
726 3300046512 Ga0495610_0013764 Ga0495610_0013764_1448_1966 169
727 3300046512 Ga0495610_0030013 Ga0495610_0030013_332_841 169
728 3300046512 Ga0495610_0046054 Ga0495610_0046054_996_1505 169
729 3300046512 Ga0495610_0046168 Ga0495610_0046168_1110_1628 169
730 3300046512 Ga0495610_0088748 Ga0495610_0088748_340_849 169
731 3300046513 Ga0495616_0000979 Ga0495616_0000979_4065_4574 169
732 3300046513 Ga0495616_0003385 Ga0495616_0003385_1009_1518 169
733 3300046513 Ga0495616_0008500 Ga0495616_0008500_4486_4995 169
734 3300046513 Ga0495616_0020460 Ga0495616_0020460_420_929 169
735 3300046513 Ga0495616_0029231 Ga0495616_0029231_103_612 169
736 3300046513 Ga0495616_0081502 Ga0495616_0081502_24_542 169
737 3300046513 Ga0495616_0103762 Ga0495616_0103762_160_669 169
738 3300046513 Ga0495616_0157510 Ga0495616_0157510_328_837 169
739 3300046515 Ga0495620_0000031 Ga0495620_0000031_113010_113519 169
740 3300046515 Ga0495620_0006106 Ga0495620_0006106_1236_1745 169
741 3300046515 Ga0495620_0013502 Ga0495620_0013502_2394_2903 169
742 3300046515 Ga0495620_0019629 Ga0495620_0019629_1278_1796 169
743 3300046515 Ga0495620_0020504 Ga0495620_0020504_2163_2672 169
744 3300046515 Ga0495620_0022463 Ga0495620_0022463_1632_2141 169
745 3300046515 Ga0495620_0023223 Ga0495620_0023223_237_746 169
746 3300046515 Ga0495620_0026376 Ga0495620_0026376_478_987 169
747 3300046515 Ga0495620_0180467 Ga0495620_0180467_97_606 169
748 3300046518 Ga0495631_0000958 Ga0495631_0000958_2081_2590 169
749 3300046518 Ga0495631_0029470 Ga0495631_0029470_1799_2308 169
750 3300046518 Ga0495631_0033430 Ga0495631_0033430_1148_1657 169
751 3300046518 Ga0495631_0052385 Ga0495631_0052385_283_792 169
752 3300046518 Ga0495631_0053257 Ga0495631_0053257_58_567 169
753 3300046518 Ga0495631_0200493 Ga0495631_0200493_291_800 169
754 3300046519 Ga0495632_0000361 Ga0495632_0000361_16823_17332 169
755 3300046519 Ga0495632_0000415 Ga0495632_0000415_1660_2169 169
756 3300046519 Ga0495632_0000977 Ga0495632_0000977_4276_4785 169
757 3300046519 Ga0495632_0003653 Ga0495632_0003653_1108_1626 169
758 3300046519 Ga0495632_0016611 Ga0495632_0016611_103_612 169
759 3300046519 Ga0495632_0035304 Ga0495632_0035304_1685_2194 169
760 3300046519 Ga0495632_0035915 Ga0495632_0035915_1086_1595 169
761 3300046519 Ga0495632_0088462 Ga0495632_0088462_497_1006 169
762 3300046519 Ga0495632_0126701 Ga0495632_0126701_86_595 169
763 3300046519 Ga0495632_0126702 Ga0495632_0126702_343_852 169
764 3300046519 Ga0495632_0188180 Ga0495632_0188180_190_699 169
765 3300046519 Ga0495632_0371963 Ga0495632_0371963_68_577 169
766 3300046520 Ga0495637_0002119 Ga0495637_0002119_9983_10492 169
767 3300046520 Ga0495637_0007702 Ga0495637_0007702_1103_1621 169
768 3300046520 Ga0495637_0009090 Ga0495637_0009090_2770_3288 169
769 3300046520 Ga0495637_0009930 Ga0495637_0009930_3072_3581 169
770 3300046520 Ga0495637_0010827 Ga0495637_0010827_3147_3656 169
771 3300046520 Ga0495637_0017275 Ga0495637_0017275_1079_1588 169
772 3300046520 Ga0495637_0071604 Ga0495637_0071604_650_1159 169
773 3300046520 Ga0495637_0076824 Ga0495637_0076824_497_1006 169
774 3300046522 Ga0495643_0000081 Ga0495643_0000081_126249_126758 169
775 3300046522 Ga0495643_0000152 Ga0495643_0000152_97493_98005 169
776 3300046522 Ga0495643_0008930 Ga0495643_0008930_4014_4523 169
777 3300046522 Ga0495643_0009634 Ga0495643_0009634_4201_4710 169
778 3300046522 Ga0495643_0016207 Ga0495643_0016207_2107_2616 169
