F490261

General Info

Members Datasets Scaffolds Average Seq Length
1113 432 1037 306

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100004479|Ga0070678_1000044797
Length 369
Sequence VRDRVSAFGGAKTEGRDDCKRPAPVIDAIASILVNADFWSAVLRIATPLVFGTLGVLLCERAGVLNLGIEGIMVAGALAGWLVVYLGAGLWIGVLAAAATGAVFGLLHGFLTVPLALSQHVAGLGITLFATSVSYFAYRVSFPSVTSPPTITPFVEMRWLSLPVLAAQTPLTLAALLLVPLVGWFLYRTPAGLAVRMVGENPAAAEGQGLDVHRVRMAAIVAGSALMGVAGAFLTLSAFNAFFFNMVNGRGWICVALVVFAGWRPGKALAGALLFAFFDAMQLRMQQAGDSGLPYQVWLMVPYLLSILALIAVARRAAYPQALMKPYVKGERLETTGPATRTRPFSAPYLPMRDCAASVIVASASSSTI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2547132374 Acidovorax radicis N35 Isolate Unclassified
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
13 2643221569 Achromobacter sp. Root565 Isolate Unclassified
14 2643221570 Acidovorax sp. Root568 Isolate Unclassified
15 2643221594 Achromobacter sp. Root170 Isolate Unclassified
16 2643221596 Acidovorax sp. Root70 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221621 Achromobacter sp. Root83 Isolate Unclassified
20 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
21 2643221652 Acidovorax sp. Root402 Isolate Unclassified
22 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
23 2643221658 Variovorax sp. Root411 Isolate Unclassified
24 2643221672 Variovorax sp. Root434 Isolate Unclassified
25 2643221683 Variovorax sp. Root473 Isolate Unclassified
26 2643221717 Acidovorax sp. Root267 Isolate Unclassified
27 2738541277 Variovorax sp. GV051 Isolate Unclassified
28 2738541307 Variovorax sp. GV008 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2738543013 Variovorax sp. BT01 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2751185800 Brucella pituitosa AA2 Isolate Unclassified
33 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
34 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
35 2816332133 Acidovorax radicis 2721A Isolate Unclassified
36 2818991446 Variovorax sp. 1180 Isolate Unclassified
37 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
38 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
39 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
40 2842677519 Variovorax sp. R-72495 Isolate Unclassified
41 2842733646 Variovorax sp. R-72446 Isolate Unclassified
42 2842747753 Variovorax sp. R-72060 Isolate Unclassified
43 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
44 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
45 2854911287 Brucella lupini LUP21 Isolate Unclassified
46 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
47 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
48 2858950400 Achromobacter sp. K91 Isolate Unclassified
49 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
50 2885198086 Variovorax sp. 679 Isolate Unclassified
51 2885211737 Variovorax sp. 553 Isolate Unclassified
52 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
53 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
54 2899924645 Variovorax sp. 369 Isolate Unclassified
55 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
56 2904456579 Variovorax sp. 2002 Isolate Unclassified
57 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
58 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
59 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
60 2928037797 Variovorax sp. 1126 Isolate Unclassified
61 2928044640 Variovorax sp. 1128 Isolate Unclassified
62 2928051484 Variovorax sp. 1133 Isolate Unclassified
63 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
64 2928070936 Variovorax gossypii 1167 Isolate Unclassified
65 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
66 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
67 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
68 2929520902 Variovorax beijingensis 502 Isolate Unclassified
69 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
70 2941479691
71 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
72 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
73 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
74 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
75 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
76 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
77 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
78 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
83 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
84 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
85 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
86 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
87 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
88 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
89 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
90 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
91 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
92 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
93 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
94 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
97 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
98 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
102 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
103 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
105 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
106 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
116 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
122 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
126 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
127 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
132 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
133 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
134 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
135 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
136 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
137 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
138 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
144 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
145 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
148 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
149 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
150 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
151 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
152 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
168 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
169 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
170 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
171 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
172 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
173 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
174 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
175 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
176 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
177 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
178 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
179 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
180 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
181 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
183 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
184 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
185 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
189 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
190 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
191 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
192 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
193 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
194 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
195 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
196 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
197 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
198 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
199 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
200 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
203 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
204 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
205 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
208 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
212 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
213 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
214 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
216 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
217 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
225 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
282 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
286 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
292 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
293 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
294 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
295 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
296 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
297 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
304 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
307 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
308 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
311 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
315 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
318 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
319 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
323 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
324 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
325 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
326 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
327 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
328 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
329 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
330 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
331 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
332 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
333 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
334 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
335 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
336 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
337 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
338 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
339 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
340 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
341 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
342 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
343 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
347 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
348 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
349 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
350 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
351 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
352 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
353 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
363 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
373 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
374 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
388 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
389 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
390 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
394 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
395 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
399 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
400 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
401 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
412 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
415 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
418 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
419 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
420 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
421 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
422 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
423 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
424 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
425 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
426 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
431 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
432 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.04
Nodule 0.9
Rhizoplane 2.34
Rhizosphere 63.52
Stem 0
Stem Tuber 0
Unclassified 13.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2666113 2162886007 Bacteria 1415
2 JGI24749J21850_1004017 3300002076 Bacteria 2052
3 JGI25155J39150_1000002 3300002704 Bacteria 292156
4 JGI25156J39149_1000003 3300002705 Bacteria 305434
5 JGI25154J39366_1000009 3300002738 Bacteria 305408
6 JGI25157J39369_1000002 3300002741 Bacteria 305434
7 JGI25152J39213_1001234 3300002773 Bacteria 11687
8 JGI25150J39212_1000784 3300002774 Bacteria 10872
9 JGI25159J45721_1000148 3300002987 Bacteria 32592
10 JGI25159J45721_1001075 3300002987 Bacteria 11677
11 JGI25159J45721_1023052 3300002987 Bacteria 1138
12 JGI25151J46595_10001070 3300003187 Bacteria 20411
13 JGI25151J46595_10002632 3300003187 Bacteria 10571
14 JGI25151J46595_10011867 3300003187 Bacteria 3989
15 JGI25151J46595_10024513 3300003187 Bacteria 2467
16 JGI25151J46595_10043128 3300003187 Bacteria 1618
17 JGI25153J46596_10001727 3300003215 Bacteria 12962
18 JGI25153J46596_10001768 3300003215 Bacteria 12822
19 JGI25160J50197_1000123 3300003354 Bacteria 70031
20 JGI25160J50197_1009409 3300003354 Bacteria 3626
21 JGI25161J50226_1000032 3300003374 Bacteria 138440
22 JGI25161J50226_1001050 3300003374 Bacteria 9462
23 Ga0055542_1000021 3300003762 Bacteria 331499
24 Ga0055526_1001458 3300003771 Bacteria 16782
25 Ga0055526_1002300 3300003771 Bacteria 13035
26 Ga0055526_1002744 3300003771 Bacteria 11681
27 Ga0055526_1003550 3300003771 Bacteria 9828
28 Ga0055526_1003943 3300003771 Bacteria 9161
29 Ga0055526_1007340 3300003771 Bacteria 5757
30 Ga0055526_1010696 3300003771 Bacteria 4237
31 Ga0055537_1000079 3300003773 Bacteria 69953
32 Ga0055537_1003026 3300003773 Bacteria 5309
33 Ga0055524_1000012 3300003775 Bacteria 260384
34 Ga0055524_1000097 3300003775 Bacteria 108145
35 Ga0055524_1000987 3300003775 Bacteria 17754
36 Ga0055524_1001542 3300003775 Bacteria 13031
37 Ga0055524_1001822 3300003775 Bacteria 11681
38 Ga0055536_1000657 3300003781 Bacteria 23356
39 Ga0055536_1000861 3300003781 Bacteria 19829
40 Ga0055536_1001022 3300003781 Bacteria 17664
41 Ga0055536_1001230 3300003781 Bacteria 15819
42 Ga0055536_1005409 3300003781 Bacteria 6255
43 Ga0055536_1008299 3300003781 Bacteria 4488
44 Ga0055536_1009066 3300003781 Bacteria 4181
45 Ga0055534_1000092 3300003784 Bacteria 70082
46 Ga0055534_1001022 3300003784 Bacteria 12273
47 Ga0055534_1001081 3300003784 Bacteria 11681
48 Ga0055534_1001381 3300003784 Bacteria 9700
49 Ga0055534_1004666 3300003784 Bacteria 3889
50 Ga0055528_1000956 3300003790 Bacteria 19155
51 Ga0055528_1002291 3300003790 Bacteria 10371
52 Ga0055528_1009159 3300003790 Bacteria 4168
53 Ga0055530_10000453 3300003791 Bacteria 36520
54 Ga0055530_10000793 3300003791 Bacteria 26295
55 Ga0055530_10017436 3300003791 Bacteria 2251
56 Ga0055540_1000012 3300003792 Bacteria 262667
57 Ga0055540_1001467 3300003792 Bacteria 14051
58 Ga0055540_1002293 3300003792 Bacteria 10309
59 Ga0055531_10000653 3300003794 Bacteria 29813
60 Ga0055531_10001541 3300003794 Bacteria 16875
61 Ga0055543_1000294 3300004625 Bacteria 35881
62 Ga0055543_1000696 3300004625 Bacteria 17270
63 Ga0065165_1002228 3300005262 Bacteria 17278
64 Ga0065165_1012757 3300005262 Bacteria 3397
65 Ga0065165_1012901 3300005262 Bacteria 3361
66 Ga0065704_10011989 3300005289 Bacteria 2169
67 Ga0065712_10148324 3300005290 Bacteria 1384
68 Ga0065715_10125828 3300005293 Bacteria 2122
69 Ga0065715_10129220 3300005293 Bacteria 2030
70 Ga0070676_10014907 3300005328 Bacteria 4278
71 Ga0070676_10035845 3300005328 Bacteria 2855
72 Ga0070676_10079487 3300005328 Bacteria 1986
73 Ga0070676_10283737 3300005328 Bacteria 1117
74 Ga0070683_100023735 3300005329 Bacteria 5488
