F490255

General Info

Members Datasets Scaffolds Average Seq Length
1112 377 2224 151

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10004499|Ga0157369_1000449916
Length 175
Sequence MRISVRVNGEEHQADCWEGESLLFALREKLGFPGSKNACEQGECGSCSVLLDGTLVCSCLVLAAQADGHEVTTVEGLAQGDHLHAVQQAFVDAGAVQCGFCTPGLVVATVDLLKRNASPTDDEIREALSGNLCRCTGYAKIFDAVRLAAAGVGWTEPAESGAAGFAGGESGASAL

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.88
Rhizosphere 88.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10004499 3300013105 Bacteria 16424
2 JGI25407J50210_10007085 3300003373 Bacteria 2806
3 Ga0070658_10092060 3300005327 Bacteria 2499
4 Ga0070658_10118883 3300005327 Bacteria 2195
5 Ga0070658_10124746 3300005327 Bacteria 2142
6 Ga0070658_10482896 3300005327 Bacteria 1069
7 Ga0070683_100050130 3300005329 Bacteria 3863
8 Ga0070683_100272919 3300005329 Bacteria 1609
9 Ga0070683_100495927 3300005329 Bacteria 1166
10 Ga0070683_101564350 3300005329 Bacteria 634
11 Ga0070690_100859593 3300005330 Bacteria 707
12 Ga0070680_100053848 3300005336 Bacteria 3284
13 Ga0070680_100101092 3300005336 Bacteria 2393
14 Ga0070680_100108456 3300005336 Bacteria 2310
15 Ga0070680_100508824 3300005336 Bacteria 1031
16 Ga0070682_100152865 3300005337 Bacteria 1586
17 Ga0068868_100036832 3300005338 Bacteria 3789
18 Ga0070660_100110092 3300005339 Bacteria 2190
19 Ga0070660_100165585 3300005339 Bacteria 1784
20 Ga0070660_100330820 3300005339 Bacteria 1253
21 Ga0070660_100599982 3300005339 Bacteria 920
22 Ga0070660_100745219 3300005339 Bacteria 822
23 Ga0070689_100136273 3300005340 Bacteria 1971
24 Ga0070691_10078192 3300005341 Bacteria 1616
25 Ga0070691_10528816 3300005341 Bacteria 686
26 Ga0070687_100057362 3300005343 Bacteria 2042
27 Ga0070687_100245886 3300005343 Bacteria 1109
28 Ga0070661_100033510 3300005344 Bacteria 3720
29 Ga0070661_100061585 3300005344 Bacteria 2755
30 Ga0070692_10015268 3300005345 Bacteria 3630
31 Ga0070692_10099802 3300005345 Bacteria 1590
32 Ga0070668_100091137 3300005347 Bacteria 2403
33 Ga0070675_100071216 3300005354 Bacteria 2883
34 Ga0070675_101283618 3300005354 Bacteria 674
35 Ga0070671_100242954 3300005355 Bacteria 1529
36 Ga0070671_100748029 3300005355 Bacteria 850
37 Ga0070674_100001639 3300005356 Bacteria 12060
38 Ga0070688_100012006 3300005365 Bacteria 4839
39 Ga0070659_100219681 3300005366 Bacteria 1568
40 Ga0070659_100241014 3300005366 Bacteria 1496
41 Ga0070659_100475469 3300005366 Bacteria 1063
42 Ga0070659_100962857 3300005366 Bacteria 748
43 Ga0070659_101325316 3300005366 Bacteria 639
44 Ga0070709_10024012 3300005434 Bacteria 3586
45 Ga0070714_100053368 3300005435 Bacteria 3450
46 Ga0070714_100092282 3300005435 Bacteria 2654
47 Ga0070714_100361204 3300005435 Bacteria 1365
48 Ga0070714_100429276 3300005435 Bacteria 1253
49 Ga0070714_100453245 3300005435 Bacteria 1219
50 Ga0070714_100691547 3300005435 Bacteria 984
51 Ga0070714_100794008 3300005435 Bacteria 916
52 Ga0070714_101747024 3300005435 Bacteria 607
53 Ga0070713_100088433 3300005436 Bacteria 2659
54 Ga0070713_100094513 3300005436 Bacteria 2577
55 Ga0070713_100505707 3300005436 Bacteria 1140
56 Ga0070713_100938597 3300005436 Bacteria 833
57 Ga0070713_101237419 3300005436 Bacteria 723
58 Ga0070710_10005124 3300005437 Bacteria 6200
59 Ga0070710_10025539 3300005437 Bacteria 3129
60 Ga0070711_100896904 3300005439 Bacteria 756
61 Ga0070705_100072942 3300005440 Bacteria 2081
62 Ga0070705_100117914 3300005440 Bacteria 1708
63 Ga0070705_100347908 3300005440 Bacteria 1080
64 Ga0070705_100894461 3300005440 Bacteria 714
65 Ga0070705_101101782 3300005440 Bacteria 650
66 Ga0070705_101107289 3300005440 Bacteria 648
67 Ga0070700_100063569 3300005441 Bacteria 2335
68 Ga0070694_100156515 3300005444 Bacteria 1669
69 Ga0070694_100443972 3300005444 Bacteria 1023
70 Ga0070708_100132367 3300005445 Bacteria 2309
71 Ga0070708_100179564 3300005445 Bacteria 1978
72 Ga0070708_100675518 3300005445 Bacteria 973
73 Ga0070663_100670482 3300005455 Bacteria 879
74 Ga0070663_100854919 3300005455 Bacteria 783
75 Ga0070663_101685491 3300005455 Bacteria 566
76 Ga0070678_100020686 3300005456 Bacteria 4322
77 Ga0070678_100118341 3300005456 Bacteria 2085
78 Ga0070678_100513407 3300005456 Bacteria 1059
79 Ga0070681_10001129 3300005458 Bacteria 22933
80 Ga0070681_10109636 3300005458 Bacteria 2700
81 Ga0070681_10140248 3300005458 Bacteria 2347
82 Ga0070681_10152188 3300005458 Bacteria 2240
83 Ga0070681_10598725 3300005458 Bacteria 1017
84 Ga0070681_10741668 3300005458 Bacteria 899
85 Ga0070681_10778623 3300005458 Bacteria 873
86 Ga0068867_100030890 3300005459 Bacteria 3865
87 Ga0068867_100244804 3300005459 Bacteria 1456
88 Ga0070685_10223648 3300005466 Bacteria 1234
89 Ga0070685_10551013 3300005466 Bacteria 823
90 Ga0070706_100049868 3300005467 Bacteria 3862
91 Ga0070706_100258145 3300005467 Bacteria 1627
92 Ga0070706_100405326 3300005467 Bacteria 1269
93 Ga0070706_100864650 3300005467 Bacteria 836
94 Ga0070707_100190723 3300005468 Bacteria 1998
95 Ga0070707_100754205 3300005468 Bacteria 937
96 Ga0070707_101046201 3300005468 Bacteria 782
97 Ga0070707_101548580 3300005468 Bacteria 630
98 Ga0070698_100073605 3300005471 Bacteria 3422
99 Ga0070698_100128875 3300005471 Bacteria 2486
100 Ga0070699_100158173 3300005518 Bacteria 2005
101 Ga0070699_100622265 3300005518 Bacteria 985
102 Ga0070699_100880570 3300005518 Bacteria 820
103 Ga0070679_100160109 3300005530 Bacteria 2225
104 Ga0070679_100199276 3300005530 Bacteria 1969
105 Ga0070679_100305321 3300005530 Bacteria 1542
106 Ga0070679_100792900 3300005530 Bacteria 890
107 Ga0070684_100057188 3300005535 Bacteria 3405
108 Ga0070684_100057250 3300005535 Bacteria 3403
109 Ga0070684_100089966 3300005535 Bacteria 2728
110 Ga0070684_100293223 3300005535 Bacteria 1492
111 Ga0070684_100317442 3300005535 Bacteria 1431
112 Ga0070684_100444650 3300005535 Bacteria 1198
113 Ga0070684_100801332 3300005535 Bacteria 881
114 Ga0070697_100102146 3300005536 Bacteria 2382
115 Ga0070697_100109749 3300005536 Bacteria 2298
116 Ga0070697_100385011 3300005536 Bacteria 1215
117 Ga0070697_100829415 3300005536 Bacteria 819
118 Ga0070697_101074971 3300005536 Bacteria 716
119 Ga0068853_100306811 3300005539 Bacteria 1468
120 Ga0070672_101034147 3300005543 Bacteria 729
121 Ga0070686_100032900 3300005544 Bacteria 3182
122 Ga0070695_100089217 3300005545 Bacteria 2055
123 Ga0070695_100159593 3300005545 Bacteria 1581
124 Ga0070695_100192979 3300005545 Bacteria 1451
125 Ga0070696_100048066 3300005546 Bacteria 2961
126 Ga0070696_100056669 3300005546 Bacteria 2733
127 Ga0070696_100581900 3300005546 Bacteria 901
128 Ga0070693_100604571 3300005547 Bacteria 792
129 Ga0070693_100845452 3300005547 Bacteria 682
130 Ga0070665_100053631 3300005548 Bacteria 4044
131 Ga0070665_100870746 3300005548 Bacteria 914
132 Ga0070665_100986248 3300005548 Bacteria 855
133 Ga0070704_100002938 3300005549 Bacteria 9686
134 Ga0068855_100072684 3300005563 Bacteria 3997
135 Ga0068855_100108078 3300005563 Bacteria 3195
136 Ga0068855_100233752 3300005563 Bacteria 2057
137 Ga0068855_100302014 3300005563 Bacteria 1773
138 Ga0068855_100351765 3300005563 Bacteria 1623
139 Ga0068855_100425009 3300005563 Bacteria 1453
140 Ga0070664_100165065 3300005564 Bacteria 1962
141 Ga0070664_100716366 3300005564 Bacteria 933
142 Ga0068857_100019391 3300005577 Bacteria 5971