779 3300046522 Ga0495643_0019471 Ga0495643_0019471_1091_1600 169
780 3300046522 Ga0495643_0028896 Ga0495643_0028896_565_1083 169
781 3300046522 Ga0495643_0031795 Ga0495643_0031795_2409_2918 169
782 3300046522 Ga0495643_0042371 Ga0495643_0042371_1733_2242 169
783 3300046522 Ga0495643_0042572 Ga0495643_0042572_286_795 169
784 3300046522 Ga0495643_0064579 Ga0495643_0064579_972_1481 169
785 3300046522 Ga0495643_0092966 Ga0495643_0092966_298_807 169
786 3300046522 Ga0495643_0116881 Ga0495643_0116881_375_884 169
787 3300046523 Ga0495644_0011278 Ga0495644_0011278_274_783 169
788 3300046523 Ga0495644_0059714 Ga0495644_0059714_551_1060 169
789 3300046523 Ga0495644_0112131 Ga0495644_0112131_283_792 169
790 3300046523 Ga0495644_0122134 Ga0495644_0122134_369_878 169
791 3300046524 Ga0495648_0004346 Ga0495648_0004346_9701_10210 169
792 3300046524 Ga0495648_0006826 Ga0495648_0006826_4971_5480 169
793 3300046524 Ga0495648_0013643 Ga0495648_0013643_148_657 169
794 3300046524 Ga0495648_0014965 Ga0495648_0014965_398_907 169
795 3300046524 Ga0495648_0017079 Ga0495648_0017079_3672_4181 169
796 3300046524 Ga0495648_0023156 Ga0495648_0023156_2853_3362 169
797 3300046524 Ga0495648_0027001 Ga0495648_0027001_3016_3525 169
798 3300046524 Ga0495648_0031859 Ga0495648_0031859_1306_1824 169
799 3300046524 Ga0495648_0071340 Ga0495648_0071340_1474_1983 169
800 3300046524 Ga0495648_0094150 Ga0495648_0094150_220_729 169
801 3300046524 Ga0495648_0151061 Ga0495648_0151061_75_584 169
802 3300046524 Ga0495648_0174021 Ga0495648_0174021_366_875 169
803 3300046524 Ga0495648_0273344 Ga0495648_0273344_225_734 169
804 3300046526 Ga0495666_0101096 Ga0495666_0101096_485_994 169
805 3300046528 Ga0495642_0000138 Ga0495642_0000138_38191_38700 169
806 3300046528 Ga0495642_0002932 Ga0495642_0002932_5046_5555 169
807 3300046530 Ga0495654_0000220 Ga0495654_0000220_34693_35202 169
808 3300046530 Ga0495654_0000323 Ga0495654_0000323_11709_12227 169
809 3300046530 Ga0495654_0003812 Ga0495654_0003812_262_771 169
810 3300046530 Ga0495654_0006021 Ga0495654_0006021_5800_6309 169
811 3300046530 Ga0495654_0006630 Ga0495654_0006630_3384_3902 169
812 3300046530 Ga0495654_0008025 Ga0495654_0008025_5017_5526 169
813 3300046530 Ga0495654_0012098 Ga0495654_0012098_3807_4316 169
814 3300046530 Ga0495654_0028514 Ga0495654_0028514_74_583 169
815 3300046530 Ga0495654_0029306 Ga0495654_0029306_103_612 169
816 3300046530 Ga0495654_0034765 Ga0495654_0034765_914_1432 169
817 3300046530 Ga0495654_0035836 Ga0495654_0035836_482_991 169
818 3300046530 Ga0495654_0042914 Ga0495654_0042914_563_1081 169
819 3300046530 Ga0495654_0043309 Ga0495654_0043309_1678_2196 169
820 3300046530 Ga0495654_0182388 Ga0495654_0182388_71_580 169
821 3300046538 Ga0495609_0000031 Ga0495609_0000031_82413_82922 169
822 3300046538 Ga0495609_0000077 Ga0495609_0000077_117649_118158 169
823 3300046538 Ga0495609_0000104 Ga0495609_0000104_4467_4976 169
824 3300046538 Ga0495609_0019036 Ga0495609_0019036_1569_2078 169
825 3300046538 Ga0495609_0020843 Ga0495609_0020843_563_1081 169
826 3300046538 Ga0495609_0022755 Ga0495609_0022755_482_991 169
827 3300046538 Ga0495609_0035741 Ga0495609_0035741_82_591 169
828 3300046542 Ga0495597_0010521 Ga0495597_0010521_833_1342 169
829 3300046542 Ga0495597_0024428 Ga0495597_0024428_1528_2037 169
830 3300046542 Ga0495597_0035861 Ga0495597_0035861_1171_1680 169
831 3300046542 Ga0495597_0041892 Ga0495597_0041892_1227_1736 169