75 Ga0070690_100003489 3300005330 Bacteria 8600
76 Ga0070690_100056744 3300005330 Bacteria 2512
77 Ga0070690_100110902 3300005330 Bacteria 1831
78 Ga0070670_100001483 3300005331 Bacteria 18899
79 Ga0070670_100002742 3300005331 Bacteria 14546
80 Ga0070670_100007028 3300005331 Bacteria 9536
81 Ga0070670_100008068 3300005331 Bacteria 8956
82 Ga0070670_100037126 3300005331 Bacteria 4192
83 Ga0070670_100066159 3300005331 Bacteria 3101
84 Ga0070670_100084979 3300005331 Bacteria 2719
85 Ga0070670_100113866 3300005331 Bacteria 2332
86 Ga0070677_10002129 3300005333 Bacteria 6319
87 Ga0070677_10022565 3300005333 Bacteria 2320
88 Ga0070677_10030335 3300005333 Bacteria 2058
89 Ga0070677_10040639 3300005333 Bacteria 1831
90 Ga0070677_10080223 3300005333 Bacteria 1394
91 Ga0070677_10083395 3300005333 Bacteria 1373
92 Ga0068869_100000178 3300005334 Bacteria 32316
93 Ga0068869_100009675 3300005334 Bacteria 6258
94 Ga0068869_100042331 3300005334 Bacteria 3265
95 Ga0068869_100091902 3300005334 Bacteria 2283
96 Ga0070666_10014344 3300005335 Bacteria 5044
97 Ga0070666_10025971 3300005335 Bacteria 3822
98 Ga0070666_10074039 3300005335 Bacteria 2321
99 Ga0070666_10088379 3300005335 Bacteria 2126
100 Ga0070666_10276568 3300005335 Bacteria 1193
101 Ga0070680_100143639 3300005336 Bacteria 2002
102 Ga0068868_100005608 3300005338 Bacteria 8829
103 Ga0068868_100068148 3300005338 Bacteria 2833
104 Ga0068868_100092542 3300005338 Bacteria 2437
105 Ga0070687_100006353 3300005343 Bacteria 4838
106 Ga0070661_100003091 3300005344 Bacteria 11456
107 Ga0070661_100014055 3300005344 Bacteria 5633
108 Ga0070661_100090249 3300005344 Bacteria 2269
109 Ga0070661_100431373 3300005344 Bacteria 1046
110 Ga0070692_10049561 3300005345 Bacteria 2179
111 Ga0070668_100004619 3300005347 Bacteria 10201
112 Ga0070668_100034232 3300005347 Bacteria 3871
113 Ga0070668_100053700 3300005347 Bacteria 3107
114 Ga0070668_100065909 3300005347 Bacteria 2809
115 Ga0070668_100078177 3300005347 Bacteria 2587
116 Ga0070668_100103436 3300005347 Bacteria 2259
117 Ga0070668_100177094 3300005347 Bacteria 1740
118 Ga0070669_100008927 3300005353 Bacteria 7153
119 Ga0070669_100015579 3300005353 Bacteria 5422
120 Ga0070669_100018890 3300005353 Bacteria 4927
121 Ga0070669_100065009 3300005353 Bacteria 2687
122 Ga0070669_100098538 3300005353 Bacteria 2202
123 Ga0070669_100113582 3300005353 Bacteria 2058
124 Ga0070669_100178562 3300005353 Bacteria 1659
125 Ga0070675_100001733 3300005354 Bacteria 16097
126 Ga0070675_100014191 3300005354 Bacteria 6280
127 Ga0070675_100020917 3300005354 Bacteria 5225
128 Ga0070675_100033094 3300005354 Bacteria 4188
129 Ga0070675_100080936 3300005354 Bacteria 2708
130 Ga0070675_100364892 3300005354 Bacteria 1283
131 Ga0070671_100004476 3300005355 Bacteria 11061
132 Ga0070671_100015093 3300005355 Bacteria 6239
133 Ga0070671_100020848 3300005355 Bacteria 5347
134 Ga0070671_100025674 3300005355 Bacteria 4835
135 Ga0070671_100063486 3300005355 Bacteria 3076
136 Ga0070671_100269750 3300005355 Bacteria 1446
137 Ga0070674_100024203 3300005356 Bacteria 3938
138 Ga0070674_100036087 3300005356 Bacteria 3316
139 Ga0070674_100047128 3300005356 Bacteria 2951
140 Ga0070674_100056035 3300005356 Bacteria 2732
141 Ga0070674_100075904 3300005356 Bacteria 2388
142 Ga0070674_100139183 3300005356 Bacteria 1819
143 Ga0070674_100152914 3300005356 Bacteria 1743
144 Ga0070673_100009444 3300005364 Bacteria 6546
145 Ga0070673_100017776 3300005364 Bacteria 5066
146 Ga0070673_100056382 3300005364 Bacteria 3100
147 Ga0070673_100205263 3300005364 Bacteria 1699
148 Ga0070688_100009048 3300005365 Bacteria 5430
149 Ga0070688_100025675 3300005365 Bacteria 3491
150 Ga0070659_100017155 3300005366 Bacteria 5442
151 Ga0070659_100332341 3300005366 Bacteria 1272
152 Ga0070667_100001198 3300005367 Bacteria 23577
153 Ga0070667_100018482 3300005367 Bacteria 5781
154 Ga0070667_100023441 3300005367 Bacteria 5121
155 Ga0070667_100120129 3300005367 Bacteria 2285
156 Ga0070667_100223216 3300005367 Bacteria 1678
157 Ga0070667_100255016 3300005367 Bacteria 1569
158 Ga0070705_100318140 3300005440 Bacteria 1122
159 Ga0070700_100004393 3300005441 Bacteria 7360
160 Ga0070700_100103998 3300005441 Bacteria 1876
161 Ga0070694_100150561 3300005444 Bacteria 1699
162 Ga0070663_100027541 3300005455 Bacteria 3861
163 Ga0070678_100004479 3300005456 Bacteria 7927
164 Ga0070678_100013926 3300005456 Bacteria 5057
165 Ga0070678_100016709 3300005456 Bacteria 4702
166 Ga0070678_100040672 3300005456 Bacteria 3290
167 Ga0070678_100061942 3300005456 Bacteria 2760
168 Ga0070678_100283497 3300005456 Bacteria 1402
169 Ga0070662_100003994 3300005457 Bacteria 9247
170 Ga0070662_100005238 3300005457 Bacteria 8274
171 Ga0070662_100013360 3300005457 Bacteria 5464
172 Ga0070662_100116545 3300005457 Bacteria 2042
173 Ga0070681_10097261 3300005458 Bacteria 2891
174 Ga0068867_100000273 3300005459 Bacteria 33912
175 Ga0068867_100005155 3300005459 Bacteria 9226
176 Ga0068867_100031942 3300005459 Bacteria 3804
177 Ga0068867_100061662 3300005459 Bacteria 2785
178 Ga0068867_100091081 3300005459 Bacteria 2314
179 Ga0068867_100201226 3300005459 Bacteria 1594
180 Ga0068867_100261268 3300005459 Bacteria 1412
181 Ga0070685_10078150 3300005466 Bacteria 1977
182 Ga0070699_100413942 3300005518 Bacteria 1220
183 Ga0070679_100329255 3300005530 Bacteria 1476
184 Ga0068853_100014373 3300005539 Bacteria 6481
185 Ga0070672_100004667 3300005543 Bacteria 8984
186 Ga0070672_100027843 3300005543 Bacteria 4220
187 Ga0070672_100047555 3300005543 Bacteria 3329
188 Ga0070672_100049824 3300005543 Bacteria 3260
189 Ga0070672_100065484 3300005543 Bacteria 2875
190 Ga0070672_100281148 3300005543 Bacteria 1407
191 Ga0070672_100310324 3300005543 Bacteria 1339
192 Ga0070686_100051186 3300005544 Bacteria 2628
193 Ga0070686_100124845 3300005544 Bacteria 1772
194 Ga0070665_100001639 3300005548 Bacteria 25785
195 Ga0070665_100035254 3300005548 Bacteria 5031
196 Ga0070665_100088396 3300005548 Bacteria 3104
197 Ga0070665_100148512 3300005548 Bacteria 2347
198 Ga0070665_100351009 3300005548 Bacteria 1480
199 Ga0070704_100186982 3300005549 Bacteria 1662
200 Ga0068855_100031834 3300005563 Bacteria 6296
201 Ga0068855_100046637 3300005563 Bacteria 5122
202 Ga0068855_100051726 3300005563 Bacteria 4839
203 Ga0070664_100004590 3300005564 Bacteria 11085
204 Ga0070664_100005648 3300005564 Bacteria 10071
205 Ga0070664_100013082 3300005564 Bacteria 6754
206 Ga0070664_100023188 3300005564 Bacteria 5126
207 Ga0070664_100106699 3300005564 Bacteria 2441
208 Ga0070664_100112024 3300005564 Bacteria 2382
209 Ga0070664_100172815 3300005564 Bacteria 1917
210 Ga0070664_100176528 3300005564 Bacteria 1897
211 Ga0070664_100413950 3300005564 Bacteria 1234
212 Ga0068857_100001689 3300005577 Bacteria 17740
213 Ga0068857_100074298 3300005577 Bacteria 3029
214 Ga0068857_100088217 3300005577 Bacteria 2775
215 Ga0068857_100202659 3300005577 Bacteria 1809
216 Ga0068854_100013238 3300005578 Bacteria 5407
217 Ga0068854_100023805 3300005578 Bacteria 4185
218 Ga0068854_100541336 3300005578 Bacteria 986
219 Ga0068856_100028024 3300005614 Bacteria 5496
220 Ga0068856_100193519 3300005614 Bacteria 2048
221 Ga0068856_100409959 3300005614 Bacteria 1375
222 Ga0068852_100012178 3300005616 Bacteria 6516
223 Ga0068852_100174244 3300005616 Bacteria 2019
224 Ga0068852_100201849 3300005616 Bacteria 1882
225 Ga0068852_100229881 3300005616 Bacteria 1767
226 Ga0068852_100255704 3300005616 Bacteria 1680
227 Ga0068852_100657862 3300005616 Bacteria 1056
228 Ga0068859_100007644 3300005617 Bacteria 10984
229 Ga0068859_100010715 3300005617 Bacteria 9227
230 Ga0068859_100121908 3300005617 Bacteria 2674
231 Ga0068859_100137430 3300005617 Bacteria 2517
232 Ga0068859_100165593 3300005617 Bacteria 2291
233 Ga0068859_100579609 3300005617 Bacteria 1215
234 Ga0068864_100000199 3300005618 Bacteria 54129
235 Ga0068864_100002200 3300005618 Bacteria 16087
236 Ga0068864_100004274 3300005618 Bacteria 11747
237 Ga0068864_100031330 3300005618 Bacteria 4512
238 Ga0068864_100032954 3300005618 Bacteria 4403
239 Ga0068864_100159549 3300005618 Bacteria 2049
240 Ga0068864_100189564 3300005618 Bacteria 1884
241 Ga0068864_100228543 3300005618 Bacteria 1720
242 Ga0068864_100247873 3300005618 Bacteria 1652
243 Ga0068866_10030595 3300005718 Bacteria 2586
244 Ga0068866_10037416 3300005718 Bacteria 2383
245 Ga0068861_100001618 3300005719 Bacteria 14363
246 Ga0068861_100002547 3300005719 Bacteria 11913
247 Ga0068861_100047800 3300005719 Bacteria 3232
248 Ga0068861_100233701 3300005719 Bacteria 1560
249 Ga0068851_10001589 3300005834 Bacteria 9966
250 Ga0068851_10032507 3300005834 Bacteria 2596
251 Ga0068851_10091791 3300005834 Bacteria 1599
252 Ga0068870_10160924 3300005840 Bacteria 1331
253 Ga0068863_100001289 3300005841 Bacteria 25007
254 Ga0068863_100001708 3300005841 Bacteria 21723
255 Ga0068863_100002680 3300005841 Bacteria 17598
256 Ga0068863_100101116 3300005841 Bacteria 2740
257 Ga0068863_100117284 3300005841 Bacteria 2537
258 Ga0068863_100196470 3300005841 Bacteria 1939
259 Ga0068863_100286672 3300005841 Bacteria 1596
260 Ga0068863_100336087 3300005841 Bacteria 1469
261 Ga0068858_100000413 3300005842 Bacteria 44413
262 Ga0068858_100018789 3300005842 Bacteria 6466
263 Ga0068858_100023951 3300005842 Bacteria 5688
264 Ga0068858_100041553 3300005842 Bacteria 4262
265 Ga0068858_100253568 3300005842 Bacteria 1672
266 Ga0068860_100004285 3300005843 Bacteria 14582
267 Ga0068860_100011743 3300005843 Bacteria 8631
268 Ga0068860_100035293 3300005843 Bacteria 4797
269 Ga0068860_100096647 3300005843 Bacteria 2816
270 Ga0068860_100150843 3300005843 Bacteria 2238
271 Ga0068860_100226399 3300005843 Bacteria 1816
272 Ga0068860_100319082 3300005843 Bacteria 1525
273 Ga0068862_100004502 3300005844 Bacteria 11751
274 Ga0068862_100011044 3300005844 Bacteria 7459
275 Ga0068862_100011483 3300005844 Bacteria 7312
276 Ga0068862_100017703 3300005844 Bacteria 5931
277 Ga0068862_100054515 3300005844 Bacteria 3423
278 Ga0068862_100098560 3300005844 Bacteria 2553
279 Ga0068862_100252081 3300005844 Bacteria 1609
280 Ga0068862_100404321 3300005844 Bacteria 1278
281 Ga0075365_10003595 3300006038 Bacteria 8023
282 Ga0075365_10127344 3300006038 Bacteria 1760
283 Ga0075368_10050796 3300006042 Bacteria 1648
284 Ga0075363_100028997 3300006048 Bacteria 2853
285 Ga0075364_10049617 3300006051 Bacteria 2738
286 Ga0075362_10008388 3300006177 Bacteria 3949
287 Ga0075362_10031282 3300006177 Bacteria 2302
288 Ga0075362_10086289 3300006177 Bacteria 1452
289 Ga0075362_10090512 3300006177 Bacteria 1420
290 Ga0075367_10059581 3300006178 Bacteria 2273
291 Ga0075367_10096874 3300006178 Bacteria 1799
292 Ga0075369_10050690 3300006186 Bacteria 1796
293 Ga0075369_10091043 3300006186 Bacteria 1361
294 Ga0075366_10010337 3300006195 Bacteria 5239
295 Ga0075366_10015004 3300006195 Bacteria 4430
296 Ga0075366_10031279 3300006195 Bacteria 3131
297 Ga0075366_10047615 3300006195 Bacteria 2542
298 Ga0075366_10076667 3300006195 Bacteria 1995
299 Ga0075366_10091349 3300006195 Bacteria 1824
300 Ga0075366_10186449 3300006195 Bacteria 1260
301 Ga0097621_100034225 3300006237 Bacteria 4052
302 Ga0097621_100048219 3300006237 Bacteria 3455
303 Ga0097621_100051615 3300006237 Bacteria 3347
304 Ga0097621_100054844 3300006237 Bacteria 3253
305 Ga0097621_100130979 3300006237 Bacteria 2135
306 Ga0097621_100318597 3300006237 Bacteria 1377
307 Ga0075370_10000555 3300006353 Bacteria 14308
308 Ga0075370_10024221 3300006353 Bacteria 3351
309 Ga0075370_10026443 3300006353 Bacteria 3215
310 Ga0075370_10036658 3300006353 Bacteria 2755
311 Ga0075370_10049636 3300006353 Bacteria 2379
312 Ga0075370_10052918 3300006353 Bacteria 2304
313 Ga0075370_10201756 3300006353 Bacteria 1173
314 Ga0068871_100011783 3300006358 Bacteria 6425
315 Ga0068871_100028695 3300006358 Bacteria 4366
316 Ga0068871_100102571 3300006358 Bacteria 2398
317 Ga0068871_100157237 3300006358 Bacteria 1942
318 Ga0068871_100215272 3300006358 Bacteria 1663
319 Ga0075428_100116147 3300006844 Unclassified 2915
320 Ga0075428_100116379 3300006844 Bacteria 2912
321 Ga0075430_100262382 3300006846 Bacteria 1431
322 Ga0075434_100124212 3300006871 Bacteria 2597
323 Ga0075429_100277178 3300006880 Unclassified 1468
324 Ga0075429_100365368 3300006880 Bacteria 1264
325 Ga0068865_100028724 3300006881 Bacteria 3683
326 Ga0068865_100077194 3300006881 Bacteria 2380
327 Ga0097620_100007644 3300006931 Bacteria 10984
328 Ga0097620_100010715 3300006931 Bacteria 9227
329 Ga0097620_100121912 3300006931 Bacteria 2674
330 Ga0097620_100137423 3300006931 Bacteria 2517
331 Ga0097620_100165591 3300006931 Bacteria 2291
332 Ga0097620_100579591 3300006931 Bacteria 1215
333 Ga0079104_1000019 3300006946 Bacteria 269313
334 Ga0099826_10000027 3300006948 Bacteria 140533
335 Ga0099826_10006221 3300006948 Bacteria 8671
336 Ga0105244_10000965 3300009036 Bacteria 24157
337 Ga0105240_10018468 3300009093 Bacteria 9363
338 Ga0105240_10219187 3300009093 Bacteria 2218
339 Ga0111539_10207790 3300009094 Bacteria 2282
340 Ga0105245_10012088 3300009098 Bacteria 7507
341 Ga0105245_10396835 3300009098 Bacteria 1377
342 Ga0105247_10416447 3300009101 Bacteria 961
343 Ga0114129_10032558 3300009147 Bacteria 7367
344 Ga0114129_10457835 3300009147 Bacteria 1672
345 Ga0105243_10001682 3300009148 Bacteria 19081
346 Ga0105243_10004695 3300009148 Bacteria 10755
347 Ga0105243_10043521 3300009148 Bacteria 3519
348 Ga0105243_10141731 3300009148 Bacteria 2052
349 Ga0105243_10145806 3300009148 Bacteria 2025
350 Ga0105243_10147041 3300009148 Bacteria 2017
351 Ga0105243_10281602 3300009148 Bacteria 1498
352 Ga0105241_10190773 3300009174 Bacteria 1706
353 Ga0105242_10019130 3300009176 Bacteria 5364
354 Ga0105242_10026470 3300009176 Bacteria 4598
355 Ga0105242_10122447 3300009176 Bacteria 2234
356 Ga0105242_10571759 3300009176 Bacteria 1087
357 Ga0105248_10003661 3300009177 Bacteria 17051
358 Ga0105248_10006013 3300009177 Bacteria 13318
359 Ga0105248_10074417 3300009177 Bacteria 3818
360 Ga0105248_10152277 3300009177 Bacteria 2610
361 Ga0105237_10001628 3300009545 Bacteria 29150
362 Ga0105237_10097306 3300009545 Bacteria 2933
363 Ga0105237_10106835 3300009545 Bacteria 2791
364 Ga0105237_10295838 3300009545 Bacteria 1622
365 Ga0105238_10093980 3300009551 Bacteria 2986
366 Ga0105249_10029237 3300009553 Bacteria 4976
367 Ga0105249_10099373 3300009553 Bacteria 2735
368 Ga0105249_10203716 3300009553 Bacteria 1937
369 Ga0105249_10269646 3300009553 Bacteria 1695
370 Ga0105249_10296283 3300009553 Bacteria 1621
371 Ga0105239_10001684 3300010375 Bacteria 29148
372 Ga0105239_10605511 3300010375 Bacteria 1250
373 Ga0105246_10107068 3300011119 Bacteria 2046
374 Ga0157369_10016621 3300013105 Bacteria 8272
375 Ga0157369_10181105 3300013105 Bacteria 2217
376 Ga0157374_10010969 3300013296 Bacteria 7825
377 Ga0157374_10294593 3300013296 Bacteria 1604
378 Ga0157374_10297913 3300013296 Bacteria 1595
379 Ga0157374_10497260 3300013296 Bacteria 1224
380 Ga0157378_10004470 3300013297 Bacteria 12280
381 Ga0157378_10039364 3300013297 Bacteria 4193
382 Ga0157378_10081937 3300013297 Bacteria 2917
383 Ga0157378_10193818 3300013297 Bacteria 1918
384 Ga0163162_10008437 3300013306 Bacteria 10048
385 Ga0163162_10045471 3300013306 Bacteria 4398
386 Ga0163162_10106036 3300013306 Bacteria 2905
387 Ga0163162_10141004 3300013306 Bacteria 2524
388 Ga0163162_10682703 3300013306 Bacteria 1149
389 Ga0157372_10076681 3300013307 Bacteria 3774
390 Ga0157372_10204874 3300013307 Bacteria 2286
391 Ga0157372_10225279 3300013307 Unclassified 2174
392 Ga0157372_10757061 3300013307 Bacteria 1129
393 Ga0157375_10032335 3300013308 Bacteria 4961
394 Ga0157375_10050218 3300013308 Bacteria 4090
395 Ga0157375_10067123 3300013308 Bacteria 3583
396 Ga0157375_10094008 3300013308 Bacteria 3065
397 Ga0157375_10234111 3300013308 Bacteria 1996
398 Ga0157375_10250551 3300013308 Bacteria 1931
399 Ga0157375_10305054 3300013308 Bacteria 1756
400 Ga0157375_10492337 3300013308 Bacteria 1391
401 Ga0163163_10001130 3300014325 Bacteria 22677
402 Ga0163163_10009364 3300014325 Bacteria 8742
403 Ga0163163_10073498 3300014325 Bacteria 3410
404 Ga0163163_10079344 3300014325 Bacteria 3281
405 Ga0163163_10107903 3300014325 Bacteria 2810
406 Ga0157380_10026504 3300014326 Bacteria 4401
407 Ga0157380_10033826 3300014326 Bacteria 3938