143 Ga0068857_100033041 3300005577 Bacteria 4574
144 Ga0068857_100059894 3300005577 Bacteria 3383
145 Ga0068857_100300411 3300005577 Bacteria 1480
146 Ga0068854_100658541 3300005578 Bacteria 900
147 Ga0068856_100062119 3300005614 Bacteria 3690
148 Ga0068856_100134039 3300005614 Bacteria 2482
149 Ga0068856_100512191 3300005614 Bacteria 1221
150 Ga0070702_100069911 3300005615 Bacteria 2070
151 Ga0070702_100170582 3300005615 Bacteria 1415
152 Ga0070702_100747294 3300005615 Bacteria 751
153 Ga0068852_100018025 3300005616 Bacteria 5553
154 Ga0068852_100045532 3300005616 Bacteria 3732
155 Ga0068852_100294898 3300005616 Bacteria 1568
156 Ga0068859_100331513 3300005617 Bacteria 1616
157 Ga0068859_101247572 3300005617 Bacteria 819
158 Ga0068864_100129295 3300005618 Bacteria 2267
159 Ga0068864_100669633 3300005618 Bacteria 1012
160 Ga0068866_10045370 3300005718 Bacteria 2204
161 Ga0068866_10104869 3300005718 Bacteria 1566
162 Ga0068861_100222240 3300005719 Bacteria 1597
163 Ga0068861_100572329 3300005719 Bacteria 1033
164 Ga0068858_100832431 3300005842 Bacteria 901
165 Ga0068862_100986186 3300005844 Bacteria 833
166 Ga0068862_101099680 3300005844 Bacteria 790
167 Ga0081455_10010251 3300005937 Bacteria 9529
168 Ga0081455_10011450 3300005937 Bacteria 8912
169 Ga0081455_10012609 3300005937 Bacteria 8423
170 Ga0081455_10243025 3300005937 Bacteria 1321
171 Ga0081455_10363616 3300005937 Bacteria 1016
172 Ga0081455_10564750 3300005937 Bacteria 749
173 Ga0081538_10000518 3300005981 Bacteria 43151
174 Ga0081538_10051296 3300005981 Bacteria 2479
175 Ga0081538_10173146 3300005981 Bacteria 938
176 Ga0081538_10174882 3300005981 Bacteria 929
177 Ga0081539_10018622 3300005985 Bacteria 4807
178 Ga0070717_10014276 3300006028 Bacteria 6109
179 Ga0070717_10521603 3300006028 Bacteria 1075
180 Ga0070715_10011644 3300006163 Bacteria 3173
181 Ga0070715_10510508 3300006163 Bacteria 690
182 Ga0070715_10692049 3300006163 Bacteria 608
183 Ga0070712_100030457 3300006175 Bacteria 3626
184 Ga0070712_100110168 3300006175 Bacteria 2053
185 Ga0070712_100177212 3300006175 Bacteria 1658
186 Ga0070712_100211056 3300006175 Bacteria 1531
187 Ga0070712_101030674 3300006175 Bacteria 713
188 Ga0097621_100870685 3300006237 Bacteria 838
189 Ga0068871_100026449 3300006358 Bacteria 4527
190 Ga0075433_10004384 3300006852 Bacteria 10975
191 Ga0075433_10024478 3300006852 Bacteria 5096
192 Ga0075433_10456585 3300006852 Bacteria 1126
193 Ga0075433_11051538 3300006852 Bacteria 708
194 Ga0075434_100005135 3300006871 Bacteria 11890
195 Ga0075434_100023021 3300006871 Bacteria 6065
196 Ga0075434_100529470 3300006871 Bacteria 1199
197 Ga0075434_101554258 3300006871 Bacteria 670
198 Ga0075434_101591479 3300006871 Bacteria 662
199 Ga0075429_100742484 3300006880 Bacteria 860
200 Ga0068865_100017722 3300006881 Bacteria 4584
201 Ga0075436_100009853 3300006914 Bacteria 6536
202 Ga0097620_100331517 3300006931 Bacteria 1616
203 Ga0097620_101247658 3300006931 Bacteria 819
204 Ga0075435_100000140 3300007076 Bacteria 40976
205 Ga0075435_100020149 3300007076 Bacteria 5103
206 Ga0075435_100024269 3300007076 Bacteria 4703
207 Ga0075435_100045328 3300007076 Bacteria 3525
208 Ga0075435_100806250 3300007076 Bacteria 817
209 Ga0105244_10238047 3300009036 Bacteria 850
210 Ga0105240_10222720 3300009093 Bacteria 2197
211 Ga0105240_10439215 3300009093 Bacteria 1463
212 Ga0105240_10637414 3300009093 Bacteria 1170
213 Ga0105240_10708309 3300009093 Bacteria 1098
214 Ga0105240_11069326 3300009093 Bacteria 860
215 Ga0105240_11110382 3300009093 Bacteria 841
216 Ga0111539_10031415 3300009094 Bacteria 6451
217 Ga0111539_10089729 3300009094 Bacteria 3612
218 Ga0111539_10867885 3300009094 Bacteria 1050
219 Ga0105245_10011977 3300009098 Bacteria 7541
220 Ga0105245_10119636 3300009098 Bacteria 2459
221 Ga0105245_10431456 3300009098 Bacteria 1323
222 Ga0105245_10746476 3300009098 Bacteria 1014
223 Ga0105245_10864972 3300009098 Bacteria 945
224 Ga0105245_11650211 3300009098 Bacteria 693
225 Ga0105247_10203629 3300009101 Bacteria 1331
226 Ga0114129_10009001 3300009147 Bacteria 14238
227 Ga0114129_10048698 3300009147 Bacteria 5955
228 Ga0114129_10056182 3300009147 Bacteria 5514
229 Ga0114129_10385876 3300009147 Bacteria 1849
230 Ga0114129_11103449 3300009147 Bacteria 993
231 Ga0114129_12821085 3300009147 Bacteria 577
232 Ga0105243_10032733 3300009148 Bacteria 4019
233 Ga0105243_10080853 3300009148 Bacteria 2651
234 Ga0105243_10513992 3300009148 Bacteria 1137
235 Ga0105243_10581757 3300009148 Bacteria 1075
236 Ga0105241_10043494 3300009174 Bacteria 3402
237 Ga0105241_10268096 3300009174 Bacteria 1454
238 Ga0105241_10405328 3300009174 Bacteria 1197
239 Ga0105241_10816530 3300009174 Bacteria 860
240 Ga0105242_10006264 3300009176 Bacteria 9162
241 Ga0105242_11961248 3300009176 Bacteria 627
242 Ga0105242_12274041 3300009176 Bacteria 588
243 Ga0105248_10008130 3300009177 Bacteria 11517
244 Ga0105248_10056872 3300009177 Bacteria 4389
245 Ga0105248_10194172 3300009177 Bacteria 2287
246 Ga0105248_10951507 3300009177 Bacteria 970
247 Ga0105248_11117168 3300009177 Bacteria 891
248 Ga0105237_10492868 3300009545 Bacteria 1232
249 Ga0105238_10023360 3300009551 Bacteria 6303
250 Ga0105249_10017957 3300009553 Bacteria 6286
251 Ga0105249_10686243 3300009553 Bacteria 1083
252 Ga0105249_11153319 3300009553 Bacteria 846
253 Ga0105249_12218630 3300009553 Bacteria 622
254 Ga0105239_10096721 3300010375 Bacteria 3262
255 Ga0105239_10515853 3300010375 Bacteria 1360
256 Ga0105239_11824757 3300010375 Bacteria 705
257 Ga0105246_10322712 3300011119 Bacteria 1255
258 Ga0157373_10164163 3300013100 Bacteria 1563
259 Ga0157371_11027283 3300013102 Bacteria 630
260 Ga0157370_10008306 3300013104 Bacteria 11204
261 Ga0157370_10300734 3300013104 Bacteria 1481
262 Ga0157370_10347658 3300013104 Bacteria 1367
263 Ga0157370_10833691 3300013104 Bacteria 838
264 Ga0157370_10932051 3300013104 Bacteria 788
265 Ga0157369_10032180 3300013105 Bacteria 5769
266 Ga0157369_10045279 3300013105 Bacteria 4786
267 Ga0157369_10046810 3300013105 Bacteria 4700
268 Ga0157369_10336345 3300013105 Bacteria 1569
269 Ga0157369_10382575 3300013105 Bacteria 1461
270 Ga0157369_10462735 3300013105 Bacteria 1313
271 Ga0157369_11585855 3300013105 Bacteria 666
272 Ga0157374_10033180 3300013296 Bacteria 4709
273 Ga0157378_10018799 3300013297 Bacteria 6075
274 Ga0157378_10345069 3300013297 Bacteria 1453
275 Ga0157378_11503761 3300013297 Bacteria 718
276 Ga0163162_10030463 3300013306 Bacteria 5345
277 Ga0163162_10263641 3300013306 Bacteria 1855
278 Ga0163162_10736469 3300013306 Bacteria 1106
279 Ga0157372_10029001 3300013307 Bacteria 6038
280 Ga0157372_10140215 3300013307 Bacteria 2785
281 Ga0157372_10304928 3300013307 Bacteria 1853
282 Ga0157372_10524982 3300013307 Bacteria 1380
283 Ga0157372_10741397 3300013307 Bacteria 1142
284 Ga0157375_10064197 3300013308 Bacteria 3655
285 Ga0157375_10263695 3300013308 Bacteria 1884
286 Ga0157375_10510413 3300013308 Bacteria 1366
287 Ga0157375_10569078 3300013308 Bacteria 1294
288 Ga0157375_10839944 3300013308 Bacteria 1065
289 Ga0163163_10208813 3300014325 Bacteria 2001
290 Ga0163163_10351850 3300014325 Bacteria 1529
291 Ga0157380_10134754 3300014326 Bacteria 2112
292 Ga0157380_10692548 3300014326 Bacteria 1023
293 Ga0182008_10413879 3300014497 Bacteria 726
294 Ga0157377_10003323 3300014745 Bacteria 7271