832 3300046542 Ga0495597_0041914 Ga0495597_0041914_1493_2002 169
833 3300046542 Ga0495597_0055472 Ga0495597_0055472_1039_1548 169
834 3300046542 Ga0495597_0128223 Ga0495597_0128223_30_539 169
835 3300046557 Ga0495622_0009921 Ga0495622_0009921_2942_3451 169
836 3300046557 Ga0495622_0013308 Ga0495622_0013308_3269_3778 169
837 3300046557 Ga0495622_0053427 Ga0495622_0053427_271_780 169
838 3300046557 Ga0495622_0126476 Ga0495622_0126476_97_606 169
839 3300046558 Ga0495633_0000011 Ga0495633_0000011_162991_163500 169
840 3300046558 Ga0495633_0006603 Ga0495633_0006603_1955_2464 169
841 3300046558 Ga0495633_0034751 Ga0495633_0034751_1058_1567 169
842 3300046558 Ga0495633_0038466 Ga0495633_0038466_328_837 169
843 3300046558 Ga0495633_0041069 Ga0495633_0041069_1594_2103 169
844 3300046558 Ga0495633_0123942 Ga0495633_0123942_444_953 169
845 3300046558 Ga0495633_0264969 Ga0495633_0264969_237_746 169
846 3300046615 Ga0495656_0001483 Ga0495656_0001483_6916_7425 169
847 3300046615 Ga0495656_0400149 Ga0495656_0400149_156_665 169
848 3300046616 Ga0495668_0002192 Ga0495668_0002192_1092_1601 169
849 3300046616 Ga0495668_0003612 Ga0495668_0003612_10267_10776 169
850 3300046616 Ga0495668_0005092 Ga0495668_0005092_6741_7250 169
851 3300046616 Ga0495668_0071049 Ga0495668_0071049_313_822 169
852 3300046616 Ga0495668_0230100 Ga0495668_0230100_489_998 169
853 3300046648 Ga0495611_0000863 Ga0495611_0000863_12002_12511 169
854 3300046648 Ga0495611_0006413 Ga0495611_0006413_163_672 169
855 3300046648 Ga0495611_0006961 Ga0495611_0006961_4093_4602 169
856 3300046648 Ga0495611_0047137 Ga0495611_0047137_140_658 169
857 3300046648 Ga0495611_0098874 Ga0495611_0098874_688_1197 169
858 3300046660 Ga0495625_0001167 Ga0495625_0001167_21951_22460 169
859 3300046660 Ga0495625_0006860 Ga0495625_0006860_8973_9482 169
860 3300046660 Ga0495625_0011364 Ga0495625_0011364_656_1165 169
861 3300046660 Ga0495625_0017975 Ga0495625_0017975_4055_4564 169
862 3300046660 Ga0495625_0026250 Ga0495625_0026250_2026_2535 169
863 3300046660 Ga0495625_0109981 Ga0495625_0109981_504_1013 169
864 3300046660 Ga0495625_0110246 Ga0495625_0110246_59_568 169
865 3300046660 Ga0495625_0161254 Ga0495625_0161254_952_1461 169
866 3300046660 Ga0495625_0184428 Ga0495625_0184428_486_995 169
867 3300046660 Ga0495625_0323952 Ga0495625_0323952_126_635 169
868 3300046664 Ga0495659_0011527 Ga0495659_0011527_491_1000 169
869 3300046664 Ga0495659_0014303 Ga0495659_0014303_1695_2204 169
870 3300046665 Ga0495661_0000021 Ga0495661_0000021_52237_52746 169
871 3300046665 Ga0495661_0002252 Ga0495661_0002252_11134_11652 169
872 3300046665 Ga0495661_0003563 Ga0495661_0003563_1236_1754 169
873 3300046665 Ga0495661_0008906 Ga0495661_0008906_4297_4806 169
874 3300046665 Ga0495661_0050337 Ga0495661_0050337_1645_2154 169
875 3300046665 Ga0495661_0052944 Ga0495661_0052944_449_958 169
876 3300046665 Ga0495661_0065824 Ga0495661_0065824_368_877 169
877 3300046665 Ga0495661_0066129 Ga0495661_0066129_367_876 169
878 3300046665 Ga0495661_0078361 Ga0495661_0078361_1036_1545 169
879 3300046665 Ga0495661_0078459 Ga0495661_0078459_592_1110 169
880 3300046665 Ga0495661_0106429 Ga0495661_0106429_698_1207 169
881 3300046665 Ga0495661_0171761 Ga0495661_0171761_609_1118 169
882 3300046665 Ga0495661_0225682 Ga0495661_0225682_281_790 169
883 3300046665 Ga0495661_0379649 Ga0495661_0379649_62_571 169
884 3300046674 Ga0495588_0175461 Ga0495588_0175461_507_1016 169