408 Ga0157380_10034112 3300014326 Bacteria 3924
409 Ga0157380_10112611 3300014326 Bacteria 2290
410 Ga0157380_10134768 3300014326 Bacteria 2112
411 Ga0157380_10163276 3300014326 Bacteria 1938
412 Ga0182008_10009302 3300014497 Bacteria 5311
413 Ga0182008_10019759 3300014497 Bacteria 3473
414 Ga0182008_10047686 3300014497 Bacteria 2128
415 Ga0157377_10013130 3300014745 Bacteria 4185
416 Ga0157379_10010513 3300014968 Bacteria 8067
417 Ga0157379_10025218 3300014968 Bacteria 5279
418 Ga0157379_10037328 3300014968 Bacteria 4331
419 Ga0157379_10045346 3300014968 Bacteria 3924
420 Ga0157379_10078733 3300014968 Bacteria 2952
421 Ga0157379_10094540 3300014968 Bacteria 2682
422 Ga0157379_10246802 3300014968 Bacteria 1620
423 Ga0157376_10008722 3300014969 Bacteria 7326
424 Ga0157376_10068333 3300014969 Bacteria 3009
425 Ga0157376_10158997 3300014969 Bacteria 2046
426 Ga0157376_10200191 3300014969 Bacteria 1837
427 Ga0157376_10206137 3300014969 Bacteria 1812
428 Ga0182006_1001032 3300015261 Bacteria 18152
429 Ga0182007_10000366 3300015262 Bacteria 28535
430 Ga0182007_10011494 3300015262 Bacteria 3445
431 Ga0183362_10001 3300015683 Bacteria 2046624
432 Ga0163161_10001014 3300017792 Bacteria 21406
433 Ga0163161_10018424 3300017792 Bacteria 4893
434 Ga0163161_10038391 3300017792 Bacteria 3435
435 Ga0163161_10133045 3300017792 Bacteria 1878
436 Ga0209435_100001 3300025206 Bacteria 1424171
437 Ga0209672_100665 3300025228 Bacteria 17404
438 Ga0209147_101220 3300025229 Bacteria 10252
439 Ga0209258_100058 3300025242 Bacteria 331567
440 Ga0207425_1000733 3300025245 Bacteria 17320
441 Ga0207425_1002759 3300025245 Bacteria 5968
442 Ga0209646_1000001 3300025246 Bacteria 3092932
443 Ga0209026_1000003 3300025250 Bacteria 1060571
444 Ga0209148_1000071 3300025254 Bacteria 331551
445 Ga0209759_1000001 3300025256 Bacteria 2799452
446 Ga0209129_1000023 3300025258 Bacteria 420646
447 Ga0209129_1001044 3300025258 Bacteria 16361
448 Ga0209129_1004583 3300025258 Bacteria 5315
449 Ga0209565_1000004 3300025263 Bacteria 983150
450 Ga0209565_1000073 3300025263 Bacteria 164695
451 Ga0209565_1000187 3300025263 Bacteria 76001
452 Ga0209565_1000912 3300025263 Bacteria 15923
453 Ga0209565_1005208 3300025263 Bacteria 3816
454 Ga0209673_1000066 3300025273 Bacteria 250037
455 Ga0209673_1000074 3300025273 Bacteria 233552
456 Ga0209673_1000127 3300025273 Bacteria 164695
457 Ga0209673_1000389 3300025273 Bacteria 79243
458 Ga0209673_1002877 3300025273 Bacteria 10944
459 Ga0209130_1000050 3300025284 Bacteria 222092
460 Ga0209130_1000069 3300025284 Bacteria 179177
461 Ga0209130_1000082 3300025284 Bacteria 164441
462 Ga0209675_1000029 3300025291 Bacteria 281053
463 Ga0209675_1000044 3300025291 Bacteria 230392
464 Ga0209675_1000226 3300025291 Bacteria 57689
465 Ga0209675_1000232 3300025291 Bacteria 56301
466 Ga0209675_1005829 3300025291 Bacteria 5063
467 Ga0209675_1008851 3300025291 Bacteria 3635
468 Ga0209675_1009803 3300025291 Bacteria 3343
469 Ga0209676_1000005 3300025292 Bacteria 1076001
470 Ga0209676_1000029 3300025292 Bacteria 520536
471 Ga0209676_1000083 3300025292 Bacteria 279816
472 Ga0209676_1000142 3300025292 Bacteria 175752
473 Ga0209676_1001525 3300025292 Bacteria 21042
474 Ga0209676_1007840 3300025292 Bacteria 4910
475 Ga0209676_1008694 3300025292 Bacteria 4486
476 Ga0209676_1010602 3300025292 Bacteria 3812
477 Ga0209676_1029646 3300025292 Bacteria 1686
478 Ga0209025_1000316 3300025294 Bacteria 107447
479 Ga0209025_1000351 3300025294 Bacteria 99585
480 Ga0209025_1000583 3300025294 Bacteria 66212
481 Ga0209025_1000766 3300025294 Bacteria 53411
482 Ga0209025_1001156 3300025294 Bacteria 37386
483 Ga0209025_1002301 3300025294 Bacteria 20715
484 Ga0209025_1005031 3300025294 Bacteria 11033
485 Ga0209025_1021697 3300025294 Bacteria 3445
486 Ga0209025_1023162 3300025294 Bacteria 3258
487 Ga0209025_1023652 3300025294 Bacteria 3201
488 Ga0209025_1036435 3300025294 Bacteria 2203
489 Ga0209025_1039894 3300025294 Bacteria 2040
490 Ga0209564_1000090 3300025295 Bacteria 249298
491 Ga0209564_1000145 3300025295 Bacteria 175251
492 Ga0209564_1000585 3300025295 Bacteria 57689
493 Ga0209564_1001244 3300025295 Bacteria 28537
494 Ga0209564_1001318 3300025295 Bacteria 26574
495 Ga0209564_1001617 3300025295 Bacteria 21862
496 Ga0209564_1002063 3300025295 Bacteria 17284
497 Ga0209758_1000044 3300025297 Bacteria 398448
498 Ga0209758_1000249 3300025297 Bacteria 110026
499 Ga0209758_1024457 3300025297 Bacteria 2691
500 Ga0209758_1043783 3300025297 Bacteria 1645
501 Ga0209050_1000003 3300025298 Bacteria 1609245
502 Ga0209050_1000007 3300025298 Bacteria 1187891
503 Ga0209050_1001232 3300025298 Bacteria 29637
504 Ga0209050_1002246 3300025298 Bacteria 17232
505 Ga0209050_1013755 3300025298 Bacteria 3561
506 Ga0209050_1014496 3300025298 Bacteria 3388
507 Ga0209256_1000001 3300025299 Bacteria 2166974
508 Ga0209256_1000020 3300025299 Bacteria 542402
509 Ga0209256_1000022 3300025299 Bacteria 481843
510 Ga0209256_1000051 3300025299 Bacteria 307241
511 Ga0209256_1000127 3300025299 Bacteria 164393
512 Ga0209256_1001660 3300025299 Bacteria 21630
513 Ga0207426_1000001 3300025302 Bacteria 1341301
514 Ga0207426_1000031 3300025302 Bacteria 460699
515 Ga0207426_1000071 3300025302 Bacteria 329539
516 Ga0207426_1001744 3300025302 Bacteria 16547
517 Ga0209051_1000003 3300025303 Bacteria 1609245
518 Ga0209051_1000036 3300025303 Bacteria 339863
519 Ga0209051_1000416 3300025303 Bacteria 58872
520 Ga0209051_1000500 3300025303 Bacteria 49702
521 Ga0209051_1000542 3300025303 Bacteria 46577
522 Ga0209051_1000735 3300025303 Bacteria 35429
523 Ga0209051_1011957 3300025303 Bacteria 4237
524 Ga0209051_1018109 3300025303 Bacteria 3126
525 Ga0209051_1031523 3300025303 Bacteria 2038
526 Ga0209257_1000011 3300025304 Bacteria 1112630
527 Ga0209257_1000012 3300025304 Bacteria 1111138
528 Ga0209257_1000018 3300025304 Bacteria 836016
529 Ga0209257_1000226 3300025304 Bacteria 133836
530 Ga0209257_1003858 3300025304 Bacteria 12252
531 Ga0209257_1005060 3300025304 Bacteria 9573
532 Ga0207697_10000857 3300025315 Bacteria 17209
533 Ga0207656_10004471 3300025321 Bacteria 4887
534 Ga0207656_10007788 3300025321 Bacteria 3920
535 Ga0207655_1002684 3300025728 Bacteria 13976
536 Ga0207682_10000120 3300025893 Bacteria 36172
537 Ga0207682_10001604 3300025893 Bacteria 10396
538 Ga0207682_10047517 3300025893 Bacteria 1767
539 Ga0207682_10051884 3300025893 Bacteria 1699
540 Ga0207682_10065244 3300025893 Bacteria 1532
541 Ga0207642_10016419 3300025899 Bacteria 2788
542 Ga0207642_10029220 3300025899 Bacteria 2280
543 Ga0207642_10068697 3300025899 Bacteria 1677
544 Ga0207680_10011590 3300025903 Bacteria 4459
545 Ga0207680_10147969 3300025903 Bacteria 1563
546 Ga0207647_10059083 3300025904 Bacteria 2347
547 Ga0207645_10001475 3300025907 Bacteria 19229
548 Ga0207645_10017113 3300025907 Bacteria 4789
549 Ga0207645_10085833 3300025907 Bacteria 2021
550 Ga0207643_10000681 3300025908 Bacteria 21214
551 Ga0207643_10026471 3300025908 Bacteria 3211
552 Ga0207643_10107981 3300025908 Bacteria 1637
553 Ga0207654_10099305 3300025911 Bacteria 1790
554 Ga0207695_10118124 3300025913 Bacteria 2623
555 Ga0207671_10001800 3300025914 Bacteria 23963
556 Ga0207660_10155321 3300025917 Bacteria 1761
557 Ga0207662_10004254 3300025918 Bacteria 7509
558 Ga0207657_10000822 3300025919 Bacteria 32803
559 Ga0207649_10049281 3300025920 Bacteria 2600
560 Ga0207649_10090844 3300025920 Bacteria 1999
561 Ga0207681_10016998 3300025923 Bacteria 4563
562 Ga0207681_10021841 3300025923 Bacteria 4074
563 Ga0207681_10057263 3300025923 Bacteria 2663
564 Ga0207694_10004998 3300025924 Bacteria 10260
565 Ga0207650_10006154 3300025925 Bacteria 8179
566 Ga0207650_10040265 3300025925 Bacteria 3419
567 Ga0207650_10043242 3300025925 Bacteria 3306
568 Ga0207650_10174301 3300025925 Bacteria 1711
569 Ga0207659_10010325 3300025926 Bacteria 5864
570 Ga0207659_10024313 3300025926 Bacteria 4057
571 Ga0207659_10039189 3300025926 Bacteria 3302
572 Ga0207659_10101309 3300025926 Bacteria 2172
573 Ga0207659_10413358 3300025926 Bacteria 1130
574 Ga0207659_10474914 3300025926 Bacteria 1056
575 Ga0207644_10008321 3300025931 Bacteria 6797
576 Ga0207644_10021143 3300025931 Bacteria 4429
577 Ga0207690_10002002 3300025932 Bacteria 12484
578 Ga0207706_10000149 3300025933 Bacteria 76532
579 Ga0207706_10000850 3300025933 Bacteria 31426
580 Ga0207706_10003793 3300025933 Bacteria 14408
581 Ga0207706_10029503 3300025933 Bacteria 4896
582 Ga0207706_10108327 3300025933 Bacteria 2445
583 Ga0207706_10134632 3300025933 Bacteria 2173
584 Ga0207706_10272194 3300025933 Bacteria 1478
585 Ga0207686_10148193 3300025934 Bacteria 1630
586 Ga0207709_10000771 3300025935 Bacteria 25177
587 Ga0207709_10001360 3300025935 Bacteria 17193
588 Ga0207709_10025348 3300025935 Bacteria 3394
589 Ga0207709_10028943 3300025935 Bacteria 3207
590 Ga0207709_10029949 3300025935 Bacteria 3162
591 Ga0207709_10117902 3300025935 Bacteria 1787
592 Ga0207709_10136795 3300025935 Bacteria 1678
593 Ga0207709_10148361 3300025935 Bacteria 1621
594 Ga0207670_10400184 3300025936 Bacteria 1098
595 Ga0207669_10006269 3300025937 Bacteria 5419
596 Ga0207669_10061575 3300025937 Bacteria 2307
597 Ga0207669_10097632 3300025937 Bacteria 1932
598 Ga0207669_10241973 3300025937 Bacteria 1338
599 Ga0207704_10018734 3300025938 Bacteria 3621
600 Ga0207704_10026431 3300025938 Bacteria 3185
601 Ga0207704_10091255 3300025938 Bacteria 2001
602 Ga0207704_10271794 3300025938 Bacteria 1284
603 Ga0207691_10000773 3300025940 Bacteria 31657
604 Ga0207691_10001626 3300025940 Bacteria 22311
605 Ga0207691_10004125 3300025940 Bacteria 14115
606 Ga0207691_10016262 3300025940 Bacteria 7064
607 Ga0207691_10022311 3300025940 Bacteria 5971
608 Ga0207691_10024119 3300025940 Bacteria 5721
609 Ga0207691_10041027 3300025940 Bacteria 4275
610 Ga0207691_10082806 3300025940 Bacteria 2881
611 Ga0207691_10089646 3300025940 Bacteria 2757
612 Ga0207691_10245462 3300025940 Bacteria 1547
613 Ga0207691_10287616 3300025940 Bacteria 1414
614 Ga0207711_10023053 3300025941 Bacteria 5212
615 Ga0207711_10124729 3300025941 Bacteria 2302
616 Ga0207711_10155887 3300025941 Bacteria 2064
617 Ga0207711_10156409 3300025941 Bacteria 2060
618 Ga0207711_10344043 3300025941 Bacteria 1381
619 Ga0207689_10000049 3300025942 Bacteria 88948
620 Ga0207689_10000307 3300025942 Bacteria 45007
621 Ga0207689_10001301 3300025942 Bacteria 24043
622 Ga0207689_10008205 3300025942 Bacteria 9100
623 Ga0207689_10060861 3300025942 Bacteria 3105
624 Ga0207689_10165152 3300025942 Bacteria 1824
625 Ga0207689_10193318 3300025942 Bacteria 1679
626 Ga0207689_10231835 3300025942 Bacteria 1526
627 Ga0207679_10008364 3300025945 Bacteria 6589
628 Ga0207679_10062155 3300025945 Bacteria 2782
629 Ga0207679_10106195 3300025945 Bacteria 2207
630 Ga0207679_10217309 3300025945 Bacteria 1606
631 Ga0207667_10001720 3300025949 Bacteria 27567
632 Ga0207667_10032111 3300025949 Bacteria 5660
633 Ga0207667_10133856 3300025949 Bacteria 2553
634 Ga0207667_10432257 3300025949 Bacteria 1339
635 Ga0207651_10001889 3300025960 Bacteria 9820
636 Ga0207651_10019990 3300025960 Bacteria 4029
637 Ga0207651_10022461 3300025960 Bacteria 3858
638 Ga0207651_10078633 3300025960 Bacteria 2366
639 Ga0207651_10120546 3300025960 Bacteria 1988
640 Ga0207712_10010255 3300025961 Bacteria 5944
641 Ga0207712_10064721 3300025961 Bacteria 2608
642 Ga0207712_10094687 3300025961 Bacteria 2207
643 Ga0207668_10008031 3300025972 Bacteria 6282
644 Ga0207668_10029069 3300025972 Bacteria 3620
645 Ga0207668_10056523 3300025972 Bacteria 2733
646 Ga0207668_10069586 3300025972 Bacteria 2506
647 Ga0207668_10146608 3300025972 Bacteria 1822
648 Ga0207668_10273177 3300025972 Bacteria 1383
649 Ga0207668_10276807 3300025972 Bacteria 1374
650 Ga0207640_10044846 3300025981 Bacteria 2836
651 Ga0207640_10062911 3300025981 Bacteria 2464
652 Ga0207658_10003343 3300025986 Bacteria 11381
653 Ga0207658_10006980 3300025986 Bacteria 7688
654 Ga0207658_10021590 3300025986 Bacteria 4473
655 Ga0207658_10040679 3300025986 Bacteria 3362
656 Ga0207677_10003034 3300026023 Bacteria 8873
657 Ga0207677_10008690 3300026023 Bacteria 5686
658 Ga0207677_10059178 3300026023 Bacteria 2642
659 Ga0207677_10076559 3300026023 Bacteria 2382
660 Ga0207677_10173734 3300026023 Bacteria 1688
661 Ga0207677_10398444 3300026023 Bacteria 1167
662 Ga0207703_10002822 3300026035 Bacteria 14826
663 Ga0207703_10003906 3300026035 Bacteria 12376
664 Ga0207703_10037171 3300026035 Bacteria 3879
665 Ga0207703_10274231 3300026035 Bacteria 1529
666 Ga0207639_10005031 3300026041 Bacteria 8906
667 Ga0207639_10055874 3300026041 Bacteria 3023
668 Ga0207639_10221377 3300026041 Bacteria 1635
669 Ga0207639_10234731 3300026041 Bacteria 1592
670 Ga0207639_10313675 3300026041 Bacteria 1390
671 Ga0207678_10011833 3300026067 Bacteria 7661
672 Ga0207678_10100600 3300026067 Bacteria 2469
673 Ga0207678_10103375 3300026067 Bacteria 2432
674 Ga0207678_10220158 3300026067 Bacteria 1625
675 Ga0207678_10299085 3300026067 Bacteria 1383
676 Ga0207708_10000529 3300026075 Bacteria 29463
677 Ga0207708_10008749 3300026075 Bacteria 7489
678 Ga0207708_10022047 3300026075 Bacteria 4808
679 Ga0207708_10274462 3300026075 Bacteria 1364
680 Ga0207702_10157221 3300026078 Bacteria 2073
681 Ga0207702_10205785 3300026078 Bacteria 1827
682 Ga0207641_10008475 3300026088 Bacteria 8497
683 Ga0207641_10017295 3300026088 Bacteria 5902
684 Ga0207641_10036405 3300026088 Bacteria 4108
685 Ga0207641_10065664 3300026088 Bacteria 3104
686 Ga0207641_10141285 3300026088 Bacteria 2172
687 Ga0207641_10207970 3300026088 Bacteria 1808
688 Ga0207648_10002306 3300026089 Bacteria 20605
689 Ga0207648_10003420 3300026089 Bacteria 16668
690 Ga0207648_10006661 3300026089 Bacteria 11462
691 Ga0207648_10010535 3300026089 Bacteria 8755
692 Ga0207648_10021312 3300026089 Bacteria 5826
693 Ga0207648_10027187 3300026089 Bacteria 5081
694 Ga0207648_10049953 3300026089 Bacteria 3658
695 Ga0207648_10080063 3300026089 Bacteria 2850
696 Ga0207648_10461373 3300026089 Bacteria 1158
697 Ga0207676_10004825 3300026095 Bacteria 9564
698 Ga0207676_10027811 3300026095 Bacteria 4217
699 Ga0207676_10064917 3300026095 Bacteria 2905
700 Ga0207676_10105918 3300026095 Bacteria 2342
701 Ga0207676_10197159 3300026095 Bacteria 1776
702 Ga0207676_10337422 3300026095 Bacteria 1389
703 Ga0207674_10003249 3300026116 Bacteria 20002
704 Ga0207674_10003275 3300026116 Bacteria 19914
705 Ga0207674_10020383 3300026116 Bacteria 7164
706 Ga0207674_10157866 3300026116 Bacteria 2223
707 Ga0207675_100003946 3300026118 Bacteria 14398
708 Ga0207675_100008033 3300026118 Bacteria 9941
709 Ga0207675_100032927 3300026118 Bacteria 4829
710 Ga0207675_100035316 3300026118 Bacteria 4662
711 Ga0207675_100035639 3300026118 Bacteria 4641
712 Ga0207675_100055481 3300026118 Bacteria 3696
713 Ga0207675_100596275 3300026118 Bacteria 1107
714 Ga0207683_10006932 3300026121 Bacteria 9705
715 Ga0207683_10008101 3300026121 Bacteria 8986
716 Ga0207683_10010884 3300026121 Bacteria 7760
717 Ga0207683_10030812 3300026121 Bacteria 4651
718 Ga0207683_10050620 3300026121 Bacteria 3639
719 Ga0207683_10240983 3300026121 Bacteria 1650
720 Ga0207683_10260994 3300026121 Bacteria 1582
721 Ga0207683_10318998 3300026121 Bacteria 1423
722 Ga0207698_10034135 3300026142 Bacteria 3705
723 Ga0207698_10121441 3300026142 Bacteria 2212
724 Ga0207698_10182443 3300026142 Bacteria 1861
725 Ga0207698_10427876 3300026142 Bacteria 1272
726 Ga0207698_10624105 3300026142 Bacteria 1065
727 Ga0209281_1000160 3300027111 Bacteria 161071
728 Ga0209371_1003487 3300027312 Bacteria 7604
729 Ga0209999_1015003 3300027543 Bacteria 1408
730 Ga0209983_1006590 3300027665 Bacteria 2383
731 Ga0209983_1028576 3300027665 Bacteria 1183
732 Ga0209282_1000069 3300027666 Bacteria 85661
733 Ga0209282_1018317 3300027666 Bacteria 4444
734 Ga0209282_1087699 3300027666 Bacteria 1640
735 Ga0209971_1015433 3300027682 Bacteria 1810
736 Ga0209998_10027200 3300027717 Bacteria 1252
737 Ga0268266_10017786 3300028379 Bacteria 6057
738 Ga0268266_10039667 3300028379 Bacteria 4011
739 Ga0268266_10044855 3300028379 Bacteria 3780
740 Ga0268266_10078909 3300028379 Bacteria 2866
741 Ga0268266_10079755 3300028379 Bacteria 2851
742 Ga0268266_10086096 3300028379 Bacteria 2747
743 Ga0268266_10154105 3300028379 Bacteria 2074
744 Ga0268265_10006606 3300028380 Bacteria 7850