295 Ga0157377_10562207 3300014745 Bacteria 808
296 Ga0157379_10097916 3300014968 Bacteria 2633
297 Ga0157376_10013033 3300014969 Bacteria 6193
298 Ga0157376_10077981 3300014969 Bacteria 2835
299 Ga0182006_1141934 3300015261 Bacteria 820
300 Ga0182007_10231938 3300015262 Bacteria 656
301 Ga0182007_10367363 3300015262 Bacteria 544
302 Ga0197907_11047046 3300020069 Bacteria 1367
303 Ga0197907_11349487 3300020069 Bacteria 1293
304 Ga0206356_10777109 3300020070 Bacteria 1701
305 Ga0206354_10741990 3300020081 Bacteria 2595
306 Ga0206353_10780697 3300020082 Bacteria 735
307 Ga0206353_11185381 3300020082 Bacteria 2081
308 Ga0206353_11283255 3300020082 Bacteria 4825
309 Ga0206353_11751382 3300020082 Bacteria 1296
310 Ga0206353_11789119 3300020082 Bacteria 2995
311 Ga0213873_10039551 3300021358 Bacteria 1209
312 Ga0213874_10142815 3300021377 Bacteria 830
313 Ga0213876_10273908 3300021384 Bacteria 897
314 Ga0213871_10077264 3300021441 Bacteria 949
315 Ga0207692_10064075 3300025898 Bacteria 1912
316 Ga0207692_10113744 3300025898 Bacteria 1505
317 Ga0207710_10343985 3300025900 Bacteria 759
318 Ga0207688_10072754 3300025901 Bacteria 1953
319 Ga0207688_10143079 3300025901 Bacteria 1408
320 Ga0207688_10228445 3300025901 Bacteria 1123
321 Ga0207688_10639295 3300025901 Bacteria 671
322 Ga0207688_10839980 3300025901 Bacteria 582
323 Ga0207685_10003453 3300025905 Bacteria 3846
324 Ga0207685_10042480 3300025905 Bacteria 1707
325 Ga0207685_10429030 3300025905 Bacteria 683
326 Ga0207685_10487818 3300025905 Bacteria 646
327 Ga0207699_10612734 3300025906 Bacteria 793
328 Ga0207684_10039896 3300025910 Bacteria 3980
329 Ga0207684_10308549 3300025910 Bacteria 1364
330 Ga0207684_10702501 3300025910 Bacteria 859
331 Ga0207707_10014838 3300025912 Bacteria 6786
332 Ga0207707_10111137 3300025912 Bacteria 2396
333 Ga0207707_10146159 3300025912 Bacteria 2067
334 Ga0207707_10198241 3300025912 Bacteria 1751
335 Ga0207707_10584770 3300025912 Bacteria 946
336 Ga0207695_10543070 3300025913 Bacteria 1044
337 Ga0207695_11223259 3300025913 Bacteria 631
338 Ga0207695_11391233 3300025913 Bacteria 582
339 Ga0207671_10044114 3300025914 Bacteria 3297
340 Ga0207693_10003565 3300025915 Bacteria 13299
341 Ga0207693_10018792 3300025915 Bacteria 5500
342 Ga0207693_10019938 3300025915 Bacteria 5333
343 Ga0207693_10086334 3300025915 Bacteria 2459
344 Ga0207693_10302964 3300025915 Bacteria 1252
345 Ga0207693_10422443 3300025915 Bacteria 1042
346 Ga0207693_10452898 3300025915 Bacteria 1003
347 Ga0207693_10651909 3300025915 Bacteria 818
348 Ga0207693_11210892 3300025915 Bacteria 569
349 Ga0207663_10007094 3300025916 Bacteria 5786
350 Ga0207663_10226444 3300025916 Bacteria 1363
351 Ga0207663_10381228 3300025916 Bacteria 1074
352 Ga0207660_10009367 3300025917 Bacteria 6338
353 Ga0207660_10028394 3300025917 Bacteria 3826
354 Ga0207660_10183140 3300025917 Bacteria 1628
355 Ga0207660_10185704 3300025917 Bacteria 1617
356 Ga0207660_10193902 3300025917 Bacteria 1583
357 Ga0207660_10444825 3300025917 Bacteria 1047
358 Ga0207662_10269070 3300025918 Bacteria 1124
359 Ga0207657_10000416 3300025919 Bacteria 45222
360 Ga0207657_10000610 3300025919 Bacteria 37898
361 Ga0207657_10004617 3300025919 Bacteria 14547
362 Ga0207657_10022825 3300025919 Bacteria 5842
363 Ga0207657_10151254 3300025919 Bacteria 1890
364 Ga0207657_10154164 3300025919 Bacteria 1869
365 Ga0207657_10296287 3300025919 Bacteria 1282
366 Ga0207657_10463485 3300025919 Bacteria 994
367 Ga0207649_10034017 3300025920 Bacteria 3050
368 Ga0207649_10058915 3300025920 Bacteria 2407
369 Ga0207649_10261521 3300025920 Bacteria 1250
370 Ga0207649_10517658 3300025920 Bacteria 909
371 Ga0207652_10003206 3300025921 Bacteria 13597
372 Ga0207652_10017952 3300025921 Bacteria 5797
373 Ga0207652_10213248 3300025921 Bacteria 1739
374 Ga0207652_10315648 3300025921 Bacteria 1411
375 Ga0207652_11106148 3300025921 Bacteria 693
376 Ga0207646_10116678 3300025922 Bacteria 2398
377 Ga0207646_10140658 3300025922 Bacteria 2173
378 Ga0207646_10480907 3300025922 Bacteria 1120
379 Ga0207646_10956458 3300025922 Bacteria 758
380 Ga0207646_11341739 3300025922 Bacteria 623
381 Ga0207646_11371729 3300025922 Bacteria 616
382 Ga0207646_11774333 3300025922 Bacteria 528
383 Ga0207659_10032822 3300025926 Bacteria 3567
384 Ga0207659_10350236 3300025926 Bacteria 1225
385 Ga0207687_10016945 3300025927 Bacteria 4788
386 Ga0207687_10403443 3300025927 Bacteria 1125
387 Ga0207700_10000004 3300025928 Bacteria 443409
388 Ga0207700_10126938 3300025928 Bacteria 2077
389 Ga0207700_10205214 3300025928 Bacteria 1663
390 Ga0207700_10223947 3300025928 Bacteria 1596
391 Ga0207700_11029053 3300025928 Bacteria 737
392 Ga0207664_10002557 3300025929 Bacteria 12026
393 Ga0207664_10116950 3300025929 Bacteria 2225
394 Ga0207664_10152546 3300025929 Bacteria 1964
395 Ga0207664_10176820 3300025929 Bacteria 1830
396 Ga0207664_10178321 3300025929 Bacteria 1823
397 Ga0207664_10180407 3300025929 Bacteria 1812
398 Ga0207664_11029652 3300025929 Bacteria 737
399 Ga0207644_10178931 3300025931 Bacteria 1661
400 Ga0207644_10423624 3300025931 Bacteria 1091
401 Ga0207644_11057209 3300025931 Bacteria 682
402 Ga0207690_10034236 3300025932 Bacteria 3272
403 Ga0207690_10047168 3300025932 Bacteria 2857
404 Ga0207690_10155708 3300025932 Bacteria 1698
405 Ga0207690_10180276 3300025932 Bacteria 1590
406 Ga0207690_10321389 3300025932 Bacteria 1217
407 Ga0207706_10031346 3300025933 Bacteria 4737
408 Ga0207706_10390263 3300025933 Bacteria 1207
409 Ga0207686_10048195 3300025934 Bacteria 2638
410 Ga0207686_10895129 3300025934 Bacteria 716
411 Ga0207709_10496246 3300025935 Bacteria 952
412 Ga0207669_10075065 3300025937 Bacteria 2141
413 Ga0207669_10292088 3300025937 Bacteria 1235
414 Ga0207669_10968653 3300025937 Bacteria 714
415 Ga0207704_10004032 3300025938 Bacteria 6686
416 Ga0207665_10070955 3300025939 Bacteria 2377
417 Ga0207665_10502673 3300025939 Bacteria 937
418 Ga0207691_10013728 3300025940 Bacteria 7739
419 Ga0207691_10539009 3300025940 Bacteria 990
420 Ga0207711_10090389 3300025941 Bacteria 2692
421 Ga0207711_10096344 3300025941 Bacteria 2611
422 Ga0207711_11140097 3300025941 Bacteria 721
423 Ga0207661_10023738 3300025944 Bacteria 4638
424 Ga0207661_10209783 3300025944 Bacteria 1716
425 Ga0207661_10263049 3300025944 Bacteria 1537
426 Ga0207661_10768524 3300025944 Bacteria 887
427 Ga0207661_10837006 3300025944 Bacteria 847
428 Ga0207667_10099837 3300025949 Bacteria 2995
429 Ga0207667_10136696 3300025949 Bacteria 2524
430 Ga0207667_10143680 3300025949 Bacteria 2456
431 Ga0207667_10194294 3300025949 Bacteria 2082
432 Ga0207667_10239947 3300025949 Bacteria 1855
433 Ga0207667_10253165 3300025949 Bacteria 1801
434 Ga0207667_10594592 3300025949 Bacteria 1116
435 Ga0207667_10884102 3300025949 Bacteria 886
436 Ga0207667_11168952 3300025949 Bacteria 750
437 Ga0207651_10159469 3300025960 Bacteria 1767
438 Ga0207712_10032434 3300025961 Bacteria 3526
439 Ga0207712_10863529 3300025961 Bacteria 798
440 Ga0207668_10197019 3300025972 Bacteria 1601
441 Ga0207640_10812205 3300025981 Bacteria 811
442 Ga0207640_10939913 3300025981 Bacteria 757
443 Ga0207640_11179175 3300025981 Bacteria 680
444 Ga0207677_10094427 3300026023 Bacteria 2183
445 Ga0207677_10568347 3300026023 Bacteria 991
446 Ga0207677_10891209 3300026023 Bacteria 801