885 3300046674 Ga0495588_0211956 Ga0495588_0211956_387_896 169
886 3300046691 Ga0495670_0000046 Ga0495670_0000046_60935_61453 169
887 3300046691 Ga0495670_0000721 Ga0495670_0000721_3025_3534 169
888 3300046691 Ga0495670_0009127 Ga0495670_0009127_493_1002 169
889 3300046691 Ga0495670_0024294 Ga0495670_0024294_1834_2343 169
890 3300046691 Ga0495670_0037737 Ga0495670_0037737_1331_1840 169
891 3300046691 Ga0495670_0073773 Ga0495670_0073773_885_1394 169
892 3300046691 Ga0495670_0084092 Ga0495670_0084092_1046_1555 169
893 3300046691 Ga0495670_0093112 Ga0495670_0093112_180_689 169
894 3300046691 Ga0495670_0115113 Ga0495670_0115113_816_1325 169
895 3300046691 Ga0495670_0140615 Ga0495670_0140615_320_829 169
896 3300046691 Ga0495670_0196956 Ga0495670_0196956_390_899 169
897 3300046692 Ga0495671_0003617 Ga0495671_0003617_6956_7465 169
898 3300046692 Ga0495671_0004970 Ga0495671_0004970_3903_4412 169
899 3300046692 Ga0495671_0005277 Ga0495671_0005277_2704_3213 169
900 3300046692 Ga0495671_0008308 Ga0495671_0008308_354_863 169
901 3300046692 Ga0495671_0018879 Ga0495671_0018879_437_946 169
902 3300046692 Ga0495671_0025002 Ga0495671_0025002_58_567 169
903 3300046692 Ga0495671_0036771 Ga0495671_0036771_654_1163 169
904 3300046692 Ga0495671_0057444 Ga0495671_0057444_656_1165 169
905 3300046692 Ga0495671_0065445 Ga0495671_0065445_545_1063 169
906 3300046692 Ga0495671_0118869 Ga0495671_0118869_533_1042 169
907 3300046694 Ga0495649_0000833 Ga0495649_0000833_15688_16200 169
908 3300046694 Ga0495649_0001663 Ga0495649_0001663_1058_1567 169
909 3300046694 Ga0495649_0003911 Ga0495649_0003911_5114_5623 169
910 3300046694 Ga0495649_0011155 Ga0495649_0011155_3077_3595 169
911 3300046694 Ga0495649_0011768 Ga0495649_0011768_4566_5075 169
912 3300046694 Ga0495649_0028774 Ga0495649_0028774_2483_2992 169
913 3300046694 Ga0495649_0052493 Ga0495649_0052493_236_745 169
914 3300046694 Ga0495649_0065282 Ga0495649_0065282_339_848 169
915 3300046694 Ga0495649_0065797 Ga0495649_0065797_937_1446 169
916 3300046694 Ga0495649_0071430 Ga0495649_0071430_991_1500 169
917 3300046694 Ga0495649_0200816 Ga0495649_0200816_73_582 169
918 3300046794 Ga0495589_0000933 Ga0495589_0000933_16305_16814 169
919 3300046794 Ga0495589_0000960 Ga0495589_0000960_9826_10335 169
920 3300046794 Ga0495589_0009401 Ga0495589_0009401_4278_4787 169
921 3300046794 Ga0495589_0020069 Ga0495589_0020069_1195_1713 169
922 3300046794 Ga0495589_0038107 Ga0495589_0038107_407_916 169
923 3300046794 Ga0495589_0070831 Ga0495589_0070831_892_1401 169
924 3300046810 Ga0495660_0002748 Ga0495660_0002748_6533_7042 169
925 3300046810 Ga0495660_0004061 Ga0495660_0004061_7755_8264 169
926 3300046810 Ga0495660_0005559 Ga0495660_0005559_5615_6124 169
927 3300046810 Ga0495660_0005966 Ga0495660_0005966_3868_4386 169
928 3300046810 Ga0495660_0008878 Ga0495660_0008878_1519_2037 169
929 3300046810 Ga0495660_0013314 Ga0495660_0013314_45_554 169
930 3300046810 Ga0495660_0021175 Ga0495660_0021175_2844_3356 169
931 3300046810 Ga0495660_0025015 Ga0495660_0025015_901_1410 169
932 3300046810 Ga0495660_0029059 Ga0495660_0029059_1422_1931 169
933 3300046810 Ga0495660_0029124 Ga0495660_0029124_2052_2561 169
934 3300046810 Ga0495660_0034920 Ga0495660_0034920_1855_2364 169
935 3300046810 Ga0495660_0061744 Ga0495660_0061744_1356_1865 169
936 3300046810 Ga0495660_0066529 Ga0495660_0066529_684_1193 169