745 Ga0268265_10029739 3300028380 Bacteria 3927
746 Ga0268265_10088981 3300028380 Bacteria 2461
747 Ga0268265_10164888 3300028380 Bacteria 1887
748 Ga0268265_10191253 3300028380 Bacteria 1767
749 Ga0268265_10294024 3300028380 Bacteria 1459
750 Ga0268264_10000624 3300028381 Bacteria 42120
751 Ga0268264_10017548 3300028381 Bacteria 5862
752 Ga0268264_10102319 3300028381 Bacteria 2492
753 Ga0268264_10180804 3300028381 Bacteria 1915
754 Ga0268264_10186400 3300028381 Bacteria 1888
755 Ga0268264_10452026 3300028381 Bacteria 1245
756 Ga0307517_10033655 3300028786 Bacteria 5873
757 Ga0307515_10000058 3300028794 Bacteria 259680
758 Ga0307515_10000267 3300028794 Bacteria 128554
759 Ga0307515_10000283 3300028794 Bacteria 124822
760 Ga0307515_10000302 3300028794 Bacteria 121875
761 Ga0307515_10000586 3300028794 Bacteria 85517
762 Ga0307515_10003631 3300028794 Bacteria 32412
763 Ga0307515_10011842 3300028794 Bacteria 16497
764 Ga0307515_10081285 3300028794 Bacteria 4211
765 Ga0307515_10105750 3300028794 Bacteria 3347
766 Ga0307515_10118612 3300028794 Bacteria 3018
767 Ga0307515_10157981 3300028794 Bacteria 2329
768 Ga0307515_10251002 3300028794 Bacteria 1522
769 Ga0268256_1007657 3300030500 Bacteria 3816
770 Ga0307512_10018592 3300030522 Bacteria 6347
771 Ga0307512_10038652 3300030522 Bacteria 4012
772 Ga0316177_1102153 3300030731 Bacteria 3157
773 Ga0314311_1141747 3300030733 Bacteria 3965
774 Ga0316183_1033032 3300030742 Bacteria 2810
775 Ga0265327_10005641 3300031251 Bacteria 10362
776 Ga0307513_10000010 3300031456 Bacteria 360812
777 Ga0307513_10000051 3300031456 Bacteria 149733
778 Ga0307513_10049729 3300031456 Bacteria 4538
779 Ga0307513_10060104 3300031456 Bacteria 4030
780 Ga0307513_10077516 3300031456 Bacteria 3441
781 Ga0307513_10103072 3300031456 Bacteria 2871
782 Ga0307513_10108365 3300031456 Bacteria 2779
783 Ga0307513_10139562 3300031456 Bacteria 2352
784 Ga0307513_10399439 3300031456 Bacteria 1109
785 Ga0307509_10011999 3300031507 Bacteria 10407
786 Ga0307509_10071187 3300031507 Bacteria 3628
787 Ga0307509_10096280 3300031507 Bacteria 3012
788 Ga0307408_100000193 3300031548 Bacteria 65882
789 Ga0307408_100001412 3300031548 Bacteria 17856
790 Ga0307408_100007530 3300031548 Bacteria 7197
791 Ga0307408_100022612 3300031548 Bacteria 4274
792 Ga0307408_100056105 3300031548 Bacteria 2855
793 Ga0307408_100090913 3300031548 Bacteria 2304
794 Ga0307408_100128014 3300031548 Bacteria 1977
795 Ga0307508_10000876 3300031616 Bacteria 35008
796 Ga0307508_10001111 3300031616 Bacteria 31133
797 Ga0307508_10016840 3300031616 Bacteria 6650
798 Ga0307508_10171782 3300031616 Bacteria 1771
799 Ga0307514_10000806 3300031649 Bacteria 51095
800 Ga0307514_10014746 3300031649 Bacteria 6462
801 Ga0307514_10068076 3300031649 Bacteria 2685
802 Ga0307516_10001118 3300031730 Bacteria 37358
803 Ga0307516_10037208 3300031730 Bacteria 4866
804 Ga0307516_10097543 3300031730 Bacteria 2759
805 Ga0307405_10397803 3300031731 Bacteria 1077
806 Ga0307410_10001817 3300031852 Bacteria 9908
807 Ga0307406_10000944 3300031901 Bacteria 16257
808 Ga0307406_10002109 3300031901 Bacteria 10838
809 Ga0307406_10020580 3300031901 Bacteria 3888
810 Ga0307406_10107886 3300031901 Bacteria 1910
811 Ga0307407_10087522 3300031903 Bacteria 1901
812 Ga0307412_10002610 3300031911 Bacteria 10008
813 Ga0307412_10008248 3300031911 Bacteria 5939
814 Ga0307412_10059041 3300031911 Bacteria 2569
815 Ga0307409_100026624 3300031995 Bacteria 4082
816 Ga0307416_100095618 3300032002 Bacteria 2566
817 Ga0307416_100523136 3300032002 Bacteria 1255
818 Ga0307416_100694142 3300032002 Bacteria 1106
819 Ga0307414_10061593 3300032004 Bacteria 2659
820 Ga0307414_10272083 3300032004 Bacteria 1419
821 Ga0307411_10128359 3300032005 Bacteria 1848
822 Ga0307411_10135310 3300032005 Bacteria 1808
823 Ga0307411_10196374 3300032005 Bacteria 1545
824 Ga0307507_10247610 3300033179 Bacteria 1156
825 Ga0307510_10133426 3300033180 Bacteria 2148
826 Ga0373953_0045721 3300035117 Bacteria 1756
827 Ga0373955_0061335 3300035172 Bacteria 2077
828 Ga0373955_0079570 3300035172 Bacteria 1849
829 Ga0373924_0136413 3300035410 Bacteria 1069
830 Ga0373931_0052842 3300035691 Bacteria 2167
831 Ga0373937_0014096 3300036401 Bacteria 7050
832 Ga0373937_0064919 3300036401 Bacteria 3359
833 Ga0373937_0246317 3300036401 Bacteria 1684
834 Ga0373925_0003621 3300037068 Bacteria 11900
835 Ga0373925_0106669 3300037068 Bacteria 2160
836 Ga0400483_058929 3300039062 Bacteria 2961
837 Ga0400483_242388 3300039062 Bacteria 1539
838 Ga0439436_0001073 3300041404 Bacteria 7715
839 Ga0439436_0026058 3300041404 Bacteria 1715
840 Ga0439436_0056618 3300041404 Bacteria 1101
841 Ga0439447_004235 3300041407 Bacteria 4973
842 Ga0439431_0016358 3300041997 Bacteria 1735
843 Ga0439442_020080 3300042002 Bacteria 1384
844 Ga0439432_001458 3300042006 Bacteria 8874
845 Ga0439449_0000923 3300042007 Bacteria 11452
846 Ga0439449_0005718 3300042007 Bacteria 4752
847 Ga0439449_0040190 3300042007 Bacteria 1739
848 Ga0439450_024941 3300042008 Bacteria 1307
849 Ga0439452_005984 3300042010 Bacteria 3854
850 Ga0439452_019491 3300042010 Bacteria 1793
851 Ga0439452_027810 3300042010 Bacteria 1417
852 Ga0439457_002549 3300042014 Bacteria 5168
853 Ga0439462_0015908 3300042015 Bacteria 1942
854 Ga0439462_0035634 3300042015 Bacteria 1323
855 Ga0450911_000137 3300042115 Bacteria 29337
856 Ga0450921_000339 3300042123 Bacteria 2107
857 Ga0450898_006861 3300042134 Bacteria 1760
858 Ga0439434_0002704 3300042435 Bacteria 5161
859 Ga0450918_002201 3300042531 Bacteria 3710
860 Ga0450893_0009504 3300042532 Bacteria 1589
861 Ga0451577_0029841 3300042876 Bacteria 4927
862 Ga0451577_0075805 3300042876 Bacteria 2999
863 Ga0451577_0104665 3300042876 Bacteria 2529
864 Ga0451577_0131994 3300042876 Bacteria 2241
865 Ga0453684_0004147 3300044712 Bacteria 31361
866 Ga0453684_0059476 3300044712 Bacteria 4925
867 Ga0453684_0150918 3300044712 Bacteria 2762
868 Ga0451576_0009619 3300045051 Bacteria 11183
869 Ga0451576_0116563 3300045051 Bacteria 2781
870 Ga0495627_006938 3300046453 Bacteria 4397
871 Ga0495627_020194 3300046453 Bacteria 2223
872 Ga0495590_0014273 3300046457 Bacteria 2901
873 Ga0495629_0243433 3300046459 Bacteria 1238
874 Ga0495605_0004236 3300046474 Bacteria 8448
875 Ga0495639_0015227 3300046475 Bacteria 3332
876 Ga0495664_0015726 3300046477 Bacteria 4306
877 Ga0495596_0000317 3300046500 Bacteria 31540
878 Ga0495607_0000280 3300046501 Bacteria 54943
879 Ga0495583_0063383 3300046506 Bacteria 1643
880 Ga0495610_0000424 3300046512 Bacteria 43401
881 Ga0495610_0018922 3300046512 Bacteria 3871
882 Ga0495616_0006264 3300046513 Bacteria 7226
883 Ga0495616_0044348 3300046513 Bacteria 2255
884 Ga0495620_0052852 3300046515 Bacteria 1723
885 Ga0495631_0001923 3300046518 Bacteria 12220
886 Ga0495632_0048912 3300046519 Bacteria 2092
887 Ga0495632_0051016 3300046519 Bacteria 2038
888 Ga0495637_0007031 3300046520 Bacteria 5604
889 Ga0495637_0013071 3300046520 Bacteria 3952
890 Ga0495643_0093802 3300046522 Bacteria 1545
891 Ga0495642_0111393 3300046528 Bacteria 1170
892 Ga0495654_0008854 3300046530 Bacteria 5534
893 Ga0495609_0009581 3300046538 Bacteria 4683
894 Ga0495621_0095725 3300046539 Bacteria 1125
895 Ga0495597_0020417 3300046542 Bacteria 3087
896 Ga0495597_0022634 3300046542 Bacteria 2913
897 Ga0495633_0006330 3300046558 Bacteria 7044
898 Ga0495656_0002566 3300046615 Bacteria 6051
899 Ga0495625_0000396 3300046660 Bacteria 66627
900 Ga0495625_0000807 3300046660 Bacteria 43441
901 Ga0495625_0038121 3300046660 Bacteria 3520
902 Ga0495625_0081869 3300046660 Bacteria 2246
903 Ga0495661_0068155 3300046665 Bacteria 2088
904 Ga0495658_0006349 3300046683 Bacteria 5806
905 Ga0495671_0001711 3300046692 Bacteria 14294
906 Ga0495649_0175933 3300046694 Bacteria 1118
907 Ga0495660_0035956 3300046810 Bacteria 2764
908 Ga0495672_0005564 3300047320 Bacteria 9963
909 Ga0495687_000196 3300047443 Bacteria 87053
910 Ga0495687_021061 3300047443 Bacteria 3165
911 Ga0495687_045689 3300047443 Bacteria 1894
912 Ga0495677_0103754 3300047445 Bacteria 1078
913 Ga0495686_0145921 3300047472 Bacteria 1393
914 Ga0496101_0003644 3300048904 Bacteria 9612
915 Ga0496102_0024833 3300048905 Bacteria 5330
916 Ga0496103_0023992 3300048906 Bacteria 3680
917 Ga0496103_0208205 3300048906 Bacteria 1258
918 Ga0496104_0021963 3300048907 Bacteria 5862
919 Ga0496105_0021257 3300048908 Bacteria 5251
920 Ga0496105_0095237 3300048908 Bacteria 2459
921 Ga0496105_0173682 3300048908 Bacteria 1766
922 Ga0496106_0036400 3300048909 Bacteria 3682
923 Ga0496107_0008919 3300048910 Bacteria 6949
924 Ga0496107_0223374 3300048910 Bacteria 1401
925 Ga0496108_0020007 3300048911 Bacteria 5500
926 Ga0496109_0005385 3300048912 Bacteria 10697
927 Ga0496109_0038690 3300048912 Bacteria 4313
928 Ga0496109_0337549 3300048912 Bacteria 1423
929 Ga0496110_0027094 3300048913 Bacteria 4910
930 Ga0496110_0042796 3300048913 Bacteria 3953
931 Ga0496110_0094456 3300048913 Bacteria 2678
932 Ga0496112_0541449 3300048915 Bacteria 1098
933 Ga0496114_0030341 3300048917 Bacteria 4448
934 Ga0496114_0047087 3300048917 Bacteria 3585
935 Ga0496114_0099241 3300048917 Bacteria 2484
936 Ga0496116_0009002 3300048919 Bacteria 8579
937 Ga0496116_0016831 3300048919 Bacteria 5703
938 Ga0496116_0020474 3300048919 Bacteria 5022
939 Ga0496116_0024283 3300048919 Bacteria 4488
940 Ga0496116_0099800 3300048919 Bacteria 1737
941 Ga0496117_0034564 3300048920 Bacteria 3806
942 Ga0496117_0084871 3300048920 Bacteria 2064
943 Ga0496117_0114986 3300048920 Bacteria 1666
944 Ga0496118_0023463 3300048921 Bacteria 5357
945 Ga0496118_0070259 3300048921 Bacteria 2529
946 Ga0496118_0139684 3300048921 Bacteria 1538
947 Ga0496119_0017168 3300048922 Bacteria 5461
948 Ga0496119_0026563 3300048922 Bacteria 4011
949 Ga0496119_0147843 3300048922 Bacteria 1262
950 Ga0496120_0014853 3300048923 Bacteria 5164
951 Ga0496121_0000479 3300048924 Bacteria 77608
952 Ga0496121_0016763 3300048924 Bacteria 7537
953 Ga0496121_0049646 3300048924 Bacteria 3555
954 Ga0496121_0108493 3300048924 Bacteria 2123
955 Ga0496121_0161557 3300048924 Bacteria 1637
956 Ga0496122_0000217 3300048925 Bacteria 128502
957 Ga0496122_0000669 3300048925 Bacteria 68904
958 Ga0496122_0003097 3300048925 Bacteria 22353
959 Ga0496122_0003536 3300048925 Bacteria 20449
960 Ga0496122_0012827 3300048925 Bacteria 8288
961 Ga0496122_0046214 3300048925 Bacteria 3374
962 Ga0496123_0000057 3300048926 Bacteria 228608
963 Ga0496123_0000603 3300048926 Bacteria 61111
964 Ga0496123_0005860 3300048926 Bacteria 12169
965 Ga0496123_0017368 3300048926 Bacteria 5791
966 Ga0496123_0029483 3300048926 Bacteria 4038
967 Ga0496124_0052640 3300048927 Bacteria 3457
968 Ga0496124_0073690 3300048927 Bacteria 2824
969 Ga0496124_0087189 3300048927 Bacteria 2553
970 Ga0496124_0121197 3300048927 Bacteria 2090
971 Ga0496124_0282098 3300048927 Bacteria 1210
972 Ga0496125_0000168 3300048928 Bacteria 146364
973 Ga0496125_0000323 3300048928 Bacteria 93243
974 Ga0496125_0001023 3300048928 Bacteria 43458
975 Ga0496125_0023979 3300048928 Bacteria 5620
976 Ga0496125_0025456 3300048928 Bacteria 5417
977 Ga0496125_0030089 3300048928 Bacteria 4863
978 Ga0496125_0050199 3300048928 Bacteria 3456
979 Ga0496125_0064894 3300048928 Bacteria 2897
980 Ga0496125_0207534 3300048928 Bacteria 1276
981 Ga0496126_0016753 3300048929 Bacteria 7319
982 Ga0496126_0123726 3300048929 Bacteria 2240
983 Ga0496126_0162140 3300048929 Bacteria 1910
984 nmdc:mga03683_167353_c1 3300050489 Bacteria 998
985 nmdc:mga03683_3206_c1 3300050489 Bacteria 5230
986 nmdc:mga03683_42761_c1 3300050489 Bacteria 1866
987 nmdc:mga03683_67440_c1 3300050489 Bacteria 1523
988 nmdc:mga03683_95159_c1 3300050489 Bacteria 1303
989 nmdc:mga03n38_54907_c1 3300050490 Bacteria 1792
990 nmdc:mga00v17_20825_c1 3300050491 Bacteria 3762
991 nmdc:mga0yw44_70118_c1 3300050492 Bacteria 2173
992 nmdc:mga0k408_132207_c1 3300050493 Bacteria 1482
993 nmdc:mga0k408_3141_c1 3300050493 Bacteria 8757
994 nmdc:mga0k408_42063_c1 3300050493 Bacteria 2632
995 nmdc:mga0k408_86130_c1 3300050493 Bacteria 1844
996 nmdc:mga06z11_79686_c1 3300050494 Bacteria 1754
997 nmdc:mga07m45_14323_c1 3300050496 Bacteria 3809
998 nmdc:mga07m45_17804_c1 3300050496 Bacteria 3823
999 nmdc:mga07m45_3635_c1 3300050496 Bacteria 7450
1000 nmdc:mga07m45_50012_c1 3300050496 Bacteria 2355
1001 nmdc:mga07m45_686_c1 3300050496 Bacteria 14388
1002 nmdc:mga07m45_7718_c1 3300050496 Bacteria 5505
1003 nmdc:mga05p37_228483_c1 3300050507 Bacteria 2243
1004 nmdc:mga05p37_2709_c2 3300050507 Bacteria 16162
1005 nmdc:mga09592_271113_c1 3300050508 Bacteria 1472
1006 nmdc:mga09592_605991_c1 3300050508 Bacteria 938
1007 nmdc:mga09592_9202_c1 3300050508 Bacteria 8035
1008 nmdc:mga0qj67_417732_c1 3300050509 Bacteria 1081
1009 nmdc:mga06r32_458823_c1 3300050510 Bacteria 1253
1010 nmdc:mga0n895_68479_c1 3300050512 Bacteria 3516
1011 nmdc:mga0a205_9315_c1 3300050515 Bacteria 8967
1012 nmdc:mga0sz30_123953_c1 3300050516 Bacteria 1136
1013 nmdc:mga0sz30_6916_c1 3300050516 Bacteria 4235
1014 Ga0500610_0000489 3300053079 Bacteria 12171
1015 Ga0495619_0185339 3300053085 Bacteria 1440
1016 Ga0500644_0053915 3300053088 Bacteria 1390
1017 Ga0500647_0133216 3300053091 Bacteria 1171
1018 Ga0500651_0045805 3300053093 Bacteria 2751
1019 Ga0500650_0046871 3300053098 Bacteria 2003
1020 Ga0500571_010381 3300053110 Bacteria 5144
1021 Ga0500593_005223 3300053117 Bacteria 5093
1022 Ga0500594_0003123 3300053118 Bacteria 3623
1023 Ga0500607_007771 3300053121 Bacteria 6586
1024 Ga0500608_035205 3300053122 Bacteria 2388
1025 Ga0500655_006844 3300053133 Bacteria 2052
1026 Ga0500658_0001265 3300053134 Bacteria 10249
1027 Ga0500658_0002137 3300053134 Bacteria 7686
1028 Ga0500658_0130232 3300053134 Bacteria 1121
1029 Ga0500559_0005433 3300053136 Bacteria 5861
1030 Ga0500568_0001949 3300053139 Bacteria 12653
1031 Ga0500627_0022906 3300053158 Bacteria 2540
1032 Ga0500634_0065523 3300053161 Bacteria 1916
1033 Ga0500637_0005139 3300053178 Bacteria 6306
1034 Ga0500645_000198 3300053730 Bacteria 46701
1035 Ga0500645_000493 3300053730 Bacteria 26655
1036 Ga0500645_011097 3300053730 Bacteria 2954
1037 Ga0500587_000066 3300053739 Bacteria 8567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10157866 Ga0207674_101578663 234
2 3300025942 Ga0207689_10193318 Ga0207689_101933183 245
3 3300026041 Ga0207639_10313675 Ga0207639_103136752 249
4 3300050508 nmdc:mga09592_605991_c1 nmdc:mga09592_605991_c1_16_870 252
5 3300048928 Ga0496125_0207534 Ga0496125_0207534_451_1263 253
6 3300047320 Ga0495672_0005564 Ga0495672_0005564_9105_9944 262
7 3300048922 Ga0496119_0147843 Ga0496119_0147843_20_856 262
8 3300003784 Ga0055534_1001022 Ga0055534_10010223 264
9 3300050515 nmdc:mga0a205_9315_c1 nmdc:mga0a205_9315_c1_6647_7594 268
10 3300006871 Ga0075434_100124212 Ga0075434_1001242123 269
11 3300050507 nmdc:mga05p37_228483_c1 nmdc:mga05p37_228483_c1_787_1734 269
12 3300050512 nmdc:mga0n895_68479_c1 nmdc:mga0n895_68479_c1_1636_2583 269
13 3300005444 Ga0070694_100150561 Ga0070694_1001505612 272
14 3300005543 Ga0070672_100281148 Ga0070672_1002811482 276
15 3300013308 Ga0157375_10067123 Ga0157375_100671232 276
16 3300025972 Ga0207668_10276807 Ga0207668_102768072 276
17 3300026118 Ga0207675_100596275 Ga0207675_1005962751 276
18 3300025298 Ga0209050_1014496 Ga0209050_10144963 280
19 3300025303 Ga0209051_1031523 Ga0209051_10315232 280
20 3300041404 Ga0439436_0056618 Ga0439436_0056618_37_987 280
21 3300048927 Ga0496124_0282098 Ga0496124_0282098_106_1056 280
22 3300050508 nmdc:mga09592_271113_c1 nmdc:mga09592_271113_c1_335_1264 280
23 3300005336 Ga0070680_100143639 Ga0070680_1001436392 281
24 3300005367 Ga0070667_100120129 Ga0070667_1001201292 281
25 3300005440 Ga0070705_100318140 Ga0070705_1003181402 281
26 3300005458 Ga0070681_10097261 Ga0070681_100972612 281
27 3300005563 Ga0068855_100046637 Ga0068855_1000466372 281
28 3300025911 Ga0207654_10099305 Ga0207654_100993052 281
29 3300025949 Ga0207667_10133856 Ga0207667_101338562 281
30 3300028786 Ga0307517_10033655 Ga0307517_100336553 281
31 3300028794 Ga0307515_10157981 Ga0307515_101579812 281
32 3300031456 Ga0307513_10077516 Ga0307513_100775163 281
33 3300031456 Ga0307513_10139562 Ga0307513_101395623 281
34 3300031616 Ga0307508_10016840 Ga0307508_100168403 281
35 3300031649 Ga0307514_10068076 Ga0307514_100680763 281