447 Ga0207703_10355749 3300026035 Bacteria 1349
448 Ga0207639_10068169 3300026041 Bacteria 2771
449 Ga0207678_10018270 3300026067 Bacteria 6158
450 Ga0207678_10194806 3300026067 Bacteria 1732
451 Ga0207708_10022143 3300026075 Bacteria 4799
452 Ga0207708_10024328 3300026075 Bacteria 4581
453 Ga0207702_10022866 3300026078 Bacteria 5187
454 Ga0207702_10199303 3300026078 Bacteria 1855
455 Ga0207702_10307064 3300026078 Bacteria 1507
456 Ga0207702_11335426 3300026078 Bacteria 711
457 Ga0207641_10704317 3300026088 Bacteria 995
458 Ga0207641_10820819 3300026088 Bacteria 921
459 Ga0207648_10004050 3300026089 Bacteria 15221
460 Ga0207648_10049380 3300026089 Bacteria 3681
461 Ga0207648_10373785 3300026089 Bacteria 1288
462 Ga0207676_10466005 3300026095 Bacteria 1194
463 Ga0207676_10477664 3300026095 Bacteria 1180
464 Ga0207674_10009649 3300026116 Bacteria 11008
465 Ga0207674_10015268 3300026116 Bacteria 8445
466 Ga0207674_10033571 3300026116 Bacteria 5372
467 Ga0207674_10034595 3300026116 Bacteria 5280
468 Ga0207675_100138731 3300026118 Bacteria 2309
469 Ga0207675_101862906 3300026118 Bacteria 620
470 Ga0207683_10002338 3300026121 Bacteria 16626
471 Ga0207683_10105840 3300026121 Bacteria 2515
472 Ga0207683_10206846 3300026121 Bacteria 1785
473 Ga0207683_10703252 3300026121 Bacteria 937
474 Ga0207698_10013668 3300026142 Bacteria 5365
475 Ga0207698_10125784 3300026142 Bacteria 2179
476 Ga0207698_10147953 3300026142 Bacteria 2034
477 Ga0207698_10329570 3300026142 Bacteria 1433
478 Ga0207698_10457688 3300026142 Bacteria 1233
479 Ga0207428_10297768 3300027907 Bacteria 1194
480 Ga0207428_10336607 3300027907 Bacteria 1112
481 Ga0268266_10048959 3300028379 Bacteria 3623
482 Ga0268266_10815941 3300028379 Bacteria 901
483 Ga0268266_10938016 3300028379 Bacteria 837
484 Ga0265319_1120671 3300028563 Bacteria 817
485 Ga0265334_10015319 3300028573 Bacteria 3186
486 Ga0265334_10033057 3300028573 Bacteria 2061
487 Ga0265334_10114416 3300028573 Bacteria 968
488 Ga0265334_10142860 3300028573 Bacteria 847
489 Ga0265318_10010160 3300028577 Bacteria 4112
490 Ga0265318_10025573 3300028577 Bacteria 2330
491 Ga0265318_10266915 3300028577 Bacteria 624
492 Ga0265322_10015344 3300028654 Bacteria 2214
493 Ga0265338_10028139 3300028800 Bacteria 5615
494 Ga0265328_10044387 3300031239 Bacteria 1635
495 Ga0265320_10226574 3300031240 Bacteria 832
496 Ga0265325_10029899 3300031241 Bacteria 2925
497 Ga0265327_10097793 3300031251 Bacteria 1421
498 Ga0265327_10413925 3300031251 Bacteria 584
499 Ga0265316_10181661 3300031344 Bacteria 1566
500 Ga0265316_10761147 3300031344 Bacteria 680
501 Ga0307408_100015573 3300031548 Bacteria 5064
502 Ga0307408_100287868 3300031548 Bacteria 1371
503 Ga0307408_100384526 3300031548 Bacteria 1201
504 Ga0307408_100533329 3300031548 Bacteria 1033
505 Ga0265313_10055786 3300031595 Bacteria 1870
506 Ga0265314_10012245 3300031711 Bacteria 7017
507 Ga0265342_10150680 3300031712 Bacteria 1291
508 Ga0265342_10332060 3300031712 Bacteria 795
509 Ga0307405_10004812 3300031731 Bacteria 6440
510 Ga0307405_10435309 3300031731 Bacteria 1036
511 Ga0307405_11088093 3300031731 Bacteria 686
512 Ga0307413_10597116 3300031824 Bacteria 903
513 Ga0307410_10417627 3300031852 Bacteria 1087
514 Ga0307406_10182313 3300031901 Bacteria 1530
515 Ga0307406_11130915 3300031901 Bacteria 677
516 Ga0307407_10031785 3300031903 Bacteria 2863
517 Ga0307407_10502923 3300031903 Bacteria 889
518 Ga0307412_10560373 3300031911 Bacteria 961
519 Ga0307412_10940949 3300031911 Bacteria 760
520 Ga0307412_11086437 3300031911 Bacteria 711
521 Ga0307409_100025747 3300031995 Bacteria 4134
522 Ga0307409_100061797 3300031995 Bacteria 2929
523 Ga0307416_100040131 3300032002 Bacteria 3633
524 Ga0307416_100118391 3300032002 Bacteria 2353
525 Ga0307416_100222007 3300032002 Bacteria 1813
526 Ga0307416_100360839 3300032002 Bacteria 1475
527 Ga0307416_101218764 3300032002 Bacteria 858
528 Ga0307414_10243475 3300032004 Bacteria 1490
529 Ga0307411_10153998 3300032005 Bacteria 1712
530 Ga0307415_100832037 3300032126 Bacteria 845
531 Ga0307415_101273243 3300032126 Bacteria 695
532 Ga0373959_0019332 3300034820 Bacteria 1290
533 Ga0373926_0095199 3300035083 Bacteria 1110
534 Ga0373934_0137215 3300035086 Bacteria 999
535 Ga0373934_0430607 3300035086 Bacteria 552
536 Ga0373944_0072406 3300035089 Bacteria 1125
537 Ga0373936_0020681 3300035113 Bacteria 2558
538 Ga0373953_0032746 3300035117 Bacteria 2030
539 Ga0373953_0330680 3300035117 Bacteria 667
540 Ga0373957_0025026 3300035120 Bacteria 2148
541 Ga0373943_0000899 3300035170 Bacteria 13105
542 Ga0373943_0039717 3300035170 Bacteria 2269
543 Ga0373943_0087086 3300035170 Bacteria 1611
544 Ga0373946_0044796 3300035171 Bacteria 1828
545 Ga0373955_0008799 3300035172 Bacteria 4704
546 Ga0373942_0049779 3300035207 Bacteria 1171
547 Ga0373924_0079925 3300035410 Bacteria 1389
548 Ga0373931_0039207 3300035691 Bacteria 2482
549 Ga0373927_0135226 3300035695 Bacteria 1611
550 Ga0373927_0281848 3300035695 Bacteria 1093
551 Ga0373933_0297194 3300035724 Bacteria 1045
552 Ga0373947_0003187 3300035725 Bacteria 9757
553 Ga0373947_0033686 3300035725 Bacteria 3026
554 Ga0373947_0060207 3300035725 Bacteria 2305
555 Ga0373947_0760366 3300035725 Bacteria 661
556 Ga0373937_0076296 3300036401 Bacteria 3095
557 Ga0373937_0193836 3300036401 Bacteria 1910
558 Ga0373925_0744518 3300037068 Bacteria 808
559 Ga0395899_0001001 3300037312 Bacteria 25945
560 Ga0395899_0015657 3300037312 Bacteria 5783
561 Ga0395899_0018455 3300037312 Bacteria 5303
562 Ga0395899_0032687 3300037312 Bacteria 3910
563 Ga0395899_0035364 3300037312 Bacteria 3750
564 Ga0395899_0041054 3300037312 Bacteria 3458
565 Ga0395899_0081807 3300037312 Bacteria 2349
566 Ga0395899_0090882 3300037312 Bacteria 2213
567 Ga0395899_0091878 3300037312 Bacteria 2198
568 Ga0395899_0094300 3300037312 Bacteria 2166
569 Ga0395899_0146113 3300037312 Bacteria 1679
570 Ga0395899_0212186 3300037312 Bacteria 1345
571 Ga0395899_0272526 3300037312 Bacteria 1154
572 Ga0395899_0650435 3300037312 Bacteria 666
573 Ga0395899_0948472 3300037312 Bacteria 522
574 Ga0395900_0004233 3300037418 Bacteria 15232
575 Ga0395900_0004700 3300037418 Bacteria 14396
576 Ga0395900_0004724 3300037418 Bacteria 14368
577 Ga0395900_0014519 3300037418 Bacteria 8037
578 Ga0395900_0015755 3300037418 Bacteria 7705
579 Ga0395900_0015897 3300037418 Bacteria 7666
580 Ga0395900_0025692 3300037418 Bacteria 6029
581 Ga0395900_0028300 3300037418 Bacteria 5740
582 Ga0395900_0029582 3300037418 Bacteria 5619
583 Ga0395900_0032992 3300037418 Bacteria 5328
584 Ga0395900_0086108 3300037418 Bacteria 3229
585 Ga0395900_0109879 3300037418 Bacteria 2833
586 Ga0395900_0116756 3300037418 Bacteria 2738
587 Ga0395900_0172876 3300037418 Bacteria 2198
588 Ga0395900_0173719 3300037418 Bacteria 2192
589 Ga0395900_0187989 3300037418 Bacteria 2096
590 Ga0395900_0201725 3300037418 Bacteria 2012
591 Ga0395900_0229164 3300037418 Bacteria 1869
592 Ga0395900_0315526 3300037418 Bacteria 1545
593 Ga0395900_0424851 3300037418 Bacteria 1289
594 Ga0395900_0654618 3300037418 Bacteria 987
595 Ga0395898_0004894 3300037466 Bacteria 14544
596 Ga0395898_0006542 3300037466 Bacteria 12435
597 Ga0395898_0008982 3300037466 Bacteria 10525
598 Ga0395898_0016102 3300037466 Bacteria 7659
599 Ga0395898_0021780 3300037466 Bacteria 6494