937 3300046810 Ga0495660_0068950 Ga0495660_0068950_1039_1548 169
938 3300046810 Ga0495660_0112351 Ga0495660_0112351_489_998 169
939 3300046810 Ga0495660_0130958 Ga0495660_0130958_435_944 169
940 3300046810 Ga0495660_0294047 Ga0495660_0294047_157_666 169
941 3300047318 Ga0495636_0001023 Ga0495636_0001023_5697_6206 169
942 3300047318 Ga0495636_0034644 Ga0495636_0034644_491_1000 169
943 3300047320 Ga0495672_0001293 Ga0495672_0001293_20166_20675 169
944 3300047320 Ga0495672_0003413 Ga0495672_0003413_2440_2949 169
945 3300047320 Ga0495672_0010999 Ga0495672_0010999_1608_2117 169
946 3300047320 Ga0495672_0020045 Ga0495672_0020045_3189_3698 169
947 3300047320 Ga0495672_0024942 Ga0495672_0024942_241_750 169
948 3300047320 Ga0495672_0026521 Ga0495672_0026521_2849_3358 169
949 3300047320 Ga0495672_0056958 Ga0495672_0056958_477_986 169
950 3300047320 Ga0495672_0155053 Ga0495672_0155053_219_728 169
951 3300047321 Ga0495676_0000043 Ga0495676_0000043_9973_10482 169
952 3300047321 Ga0495676_0001108 Ga0495676_0001108_1261_1770 169
953 3300047323 Ga0495683_0000008 Ga0495683_0000008_36889_37398 169
954 3300047323 Ga0495683_0000398 Ga0495683_0000398_586_1095 169
955 3300047323 Ga0495683_0009043 Ga0495683_0009043_347_856 169
956 3300047323 Ga0495683_0011180 Ga0495683_0011180_748_1257 169
957 3300047323 Ga0495683_0011698 Ga0495683_0011698_1070_1579 169
958 3300047323 Ga0495683_0015939 Ga0495683_0015939_1506_2015 169
959 3300047323 Ga0495683_0021182 Ga0495683_0021182_1627_2136 169
960 3300047323 Ga0495683_0070427 Ga0495683_0070427_763_1272 169
961 3300047323 Ga0495683_0251938 Ga0495683_0251938_41_550 169
962 3300047443 Ga0495687_008541 Ga0495687_008541_359_868 169
963 3300047445 Ga0495677_0008726 Ga0495677_0008726_1791_2300 169
964 3300047445 Ga0495677_0126574 Ga0495677_0126574_159_668 169
965 3300047446 Ga0495679_000043 Ga0495679_000043_44845_45354 169
966 3300047446 Ga0495679_000049 Ga0495679_000049_60025_60534 169
967 3300047446 Ga0495679_000364 Ga0495679_000364_18557_19075 169
968 3300047446 Ga0495679_001121 Ga0495679_001121_841_1350 169
969 3300047446 Ga0495679_001507 Ga0495679_001507_880_1389 169
970 3300047446 Ga0495679_002066 Ga0495679_002066_8828_9337 169
971 3300047446 Ga0495679_007018 Ga0495679_007018_337_846 169
972 3300047446 Ga0495679_022380 Ga0495679_022380_381_899 169
973 3300047446 Ga0495679_030630 Ga0495679_030630_903_1412 169
974 3300047447 Ga0495685_005771 Ga0495685_005771_3096_3605 169
975 3300047447 Ga0495685_032082 Ga0495685_032082_436_945 169
976 3300047469 Ga0495673_0002361 Ga0495673_0002361_475_984 169
977 3300047469 Ga0495673_0004631 Ga0495673_0004631_639_1148 169
978 3300047469 Ga0495673_0004892 Ga0495673_0004892_7440_7949 169
979 3300047469 Ga0495673_0011404 Ga0495673_0011404_617_1126 169
980 3300047469 Ga0495673_0016361 Ga0495673_0016361_163_672 169
981 3300047469 Ga0495673_0022602 Ga0495673_0022602_711_1220 169
982 3300047469 Ga0495673_0037976 Ga0495673_0037976_641_1150 169
983 3300047469 Ga0495673_0048242 Ga0495673_0048242_325_834 169
984 3300047469 Ga0495673_0055885 Ga0495673_0055885_517_1026 169
985 3300047469 Ga0495673_0064820 Ga0495673_0064820_333_842 169
986 3300047469 Ga0495673_0081171 Ga0495673_0081171_45_554 169
987 3300047470 Ga0495681_0001059 Ga0495681_0001059_10341_10850 169
988 3300047470 Ga0495681_0004373 Ga0495681_0004373_5394_5903 169
989 3300047470 Ga0495681_0012322 Ga0495681_0012322_103_612 169
990 3300047470 Ga0495681_0022787 Ga0495681_0022787_1129_1638 169