36 3300046519 Ga0495632_0048912 Ga0495632_0048912_375_1313 281
37 3300003187 JGI25151J46595_10001070 JGI25151J46595_1000107018 282
38 3300003771 Ga0055526_1010696 Ga0055526_10106963 282
39 3300003775 Ga0055524_1000987 Ga0055524_100098716 282
40 3300006195 Ga0075366_10091349 Ga0075366_100913492 282
41 3300025263 Ga0209565_1005208 Ga0209565_10052084 282
42 3300025291 Ga0209675_1005829 Ga0209675_10058293 282
43 3300025294 Ga0209025_1002301 Ga0209025_100230114 282
44 3300025295 Ga0209564_1001617 Ga0209564_10016174 282
45 3300025297 Ga0209758_1024457 Ga0209758_10244572 282
46 3300025299 Ga0209256_1001660 Ga0209256_100166019 282
47 3300031730 Ga0307516_10001118 Ga0307516_1000111815 282
48 3300048919 Ga0496116_0020474 Ga0496116_0020474_664_1614 282
49 3300050493 nmdc:mga0k408_42063_c1 nmdc:mga0k408_42063_c1_354_1289 282
50 3300050509 nmdc:mga0qj67_417732_c1 nmdc:mga0qj67_417732_c1_126_1055 282
51 3300031456 Ga0307513_10108365 Ga0307513_101083651 283
52 3300033180 Ga0307510_10133426 Ga0307510_101334262 283
53 3300003187 JGI25151J46595_10024513 JGI25151J46595_100245133 284
54 3300003771 Ga0055526_1007340 Ga0055526_10073404 284
55 3300003781 Ga0055536_1000861 Ga0055536_10008613 284
56 3300003784 Ga0055534_1004666 Ga0055534_10046663 284
57 3300009545 Ga0105237_10097306 Ga0105237_100973063 284
58 3300009553 Ga0105249_10296283 Ga0105249_102962832 284
59 3300025291 Ga0209675_1000226 Ga0209675_100022640 284
60 3300025292 Ga0209676_1000083 Ga0209676_100008318 284
61 3300025294 Ga0209025_1000583 Ga0209025_100058318 284
62 3300025295 Ga0209564_1000585 Ga0209564_100058540 284
63 3300025917 Ga0207660_10155321 Ga0207660_101553212 284
64 3300025935 Ga0207709_10028943 Ga0207709_100289433 284
65 3300027312 Ga0209371_1003487 Ga0209371_10034877 284
66 3300030500 Ga0268256_1007657 Ga0268256_10076573 284
67 3300048919 Ga0496116_0016831 Ga0496116_0016831_494_1444 284
68 3300048920 Ga0496117_0114986 Ga0496117_0114986_79_1029 284
69 3300048921 Ga0496118_0070259 Ga0496118_0070259_1113_2063 284
70 3300048922 Ga0496119_0017168 Ga0496119_0017168_1801_2751 284
71 3300048923 Ga0496120_0014853 Ga0496120_0014853_1694_2644 284
72 3300048924 Ga0496121_0000479 Ga0496121_0000479_50336_51286 284
73 3300048925 Ga0496122_0046214 Ga0496122_0046214_1904_2854 284
74 3300048927 Ga0496124_0073690 Ga0496124_0073690_1004_1954 284
75 3300048928 Ga0496125_0000168 Ga0496125_0000168_98041_98991 284
76 3300053091 Ga0500647_0133216 Ga0500647_0133216_155_1093 284
77 3300006844 Ga0075428_100116147 Ga0075428_1001161471 285
78 3300006880 Ga0075429_100277178 Ga0075429_1002771782 285
79 3300048913 Ga0496110_0094456 Ga0496110_0094456_547_1497 285
80 3300050507 nmdc:mga05p37_2709_c2 nmdc:mga05p37_2709_c2_1746_2693 285
81 3300050508 nmdc:mga09592_9202_c1 nmdc:mga09592_9202_c1_1006_1953 285
82 3300050510 nmdc:mga06r32_458823_c1 nmdc:mga06r32_458823_c1_156_1103 285
83 3300006880 Ga0075429_100365368 Ga0075429_1003653682 286
84 3300006177 Ga0075362_10086289 Ga0075362_100862891 287
85 3300006195 Ga0075366_10076667 Ga0075366_100766672 287
86 3300050489 nmdc:mga03683_42761_c1 nmdc:mga03683_42761_c1_558_1478 287
87 3300003771 Ga0055526_1003943 Ga0055526_10039437 288
88 3300006846 Ga0075430_100262382 Ga0075430_1002623821 288
89 3300009147 Ga0114129_10032558 Ga0114129_100325582 288
90 3300025295 Ga0209564_1000145 Ga0209564_100014565 288
91 3300050493 nmdc:mga0k408_86130_c1 nmdc:mga0k408_86130_c1_804_1724 288
92 iso_pu_bacteria 2897803580 2897805876 288
93 3300031507 Ga0307509_10096280 Ga0307509_100962803 289
94 3300031616 Ga0307508_10001111 Ga0307508_1000111131 289
95 3300053178 Ga0500637_0005139 Ga0500637_0005139_2533_3471 289
96 3300009147 Ga0114129_10457835 Ga0114129_104578352 290
97 3300028794 Ga0307515_10000283 Ga0307515_10000283105 290
98 3300031911 Ga0307412_10002610 Ga0307412_100026104 290
99 iso_pu_bacteria 2511231221 2512036213 291
100 iso_pu_bacteria 2597490356 2599101933 291
101 iso_pu_bacteria 2842333319 2842335006 291
102 iso_pu_bacteria 2846952575 2846958079 291
103 iso_pu_bacteria 2848858292 2848864859 291
104 iso_pu_bacteria 8054002106 8054008479 291
105 3300045051 Ga0451576_0116563 Ga0451576_0116563_764_1699 292
106 iso_pu_bacteria 2894023352 2894027683 292
107 3300030522 Ga0307512_10018592 Ga0307512_100185922 293
108 3300031616 Ga0307508_10171782 Ga0307508_101717822 293
109 3300048927 Ga0496124_0121197 Ga0496124_0121197_1041_1988 293
110 3300050489 nmdc:mga03683_3206_c1 nmdc:mga03683_3206_c1_3168_4067 293
111 3300005457 Ga0070662_100003994 Ga0070662_1000039945 294
112 3300005564 Ga0070664_100023188 Ga0070664_1000231885 294
113 3300006186 Ga0075369_10050690 Ga0075369_100506902 294
114 3300006353 Ga0075370_10026443 Ga0075370_100264433 294
115 3300009036 Ga0105244_10000965 Ga0105244_1000096510 294
116 3300009093 Ga0105240_10018468 Ga0105240_1001846811 294
117 3300009093 Ga0105240_10219187 Ga0105240_102191872 294
118 3300009148 Ga0105243_10001682 Ga0105243_1000168216 294
119 3300009545 Ga0105237_10295838 Ga0105237_102958382 294
120 3300009551 Ga0105238_10093980 Ga0105238_100939803 294
121 3300010375 Ga0105239_10001684 Ga0105239_1000168417 294
122 3300014497 Ga0182008_10009302 Ga0182008_100093023 294
123 3300015261 Ga0182006_1001032 Ga0182006_10010327 294
124 3300015262 Ga0182007_10000366 Ga0182007_1000036619 294
125 3300025728 Ga0207655_1002684 Ga0207655_10026849 294
126 3300025913 Ga0207695_10118124 Ga0207695_101181243 294
127 3300025914 Ga0207671_10001800 Ga0207671_100018003 294
128 3300025924 Ga0207694_10004998 Ga0207694_100049983 294
129 3300025933 Ga0207706_10003793 Ga0207706_100037938 294
130 3300025935 Ga0207709_10001360 Ga0207709_1000136016 294
131 3300025945 Ga0207679_10217309 Ga0207679_102173091 294
132 3300026041 Ga0207639_10234731 Ga0207639_102347312 294
133 3300036401 Ga0373937_0014096 Ga0373937_0014096_4798_5733 294
134 3300046457 Ga0495590_0014273 Ga0495590_0014273_1805_2725 294
135 3300047443 Ga0495687_021061 Ga0495687_021061_2130_3050 294
136 3300047443 Ga0495687_045689 Ga0495687_045689_273_1193 294
137 3300048919 Ga0496116_0099800 Ga0496116_0099800_647_1570 294
138 3300050496 nmdc:mga07m45_17804_c1 nmdc:mga07m45_17804_c1_547_1470 294
139 3300053134 Ga0500658_0130232 Ga0500658_0130232_128_1048 294
140 3300006178 Ga0075367_10059581 Ga0075367_100595812 295
141 3300013307 Ga0157372_10225279 Ga0157372_102252793 295
142 3300027665 Ga0209983_1006590 Ga0209983_10065902 295
143 3300027717 Ga0209998_10027200 Ga0209998_100272001 295
144 3300035172 Ga0373955_0061335 Ga0373955_0061335_150_1070 295
145 3300036401 Ga0373937_0064919 Ga0373937_0064919_339_1259 295
146 3300037068 Ga0373925_0106669 Ga0373925_0106669_201_1121 295
147 3300046459 Ga0495629_0243433 Ga0495629_0243433_202_1122 295
148 3300046683 Ga0495658_0006349 Ga0495658_0006349_1137_2057 295
149 3300046810 Ga0495660_0035956 Ga0495660_0035956_52_978 295
150 3300053085 Ga0495619_0185339 Ga0495619_0185339_167_1087 295
151 iso_pu_bacteria 2751185800 2753357601 295
152 iso_pu_bacteria 2758568016 2758640098 295
153 iso_pu_bacteria 2854911287 2854913334 295
154 3300005356 Ga0070674_100075904 Ga0070674_1000759042 296
155 3300005564 Ga0070664_100172815 Ga0070664_1001728153 296
156 3300009176 Ga0105242_10571759 Ga0105242_105717592 296
157 3300013296 Ga0157374_10294593 Ga0157374_102945932 296
158 3300025920 Ga0207649_10090844 Ga0207649_100908442 296
159 3300025935 Ga0207709_10148361 Ga0207709_101483611 296
160 3300025937 Ga0207669_10241973 Ga0207669_102419731 296
161 3300028379 Ga0268266_10154105 Ga0268266_101541052 296
162 3300042010 Ga0439452_027810 Ga0439452_027810_214_1176 296
163 3300042532 Ga0450893_0009504 Ga0450893_0009504_120_1052 296
164 3300046542 Ga0495597_0020417 Ga0495597_0020417_258_1220 296
165 3300048912 Ga0496109_0038690 Ga0496109_0038690_1685_2647 296
166 iso_pu_bacteria 2599185292 2599902927 296
167 iso_pu_bacteria 2643221569 2643861750 296
168 iso_pu_bacteria 2643221594 2643983215 296
169 iso_pu_bacteria 2643221621 2644123476 296
170 iso_pu_bacteria 2808606395 2809033260 296
171 iso_pu_bacteria 2857537821 2857538241 296
172 iso_pu_bacteria 2857576091 2857580794 296
173 iso_pu_bacteria 2858950400 2858952051 296
174 iso_pu_bacteria 2941479691 2941482490 296
175 3300005328 Ga0070676_10283737 Ga0070676_102837372 297
176 3300005331 Ga0070670_100084979 Ga0070670_1000849792 297
177 3300005347 Ga0070668_100078177 Ga0070668_1000781772 297
178 3300005353 Ga0070669_100113582 Ga0070669_1001135822 297
179 3300005354 Ga0070675_100080936 Ga0070675_1000809362 297
180 3300005530 Ga0070679_100329255 Ga0070679_1003292552 297
181 3300005548 Ga0070665_100148512 Ga0070665_1001485122 297
182 3300005564 Ga0070664_100413950 Ga0070664_1004139502 297
183 3300005841 Ga0068863_100286672 Ga0068863_1002866721 297
184 3300005843 Ga0068860_100319082 Ga0068860_1003190822 297
185 3300006178 Ga0075367_10096874 Ga0075367_100968741 297
186 3300006195 Ga0075366_10186449 Ga0075366_101864492 297
187 3300006353 Ga0075370_10036658 Ga0075370_100366582 297
188 3300009148 Ga0105243_10281602 Ga0105243_102816021 297
189 3300025923 Ga0207681_10057263 Ga0207681_100572633 297
190 3300025926 Ga0207659_10039189 Ga0207659_100391892 297
191 3300025926 Ga0207659_10413358 Ga0207659_104133582 297
192 3300025933 Ga0207706_10029503 Ga0207706_100295033 297
193 3300025935 Ga0207709_10136795 Ga0207709_101367952 297
194 3300025940 Ga0207691_10082806 Ga0207691_100828063 297
195 3300025972 Ga0207668_10069586 Ga0207668_100695862 297
196 3300025986 Ga0207658_10021590 Ga0207658_100215902 297
197 3300026067 Ga0207678_10220158 Ga0207678_102201582 297
198 3300026089 Ga0207648_10461373 Ga0207648_104613732 297
199 3300026116 Ga0207674_10020383 Ga0207674_100203836 297
200 3300028379 Ga0268266_10078909 Ga0268266_100789093 297
201 3300028379 Ga0268266_10079755 Ga0268266_100797553 297
202 3300028381 Ga0268264_10452026 Ga0268264_104520262 297
203 3300031456 Ga0307513_10399439 Ga0307513_103994391 297
204 3300046501 Ga0495607_0000280 Ga0495607_0000280_47013_47951 297
205 3300046542 Ga0495597_0022634 Ga0495597_0022634_1169_2089 297
206 3300047443 Ga0495687_000196 Ga0495687_000196_38654_39574 297
207 3300050489 nmdc:mga03683_95159_c1 nmdc:mga03683_95159_c1_184_1104 297
208 3300050490 nmdc:mga03n38_54907_c1 nmdc:mga03n38_54907_c1_354_1274 297
209 3300050496 nmdc:mga07m45_50012_c1 nmdc:mga07m45_50012_c1_1166_2086 297
210 iso_pu_bacteria 2511231002 2511245932 297
211 iso_pu_bacteria 2513020051 2513231799 297
212 iso_pu_bacteria 2547132374 2548497399 297
213 iso_pu_bacteria 2599185214 2599626662 297
214 iso_pu_bacteria 2599185226 2599675726 297
215 iso_pu_bacteria 2599185227 2599684199 297
216 iso_pu_bacteria 2599185229 2599696213 297
217 iso_pu_bacteria 2643221570 2643866565 297
218 iso_pu_bacteria 2643221596 2643993317 297
219 iso_pu_bacteria 2643221609 2644060686 297
220 iso_pu_bacteria 2643221611 2644074006 297
221 iso_pu_bacteria 2643221628 2644159576 297
222 iso_pu_bacteria 2643221652 2644294078 297
223 iso_pu_bacteria 2643221658 2644327938 297
224 iso_pu_bacteria 2643221672 2644397900 297
225 iso_pu_bacteria 2643221683 2644468259 297
226 iso_pu_bacteria 2643221717 2644646251 297
227 iso_pu_bacteria 2738541277 2738718081 297
228 iso_pu_bacteria 2738541307 2738885020 297
229 iso_pu_bacteria 2738543012 2739242712 297
230 iso_pu_bacteria 2738543013 2739250458 297
231 iso_pu_bacteria 2738543019 2739278767 297
232 iso_pu_bacteria 2816332133 2816472972 297
233 iso_pu_bacteria 2818991446 2819595772 297
234 iso_pu_bacteria 2831265667 2831266783 297
235 iso_pu_bacteria 2838054893 2838057136 297
236 iso_pu_bacteria 2842677519 2842682576 297
237 iso_pu_bacteria 2842733646 2842735584 297
238 iso_pu_bacteria 2842747753 2842751321 297
239 iso_pu_bacteria 2885192300 2885192725 297
240 iso_pu_bacteria 2885198086 2885201232 297
241 iso_pu_bacteria 2885211737 2885214886 297
242 iso_pu_bacteria 2899924645 2899925118 297
243 iso_pu_bacteria 2904449895 2904454452 297
244 iso_pu_bacteria 2904456579 2904461105 297
245 iso_pu_bacteria 2904541872 2904544741 297
246 iso_pu_bacteria 2919462493 2919465982 297
247 iso_pu_bacteria 2919704043 2919707444 297
248 iso_pu_bacteria 2928037797 2928038757 297
249 iso_pu_bacteria 2928044640 2928045638 297
250 iso_pu_bacteria 2928051484 2928053255 297
251 iso_pu_bacteria 2928064002 2928066860 297
252 iso_pu_bacteria 2928070936 2928071254 297
253 iso_pu_bacteria 2928084124 2928084817 297
254 iso_pu_bacteria 2928115317 2928119626 297
255 iso_pu_bacteria 2929160207 2929163588 297
256 iso_pu_bacteria 2929520902 2929526987 297
257 iso_pu_bacteria 2932422444 2932425138 297
258 iso_pu_bacteria 2945909444 2945912275 297
259 iso_pu_bacteria 2945945610 2945948209 297
260 iso_pu_bacteria 2945984333 2945985414 297
261 iso_pu_bacteria 2954767861 2954772326 297
262 iso_pu_bacteria 2974320154 2974323373 297
263 iso_pu_bacteria 2990710928 2990712248 297
264 3300009098 Ga0105245_10396835 Ga0105245_103968352 298
265 3300014325 Ga0163163_10107903 Ga0163163_101079033 298
266 3300026023 Ga0207677_10059178 Ga0207677_100591782 298
267 3300039062 Ga0400483_242388 Ga0400483_242388_103_1044 298
268 3300053730 Ga0500645_000198 Ga0500645_000198_24149_25081 298
269 iso_pu_bacteria 2585428062 2587757178 298
270 iso_pu_bacteria 2643221654 2644303759 298
271 3300003775 Ga0055524_1000097 Ga0055524_100009720 299
272 3300005354 Ga0070675_100364892 Ga0070675_1003648922 299
273 3300006353 Ga0075370_10201756 Ga0075370_102017562 299
274 3300006946 Ga0079104_1000019 Ga0079104_100001977 299
275 3300006948 Ga0099826_10000027 Ga0099826_10000027103 299
276 3300025294 Ga0209025_1001156 Ga0209025_100115631 299
277 3300025299 Ga0209256_1000051 Ga0209256_100005179 299
278 3300025299 Ga0209256_1000127 Ga0209256_100012751 299
279 3300025303 Ga0209051_1018109 Ga0209051_10181092 299
280 3300027111 Ga0209281_1000160 Ga0209281_100016077 299
281 3300027666 Ga0209282_1000069 Ga0209282_100006959 299
282 3300028794 Ga0307515_10000586 Ga0307515_100005864 299
283 3300028794 Ga0307515_10003631 Ga0307515_100036314 299
284 3300028794 Ga0307515_10011842 Ga0307515_1001184212 299
285 3300030522 Ga0307512_10038652 Ga0307512_100386522 299
286 3300031456 Ga0307513_10049729 Ga0307513_100497292 299
287 3300031507 Ga0307509_10011999 Ga0307509_100119993 299
288 3300031616 Ga0307508_10000876 Ga0307508_1000087628 299
289 3300031649 Ga0307514_10014746 Ga0307514_100147464 299
290 3300031730 Ga0307516_10037208 Ga0307516_100372084 299
291 3300033179 Ga0307507_10247610 Ga0307507_102476101 299
292 3300039062 Ga0400483_058929 Ga0400483_058929_1564_2511 299
293 3300046474 Ga0495605_0004236 Ga0495605_0004236_7347_8297 299
294 3300046500 Ga0495596_0000317 Ga0495596_0000317_3103_4053 299
295 3300046512 Ga0495610_0000424 Ga0495610_0000424_28694_29644 299
296 3300046513 Ga0495616_0044348 Ga0495616_0044348_634_1584 299
297 3300046522 Ga0495643_0093802 Ga0495643_0093802_545_1483 299
298 3300046538 Ga0495609_0009581 Ga0495609_0009581_688_1638 299
299 3300046660 Ga0495625_0000807 Ga0495625_0000807_14637_15575 299
300 3300046665 Ga0495661_0068155 Ga0495661_0068155_786_1736 299
301 3300046692 Ga0495671_0001711 Ga0495671_0001711_870_1820 299
302 3300046694 Ga0495649_0175933 Ga0495649_0175933_24_974 299
303 3300047472 Ga0495686_0145921 Ga0495686_0145921_153_1091 299
304 3300048917 Ga0496114_0030341 Ga0496114_0030341_453_1376 299
305 3300048919 Ga0496116_0009002 Ga0496116_0009002_280_1230 299
306 3300048922 Ga0496119_0026563 Ga0496119_0026563_2818_3762 299
307 3300048924 Ga0496121_0049646 Ga0496121_0049646_2198_3148 299
308 3300048925 Ga0496122_0003097 Ga0496122_0003097_3189_4139 299
309 3300048925 Ga0496122_0003536 Ga0496122_0003536_17870_18814 299
310 3300048926 Ga0496123_0005860 Ga0496123_0005860_3089_4039 299
311 3300048928 Ga0496125_0000323 Ga0496125_0000323_15318_16262 299
312 3300048928 Ga0496125_0023979 Ga0496125_0023979_4078_5022 299
313 3300048928 Ga0496125_0030089 Ga0496125_0030089_2076_3020 299
314 3300050493 nmdc:mga0k408_3141_c1 nmdc:mga0k408_3141_c1_2321_3250 299
315 3300050494 nmdc:mga06z11_79686_c1 nmdc:mga06z11_79686_c1_564_1502 299
316 3300053088 Ga0500644_0053915 Ga0500644_0053915_159_1097 299
317 3300053739 Ga0500587_000066 Ga0500587_000066_6050_6988 299
318 3300005344 Ga0070661_100003091 Ga0070661_1000030912 300
319 3300005355 Ga0070671_100020848 Ga0070671_1000208481 300
320 3300005366 Ga0070659_100017155 Ga0070659_1000171552 300
321 3300005367 Ga0070667_100223216 Ga0070667_1002232162 300