600 Ga0395898_0031400 3300037466 Bacteria 5307
601 Ga0395898_0039643 3300037466 Bacteria 4661
602 Ga0395898_0053413 3300037466 Bacteria 3946
603 Ga0395898_0076712 3300037466 Bacteria 3227
604 Ga0395898_0119682 3300037466 Bacteria 2523
605 Ga0395898_0155740 3300037466 Bacteria 2185
606 Ga0395898_0171390 3300037466 Bacteria 2075
607 Ga0395898_0196487 3300037466 Bacteria 1927
608 Ga0395898_0244556 3300037466 Bacteria 1711
609 Ga0395898_0285893 3300037466 Bacteria 1573
610 Ga0395898_0506784 3300037466 Bacteria 1148
611 Ga0395898_0832280 3300037466 Bacteria 863
612 Ga0395898_1158190 3300037466 Bacteria 705
613 Ga0395905_0005063 3300037471 Bacteria 13564
614 Ga0395905_0005451 3300037471 Bacteria 12987
615 Ga0395905_0010082 3300037471 Bacteria 9209
616 Ga0395905_0014689 3300037471 Bacteria 7468
617 Ga0395905_0023069 3300037471 Bacteria 5883
618 Ga0395905_0028306 3300037471 Bacteria 5281
619 Ga0395905_0064605 3300037471 Bacteria 3425
620 Ga0395905_0079795 3300037471 Bacteria 3067
621 Ga0395905_0103737 3300037471 Bacteria 2669
622 Ga0395905_0104764 3300037471 Bacteria 2656
623 Ga0395905_0108622 3300037471 Bacteria 2604
624 Ga0395905_0301032 3300037471 Bacteria 1491
625 Ga0395905_0491894 3300037471 Bacteria 1126
626 Ga0395905_0491959 3300037471 Bacteria 1126
627 Ga0395905_0560368 3300037471 Bacteria 1044
628 Ga0395905_0818853 3300037471 Bacteria 834
629 Ga0395905_1026758 3300037471 Bacteria 728
630 Ga0395901_0002221 3300038443 Bacteria 19812
631 Ga0395901_0002468 3300038443 Bacteria 18763
632 Ga0395901_0016661 3300038443 Bacteria 7487
633 Ga0395901_0017935 3300038443 Bacteria 7225
634 Ga0395901_0018242 3300038443 Bacteria 7164
635 Ga0395901_0029987 3300038443 Bacteria 5603
636 Ga0395901_0036111 3300038443 Bacteria 5105
637 Ga0395901_0049122 3300038443 Bacteria 4382
638 Ga0395901_0052058 3300038443 Bacteria 4256
639 Ga0395901_0053242 3300038443 Bacteria 4205
640 Ga0395901_0095541 3300038443 Bacteria 3114
641 Ga0395901_0115220 3300038443 Bacteria 2823
642 Ga0395901_0168721 3300038443 Bacteria 2297
643 Ga0395901_0181430 3300038443 Bacteria 2208
644 Ga0395901_0284494 3300038443 Bacteria 1717
645 Ga0395901_0291567 3300038443 Bacteria 1693
646 Ga0395901_0408991 3300038443 Bacteria 1393
647 Ga0395901_0475947 3300038443 Bacteria 1274
648 Ga0395901_0667355 3300038443 Bacteria 1041
649 Ga0395901_0745974 3300038443 Bacteria 972
650 Ga0395901_0817566 3300038443 Bacteria 919
651 Ga0395901_1223430 3300038443 Bacteria 716
652 Ga0436365_1553456 3300039437 Bacteria 1073
653 Ga0436360_0506477 3300039438 Bacteria 5147
654 Ga0436360_0511686 3300039438 Bacteria 594
655 Ga0436363_0668989 3300039450 Bacteria 616
656 Ga0436363_1348640 3300039450 Bacteria 678
657 Ga0436362_0327669 3300039453 Bacteria 2618
658 Ga0439438_045069 3300041405 Bacteria 1135
659 Ga0439438_120893 3300041405 Bacteria 630
660 Ga0439461_0003605 3300041410 Bacteria 2553
661 Ga0439465_0098857 3300041413 Bacteria 1006
662 Ga0451835_0827407 3300041492 Bacteria 906
663 Ga0439431_0130726 3300041997 Bacteria 705
664 Ga0439441_012332 3300042001 Bacteria 1465
665 Ga0439445_0242928 3300042004 Bacteria 537
666 Ga0439463_043686 3300042016 Bacteria 1141
667 Ga0450917_008674 3300042120 Bacteria 790
668 Ga0450906_055882 3300042145 Bacteria 699
669 Ga0450907_011944 3300042146 Bacteria 1443
670 Ga0439446_0361271 3300042156 Bacteria 519
671 Ga0450908_042915 3300042184 Bacteria 784
672 Ga0439434_0015538 3300042435 Bacteria 2271
673 Ga0466969_0103243 3300044656 Bacteria 1340
674 Ga0466972_0455956 3300044658 Bacteria 601
675 Ga0466966_0013321 3300044684 Bacteria 5444
676 Ga0466966_0055786 3300044684 Bacteria 2500
677 Ga0466966_0103961 3300044684 Bacteria 1755
678 Ga0466966_0128302 3300044684 Bacteria 1554
679 Ga0466966_0296909 3300044684 Bacteria 971
680 Ga0466961_0001805 3300044693 Bacteria 13266
681 Ga0466963_0003083 3300044694 Bacteria 9444
682 Ga0466963_0041038 3300044694 Bacteria 3034
683 Ga0466964_0003275 3300044706 Bacteria 5892
684 Ga0466964_0004021 3300044706 Bacteria 5405
685 Ga0466964_0006266 3300044706 Bacteria 4432
686 Ga0466964_0007545 3300044706 Bacteria 4070
687 Ga0466964_0125030 3300044706 Bacteria 1164
688 Ga0466971_0026732 3300044719 Bacteria 2581
689 Ga0466968_0026293 3300044735 Bacteria 2387
690 Ga0466968_0265340 3300044735 Bacteria 818
691 Ga0466957_0035461 3300044842 Bacteria 2993
692 Ga0466957_0045276 3300044842 Bacteria 2669
693 Ga0466957_0102563 3300044842 Bacteria 1805
694 Ga0466957_0199451 3300044842 Bacteria 1314
695 Ga0466957_0603646 3300044842 Bacteria 768
696 Ga0466960_0026703 3300044901 Bacteria 2626
697 Ga0466959_0059584 3300045049 Bacteria 2780
698 Ga0466959_0138653 3300045049 Bacteria 1720
699 Ga0466959_0148827 3300045049 Bacteria 1651
700 Ga0466958_0007711 3300045836 Bacteria 5937
701 Ga0466958_0066985 3300045836 Bacteria 2193
702 Ga0466958_0214086 3300045836 Bacteria 1228
703 Ga0466958_0220499 3300045836 Bacteria 1210
704 Ga0466958_0853854 3300045836 Bacteria 594
705 Ga0466967_0001914 3300045976 Bacteria 12584
706 Ga0466967_0003262 3300045976 Bacteria 10507
707 Ga0466967_0011854 3300045976 Bacteria 6631
708 Ga0466967_0015468 3300045976 Bacteria 5982
709 Ga0466967_0025617 3300045976 Bacteria 4867
710 Ga0466967_0054908 3300045976 Bacteria 3508
711 Ga0466967_0084997 3300045976 Bacteria 2864
712 Ga0466967_0087121 3300045976 Bacteria 2830
713 Ga0466967_0094124 3300045976 Bacteria 2727
714 Ga0466967_0115898 3300045976 Bacteria 2468
715 Ga0466967_0137708 3300045976 Bacteria 2271
716 Ga0466967_0160751 3300045976 Bacteria 2108
717 Ga0466967_0179667 3300045976 Bacteria 1995
718 Ga0466967_0213864 3300045976 Bacteria 1829
719 Ga0466967_0237608 3300045976 Bacteria 1737
720 Ga0466967_0433146 3300045976 Bacteria 1283
721 Ga0466967_0551817 3300045976 Bacteria 1134
722 Ga0466967_0858283 3300045976 Bacteria 902
723 Ga0466967_1476351 3300045976 Bacteria 677
724 Ga0495592_0112947 3300046454 Bacteria 1920
725 Ga0495592_0114033 3300046454 Bacteria 1909
726 Ga0495592_0750564 3300046454 Bacteria 583
727 Ga0495603_0023275 3300046455 Bacteria 3751
728 Ga0495629_0046938 3300046459 Bacteria 3029
729 Ga0495629_0114708 3300046459 Bacteria 1877
730 Ga0495629_0483832 3300046459 Bacteria 836
731 Ga0495629_0819019 3300046459 Bacteria 613
732 Ga0495641_0001250 3300046461 Bacteria 21835
733 Ga0495641_0023550 3300046461 Bacteria 3056
734 Ga0495651_0012474 3300046462 Bacteria 6553
735 Ga0495651_0040858 3300046462 Bacteria 3603
736 Ga0495651_0248700 3300046462 Bacteria 1215
737 Ga0495653_0061120 3300046463 Bacteria 2851
738 Ga0495653_0587652 3300046463 Bacteria 686
739 Ga0495582_0000397 3300046473 Bacteria 23729
740 Ga0495582_0127741 3300046473 Bacteria 1435
741 Ga0495605_0061489 3300046474 Bacteria 1797
742 Ga0495605_0183141 3300046474 Bacteria 920
743 Ga0495639_0002254 3300046475 Bacteria 8463
744 Ga0495662_0035472 3300046476 Bacteria 2406
745 Ga0495664_0016551 3300046477 Bacteria 4202
746 Ga0495664_0276691 3300046477 Bacteria 1014
747 Ga0495664_0496142 3300046477 Bacteria 729
748 Ga0495584_0084022 3300046491 Bacteria 1603
749 Ga0495584_0105889 3300046491 Bacteria 1422
750 Ga0495584_0108216 3300046491 Bacteria 1406
751 Ga0495585_0266184 3300046492 Bacteria 851
752 Ga0495596_0074630 3300046500 Bacteria 1317
753 Ga0495596_0105199 3300046500 Bacteria 1096
754 Ga0495596_0156887 3300046500 Bacteria 884
755 Ga0495596_0335123 3300046500 Bacteria 589