991 3300047470 Ga0495681_0025708 Ga0495681_0025708_1093_1611 169
992 3300047470 Ga0495681_0027867 Ga0495681_0027867_887_1396 169
993 3300047470 Ga0495681_0027869 Ga0495681_0027869_781_1299 169
994 3300047470 Ga0495681_0070314 Ga0495681_0070314_1023_1532 169
995 3300047470 Ga0495681_0121413 Ga0495681_0121413_39_548 169
996 3300047470 Ga0495681_0146912 Ga0495681_0146912_269_778 169
997 3300047470 Ga0495681_0150071 Ga0495681_0150071_129_638 169
998 3300047470 Ga0495681_0176161 Ga0495681_0176161_44_553 169
999 3300047472 Ga0495686_0002463 Ga0495686_0002463_1086_1604 169
1000 3300047472 Ga0495686_0027487 Ga0495686_0027487_154_663 169
1001 3300047472 Ga0495686_0036846 Ga0495686_0036846_375_884 169
1002 3300047472 Ga0495686_0047548 Ga0495686_0047548_2010_2519 169
1003 3300047472 Ga0495686_0049213 Ga0495686_0049213_1207_1725 169
1004 3300047472 Ga0495686_0053815 Ga0495686_0053815_1832_2341 169
1005 3300047472 Ga0495686_0103026 Ga0495686_0103026_1021_1530 169
1006 3300047472 Ga0495686_0177512 Ga0495686_0177512_314_823 169
1007 3300047472 Ga0495686_0216498 Ga0495686_0216498_179_688 169
1008 3300048091 Ga0495626_0000093 Ga0495626_0000093_11523_12032 169
1009 3300048091 Ga0495626_0002267 Ga0495626_0002267_711_1220 169
1010 3300048091 Ga0495626_0002278 Ga0495626_0002278_12487_12996 169
1011 3300048091 Ga0495626_0002398 Ga0495626_0002398_300_809 169
1012 3300048091 Ga0495626_0004721 Ga0495626_0004721_1535_2044 169
1013 3300048091 Ga0495626_0005009 Ga0495626_0005009_1872_2381 169
1014 3300048091 Ga0495626_0007868 Ga0495626_0007868_343_852 169
1015 3300048091 Ga0495626_0052850 Ga0495626_0052850_459_968 169
1016 3300048903 Ga0496100_0273706 Ga0496100_0273706_87_596 169
1017 3300048903 Ga0496100_1109944 Ga0496100_1109944_59_571 169
1018 3300048909 Ga0496106_0030309 Ga0496106_0030309_2740_3249 169
1019 3300048909 Ga0496106_0110577 Ga0496106_0110577_1560_2069 169
1020 3300048909 Ga0496106_1085744 Ga0496106_1085744_81_590 169
1021 3300048911 Ga0496108_1366467 Ga0496108_1366467_68_577 169
1022 3300048913 Ga0496110_0124242 Ga0496110_0124242_1642_2151 169
1023 3300048917 Ga0496114_0002603 Ga0496114_0002603_7959_8471 169
1024 3300048918 Ga0496115_0264884 Ga0496115_0264884_528_1037 169
1025 3300048919 Ga0496116_0000151 Ga0496116_0000151_22456_22974 169
1026 3300048919 Ga0496116_0001307 Ga0496116_0001307_26742_27251 169
1027 3300048919 Ga0496116_0020966 Ga0496116_0020966_397_906 169
1028 3300048920 Ga0496117_0001557 Ga0496117_0001557_22787_23305 169
1029 3300048920 Ga0496117_0003110 Ga0496117_0003110_14541_15053 169
1030 3300048920 Ga0496117_0004055 Ga0496117_0004055_13956_14474 169
1031 3300048920 Ga0496117_0019269 Ga0496117_0019269_3841_4350 169
1032 3300048920 Ga0496117_0021162 Ga0496117_0021162_925_1434 169
1033 3300048920 Ga0496117_0030229 Ga0496117_0030229_164_673 169
1034 3300048921 Ga0496118_0003144 Ga0496118_0003144_19935_20444 169
1035 3300048921 Ga0496118_0006743 Ga0496118_0006743_1795_2307 169
1036 3300048921 Ga0496118_0006817 Ga0496118_0006817_11111_11629 169
1037 3300048921 Ga0496118_0118879 Ga0496118_0118879_596_1114 169
1038 3300048922 Ga0496119_0000683 Ga0496119_0000683_25461_25973 169
1039 3300048922 Ga0496119_0015481 Ga0496119_0015481_1876_2394 169
1040 3300048922 Ga0496119_0020465 Ga0496119_0020465_3551_4069 169
1041 3300048922 Ga0496119_0080697 Ga0496119_0080697_301_810 169
1042 3300048922 Ga0496119_0182513 Ga0496119_0182513_402_911 169