322 3300005457 Ga0070662_100005238 Ga0070662_1000052386 300
323 3300005563 Ga0068855_100031834 Ga0068855_1000318344 300
324 3300005564 Ga0070664_100004590 Ga0070664_1000045903 300
325 3300005577 Ga0068857_100088217 Ga0068857_1000882172 300
326 3300005614 Ga0068856_100028024 Ga0068856_1000280246 300
327 3300005616 Ga0068852_100012178 Ga0068852_1000121783 300
328 3300005844 Ga0068862_100011483 Ga0068862_1000114835 300
329 3300006177 Ga0075362_10031282 Ga0075362_100312822 300
330 3300006195 Ga0075366_10047615 Ga0075366_100476152 300
331 3300006353 Ga0075370_10049636 Ga0075370_100496362 300
332 3300009545 Ga0105237_10001628 Ga0105237_1000162817 300
333 3300013307 Ga0157372_10757061 Ga0157372_107570611 300
334 3300025920 Ga0207649_10049281 Ga0207649_100492813 300
335 3300025932 Ga0207690_10002002 Ga0207690_100020025 300
336 3300025933 Ga0207706_10000149 Ga0207706_1000014937 300
337 3300025934 Ga0207686_10148193 Ga0207686_101481932 300
338 3300025940 Ga0207691_10022311 Ga0207691_100223113 300
339 3300025949 Ga0207667_10001720 Ga0207667_1000172021 300
340 3300025960 Ga0207651_10019990 Ga0207651_100199903 300
341 3300026023 Ga0207677_10398444 Ga0207677_103984441 300
342 3300026041 Ga0207639_10055874 Ga0207639_100558743 300
343 3300026067 Ga0207678_10011833 Ga0207678_100118333 300
344 3300026142 Ga0207698_10121441 Ga0207698_101214412 300
345 3300028794 Ga0307515_10000267 Ga0307515_1000026747 300
346 3300031649 Ga0307514_10000806 Ga0307514_100008063 300
347 3300041404 Ga0439436_0026058 Ga0439436_0026058_582_1502 300
348 3300041407 Ga0439447_004235 Ga0439447_004235_209_1129 300
349 3300041997 Ga0439431_0016358 Ga0439431_0016358_680_1612 300
350 3300042007 Ga0439449_0005718 Ga0439449_0005718_2990_3910 300
351 3300042007 Ga0439449_0040190 Ga0439449_0040190_475_1395 300
352 3300042008 Ga0439450_024941 Ga0439450_024941_11_931 300
353 3300042010 Ga0439452_019491 Ga0439452_019491_299_1219 300
354 3300042015 Ga0439462_0035634 Ga0439462_0035634_231_1151 300
355 3300042134 Ga0450898_006861 Ga0450898_006861_272_1192 300
356 3300046528 Ga0495642_0111393 Ga0495642_0111393_138_1058 300
357 3300048910 Ga0496107_0008919 Ga0496107_0008919_3151_4071 300
358 3300048920 Ga0496117_0084871 Ga0496117_0084871_496_1446 300
359 3300048921 Ga0496118_0139684 Ga0496118_0139684_113_1063 300
360 3300048924 Ga0496121_0108493 Ga0496121_0108493_137_1087 300
361 3300048925 Ga0496122_0000669 Ga0496122_0000669_8485_9435 300
362 3300048926 Ga0496123_0000603 Ga0496123_0000603_38222_39172 300
363 3300048927 Ga0496124_0052640 Ga0496124_0052640_1920_2870 300
364 3300048928 Ga0496125_0050199 Ga0496125_0050199_471_1421 300
365 3300048929 Ga0496126_0123726 Ga0496126_0123726_91_1041 300
366 3300050489 nmdc:mga03683_167353_c1 nmdc:mga03683_167353_c1_39_959 300
367 3300050496 nmdc:mga07m45_14323_c1 nmdc:mga07m45_14323_c1_934_1854 300
368 3300002704 JGI25155J39150_1000002 JGI25155J39150_100000291 301
369 3300002705 JGI25156J39149_1000003 JGI25156J39149_1000003214 301
370 3300002738 JGI25154J39366_1000009 JGI25154J39366_100000991 301
371 3300002741 JGI25157J39369_1000002 JGI25157J39369_100000291 301
372 3300002773 JGI25152J39213_1001234 JGI25152J39213_100123410 301
373 3300002774 JGI25150J39212_1000784 JGI25150J39212_10007843 301
374 3300002987 JGI25159J45721_1000148 JGI25159J45721_100014828 301
375 3300002987 JGI25159J45721_1001075 JGI25159J45721_10010753 301
376 3300002987 JGI25159J45721_1023052 JGI25159J45721_10230522 301
377 3300003187 JGI25151J46595_10002632 JGI25151J46595_1000263210 301
378 3300003187 JGI25151J46595_10011867 JGI25151J46595_100118671 301
379 3300003187 JGI25151J46595_10043128 JGI25151J46595_100431282 301
380 3300003215 JGI25153J46596_10001727 JGI25153J46596_1000172710 301
381 3300003354 JGI25160J50197_1000123 JGI25160J50197_100012341 301
382 3300003354 JGI25160J50197_1009409 JGI25160J50197_10094092 301
383 3300003374 JGI25161J50226_1000032 JGI25161J50226_100003234 301
384 3300003374 JGI25161J50226_1001050 JGI25161J50226_10010502 301
385 3300003762 Ga0055542_1000021 Ga0055542_1000021268 301
386 3300003771 Ga0055526_1001458 Ga0055526_10014585 301
387 3300003771 Ga0055526_1002300 Ga0055526_10023003 301
388 3300003771 Ga0055526_1002744 Ga0055526_100274410 301
389 3300003771 Ga0055526_1003550 Ga0055526_10035502 301
390 3300003773 Ga0055537_1000079 Ga0055537_100007938 301
391 3300003773 Ga0055537_1003026 Ga0055537_10030265 301
392 3300003775 Ga0055524_1000012 Ga0055524_100001253 301
393 3300003775 Ga0055524_1001542 Ga0055524_100154213 301
394 3300003775 Ga0055524_1001822 Ga0055524_100182210 301
395 3300003781 Ga0055536_1000657 Ga0055536_10006574 301
396 3300003781 Ga0055536_1001022 Ga0055536_100102216 301
397 3300003781 Ga0055536_1001230 Ga0055536_10012303 301
398 3300003781 Ga0055536_1005409 Ga0055536_10054095 301
399 3300003781 Ga0055536_1008299 Ga0055536_10082993 301
400 3300003781 Ga0055536_1009066 Ga0055536_10090662 301
401 3300003784 Ga0055534_1000092 Ga0055534_10000926 301
402 3300003784 Ga0055534_1001081 Ga0055534_100108110 301
403 3300003784 Ga0055534_1001381 Ga0055534_10013815 301
404 3300003790 Ga0055528_1000956 Ga0055528_10009566 301
405 3300003790 Ga0055528_1002291 Ga0055528_100229114 301
406 3300003790 Ga0055528_1009159 Ga0055528_10091593 301
407 3300003791 Ga0055530_10000453 Ga0055530_1000045326 301
408 3300003791 Ga0055530_10000793 Ga0055530_1000079315 301
409 3300003791 Ga0055530_10017436 Ga0055530_100174362 301
410 3300003792 Ga0055540_1000012 Ga0055540_1000012171 301
411 3300003792 Ga0055540_1001467 Ga0055540_10014673 301
412 3300003792 Ga0055540_1002293 Ga0055540_10022935 301
413 3300003794 Ga0055531_10000653 Ga0055531_100006533 301
414 3300003794 Ga0055531_10001541 Ga0055531_100015417 301
415 3300004625 Ga0055543_1000294 Ga0055543_100029428 301
416 3300004625 Ga0055543_1000696 Ga0055543_100069610 301
417 3300005262 Ga0065165_1002228 Ga0065165_100222810 301
418 3300005262 Ga0065165_1012757 Ga0065165_10127573 301
419 3300005262 Ga0065165_1012901 Ga0065165_10129011 301
420 3300005289 Ga0065704_10011989 Ga0065704_100119892 301
421 3300005290 Ga0065712_10148324 Ga0065712_101483242 301
422 3300005293 Ga0065715_10125828 Ga0065715_101258282 301
423 3300005328 Ga0070676_10035845 Ga0070676_100358452 301
424 3300005328 Ga0070676_10079487 Ga0070676_100794872 301
425 3300005330 Ga0070690_100003489 Ga0070690_1000034897 301
426 3300005331 Ga0070670_100037126 Ga0070670_1000371263 301
427 3300005333 Ga0070677_10002129 Ga0070677_100021293 301
428 3300005333 Ga0070677_10030335 Ga0070677_100303352 301
429 3300005333 Ga0070677_10040639 Ga0070677_100406392 301
430 3300005333 Ga0070677_10080223 Ga0070677_100802232 301
431 3300005334 Ga0068869_100042331 Ga0068869_1000423313 301
432 3300005335 Ga0070666_10014344 Ga0070666_100143443 301
433 3300005335 Ga0070666_10074039 Ga0070666_100740392 301
434 3300005338 Ga0068868_100005608 Ga0068868_1000056082 301
435 3300005338 Ga0068868_100068148 Ga0068868_1000681482 301
436 3300005344 Ga0070661_100090249 Ga0070661_1000902492 301
437 3300005347 Ga0070668_100053700 Ga0070668_1000537002 301
438 3300005347 Ga0070668_100065909 Ga0070668_1000659092 301
439 3300005353 Ga0070669_100018890 Ga0070669_1000188901 301
440 3300005353 Ga0070669_100065009 Ga0070669_1000650092 301
441 3300005354 Ga0070675_100001733 Ga0070675_10000173313 301
442 3300005354 Ga0070675_100014191 Ga0070675_1000141914 301
443 3300005355 Ga0070671_100004476 Ga0070671_1000044767 301
444 3300005355 Ga0070671_100015093 Ga0070671_1000150935 301
445 3300005356 Ga0070674_100036087 Ga0070674_1000360873 301
446 3300005356 Ga0070674_100056035 Ga0070674_1000560352 301
447 3300005356 Ga0070674_100139183 Ga0070674_1001391832 301
448 3300005356 Ga0070674_100152914 Ga0070674_1001529142 301
449 3300005364 Ga0070673_100017776 Ga0070673_1000177763 301
450 3300005364 Ga0070673_100056382 Ga0070673_1000563822 301
451 3300005364 Ga0070673_100205263 Ga0070673_1002052632 301
452 3300005365 Ga0070688_100025675 Ga0070688_1000256752 301
453 3300005366 Ga0070659_100332341 Ga0070659_1003323412 301
454 3300005367 Ga0070667_100018482 Ga0070667_1000184824 301
455 3300005441 Ga0070700_100004393 Ga0070700_1000043934 301
456 3300005456 Ga0070678_100013926 Ga0070678_1000139262 301
457 3300005456 Ga0070678_100040672 Ga0070678_1000406723 301
458 3300005456 Ga0070678_100283497 Ga0070678_1002834971 301
459 3300005459 Ga0068867_100005155 Ga0068867_1000051555 301
460 3300005459 Ga0068867_100091081 Ga0068867_1000910812 301
461 3300005459 Ga0068867_100201226 Ga0068867_1002012262 301
462 3300005518 Ga0070699_100413942 Ga0070699_1004139421 301
463 3300005539 Ga0068853_100014373 Ga0068853_1000143733 301
464 3300005543 Ga0070672_100049824 Ga0070672_1000498243 301
465 3300005543 Ga0070672_100065484 Ga0070672_1000654842 301
466 3300005543 Ga0070672_100310324 Ga0070672_1003103242 301
467 3300005544 Ga0070686_100124845 Ga0070686_1001248452 301
468 3300005548 Ga0070665_100088396 Ga0070665_1000883964 301
469 3300005548 Ga0070665_100351009 Ga0070665_1003510092 301
470 3300005564 Ga0070664_100112024 Ga0070664_1001120243 301
471 3300005614 Ga0068856_100193519 Ga0068856_1001935193 301
472 3300005616 Ga0068852_100174244 Ga0068852_1001742442 301
473 3300005617 Ga0068859_100010715 Ga0068859_1000107155 301
474 3300005617 Ga0068859_100121908 Ga0068859_1001219082 301
475 3300005617 Ga0068859_100165593 Ga0068859_1001655932 301
476 3300005618 Ga0068864_100004274 Ga0068864_1000042743 301
477 3300005618 Ga0068864_100247873 Ga0068864_1002478732 301
478 3300005718 Ga0068866_10030595 Ga0068866_100305952 301
479 3300005719 Ga0068861_100002547 Ga0068861_1000025475 301
480 3300005719 Ga0068861_100233701 Ga0068861_1002337012 301
481 3300005834 Ga0068851_10032507 Ga0068851_100325072 301
482 3300005841 Ga0068863_100001708 Ga0068863_10000170822 301
483 3300005841 Ga0068863_100336087 Ga0068863_1003360872 301
484 3300005842 Ga0068858_100023951 Ga0068858_1000239515 301
485 3300005843 Ga0068860_100004285 Ga0068860_1000042854 301
486 3300005843 Ga0068860_100035293 Ga0068860_1000352932 301
487 3300005843 Ga0068860_100226399 Ga0068860_1002263992 301
488 3300005844 Ga0068862_100017703 Ga0068862_1000177032 301
489 3300005844 Ga0068862_100054515 Ga0068862_1000545153 301
490 3300005844 Ga0068862_100252081 Ga0068862_1002520812 301
491 3300006038 Ga0075365_10003595 Ga0075365_100035952 301
492 3300006038 Ga0075365_10127344 Ga0075365_101273442 301
493 3300006042 Ga0075368_10050796 Ga0075368_100507962 301
494 3300006048 Ga0075363_100028997 Ga0075363_1000289973 301
495 3300006051 Ga0075364_10049617 Ga0075364_100496172 301
496 3300006177 Ga0075362_10008388 Ga0075362_100083884 301
497 3300006177 Ga0075362_10090512 Ga0075362_100905121 301
498 3300006186 Ga0075369_10091043 Ga0075369_100910432 301
499 3300006195 Ga0075366_10031279 Ga0075366_100312793 301
500 3300006237 Ga0097621_100048219 Ga0097621_1000482192 301
501 3300006237 Ga0097621_100054844 Ga0097621_1000548442 301
502 3300006353 Ga0075370_10000555 Ga0075370_100005557 301
503 3300006353 Ga0075370_10024221 Ga0075370_100242213 301
504 3300006353 Ga0075370_10052918 Ga0075370_100529182 301
505 3300006358 Ga0068871_100028695 Ga0068871_1000286952 301
506 3300006358 Ga0068871_100157237 Ga0068871_1001572372 301
507 3300006881 Ga0068865_100077194 Ga0068865_1000771942 301
508 3300006931 Ga0097620_100010715 Ga0097620_1000107155 301
509 3300006931 Ga0097620_100121912 Ga0097620_1001219122 301
510 3300006931 Ga0097620_100165591 Ga0097620_1001655912 301
511 3300006948 Ga0099826_10006221 Ga0099826_100062212 301
512 3300009098 Ga0105245_10012088 Ga0105245_100120887 301
513 3300009101 Ga0105247_10416447 Ga0105247_104164471 301
514 3300009148 Ga0105243_10004695 Ga0105243_100046953 301
515 3300009148 Ga0105243_10043521 Ga0105243_100435212 301
516 3300009148 Ga0105243_10141731 Ga0105243_101417313 301
517 3300009174 Ga0105241_10190773 Ga0105241_101907732 301
518 3300009176 Ga0105242_10019130 Ga0105242_100191302 301
519 3300009176 Ga0105242_10122447 Ga0105242_101224472 301
520 3300009553 Ga0105249_10203716 Ga0105249_102037162 301
521 3300009553 Ga0105249_10269646 Ga0105249_102696461 301
522 3300010375 Ga0105239_10605511 Ga0105239_106055112 301
523 3300013105 Ga0157369_10016621 Ga0157369_100166219 301
524 3300013296 Ga0157374_10297913 Ga0157374_102979132 301
525 3300013297 Ga0157378_10004470 Ga0157378_1000447010 301
526 3300013297 Ga0157378_10039364 Ga0157378_100393642 301
527 3300013297 Ga0157378_10081937 Ga0157378_100819373 301
528 3300013297 Ga0157378_10193818 Ga0157378_101938182 301
529 3300013306 Ga0163162_10008437 Ga0163162_100084376 301
530 3300013306 Ga0163162_10045471 Ga0163162_100454712 301
531 3300013306 Ga0163162_10106036 Ga0163162_101060362 301
532 3300013306 Ga0163162_10141004 Ga0163162_101410042 301
533 3300013306 Ga0163162_10682703 Ga0163162_106827032 301
534 3300013307 Ga0157372_10076681 Ga0157372_100766813 301
535 3300013308 Ga0157375_10032335 Ga0157375_100323352 301
536 3300013308 Ga0157375_10305054 Ga0157375_103050542 301
537 3300014325 Ga0163163_10079344 Ga0163163_100793443 301
538 3300014326 Ga0157380_10026504 Ga0157380_100265043 301
539 3300014326 Ga0157380_10033826 Ga0157380_100338263 301
540 3300014326 Ga0157380_10112611 Ga0157380_101126112 301
541 3300014326 Ga0157380_10163276 Ga0157380_101632762 301
542 3300014497 Ga0182008_10019759 Ga0182008_100197594 301
543 3300014497 Ga0182008_10047686 Ga0182008_100476862 301
544 3300014968 Ga0157379_10037328 Ga0157379_100373283 301
545 3300014968 Ga0157379_10078733 Ga0157379_100787332 301
546 3300014969 Ga0157376_10068333 Ga0157376_100683333 301
547 3300014969 Ga0157376_10158997 Ga0157376_101589972 301
548 3300014969 Ga0157376_10206137 Ga0157376_102061372 301
549 3300015262 Ga0182007_10011494 Ga0182007_100114942 301
550 3300015683 Ga0183362_10001 Ga0183362_100011361 301
551 3300017792 Ga0163161_10001014 Ga0163161_1000101410 301
552 3300017792 Ga0163161_10018424 Ga0163161_100184242 301
553 3300017792 Ga0163161_10038391 Ga0163161_100383912 301
554 3300017792 Ga0163161_10133045 Ga0163161_101330452 301
555 3300025206 Ga0209435_100001 Ga0209435_100001625 301
556 3300025228 Ga0209672_100665 Ga0209672_1006656 301
557 3300025229 Ga0209147_101220 Ga0209147_1012205 301
558 3300025242 Ga0209258_100058 Ga0209258_100058267 301
559 3300025245 Ga0207425_1000733 Ga0207425_10007339 301
560 3300025245 Ga0207425_1002759 Ga0207425_10027593 301
561 3300025246 Ga0209646_1000001 Ga0209646_1000001994 301
562 3300025250 Ga0209026_1000003 Ga0209026_1000003625 301
563 3300025254 Ga0209148_1000071 Ga0209148_1000071267 301
564 3300025256 Ga0209759_1000001 Ga0209759_1000001625 301
565 3300025258 Ga0209129_1000023 Ga0209129_100002363 301
566 3300025258 Ga0209129_1001044 Ga0209129_100104415 301
567 3300025258 Ga0209129_1004583 Ga0209129_10045832 301
568 3300025263 Ga0209565_1000004 Ga0209565_1000004582 301
569 3300025263 Ga0209565_1000073 Ga0209565_100007312 301
570 3300025263 Ga0209565_1000187 Ga0209565_100018742 301
571 3300025263 Ga0209565_1000912 Ga0209565_10009122 301
572 3300025273 Ga0209673_1000066 Ga0209673_1000066207 301
573 3300025273 Ga0209673_1000074 Ga0209673_1000074200 301
574 3300025273 Ga0209673_1000127 Ga0209673_1000127155 301
575 3300025273 Ga0209673_1000389 Ga0209673_100038942 301
576 3300025273 Ga0209673_1002877 Ga0209673_10028776 301
577 3300025284 Ga0209130_1000050 Ga0209130_1000050214 301
578 3300025284 Ga0209130_1000069 Ga0209130_100006966 301
579 3300025284 Ga0209130_1000082 Ga0209130_1000082113 301
580 3300025291 Ga0209675_1000029 Ga0209675_1000029155 301
581 3300025291 Ga0209675_1000044 Ga0209675_10000445 301
582 3300025291 Ga0209675_1000232 Ga0209675_100023225 301
583 3300025291 Ga0209675_1008851 Ga0209675_10088514 301
584 3300025291 Ga0209675_1009803 Ga0209675_10098032 301
585 3300025292 Ga0209676_1000005 Ga0209676_1000005760 301
586 3300025292 Ga0209676_1000029 Ga0209676_1000029320 301
587 3300025292 Ga0209676_1000142 Ga0209676_1000142138 301
588 3300025292 Ga0209676_1001525 Ga0209676_10015259 301
589 3300025292 Ga0209676_1007840 Ga0209676_10078403 301
590 3300025292 Ga0209676_1008694 Ga0209676_10086944 301
591 3300025292 Ga0209676_1010602 Ga0209676_10106022 301
592 3300025292 Ga0209676_1029646 Ga0209676_10296462 301
593 3300025294 Ga0209025_1000316 Ga0209025_10003166 301
594 3300025294 Ga0209025_1000351 Ga0209025_100035174 301