756 Ga0495607_0099382 3300046501 Bacteria 1561
757 Ga0495607_0225143 3300046501 Bacteria 915
758 Ga0495607_0245655 3300046501 Bacteria 864
759 Ga0495608_0029157 3300046511 Bacteria 3746
760 Ga0495608_0052486 3300046511 Bacteria 2699
761 Ga0495616_0088845 3300046513 Bacteria 1467
762 Ga0495616_0428307 3300046513 Bacteria 539
763 Ga0495618_0241671 3300046514 Bacteria 1135
764 Ga0495618_0260148 3300046514 Bacteria 1087
765 Ga0495628_0013424 3300046516 Bacteria 6891
766 Ga0495628_0181249 3300046516 Bacteria 1593
767 Ga0495630_0066836 3300046517 Bacteria 2702
768 Ga0495630_0075867 3300046517 Bacteria 2532
769 Ga0495630_0135334 3300046517 Bacteria 1872
770 Ga0495630_0228121 3300046517 Bacteria 1422
771 Ga0495630_0398463 3300046517 Bacteria 1054
772 Ga0495630_0538046 3300046517 Bacteria 896
773 Ga0495631_0325870 3300046518 Bacteria 654
774 Ga0495637_0028523 3300046520 Bacteria 2493
775 Ga0495644_0128343 3300046523 Bacteria 966
776 Ga0495663_0154082 3300046525 Bacteria 786
777 Ga0495663_0268888 3300046525 Bacteria 609
778 Ga0495666_0019709 3300046526 Bacteria 3345
779 Ga0495666_0100536 3300046526 Bacteria 1363
780 Ga0495642_0235976 3300046528 Bacteria 799
781 Ga0495652_0012598 3300046529 Bacteria 7623
782 Ga0495652_0189526 3300046529 Bacteria 1570
783 Ga0495652_0402912 3300046529 Bacteria 968
784 Ga0495665_0026888 3300046531 Bacteria 3089
785 Ga0495640_0035402 3300046533 Bacteria 3533
786 Ga0495640_0044499 3300046533 Bacteria 3086
787 Ga0495586_0103308 3300046535 Bacteria 1583
788 Ga0495587_0022577 3300046536 Bacteria 3874
789 Ga0495587_0048446 3300046536 Bacteria 2516
790 Ga0495598_0102770 3300046537 Bacteria 948
791 Ga0495598_0131980 3300046537 Bacteria 857
792 Ga0495645_0060684 3300046543 Bacteria 2741
793 Ga0495645_0096890 3300046543 Bacteria 2101
794 Ga0495645_0180645 3300046543 Bacteria 1446
795 Ga0495645_0626745 3300046543 Bacteria 659
796 Ga0495667_0041845 3300046559 Bacteria 3037
797 Ga0495667_0050247 3300046559 Bacteria 2753
798 Ga0495667_0478577 3300046559 Bacteria 781
799 Ga0495667_0502674 3300046559 Bacteria 759
800 Ga0495656_0036803 3300046615 Bacteria 2018
801 Ga0495656_0196125 3300046615 Bacteria 1000
802 Ga0495634_0076063 3300046642 Bacteria 2204
803 Ga0495634_0120097 3300046642 Bacteria 1683
804 Ga0495611_0094636 3300046648 Bacteria 1382
805 Ga0495635_0013378 3300046663 Bacteria 5743
806 Ga0495635_0015938 3300046663 Bacteria 5250
807 Ga0495659_0171023 3300046664 Bacteria 881
808 Ga0495661_0370205 3300046665 Bacteria 702
809 Ga0495661_0420876 3300046665 Bacteria 647
810 Ga0495588_0059077 3300046674 Bacteria 1983
811 Ga0495657_0038175 3300046675 Bacteria 3307
812 Ga0495657_0116590 3300046675 Bacteria 1686
813 Ga0495657_0175077 3300046675 Bacteria 1319
814 Ga0495657_0390097 3300046675 Bacteria 820
815 Ga0495657_0562755 3300046675 Bacteria 661
816 Ga0495599_0101990 3300046678 Bacteria 1788
817 Ga0495599_0317149 3300046678 Bacteria 939
818 Ga0495599_0727878 3300046678 Bacteria 570
819 Ga0495623_0041457 3300046679 Bacteria 2935
820 Ga0495623_0118047 3300046679 Bacteria 1601
821 Ga0495646_0101109 3300046680 Bacteria 1653
822 Ga0495646_0105173 3300046680 Bacteria 1613
823 Ga0495647_0001542 3300046681 Bacteria 7117
824 Ga0495658_0001563 3300046683 Bacteria 11965
825 Ga0495669_0300484 3300046684 Bacteria 774
826 Ga0495613_0001506 3300046689 Bacteria 17725
827 Ga0495613_0319079 3300046689 Bacteria 1073
828 Ga0495613_0736123 3300046689 Bacteria 647
829 Ga0495624_0494701 3300046690 Bacteria 732
830 Ga0495649_0564922 3300046694 Bacteria 563
831 Ga0495589_0107891 3300046794 Bacteria 1345
832 Ga0495589_0426537 3300046794 Bacteria 608
833 Ga0495600_0057459 3300046809 Bacteria 2541
834 Ga0495600_0133015 3300046809 Bacteria 1616
835 Ga0495581_0002960 3300047315 Bacteria 9722
836 Ga0495581_0412987 3300047315 Bacteria 787
837 Ga0495604_0003309 3300047317 Bacteria 12857
838 Ga0495604_0163609 3300047317 Bacteria 1570
839 Ga0495604_0166394 3300047317 Bacteria 1554
840 Ga0495636_0246872 3300047318 Bacteria 825
841 Ga0495674_0038374 3300047319 Bacteria 4300
842 Ga0495674_0046005 3300047319 Bacteria 3875
843 Ga0495674_0055190 3300047319 Bacteria 3485
844 Ga0495674_0066253 3300047319 Bacteria 3134
845 Ga0495676_0087650 3300047321 Bacteria 2338
846 Ga0495680_0006197 3300047322 Bacteria 11149
847 Ga0495680_0006671 3300047322 Bacteria 10691
848 Ga0495680_0080049 3300047322 Bacteria 2469
849 Ga0495680_0095433 3300047322 Bacteria 2223
850 Ga0495680_0374265 3300047322 Bacteria 988
851 Ga0495683_0432331 3300047323 Bacteria 543
852 Ga0495675_0054671 3300047444 Bacteria 2533
853 Ga0495684_0019345 3300047471 Bacteria 5242
854 Ga0495684_0029105 3300047471 Bacteria 4239
855 Ga0495593_0004029 3300047673 Bacteria 8758
856 Ga0495602_0006483 3300048088 Bacteria 12277
857 Ga0495602_0087030 3300048088 Bacteria 2606
858 Ga0495602_0132184 3300048088 Bacteria 1988
859 Ga0495602_0157092 3300048088 Bacteria 1780
860 Ga0495614_0197046 3300048089 Bacteria 910
861 Ga0496100_0008217 3300048903 Bacteria 5813
862 Ga0496100_0013049 3300048903 Bacteria 4781
863 Ga0496100_0017810 3300048903 Bacteria 4202
864 Ga0496100_0082161 3300048903 Bacteria 2178
865 Ga0496100_0287704 3300048903 Bacteria 1227
866 Ga0496100_0426778 3300048903 Bacteria 1013
867 Ga0496100_0679569 3300048903 Bacteria 803
868 Ga0496100_0694590 3300048903 Bacteria 794
869 Ga0496101_0001675 3300048904 Bacteria 13292
870 Ga0496101_0003097 3300048904 Bacteria 10285
871 Ga0496101_0088309 3300048904 Bacteria 2302
872 Ga0496101_0159668 3300048904 Bacteria 1728
873 Ga0496101_0167196 3300048904 Bacteria 1689
874 Ga0496101_0285496 3300048904 Bacteria 1291
875 Ga0496101_0465055 3300048904 Bacteria 998
876 Ga0496102_0007218 3300048905 Bacteria 9482
877 Ga0496102_0010358 3300048905 Bacteria 8019
878 Ga0496102_0040337 3300048905 Bacteria 4222
879 Ga0496102_0066040 3300048905 Bacteria 3316
880 Ga0496102_0327479 3300048905 Bacteria 1443
881 Ga0496102_0525111 3300048905 Bacteria 1106
882 Ga0496102_0574841 3300048905 Bacteria 1050
883 Ga0496103_0011909 3300048906 Bacteria 5163
884 Ga0496103_0124345 3300048906 Bacteria 1644
885 Ga0496103_0194786 3300048906 Bacteria 1303
886 Ga0496103_0244348 3300048906 Bacteria 1155
887 Ga0496103_0345080 3300048906 Bacteria 957
888 Ga0496104_0000134 3300048907 Bacteria 68737
889 Ga0496104_0002226 3300048907 Bacteria 16741
890 Ga0496104_0009373 3300048907 Bacteria 8706
891 Ga0496104_0079872 3300048907 Bacteria 3118
892 Ga0496104_0124098 3300048907 Bacteria 2479
893 Ga0496104_0143093 3300048907 Bacteria 2297
894 Ga0496104_0298791 3300048907 Bacteria 1522
895 Ga0496104_0903148 3300048907 Bacteria 788
896 Ga0496104_1156832 3300048907 Bacteria 677
897 Ga0496105_0000334 3300048908 Bacteria 30835
898 Ga0496105_0000429 3300048908 Bacteria 27568
899 Ga0496105_0003332 3300048908 Bacteria 11871
900 Ga0496105_0072352 3300048908 Bacteria 2849
901 Ga0496105_0129599 3300048908 Bacteria 2080
902 Ga0496105_0695540 3300048908 Bacteria 781
903 Ga0496106_0009788 3300048909 Bacteria 7082
904 Ga0496106_0115864 3300048909 Bacteria 2090
905 Ga0496106_0207466 3300048909 Bacteria 1560
906 Ga0496106_0284268 3300048909 Bacteria 1325
907 Ga0496106_0309841 3300048909 Bacteria 1266
908 Ga0496107_0033042 3300048910 Bacteria 3700
909 Ga0496107_0050773 3300048910 Bacteria 2991
910 Ga0496107_0055898 3300048910 Bacteria 2850