1043 3300048923 Ga0496120_0000596 Ga0496120_0000596_19377_19889 169
1044 3300048923 Ga0496120_0011309 Ga0496120_0011309_2010_2528 169
1045 3300048923 Ga0496120_0014840 Ga0496120_0014840_1138_1656 169
1046 3300048923 Ga0496120_0036209 Ga0496120_0036209_2148_2666 169
1047 3300048923 Ga0496120_0044375 Ga0496120_0044375_1009_1518 169
1048 3300048923 Ga0496120_0063559 Ga0496120_0063559_1066_1575 169
1049 3300048924 Ga0496121_0002255 Ga0496121_0002255_28291_28800 169
1050 3300048924 Ga0496121_0015050 Ga0496121_0015050_3270_3788 169
1051 3300048924 Ga0496121_0016681 Ga0496121_0016681_803_1312 169
1052 3300048924 Ga0496121_0022912 Ga0496121_0022912_2865_3377 169
1053 3300048924 Ga0496121_0086229 Ga0496121_0086229_457_969 169
1054 3300048924 Ga0496121_0188468 Ga0496121_0188468_483_992 169
1055 3300048925 Ga0496122_0002099 Ga0496122_0002099_21240_21752 169
1056 3300048925 Ga0496122_0020597 Ga0496122_0020597_1871_2380 169
1057 3300048925 Ga0496122_0025307 Ga0496122_0025307_1777_2286 169
1058 3300048925 Ga0496122_0041743 Ga0496122_0041743_853_1362 169
1059 3300048925 Ga0496122_0054002 Ga0496122_0054002_20_538 169
1060 3300048925 Ga0496122_0070188 Ga0496122_0070188_994_1506 169
1061 3300048925 Ga0496122_0081533 Ga0496122_0081533_321_839 169
1062 3300048925 Ga0496122_0112101 Ga0496122_0112101_390_908 169
1063 3300048925 Ga0496122_0125652 Ga0496122_0125652_940_1449 169
1064 3300048925 Ga0496122_0323074 Ga0496122_0323074_123_632 169
1065 3300048926 Ga0496123_0000899 Ga0496123_0000899_5416_5928 169
1066 3300048926 Ga0496123_0009970 Ga0496123_0009970_180_689 169
1067 3300048926 Ga0496123_0021903 Ga0496123_0021903_1973_2491 169
1068 3300048926 Ga0496123_0048796 Ga0496123_0048796_1087_1596 169
1069 3300048926 Ga0496123_0051177 Ga0496123_0051177_1452_1961 169
1070 3300048926 Ga0496123_0065322 Ga0496123_0065322_937_1446 169
1071 3300048926 Ga0496123_0101022 Ga0496123_0101022_150_662 169
1072 3300048926 Ga0496123_0287400 Ga0496123_0287400_218_727 169
1073 3300048927 Ga0496124_0002187 Ga0496124_0002187_22086_22604 169
1074 3300048927 Ga0496124_0004118 Ga0496124_0004118_12265_12777 169
1075 3300048927 Ga0496124_0020612 Ga0496124_0020612_105_614 169
1076 3300048927 Ga0496124_0034356 Ga0496124_0034356_3248_3757 169
1077 3300048927 Ga0496124_0083840 Ga0496124_0083840_95_613 169
1078 3300048927 Ga0496124_0117852 Ga0496124_0117852_894_1412 169
1079 3300048927 Ga0496124_0129789 Ga0496124_0129789_616_1125 169
1080 3300048927 Ga0496124_0218215 Ga0496124_0218215_284_802 169
1081 3300048928 Ga0496125_0001584 Ga0496125_0001584_22247_22765 169
1082 3300048928 Ga0496125_0003412 Ga0496125_0003412_18049_18558 169
1083 3300048928 Ga0496125_0012417 Ga0496125_0012417_3702_4214 169
1084 3300048928 Ga0496125_0028559 Ga0496125_0028559_1941_2459 169
1085 3300048928 Ga0496125_0039717 Ga0496125_0039717_3031_3540 169
1086 3300048928 Ga0496125_0043333 Ga0496125_0043333_496_1005 169
1087 3300048928 Ga0496125_0078447 Ga0496125_0078447_546_1055 169
1088 3300048928 Ga0496125_0124960 Ga0496125_0124960_764_1282 169
1089 3300048928 Ga0496125_0164951 Ga0496125_0164951_362_880 169
1090 3300048928 Ga0496125_0390747 Ga0496125_0390747_95_613 169
1091 3300048929 Ga0496126_0002870 Ga0496126_0002870_10250_10768 169
1092 3300048929 Ga0496126_0005675 Ga0496126_0005675_5740_6258 169
1093 3300048929 Ga0496126_0173858 Ga0496126_0173858_846_1364 169
1094 3300048929 Ga0496126_0511040 Ga0496126_0511040_194_703 169