595 3300025294 Ga0209025_1000766 Ga0209025_100076627 301
596 3300025294 Ga0209025_1005031 Ga0209025_10050312 301
597 3300025294 Ga0209025_1021697 Ga0209025_10216973 301
598 3300025294 Ga0209025_1023162 Ga0209025_10231622 301
599 3300025294 Ga0209025_1023652 Ga0209025_10236522 301
600 3300025294 Ga0209025_1036435 Ga0209025_10364352 301
601 3300025294 Ga0209025_1039894 Ga0209025_10398943 301
602 3300025295 Ga0209564_1000090 Ga0209564_1000090191 301
603 3300025295 Ga0209564_1001244 Ga0209564_100124417 301
604 3300025295 Ga0209564_1001318 Ga0209564_100131820 301
605 3300025295 Ga0209564_1002063 Ga0209564_10020639 301
606 3300025297 Ga0209758_1000044 Ga0209758_1000044332 301
607 3300025297 Ga0209758_1043783 Ga0209758_10437832 301
608 3300025298 Ga0209050_1000003 Ga0209050_1000003382 301
609 3300025298 Ga0209050_1000007 Ga0209050_1000007337 301
610 3300025298 Ga0209050_1001232 Ga0209050_100123221 301
611 3300025298 Ga0209050_1002246 Ga0209050_10022463 301
612 3300025298 Ga0209050_1013755 Ga0209050_10137553 301
613 3300025299 Ga0209256_1000001 Ga0209256_1000001385 301
614 3300025299 Ga0209256_1000020 Ga0209256_1000020335 301
615 3300025299 Ga0209256_1000022 Ga0209256_1000022102 301
616 3300025302 Ga0207426_1000001 Ga0207426_1000001970 301
617 3300025302 Ga0207426_1000031 Ga0207426_1000031258 301
618 3300025302 Ga0207426_1000071 Ga0207426_100007142 301
619 3300025302 Ga0207426_1001744 Ga0207426_100174417 301
620 3300025303 Ga0209051_1000003 Ga0209051_1000003382 301
621 3300025303 Ga0209051_1000036 Ga0209051_1000036111 301
622 3300025303 Ga0209051_1000416 Ga0209051_100041626 301
623 3300025303 Ga0209051_1000500 Ga0209051_10005009 301
624 3300025303 Ga0209051_1000542 Ga0209051_100054231 301
625 3300025303 Ga0209051_1000735 Ga0209051_10007358 301
626 3300025303 Ga0209051_1011957 Ga0209051_10119572 301
627 3300025304 Ga0209257_1000011 Ga0209257_1000011734 301
628 3300025304 Ga0209257_1000012 Ga0209257_1000012611 301
629 3300025304 Ga0209257_1000018 Ga0209257_1000018382 301
630 3300025304 Ga0209257_1000226 Ga0209257_100022643 301
631 3300025304 Ga0209257_1003858 Ga0209257_100385810 301
632 3300025304 Ga0209257_1005060 Ga0209257_10050607 301
633 3300025321 Ga0207656_10004471 Ga0207656_100044714 301
634 3300025893 Ga0207682_10001604 Ga0207682_100016044 301
635 3300025893 Ga0207682_10047517 Ga0207682_100475172 301
636 3300025893 Ga0207682_10051884 Ga0207682_100518842 301
637 3300025899 Ga0207642_10016419 Ga0207642_100164193 301
638 3300025899 Ga0207642_10029220 Ga0207642_100292202 301
639 3300025903 Ga0207680_10011590 Ga0207680_100115903 301
640 3300025903 Ga0207680_10147969 Ga0207680_101479693 301
641 3300025907 Ga0207645_10017113 Ga0207645_100171132 301
642 3300025907 Ga0207645_10085833 Ga0207645_100858332 301
643 3300025923 Ga0207681_10021841 Ga0207681_100218411 301
644 3300025925 Ga0207650_10006154 Ga0207650_100061545 301
645 3300025926 Ga0207659_10010325 Ga0207659_100103254 301
646 3300025926 Ga0207659_10101309 Ga0207659_101013092 301
647 3300025926 Ga0207659_10474914 Ga0207659_104749141 301
648 3300025931 Ga0207644_10008321 Ga0207644_100083213 301
649 3300025931 Ga0207644_10021143 Ga0207644_100211433 301
650 3300025933 Ga0207706_10108327 Ga0207706_101083272 301
651 3300025933 Ga0207706_10272194 Ga0207706_102721942 301
652 3300025935 Ga0207709_10000771 Ga0207709_1000077115 301
653 3300025935 Ga0207709_10025348 Ga0207709_100253483 301
654 3300025935 Ga0207709_10029949 Ga0207709_100299493 301
655 3300025937 Ga0207669_10006269 Ga0207669_100062692 301
656 3300025937 Ga0207669_10061575 Ga0207669_100615752 301
657 3300025937 Ga0207669_10097632 Ga0207669_100976322 301
658 3300025938 Ga0207704_10018734 Ga0207704_100187342 301
659 3300025938 Ga0207704_10026431 Ga0207704_100264313 301
660 3300025938 Ga0207704_10271794 Ga0207704_102717941 301
661 3300025940 Ga0207691_10016262 Ga0207691_100162622 301
662 3300025940 Ga0207691_10089646 Ga0207691_100896462 301
663 3300025940 Ga0207691_10245462 Ga0207691_102454621 301
664 3300025941 Ga0207711_10344043 Ga0207711_103440432 301
665 3300025942 Ga0207689_10001301 Ga0207689_1000130113 301
666 3300025942 Ga0207689_10060861 Ga0207689_100608613 301
667 3300025942 Ga0207689_10231835 Ga0207689_102318352 301
668 3300025945 Ga0207679_10106195 Ga0207679_101061952 301
669 3300025949 Ga0207667_10432257 Ga0207667_104322571 301
670 3300025960 Ga0207651_10001889 Ga0207651_100018898 301
671 3300025960 Ga0207651_10078633 Ga0207651_100786332 301
672 3300025961 Ga0207712_10010255 Ga0207712_100102555 301
673 3300025972 Ga0207668_10056523 Ga0207668_100565233 301
674 3300025972 Ga0207668_10146608 Ga0207668_101466082 301
675 3300025972 Ga0207668_10273177 Ga0207668_102731772 301
676 3300025981 Ga0207640_10044846 Ga0207640_100448461 301
677 3300025986 Ga0207658_10006980 Ga0207658_100069805 301
678 3300026023 Ga0207677_10003034 Ga0207677_100030344 301
679 3300026023 Ga0207677_10173734 Ga0207677_101737342 301
680 3300026035 Ga0207703_10002822 Ga0207703_100028229 301
681 3300026041 Ga0207639_10005031 Ga0207639_100050315 301
682 3300026041 Ga0207639_10221377 Ga0207639_102213772 301
683 3300026067 Ga0207678_10100600 Ga0207678_101006002 301
684 3300026067 Ga0207678_10103375 Ga0207678_101033752 301
685 3300026075 Ga0207708_10022047 Ga0207708_100220472 301
686 3300026078 Ga0207702_10157221 Ga0207702_101572212 301
687 3300026088 Ga0207641_10036405 Ga0207641_100364052 301
688 3300026089 Ga0207648_10003420 Ga0207648_100034203 301
689 3300026089 Ga0207648_10010535 Ga0207648_100105352 301
690 3300026089 Ga0207648_10027187 Ga0207648_100271874 301
691 3300026089 Ga0207648_10049953 Ga0207648_100499533 301
692 3300026095 Ga0207676_10105918 Ga0207676_101059182 301
693 3300026095 Ga0207676_10337422 Ga0207676_103374222 301
694 3300026118 Ga0207675_100008033 Ga0207675_1000080334 301
695 3300026118 Ga0207675_100035316 Ga0207675_1000353164 301
696 3300026118 Ga0207675_100055481 Ga0207675_1000554812 301
697 3300026121 Ga0207683_10006932 Ga0207683_100069323 301
698 3300026121 Ga0207683_10030812 Ga0207683_100308125 301
699 3300026121 Ga0207683_10050620 Ga0207683_100506203 301
700 3300026121 Ga0207683_10240983 Ga0207683_102409832 301
701 3300026121 Ga0207683_10260994 Ga0207683_102609942 301
702 3300026121 Ga0207683_10318998 Ga0207683_103189981 301
703 3300026142 Ga0207698_10182443 Ga0207698_101824431 301
704 3300026142 Ga0207698_10427876 Ga0207698_104278762 301
705 3300027666 Ga0209282_1018317 Ga0209282_10183172 301
706 3300027666 Ga0209282_1087699 Ga0209282_10876991 301
707 3300028379 Ga0268266_10017786 Ga0268266_100177864 301
708 3300028379 Ga0268266_10086096 Ga0268266_100860962 301
709 3300028380 Ga0268265_10006606 Ga0268265_100066063 301
710 3300028380 Ga0268265_10029739 Ga0268265_100297394 301
711 3300028380 Ga0268265_10088981 Ga0268265_100889813 301
712 3300028381 Ga0268264_10017548 Ga0268264_100175481 301
713 3300028381 Ga0268264_10102319 Ga0268264_101023193 301
714 3300028381 Ga0268264_10186400 Ga0268264_101864002 301
715 3300028794 Ga0307515_10000058 Ga0307515_1000005899 301
716 3300028794 Ga0307515_10000302 Ga0307515_100003023 301
717 3300028794 Ga0307515_10081285 Ga0307515_100812852 301
718 3300028794 Ga0307515_10105750 Ga0307515_101057503 301
719 3300028794 Ga0307515_10118612 Ga0307515_101186123 301
720 3300028794 Ga0307515_10251002 Ga0307515_102510022 301
721 3300030731 Ga0316177_1102153 Ga0316177_11021533 301
722 3300030733 Ga0314311_1141747 Ga0314311_11417473 301
723 3300030742 Ga0316183_1033032 Ga0316183_10330322 301
724 3300031251 Ga0265327_10005641 Ga0265327_100056418 301
725 3300031456 Ga0307513_10000010 Ga0307513_100000102 301
726 3300031456 Ga0307513_10000051 Ga0307513_10000051128 301
727 3300031456 Ga0307513_10060104 Ga0307513_100601043 301
728 3300031456 Ga0307513_10103072 Ga0307513_101030722 301
729 3300031548 Ga0307408_100000193 Ga0307408_10000019333 301
730 3300031548 Ga0307408_100001412 Ga0307408_1000014128 301
731 3300031548 Ga0307408_100022612 Ga0307408_1000226123 301
732 3300031548 Ga0307408_100056105 Ga0307408_1000561052 301
733 3300031548 Ga0307408_100090913 Ga0307408_1000909133 301
734 3300031548 Ga0307408_100128014 Ga0307408_1001280142 301
735 3300031730 Ga0307516_10097543 Ga0307516_100975433 301
736 3300031731 Ga0307405_10397803 Ga0307405_103978031 301
737 3300031901 Ga0307406_10000944 Ga0307406_100009445 301
738 3300031901 Ga0307406_10002109 Ga0307406_100021092 301
739 3300031901 Ga0307406_10020580 Ga0307406_100205803 301
740 3300031911 Ga0307412_10008248 Ga0307412_100082482 301
741 3300031995 Ga0307409_100026624 Ga0307409_1000266242 301
742 3300032002 Ga0307416_100095618 Ga0307416_1000956182 301
743 3300032002 Ga0307416_100694142 Ga0307416_1006941422 301
744 3300032004 Ga0307414_10272083 Ga0307414_102720832 301
745 3300032005 Ga0307411_10135310 Ga0307411_101353102 301
746 3300032005 Ga0307411_10196374 Ga0307411_101963742 301
747 3300035410 Ga0373924_0136413 Ga0373924_0136413_50_988 301
748 3300037068 Ga0373925_0003621 Ga0373925_0003621_9387_10325 301
749 3300042115 Ga0450911_000137 Ga0450911_000137_3332_4255 301
750 3300042123 Ga0450921_000339 Ga0450921_000339_587_1510 301
751 3300042531 Ga0450918_002201 Ga0450918_002201_1879_2802 301
752 3300042876 Ga0451577_0029841 Ga0451577_0029841_1478_2401 301
753 3300042876 Ga0451577_0075805 Ga0451577_0075805_909_1832 301
754 3300042876 Ga0451577_0104665 Ga0451577_0104665_1409_2344 301
755 3300044712 Ga0453684_0004147 Ga0453684_0004147_3614_4549 301
756 3300044712 Ga0453684_0059476 Ga0453684_0059476_2868_3791 301
757 3300044712 Ga0453684_0150918 Ga0453684_0150918_1510_2445 301
758 3300045051 Ga0451576_0009619 Ga0451576_0009619_1221_2144 301
759 3300046453 Ga0495627_006938 Ga0495627_006938_1396_2319 301
760 3300046453 Ga0495627_020194 Ga0495627_020194_1279_2202 301
761 3300046475 Ga0495639_0015227 Ga0495639_0015227_1773_2696 301
762 3300046477 Ga0495664_0015726 Ga0495664_0015726_1534_2472 301
763 3300046506 Ga0495583_0063383 Ga0495583_0063383_57_980 301
764 3300046512 Ga0495610_0018922 Ga0495610_0018922_1436_2359 301
765 3300046513 Ga0495616_0006264 Ga0495616_0006264_4863_5786 301
766 3300046515 Ga0495620_0052852 Ga0495620_0052852_53_976 301
767 3300046518 Ga0495631_0001923 Ga0495631_0001923_10552_11475 301
768 3300046519 Ga0495632_0051016 Ga0495632_0051016_320_1282 301
769 3300046520 Ga0495637_0007031 Ga0495637_0007031_578_1501 301
770 3300046520 Ga0495637_0013071 Ga0495637_0013071_1901_2824 301
771 3300046530 Ga0495654_0008854 Ga0495654_0008854_1575_2498 301
772 3300046539 Ga0495621_0095725 Ga0495621_0095725_55_981 301
773 3300046558 Ga0495633_0006330 Ga0495633_0006330_3254_4177 301
774 3300046615 Ga0495656_0002566 Ga0495656_0002566_3050_3973 301
775 3300046660 Ga0495625_0000396 Ga0495625_0000396_13067_13990 301
776 3300046660 Ga0495625_0038121 Ga0495625_0038121_1392_2315 301
777 3300046660 Ga0495625_0081869 Ga0495625_0081869_291_1214 301
778 3300047445 Ga0495677_0103754 Ga0495677_0103754_130_1053 301
779 3300048904 Ga0496101_0003644 Ga0496101_0003644_8637_9560 301
780 3300048905 Ga0496102_0024833 Ga0496102_0024833_3207_4130 301
781 3300048906 Ga0496103_0208205 Ga0496103_0208205_229_1152 301
782 3300048907 Ga0496104_0021963 Ga0496104_0021963_2403_3326 301
783 3300048908 Ga0496105_0021257 Ga0496105_0021257_1291_2214 301
784 3300048908 Ga0496105_0095237 Ga0496105_0095237_996_1919 301
785 3300048910 Ga0496107_0223374 Ga0496107_0223374_415_1338 301
786 3300048912 Ga0496109_0337549 Ga0496109_0337549_344_1270 301
787 3300048913 Ga0496110_0027094 Ga0496110_0027094_2790_3713 301
788 3300048917 Ga0496114_0099241 Ga0496114_0099241_805_1728 301
789 3300048919 Ga0496116_0024283 Ga0496116_0024283_2997_3920 301
790 3300048920 Ga0496117_0034564 Ga0496117_0034564_635_1558 301
791 3300048921 Ga0496118_0023463 Ga0496118_0023463_1084_2007 301
792 3300048924 Ga0496121_0016763 Ga0496121_0016763_2916_3839 301
793 3300048924 Ga0496121_0161557 Ga0496121_0161557_555_1478 301
794 3300048925 Ga0496122_0000217 Ga0496122_0000217_83058_83981 301
795 3300048925 Ga0496122_0012827 Ga0496122_0012827_4219_5142 301
796 3300048926 Ga0496123_0000057 Ga0496123_0000057_20236_21159 301
797 3300048926 Ga0496123_0017368 Ga0496123_0017368_3784_4707 301
798 3300048926 Ga0496123_0029483 Ga0496123_0029483_610_1533 301
799 3300048927 Ga0496124_0087189 Ga0496124_0087189_41_964 301
800 3300048928 Ga0496125_0001023 Ga0496125_0001023_29112_30035 301
801 3300048928 Ga0496125_0025456 Ga0496125_0025456_2459_3382 301
802 3300048928 Ga0496125_0064894 Ga0496125_0064894_145_1068 301
803 3300048929 Ga0496126_0016753 Ga0496126_0016753_5578_6501 301
804 3300048929 Ga0496126_0162140 Ga0496126_0162140_311_1234 301
805 3300050489 nmdc:mga03683_67440_c1 nmdc:mga03683_67440_c1_513_1436 301
806 3300050491 nmdc:mga00v17_20825_c1 nmdc:mga00v17_20825_c1_41_964 301
807 3300050492 nmdc:mga0yw44_70118_c1 nmdc:mga0yw44_70118_c1_1105_2028 301
808 3300050496 nmdc:mga07m45_3635_c1 nmdc:mga07m45_3635_c1_5330_6253 301
809 3300050496 nmdc:mga07m45_686_c1 nmdc:mga07m45_686_c1_7652_8575 301
810 3300050496 nmdc:mga07m45_7718_c1 nmdc:mga07m45_7718_c1_1900_2823 301
811 3300050516 nmdc:mga0sz30_123953_c1 nmdc:mga0sz30_123953_c1_26_949 301
812 3300050516 nmdc:mga0sz30_6916_c1 nmdc:mga0sz30_6916_c1_106_1029 301
813 3300053079 Ga0500610_0000489 Ga0500610_0000489_6964_7887 301
814 3300053093 Ga0500651_0045805 Ga0500651_0045805_1769_2692 301
815 3300053098 Ga0500650_0046871 Ga0500650_0046871_863_1795 301
816 3300053110 Ga0500571_010381 Ga0500571_010381_2934_3857 301
817 3300053117 Ga0500593_005223 Ga0500593_005223_2979_3902 301
818 3300053118 Ga0500594_0003123 Ga0500594_0003123_2653_3576 301
819 3300053121 Ga0500607_007771 Ga0500607_007771_1333_2256 301
820 3300053122 Ga0500608_035205 Ga0500608_035205_866_1789 301
821 3300053133 Ga0500655_006844 Ga0500655_006844_1091_2014 301
822 3300053134 Ga0500658_0001265 Ga0500658_0001265_5220_6143 301
823 3300053134 Ga0500658_0002137 Ga0500658_0002137_3831_4754 301
824 3300053136 Ga0500559_0005433 Ga0500559_0005433_26_949 301
825 3300053139 Ga0500568_0001949 Ga0500568_0001949_1239_2162 301
826 3300053158 Ga0500627_0022906 Ga0500627_0022906_1066_1989 301
827 3300053161 Ga0500634_0065523 Ga0500634_0065523_168_1091 301
828 3300053730 Ga0500645_000493 Ga0500645_000493_24740_25681 301
829 3300053730 Ga0500645_011097 Ga0500645_011097_978_1910 301
830 3300002076 JGI24749J21850_1004017 JGI24749J21850_10040172 302
831 3300003215 JGI25153J46596_10001768 JGI25153J46596_100017683 302
832 3300005293 Ga0065715_10129220 Ga0065715_101292202 302
833 3300005328 Ga0070676_10014907 Ga0070676_100149074 302
834 3300005329 Ga0070683_100023735 Ga0070683_1000237352 302
835 3300005330 Ga0070690_100056744 Ga0070690_1000567442 302
836 3300005330 Ga0070690_100110902 Ga0070690_1001109022 302
837 3300005331 Ga0070670_100001483 Ga0070670_1000014833 302
838 3300005331 Ga0070670_100002742 Ga0070670_1000027429 302
839 3300005331 Ga0070670_100007028 Ga0070670_1000070282 302
840 3300005331 Ga0070670_100008068 Ga0070670_1000080685 302
841 3300005331 Ga0070670_100066159 Ga0070670_1000661592 302
842 3300005333 Ga0070677_10083395 Ga0070677_100833952 302
843 3300005334 Ga0068869_100000178 Ga0068869_10000017829 302
844 3300005334 Ga0068869_100009675 Ga0068869_1000096752 302
845 3300005334 Ga0068869_100091902 Ga0068869_1000919022 302
846 3300005335 Ga0070666_10025971 Ga0070666_100259713 302
847 3300005335 Ga0070666_10088379 Ga0070666_100883792 302
848 3300005335 Ga0070666_10276568 Ga0070666_102765681 302
849 3300005338 Ga0068868_100092542 Ga0068868_1000925422 302
850 3300005343 Ga0070687_100006353 Ga0070687_1000063531 302
851 3300005344 Ga0070661_100014055 Ga0070661_1000140553 302
852 3300005344 Ga0070661_100431373 Ga0070661_1004313731 302
853 3300005345 Ga0070692_10049561 Ga0070692_100495612 302
854 3300005347 Ga0070668_100004619 Ga0070668_1000046199 302
855 3300005347 Ga0070668_100034232 Ga0070668_1000342324 302
856 3300005347 Ga0070668_100103436 Ga0070668_1001034362 302
857 3300005347 Ga0070668_100177094 Ga0070668_1001770942 302
858 3300005353 Ga0070669_100008927 Ga0070669_1000089272 302
859 3300005353 Ga0070669_100015579 Ga0070669_1000155791 302
860 3300005353 Ga0070669_100178562 Ga0070669_1001785622 302
861 3300005354 Ga0070675_100020917 Ga0070675_1000209174 302
862 3300005355 Ga0070671_100025674 Ga0070671_1000256741 302
863 3300005355 Ga0070671_100063486 Ga0070671_1000634862 302