911 Ga0496107_0233644 3300048910 Bacteria 1368
912 Ga0496107_0235471 3300048910 Bacteria 1362
913 Ga0496107_0503341 3300048910 Bacteria 898
914 Ga0496108_0003536 3300048911 Bacteria 12533
915 Ga0496108_0017704 3300048911 Bacteria 5829
916 Ga0496108_0033079 3300048911 Bacteria 4295
917 Ga0496108_0129163 3300048911 Bacteria 2172
918 Ga0496108_0138388 3300048911 Bacteria 2097
919 Ga0496108_0466152 3300048911 Bacteria 1104
920 Ga0496108_1372233 3300048911 Bacteria 592
921 Ga0496108_1380347 3300048911 Bacteria 590
922 Ga0496108_1534265 3300048911 Bacteria 553
923 Ga0496109_0000898 3300048912 Bacteria 24813
924 Ga0496109_0004403 3300048912 Bacteria 11769
925 Ga0496109_0023182 3300048912 Bacteria 5507
926 Ga0496109_0042839 3300048912 Bacteria 4102
927 Ga0496109_0070787 3300048912 Bacteria 3201
928 Ga0496109_0078645 3300048912 Bacteria 3037
929 Ga0496109_0112373 3300048912 Bacteria 2533
930 Ga0496109_0187673 3300048912 Bacteria 1942
931 Ga0496109_0213280 3300048912 Bacteria 1816
932 Ga0496109_0252758 3300048912 Bacteria 1660
933 Ga0496110_0000164 3300048913 Bacteria 40268
934 Ga0496110_0006694 3300048913 Bacteria 9159
935 Ga0496110_0014588 3300048913 Bacteria 6528
936 Ga0496110_0015943 3300048913 Bacteria 6266
937 Ga0496110_0108442 3300048913 Bacteria 2493
938 Ga0496110_0117827 3300048913 Bacteria 2391
939 Ga0496110_0139077 3300048913 Bacteria 2195
940 Ga0496110_0198647 3300048913 Bacteria 1822
941 Ga0496110_1237352 3300048913 Bacteria 655
942 Ga0496111_0000228 3300048914 Bacteria 26792
943 Ga0496111_0000295 3300048914 Bacteria 24339
944 Ga0496111_0002679 3300048914 Bacteria 10821
945 Ga0496111_0015328 3300048914 Bacteria 5259
946 Ga0496111_0031537 3300048914 Bacteria 3776
947 Ga0496111_0032440 3300048914 Bacteria 3724
948 Ga0496111_0048024 3300048914 Bacteria 3074
949 Ga0496111_0067212 3300048914 Bacteria 2604
950 Ga0496111_0089012 3300048914 Bacteria 2261
951 Ga0496111_0162974 3300048914 Bacteria 1656
952 Ga0496112_0000291 3300048915 Bacteria 32578
953 Ga0496112_0000443 3300048915 Bacteria 27533
954 Ga0496112_0012008 3300048915 Bacteria 7943
955 Ga0496112_0027889 3300048915 Bacteria 5447
956 Ga0496112_0175579 3300048915 Bacteria 2107
957 Ga0496112_0825665 3300048915 Bacteria 851
958 Ga0496112_1218375 3300048915 Bacteria 669
959 Ga0496113_0001618 3300048916 Bacteria 12672
960 Ga0496113_0158435 3300048916 Bacteria 1789
961 Ga0496113_0263470 3300048916 Bacteria 1377
962 Ga0496113_0307251 3300048916 Bacteria 1270
963 Ga0496113_0335155 3300048916 Bacteria 1213
964 Ga0496113_0569826 3300048916 Bacteria 908
965 Ga0496114_0000281 3300048917 Bacteria 37054
966 Ga0496114_0002188 3300048917 Bacteria 14888
967 Ga0496114_0003176 3300048917 Bacteria 12601
968 Ga0496114_0026662 3300048917 Bacteria 4733
969 Ga0496114_0055144 3300048917 Bacteria 3315
970 Ga0496114_0354314 3300048917 Bacteria 1298
971 Ga0496114_0371130 3300048917 Bacteria 1266
972 Ga0496114_0438328 3300048917 Bacteria 1157
973 Ga0496114_0584784 3300048917 Bacteria 985
974 Ga0496114_0985169 3300048917 Bacteria 726
975 Ga0496115_0015385 3300048918 Bacteria 5803
976 Ga0496115_0022334 3300048918 Bacteria 4900
977 Ga0496115_0027454 3300048918 Bacteria 4452
978 Ga0496115_0057152 3300048918 Bacteria 3137
979 Ga0496115_0060452 3300048918 Bacteria 3053
980 Ga0496115_0231042 3300048918 Bacteria 1525
981 Ga0496115_0380090 3300048918 Bacteria 1149
982 Ga0501031_0005532 3300049568 Bacteria 8224
983 Ga0501031_0104493 3300049568 Bacteria 1848
984 Ga0501031_0342915 3300049568 Bacteria 967
985 Ga0501032_0063899 3300049569 Bacteria 2464
986 Ga0501033_0002824 3300049570 Bacteria 14539
987 Ga0501033_0048171 3300049570 Bacteria 3166
988 Ga0501034_1528207 3300049571 Bacteria 541
989 Ga0501036_0004455 3300049572 Bacteria 11320
990 Ga0501036_0075063 3300049572 Bacteria 2859
991 Ga0501037_0000851 3300049573 Bacteria 22750
992 Ga0501037_0137364 3300049573 Bacteria 1751
993 Ga0501038_0000817 3300049574 Bacteria 27664
994 Ga0501038_0072163 3300049574 Bacteria 2926
995 Ga0501039_0009773 3300049575 Bacteria 7309
996 Ga0501039_0018588 3300049575 Bacteria 5335
997 Ga0501040_0028879 3300049576 Bacteria 3740
998 Ga0501040_0166336 3300049576 Bacteria 1560
999 Ga0501041_0001581 3300049577 Bacteria 12684
1000 Ga0501041_0001675 3300049577 Bacteria 12408
1001 Ga0501042_0013943 3300049578 Bacteria 5476
1002 Ga0501042_0096600 3300049578 Bacteria 2123
1003 Ga0501042_0282203 3300049578 Bacteria 1199
1004 Ga0501043_0016623 3300049579 Bacteria 5767
1005 Ga0501043_0059002 3300049579 Bacteria 3011
1006 Ga0501046_0015550 3300049580 Bacteria 6391
1007 Ga0501046_0017207 3300049580 Bacteria 6040
1008 Ga0501047_0269834 3300049581 Bacteria 1548
1009 Ga0501047_0503782 3300049581 Bacteria 1037
1010 Ga0501048_0054653 3300049582 Bacteria 2836
1011 Ga0501048_0092101 3300049582 Bacteria 2137
1012 Ga0501067_0000154 3300049583 Bacteria 38151
1013 Ga0501067_0018163 3300049583 Bacteria 3895
1014 Ga0501068_0037044 3300049584 Bacteria 2919
1015 Ga0501068_0114948 3300049584 Bacteria 1675
1016 Ga0501069_0006471 3300049585 Bacteria 6125
1017 Ga0501069_0008732 3300049585 Bacteria 5336
1018 Ga0501069_0045665 3300049585 Bacteria 2427
1019 Ga0501069_0136062 3300049585 Bacteria 1408
1020 Ga0501069_0264669 3300049585 Bacteria 1004
1021 Ga0501070_0000243 3300049586 Bacteria 51201
1022 Ga0501070_0029959 3300049586 Bacteria 4559
1023 Ga0501070_0040388 3300049586 Bacteria 3890
1024 Ga0501070_0084234 3300049586 Bacteria 2632
1025 Ga0501070_0478804 3300049586 Bacteria 1001
1026 Ga0501071_0001272 3300049587 Bacteria 14323
1027 Ga0501071_0340956 3300049587 Bacteria 1139
1028 Ga0501072_0106992 3300049588 Bacteria 2224
1029 Ga0501072_0116752 3300049588 Bacteria 2125
1030 Ga0501073_0004374 3300049589 Bacteria 10610
1031 Ga0501074_0012526 3300049590 Bacteria 6166
1032 Ga0501074_0018826 3300049590 Bacteria 5015
1033 Ga0501074_0040111 3300049590 Bacteria 3391
1034 Ga0501074_0165560 3300049590 Bacteria 1578
1035 Ga0501074_0326934 3300049590 Bacteria 1089
1036 Ga0501074_1011591 3300049590 Bacteria 584
1037 Ga0501074_1137081 3300049590 Bacteria 548
1038 Ga0501075_0028059 3300049591 Bacteria 4152
1039 Ga0501076_0009936 3300049592 Bacteria 7035
1040 Ga0501076_0099117 3300049592 Bacteria 2347
1041 Ga0501077_0002323 3300049593 Bacteria 11449
1042 Ga0501077_0002523 3300049593 Bacteria 10961
1043 Ga0501077_0014680 3300049593 Bacteria 4922
1044 Ga0501079_0004378 3300049741 Bacteria 10459
1045 Ga0501079_0178252 3300049741 Bacteria 1658
1046 Ga0501079_0179793 3300049741 Bacteria 1650
1047 Ga0501079_0929063 3300049741 Bacteria 685
1048 Ga0501080_0001996 3300049742 Bacteria 17609
1049 Ga0501080_0153899 3300049742 Bacteria 2124
1050 Ga0501080_0160365 3300049742 Bacteria 2077
1051 Ga0501080_0222874 3300049742 Bacteria 1725
1052 Ga0501080_0252296 3300049742 Bacteria 1609
1053 Ga0501080_0400347 3300049742 Bacteria 1235
1054 Ga0501081_0001229 3300049743 Bacteria 15580
1055 Ga0501083_0083099 3300049744 Bacteria 2121
1056 Ga0501035_0002330 3300049822 Bacteria 18722
1057 Ga0501035_0127654 3300049822 Bacteria 2219
1058 Ga0501035_1171300 3300049822 Bacteria 597
1059 Ga0501044_0103343 3300049823 Bacteria 2864
1060 Ga0501045_0002724 3300049824 Bacteria 12060
1061 Ga0501045_0168652 3300049824 Bacteria 1630
1062 nmdc:mga05p37_105308_c1 3300050507 Bacteria 3470
1063 nmdc:mga05p37_23411_c1 3300050507 Bacteria 7494