1095 3300049459 Ga0495678_000018 Ga0495678_000018_174291_174800 169
1096 3300049459 Ga0495678_000886 Ga0495678_000886_722_1231 169
1097 3300049459 Ga0495678_001463 Ga0495678_001463_17655_18164 169
1098 3300049459 Ga0495678_003005 Ga0495678_003005_4023_4532 169
1099 3300049459 Ga0495678_007497 Ga0495678_007497_360_869 169
1100 3300049459 Ga0495678_010196 Ga0495678_010196_103_612 169
1101 3300049459 Ga0495678_011068 Ga0495678_011068_2663_3172 169
1102 3300049459 Ga0495678_012290 Ga0495678_012290_1759_2268 169
1103 3300049459 Ga0495678_015282 Ga0495678_015282_624_1133 169
1104 3300049459 Ga0495678_041316 Ga0495678_041316_138_647 169
1105 3300049459 Ga0495678_066814 Ga0495678_066814_507_1016 169
1106 3300049459 Ga0495678_088216 Ga0495678_088216_467_976 169
1107 3300049459 Ga0495678_123833 Ga0495678_123833_69_578 169
1108 3300049459 Ga0495678_162265 Ga0495678_162265_67_576 169
1109 3300049460 Ga0495682_0007572 Ga0495682_0007572_3719_4237 169
1110 3300049460 Ga0495682_0049495 Ga0495682_0049495_45_554 169
1111 3300049460 Ga0495682_0132354 Ga0495682_0132354_328_837 169
1112 3300049571 Ga0501034_0000685 Ga0501034_0000685_14726_15238 169
1113 3300049662 Ga0501222_000257 Ga0501222_000257_3312_3821 169
1114 3300049673 Ga0501240_005571 Ga0501240_005571_960_1469 169
1115 3300049688 Ga0501259_092444 Ga0501259_092444_108_617 169
1116 3300049708 Ga0501245_083655 Ga0501245_083655_13_522 169
1117 3300049853 Ga0501226_002852 Ga0501226_002852_444_953 169
1118 3300050489 nmdc:mga03683_33110_c1 nmdc:mga03683_33110_c1_256_786 169
1119 3300053125 Ga0500618_017851 Ga0500618_017851_1051_1560 169
1120 3300053135 Ga0500659_0000721 Ga0500659_0000721_9841_10353 169
1121 3300053139 Ga0500568_0047419 Ga0500568_0047419_894_1403 169
1122 3300053161 Ga0500634_0000077 Ga0500634_0000077_11129_11647 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

25

94

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

129

177

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

123

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bhy-assembly1.cif.gz_B dna-binding domain of deor in complex with the dna operator 0.991 124 162
7bhy-assembly2.cif.gz_C-2 dna-binding domain of deor in complex with the dna operator 0.9854 124 162
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9601 124 162
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9482 111 164
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9438 110 164
ID Description Score Start End Superfamily
af_O06371_1_115_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9689 125 158 1.10.10.60
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9601 124 162 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9581 124 162 1.10.10.10
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9578 124 162 1.10.10.10
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9571 115 164 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A172YDV2-F1-model_v4 RNA polymerase subunit sigma 0.9509 9 169 GO:0003677
GO:0006352
GO:0016987
AF-A0A4Q6F4P6-F1-model_v4 deleted 0.949 12 122
AF-A0A386XY88-F1-model_v4 deleted 0.9412 12 168
AF-A0A172YDV2-F1-model_v4 RNA polymerase subunit sigma 0.9342 9 169 GO:0003677
GO:0006352
GO:0016987
AF-A0A4S4ANS9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9288 12 168 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
91.71 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map