864 3300005355 Ga0070671_100269750 Ga0070671_1002697502 302
865 3300005356 Ga0070674_100024203 Ga0070674_1000242032 302
866 3300005364 Ga0070673_100009444 Ga0070673_1000094444 302
867 3300005365 Ga0070688_100009048 Ga0070688_1000090483 302
868 3300005367 Ga0070667_100001198 Ga0070667_10000119823 302
869 3300005367 Ga0070667_100023441 Ga0070667_1000234415 302
870 3300005441 Ga0070700_100103998 Ga0070700_1001039982 302
871 3300005455 Ga0070663_100027541 Ga0070663_1000275413 302
872 3300005456 Ga0070678_100016709 Ga0070678_1000167093 302
873 3300005456 Ga0070678_100061942 Ga0070678_1000619423 302
874 3300005457 Ga0070662_100013360 Ga0070662_1000133603 302
875 3300005457 Ga0070662_100116545 Ga0070662_1001165452 302
876 3300005459 Ga0068867_100000273 Ga0068867_10000027342 302
877 3300005459 Ga0068867_100061662 Ga0068867_1000616622 302
878 3300005459 Ga0068867_100261268 Ga0068867_1002612682 302
879 3300005466 Ga0070685_10078150 Ga0070685_100781502 302
880 3300005543 Ga0070672_100004667 Ga0070672_1000046675 302
881 3300005543 Ga0070672_100047555 Ga0070672_1000475553 302
882 3300005544 Ga0070686_100051186 Ga0070686_1000511862 302
883 3300005548 Ga0070665_100035254 Ga0070665_1000352543 302
884 3300005549 Ga0070704_100186982 Ga0070704_1001869822 302
885 3300005563 Ga0068855_100051726 Ga0068855_1000517263 302
886 3300005564 Ga0070664_100005648 Ga0070664_1000056486 302
887 3300005564 Ga0070664_100013082 Ga0070664_1000130822 302
888 3300005564 Ga0070664_100106699 Ga0070664_1001066992 302
889 3300005564 Ga0070664_100176528 Ga0070664_1001765281 302
890 3300005577 Ga0068857_100001689 Ga0068857_10000168911 302
891 3300005577 Ga0068857_100074298 Ga0068857_1000742981 302
892 3300005577 Ga0068857_100202659 Ga0068857_1002026592 302
893 3300005578 Ga0068854_100013238 Ga0068854_1000132385 302
894 3300005578 Ga0068854_100023805 Ga0068854_1000238052 302
895 3300005578 Ga0068854_100541336 Ga0068854_1005413361 302
896 3300005614 Ga0068856_100409959 Ga0068856_1004099592 302
897 3300005616 Ga0068852_100201849 Ga0068852_1002018492 302
898 3300005616 Ga0068852_100229881 Ga0068852_1002298812 302
899 3300005616 Ga0068852_100255704 Ga0068852_1002557042 302
900 3300005616 Ga0068852_100657862 Ga0068852_1006578622 302
901 3300005617 Ga0068859_100007644 Ga0068859_1000076442 302
902 3300005617 Ga0068859_100137430 Ga0068859_1001374302 302
903 3300005617 Ga0068859_100579609 Ga0068859_1005796092 302
904 3300005618 Ga0068864_100000199 Ga0068864_1000001993 302
905 3300005618 Ga0068864_100002200 Ga0068864_1000022007 302
906 3300005618 Ga0068864_100031330 Ga0068864_1000313302 302
907 3300005618 Ga0068864_100032954 Ga0068864_1000329542 302
908 3300005618 Ga0068864_100159549 Ga0068864_1001595492 302
909 3300005618 Ga0068864_100189564 Ga0068864_1001895642 302
910 3300005618 Ga0068864_100228543 Ga0068864_1002285432 302
911 3300005718 Ga0068866_10037416 Ga0068866_100374162 302
912 3300005719 Ga0068861_100001618 Ga0068861_10000161814 302
913 3300005719 Ga0068861_100047800 Ga0068861_1000478002 302
914 3300005834 Ga0068851_10001589 Ga0068851_100015895 302
915 3300005834 Ga0068851_10091791 Ga0068851_100917912 302
916 3300005840 Ga0068870_10160924 Ga0068870_101609242 302
917 3300005841 Ga0068863_100001289 Ga0068863_10000128926 302
918 3300005841 Ga0068863_100002680 Ga0068863_1000026808 302
919 3300005841 Ga0068863_100101116 Ga0068863_1001011162 302
920 3300005841 Ga0068863_100117284 Ga0068863_1001172842 302
921 3300005841 Ga0068863_100196470 Ga0068863_1001964702 302
922 3300005842 Ga0068858_100000413 Ga0068858_1000004135 302
923 3300005842 Ga0068858_100018789 Ga0068858_1000187892 302
924 3300005842 Ga0068858_100041553 Ga0068858_1000415532 302
925 3300005842 Ga0068858_100253568 Ga0068858_1002535682 302
926 3300005843 Ga0068860_100011743 Ga0068860_1000117437 302
927 3300005843 Ga0068860_100096647 Ga0068860_1000966472 302
928 3300005843 Ga0068860_100150843 Ga0068860_1001508432 302
929 3300005844 Ga0068862_100004502 Ga0068862_10000450210 302
930 3300005844 Ga0068862_100011044 Ga0068862_1000110447 302
931 3300005844 Ga0068862_100098560 Ga0068862_1000985603 302
932 3300005844 Ga0068862_100404321 Ga0068862_1004043212 302
933 3300006195 Ga0075366_10010337 Ga0075366_100103373 302
934 3300006195 Ga0075366_10015004 Ga0075366_100150043 302
935 3300006237 Ga0097621_100034225 Ga0097621_1000342253 302
936 3300006237 Ga0097621_100051615 Ga0097621_1000516154 302
937 3300006237 Ga0097621_100318597 Ga0097621_1003185972 302
938 3300006358 Ga0068871_100011783 Ga0068871_1000117833 302
939 3300006358 Ga0068871_100102571 Ga0068871_1001025712 302
940 3300006358 Ga0068871_100215272 Ga0068871_1002152722 302
941 3300006844 Ga0075428_100116379 Ga0075428_1001163793 302
942 3300006881 Ga0068865_100028724 Ga0068865_1000287243 302
943 3300006931 Ga0097620_100007644 Ga0097620_1000076442 302
944 3300006931 Ga0097620_100137423 Ga0097620_1001374232 302
945 3300006931 Ga0097620_100579591 Ga0097620_1005795912 302
946 3300009094 Ga0111539_10207790 Ga0111539_102077902 302
947 3300009148 Ga0105243_10147041 Ga0105243_101470412 302
948 3300009176 Ga0105242_10026470 Ga0105242_100264703 302
949 3300009177 Ga0105248_10003661 Ga0105248_100036611 302
950 3300009177 Ga0105248_10006013 Ga0105248_100060134 302
951 3300009177 Ga0105248_10074417 Ga0105248_100744173 302
952 3300009545 Ga0105237_10106835 Ga0105237_101068353 302
953 3300009553 Ga0105249_10029237 Ga0105249_100292374 302
954 3300009553 Ga0105249_10099373 Ga0105249_100993732 302
955 3300011119 Ga0105246_10107068 Ga0105246_101070681 302
956 3300013105 Ga0157369_10181105 Ga0157369_101811052 302
957 3300013296 Ga0157374_10010969 Ga0157374_100109692 302
958 3300013296 Ga0157374_10497260 Ga0157374_104972602 302
959 3300013307 Ga0157372_10204874 Ga0157372_102048742 302
960 3300013308 Ga0157375_10094008 Ga0157375_100940083 302
961 3300013308 Ga0157375_10234111 Ga0157375_102341112 302
962 3300014325 Ga0163163_10001130 Ga0163163_1000113018 302
963 3300014325 Ga0163163_10009364 Ga0163163_100093645 302
964 3300014325 Ga0163163_10073498 Ga0163163_100734982 302
965 3300014326 Ga0157380_10034112 Ga0157380_100341122 302
966 3300014326 Ga0157380_10134768 Ga0157380_101347682 302
967 3300014745 Ga0157377_10013130 Ga0157377_100131303 302
968 3300014968 Ga0157379_10010513 Ga0157379_100105135 302
969 3300014968 Ga0157379_10025218 Ga0157379_100252183 302
970 3300014968 Ga0157379_10045346 Ga0157379_100453463 302
971 3300014968 Ga0157379_10094540 Ga0157379_100945403 302
972 3300014968 Ga0157379_10246802 Ga0157379_102468022 302
973 3300014969 Ga0157376_10200191 Ga0157376_102001912 302
974 3300025297 Ga0209758_1000249 Ga0209758_100024957 302
975 3300025315 Ga0207697_10000857 Ga0207697_1000085715 302
976 3300025321 Ga0207656_10007788 Ga0207656_100077882 302
977 3300025893 Ga0207682_10000120 Ga0207682_100001205 302
978 3300025893 Ga0207682_10065244 Ga0207682_100652442 302
979 3300025899 Ga0207642_10068697 Ga0207642_100686972 302
980 3300025904 Ga0207647_10059083 Ga0207647_100590833 302
981 3300025907 Ga0207645_10001475 Ga0207645_1000147514 302
982 3300025908 Ga0207643_10000681 Ga0207643_1000068113 302
983 3300025908 Ga0207643_10026471 Ga0207643_100264713 302
984 3300025908 Ga0207643_10107981 Ga0207643_101079812 302
985 3300025918 Ga0207662_10004254 Ga0207662_100042546 302
986 3300025919 Ga0207657_10000822 Ga0207657_1000082223 302
987 3300025923 Ga0207681_10016998 Ga0207681_100169982 302
988 3300025925 Ga0207650_10040265 Ga0207650_100402652 302
989 3300025925 Ga0207650_10043242 Ga0207650_100432423 302
990 3300025925 Ga0207650_10174301 Ga0207650_101743012 302
991 3300025926 Ga0207659_10024313 Ga0207659_100243132 302
992 3300025933 Ga0207706_10000850 Ga0207706_1000085011 302
993 3300025933 Ga0207706_10134632 Ga0207706_101346322 302
994 3300025936 Ga0207670_10400184 Ga0207670_104001841 302
995 3300025940 Ga0207691_10000773 Ga0207691_1000077314 302
996 3300025940 Ga0207691_10001626 Ga0207691_1000162621 302
997 3300025940 Ga0207691_10004125 Ga0207691_100041254 302
998 3300025940 Ga0207691_10041027 Ga0207691_100410271 302
999 3300025941 Ga0207711_10023053 Ga0207711_100230533 302
1000 3300025941 Ga0207711_10124729 Ga0207711_101247291 302
1001 3300025941 Ga0207711_10155887 Ga0207711_101558872 302
1002 3300025942 Ga0207689_10000049 Ga0207689_100000495 302
1003 3300025942 Ga0207689_10000307 Ga0207689_1000030729 302
1004 3300025942 Ga0207689_10008205 Ga0207689_100082058 302
1005 3300025942 Ga0207689_10165152 Ga0207689_101651522 302
1006 3300025945 Ga0207679_10008364 Ga0207679_100083645 302
1007 3300025945 Ga0207679_10062155 Ga0207679_100621553 302
1008 3300025949 Ga0207667_10032111 Ga0207667_100321113 302
1009 3300025960 Ga0207651_10022461 Ga0207651_100224612 302
1010 3300025960 Ga0207651_10120546 Ga0207651_101205462 302
1011 3300025961 Ga0207712_10064721 Ga0207712_100647212 302
1012 3300025961 Ga0207712_10094687 Ga0207712_100946872 302
1013 3300025972 Ga0207668_10008031 Ga0207668_100080315 302
1014 3300025972 Ga0207668_10029069 Ga0207668_100290692 302
1015 3300025981 Ga0207640_10062911 Ga0207640_100629113 302
1016 3300025986 Ga0207658_10003343 Ga0207658_100033434 302
1017 3300025986 Ga0207658_10040679 Ga0207658_100406792 302
1018 3300026023 Ga0207677_10076559 Ga0207677_100765592 302
1019 3300026035 Ga0207703_10003906 Ga0207703_100039066 302
1020 3300026035 Ga0207703_10037171 Ga0207703_100371713 302
1021 3300026035 Ga0207703_10274231 Ga0207703_102742312 302
1022 3300026067 Ga0207678_10299085 Ga0207678_102990851 302
1023 3300026075 Ga0207708_10000529 Ga0207708_100005295 302
1024 3300026075 Ga0207708_10008749 Ga0207708_100087496 302
1025 3300026075 Ga0207708_10274462 Ga0207708_102744621 302
1026 3300026078 Ga0207702_10205785 Ga0207702_102057852 302
1027 3300026088 Ga0207641_10008475 Ga0207641_100084754 302
1028 3300026088 Ga0207641_10017295 Ga0207641_100172955 302
1029 3300026088 Ga0207641_10065664 Ga0207641_100656643 302
1030 3300026088 Ga0207641_10141285 Ga0207641_101412852 302
1031 3300026088 Ga0207641_10207970 Ga0207641_102079702 302
1032 3300026089 Ga0207648_10002306 Ga0207648_100023061 302
1033 3300026089 Ga0207648_10006661 Ga0207648_1000666112 302
1034 3300026089 Ga0207648_10080063 Ga0207648_100800632 302
1035 3300026095 Ga0207676_10004825 Ga0207676_1000482510 302
1036 3300026095 Ga0207676_10027811 Ga0207676_100278113 302
1037 3300026095 Ga0207676_10064917 Ga0207676_100649172 302
1038 3300026095 Ga0207676_10197159 Ga0207676_101971592 302
1039 3300026116 Ga0207674_10003249 Ga0207674_1000324913 302
1040 3300026116 Ga0207674_10003275 Ga0207674_100032755 302
1041 3300026118 Ga0207675_100003946 Ga0207675_1000039461 302
1042 3300026118 Ga0207675_100032927 Ga0207675_1000329273 302
1043 3300026118 Ga0207675_100035639 Ga0207675_1000356392 302
1044 3300026121 Ga0207683_10010884 Ga0207683_100108845 302
1045 3300026142 Ga0207698_10034135 Ga0207698_100341351 302
1046 3300026142 Ga0207698_10624105 Ga0207698_106241051 302
1047 3300027543 Ga0209999_1015003 Ga0209999_10150031 302
1048 3300027665 Ga0209983_1028576 Ga0209983_10285762 302
1049 3300027682 Ga0209971_1015433 Ga0209971_10154332 302
1050 3300028379 Ga0268266_10039667 Ga0268266_100396672 302
1051 3300028380 Ga0268265_10164888 Ga0268265_101648882 302
1052 3300028381 Ga0268264_10000624 Ga0268264_100006245 302
1053 3300028381 Ga0268264_10180804 Ga0268264_101808042 302
1054 3300031507 Ga0307509_10071187 Ga0307509_100711874 302
1055 3300031548 Ga0307408_100007530 Ga0307408_1000075302 302
1056 3300031852 Ga0307410_10001817 Ga0307410_100018173 302
1057 3300031901 Ga0307406_10107886 Ga0307406_101078862 302
1058 3300031903 Ga0307407_10087522 Ga0307407_100875222 302
1059 3300031911 Ga0307412_10059041 Ga0307412_100590413 302
1060 3300032002 Ga0307416_100523136 Ga0307416_1005231362 302
1061 3300032004 Ga0307414_10061593 Ga0307414_100615932 302
1062 3300032005 Ga0307411_10128359 Ga0307411_101283592 302
1063 3300035117 Ga0373953_0045721 Ga0373953_0045721_340_1266 302
1064 3300035172 Ga0373955_0079570 Ga0373955_0079570_636_1562 302
1065 3300035691 Ga0373931_0052842 Ga0373931_0052842_156_1082 302
1066 3300036401 Ga0373937_0246317 Ga0373937_0246317_260_1186 302
1067 3300042876 Ga0451577_0131994 Ga0451577_0131994_224_1150 302
1068 3300048906 Ga0496103_0023992 Ga0496103_0023992_2241_3167 302
1069 3300048908 Ga0496105_0173682 Ga0496105_0173682_770_1696 302
1070 3300048909 Ga0496106_0036400 Ga0496106_0036400_664_1590 302
1071 3300048911 Ga0496108_0020007 Ga0496108_0020007_1007_1933 302
1072 3300048912 Ga0496109_0005385 Ga0496109_0005385_8580_9506 302
1073 3300048913 Ga0496110_0042796 Ga0496110_0042796_2022_2948 302
1074 3300048915 Ga0496112_0541449 Ga0496112_0541449_106_1032 302
1075 3300048917 Ga0496114_0047087 Ga0496114_0047087_1866_2792 302
1076 3300050493 nmdc:mga0k408_132207_c1 nmdc:mga0k408_132207_c1_377_1318 302
1077 3300005331 Ga0070670_100113866 Ga0070670_1001138662 303
1078 3300005333 Ga0070677_10022565 Ga0070677_100225652 303
1079 3300005353 Ga0070669_100098538 Ga0070669_1000985382 303
1080 3300005354 Ga0070675_100033094 Ga0070675_1000330943 303
1081 3300005367 Ga0070667_100255016 Ga0070667_1002550161 303
1082 3300005459 Ga0068867_100031942 Ga0068867_1000319421 303
1083 3300009148 Ga0105243_10145806 Ga0105243_101458062 303
1084 3300013308 Ga0157375_10492337 Ga0157375_104923371 303
1085 3300025935 Ga0207709_10117902 Ga0207709_101179022 303
1086 3300025938 Ga0207704_10091255 Ga0207704_100912552 303
1087 3300026089 Ga0207648_10021312 Ga0207648_100213122 303
1088 3300028380 Ga0268265_10191253 Ga0268265_101912532 303
1089 3300028380 Ga0268265_10294024 Ga0268265_102940242 303
1090 3300041404 Ga0439436_0001073 Ga0439436_0001073_3126_4055 303
1091 3300042002 Ga0439442_020080 Ga0439442_020080_313_1242 303
1092 3300042006 Ga0439432_001458 Ga0439432_001458_594_1523 303
1093 3300042007 Ga0439449_0000923 Ga0439449_0000923_6889_7818 303
1094 3300042010 Ga0439452_005984 Ga0439452_005984_1796_2725 303
1095 3300042014 Ga0439457_002549 Ga0439457_002549_3939_4868 303
1096 3300042015 Ga0439462_0015908 Ga0439462_0015908_142_1071 303
1097 3300042435 Ga0439434_0002704 Ga0439434_0002704_308_1237 303
1098 2162886007 SwRhRL2b_contig_2666113 SwRhRL2b_0744.00005670 304
1099 3300005356 Ga0070674_100047128 Ga0070674_1000471282 304
1100 3300005456 Ga0070678_100004479 Ga0070678_1000044797 304
1101 3300005543 Ga0070672_100027843 Ga0070672_1000278432 304
1102 3300005548 Ga0070665_100001639 Ga0070665_1000016398 304
1103 3300006237 Ga0097621_100130979 Ga0097621_1001309792 304
1104 3300009177 Ga0105248_10152277 Ga0105248_101522772 304
1105 3300013308 Ga0157375_10050218 Ga0157375_100502183 304
1106 3300013308 Ga0157375_10250551 Ga0157375_102505512 304
1107 3300014969 Ga0157376_10008722 Ga0157376_100087222 304
1108 3300025940 Ga0207691_10024119 Ga0207691_100241193 304
1109 3300025940 Ga0207691_10287616 Ga0207691_102876162 304
1110 3300025941 Ga0207711_10156409 Ga0207711_101564092 304
1111 3300026023 Ga0207677_10008690 Ga0207677_100086903 304
1112 3300026121 Ga0207683_10008101 Ga0207683_100081012 304
1113 3300028379 Ga0268266_10044855 Ga0268266_100448553 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

38

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5735 16 289
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5734 16 289
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5646 16 288
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5557 14 259
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5444 13 285
ID Description Score Start End Superfamily
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8124 20 281 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7954 20 281 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7868 18 281 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7848 18 281 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7796 16 281 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4Q3LI64-F1-model_v4 ABC transporter permease 0.9667 34 304 GO:0005886
GO:0022857
AF-A0A4Q5VQG5-F1-model_v4 deleted 0.9623 5 230
AF-A0A2S9QFS9-F1-model_v4 ABC transporter permease 0.9546 8 304 GO:0005886
GO:0022857
AF-A0A7C6ZI90-F1-model_v4 ABC transporter permease 0.9448 14 301 GO:0005886
GO:0022857
AF-A0A081C4P7-F1-model_v4 Inner-membrane translocator 0.9422 14 301 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.96 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map