1064 nmdc:mga05p37_30852_c1 3300050507 Bacteria 6543
1065 nmdc:mga05p37_374784_c1 3300050507 Bacteria 1669
1066 nmdc:mga06r32_14701_c1 3300050510 Bacteria 7104
1067 nmdc:mga06r32_729328_c1 3300050510 Bacteria 955
1068 nmdc:mga08y16_1054378_c1 3300050511 Bacteria 790
1069 nmdc:mga08y16_1695176_c1 3300050511 Bacteria 587
1070 nmdc:mga08y16_242066_c1 3300050511 Bacteria 1865
1071 nmdc:mga08y16_325712_c1 3300050511 Bacteria 1581
1072 nmdc:mga08y16_95124_c1 3300050511 Bacteria 3103
1073 nmdc:mga0n895_11292_c1 3300050512 Bacteria 7960
1074 nmdc:mga0n895_1345301_c1 3300050512 Bacteria 684
1075 nmdc:mga0n895_2045985_c1 3300050512 Bacteria 530
1076 nmdc:mga0n895_304032_c1 3300050512 Bacteria 1617
1077 nmdc:mga0n895_58476_c1 3300050512 Bacteria 3801
1078 nmdc:mga0n895_8613_c1 3300050512 Bacteria 8850
1079 nmdc:mga0rr50_10287_c1 3300050513 Bacteria 5930
1080 nmdc:mga0rr50_214893_c1 3300050513 Bacteria 1586
1081 nmdc:mga0rr50_225_c1 3300050513 Bacteria 30540
1082 nmdc:mga0rr50_878172_c1 3300050513 Bacteria 765
1083 nmdc:mga08x19_10123_c1 3300050514 Bacteria 5657
1084 nmdc:mga08x19_39705_c1 3300050514 Bacteria 2993
1085 nmdc:mga0a205_181837_c1 3300050515 Bacteria 1997
1086 nmdc:mga0a205_3153_c1 3300050515 Bacteria 14634
1087 nmdc:mga0a205_553517_c1 3300050515 Bacteria 1005
1088 Ga0495601_0073913 3300053077 Bacteria 2180
1089 Ga0495601_0276367 3300053077 Bacteria 1095
1090 Ga0495601_0392264 3300053077 Bacteria 900
1091 Ga0495601_0476578 3300053077 Bacteria 806
1092 Ga0495612_0021233 3300053078 Bacteria 2605
1093 Ga0495612_0202884 3300053078 Bacteria 875
1094 Ga0495655_0017692 3300053083 Bacteria 1556
1095 Ga0495655_0131140 3300053083 Bacteria 772
1096 Ga0495619_0002264 3300053085 Bacteria 12718
1097 Ga0495619_0060049 3300053085 Bacteria 2526
1098 Ga0495619_0664531 3300053085 Bacteria 710
1099 Ga0501084_0000859 3300054114 Bacteria 23456
1100 Ga0501084_0761815 3300054114 Bacteria 815
1101 Ga0590077_129034 3300059426 Bacteria 600
1102 Ga0501082_0008383 3300060353 Bacteria 8916
1103 Ga0501082_0375404 3300060353 Bacteria 1240
1104 Ga0501082_0568272 3300060353 Bacteria 992
1105 Ga0466962_0188099 3300061719 Bacteria 1007
1106 Ga0530510_0022663 3300061734 Bacteria 4474
1107 Ga0530510_0055552 3300061734 Bacteria 2860
1108 Ga0530510_0135001 3300061734 Bacteria 1816
1109 Ga0530510_0248814 3300061734 Bacteria 1324
1110 Ga0530510_0313558 3300061734 Bacteria 1175
1111 Ga0530510_0683490 3300061734 Bacteria 782
1112 Ga0530510_1367719 3300061734 Bacteria 543
1113 Ga0157369_10004499
1114 JGI25407J50210_10007085
1115 Ga0070658_10092060
1116 Ga0070658_10118883
1117 Ga0070658_10124746
1118 Ga0070658_10482896
1119 Ga0070683_100050130
1120 Ga0070683_100272919
1121 Ga0070683_100495927
1122 Ga0070683_101564350
1123 Ga0070690_100859593
1124 Ga0070680_100053848
1125 Ga0070680_100101092
1126 Ga0070680_100108456
1127 Ga0070680_100508824
1128 Ga0070682_100152865
1129 Ga0068868_100036832
1130 Ga0070660_100110092
1131 Ga0070660_100165585
1132 Ga0070660_100330820
1133 Ga0070660_100599982
1134 Ga0070660_100745219
1135 Ga0070689_100136273
1136 Ga0070691_10078192
1137 Ga0070691_10528816
1138 Ga0070687_100057362
1139 Ga0070687_100245886
1140 Ga0070661_100033510
1141 Ga0070661_100061585
1142 Ga0070692_10015268
1143 Ga0070692_10099802
1144 Ga0070668_100091137
1145 Ga0070675_100071216
1146 Ga0070675_101283618
1147 Ga0070671_100242954
1148 Ga0070671_100748029
1149 Ga0070674_100001639
1150 Ga0070688_100012006
1151 Ga0070659_100219681
1152 Ga0070659_100241014
1153 Ga0070659_100475469
1154 Ga0070659_100962857
1155 Ga0070659_101325316
1156 Ga0070709_10024012
1157 Ga0070714_100053368
1158 Ga0070714_100092282
1159 Ga0070714_100361204
1160 Ga0070714_100429276
1161 Ga0070714_100453245
1162 Ga0070714_100691547
1163 Ga0070714_100794008
1164 Ga0070714_101747024
1165 Ga0070713_100088433
1166 Ga0070713_100094513
1167 Ga0070713_100505707
1168 Ga0070713_100938597
1169 Ga0070713_101237419
1170 Ga0070710_10005124
1171 Ga0070710_10025539
1172 Ga0070711_100896904
1173 Ga0070705_100072942
1174 Ga0070705_100117914
1175 Ga0070705_100347908
1176 Ga0070705_100894461
1177 Ga0070705_101101782
1178 Ga0070705_101107289
1179 Ga0070700_100063569
1180 Ga0070694_100156515
1181 Ga0070694_100443972
1182 Ga0070708_100132367
1183 Ga0070708_100179564
1184 Ga0070708_100675518
1185 Ga0070663_100670482
1186 Ga0070663_100854919
1187 Ga0070663_101685491
1188 Ga0070678_100020686
1189 Ga0070678_100118341
1190 Ga0070678_100513407
1191 Ga0070681_10001129
1192 Ga0070681_10109636
1193 Ga0070681_10140248
1194 Ga0070681_10152188
1195 Ga0070681_10598725
1196 Ga0070681_10741668
1197 Ga0070681_10778623
1198 Ga0068867_100030890
1199 Ga0068867_100244804
1200 Ga0070685_10223648
1201 Ga0070685_10551013
1202 Ga0070706_100049868
1203 Ga0070706_100258145
1204 Ga0070706_100405326
1205 Ga0070706_100864650
1206 Ga0070707_100190723
1207 Ga0070707_100754205
1208 Ga0070707_101046201
1209 Ga0070707_101548580
1210 Ga0070698_100073605
1211 Ga0070698_100128875
1212 Ga0070699_100158173
1213 Ga0070699_100622265
1214 Ga0070699_100880570
1215 Ga0070679_100160109
1216 Ga0070679_100199276
1217 Ga0070679_100305321
1218 Ga0070679_100792900
1219 Ga0070684_100057188
1220 Ga0070684_100057250
1221 Ga0070684_100089966
1222 Ga0070684_100293223
1223 Ga0070684_100317442
1224 Ga0070684_100444650
1225 Ga0070684_100801332
1226 Ga0070697_100102146
1227 Ga0070697_100109749
1228 Ga0070697_100385011
1229 Ga0070697_100829415
1230 Ga0070697_101074971
1231 Ga0068853_100306811
1232 Ga0070672_101034147
1233 Ga0070686_100032900
1234 Ga0070695_100089217
1235 Ga0070695_100159593
1236 Ga0070695_100192979
1237 Ga0070696_100048066
1238 Ga0070696_100056669
1239 Ga0070696_100581900
1240 Ga0070693_100604571
1241 Ga0070693_100845452
1242 Ga0070665_100053631
1243 Ga0070665_100870746
1244 Ga0070665_100986248
1245 Ga0070704_100002938
1246 Ga0068855_100072684
1247 Ga0068855_100108078
1248 Ga0068855_100233752
1249 Ga0068855_100302014
1250 Ga0068855_100351765
1251 Ga0068855_100425009
1252 Ga0070664_100165065
1253 Ga0070664_100716366
1254 Ga0068857_100019391
1255 Ga0068857_100033041
1256 Ga0068857_100059894
1257 Ga0068857_100300411
1258 Ga0068854_100658541
1259 Ga0068856_100062119
1260 Ga0068856_100134039
1261 Ga0068856_100512191
1262 Ga0070702_100069911
1263 Ga0070702_100170582
1264 Ga0070702_100747294
1265 Ga0068852_100018025
1266 Ga0068852_100045532
1267 Ga0068852_100294898
1268 Ga0068859_100331513
1269 Ga0068859_101247572
1270 Ga0068864_100129295
1271 Ga0068864_100669633
1272 Ga0068866_10045370
1273 Ga0068866_10104869
1274 Ga0068861_100222240
1275 Ga0068861_100572329
1276 Ga0068858_100832431
1277 Ga0068862_100986186
1278 Ga0068862_101099680
1279 Ga0081455_10010251
1280 Ga0081455_10011450
1281 Ga0081455_10012609
1282 Ga0081455_10243025
1283 Ga0081455_10363616
1284 Ga0081455_10564750
1285 Ga0081538_10000518
1286 Ga0081538_10051296
1287 Ga0081538_10173146
1288 Ga0081538_10174882
1289 Ga0081539_10018622
1290 Ga0070717_10014276
1291 Ga0070717_10521603
1292 Ga0070715_10011644
1293 Ga0070715_10510508
1294 Ga0070715_10692049
1295 Ga0070712_100030457
1296 Ga0070712_100110168
1297 Ga0070712_100177212
1298 Ga0070712_100211056
1299 Ga0070712_101030674
1300 Ga0097621_100870685
1301 Ga0068871_100026449
1302 Ga0075433_10004384
1303 Ga0075433_10024478
1304 Ga0075433_10456585
1305 Ga0075433_11051538
1306 Ga0075434_100005135
1307 Ga0075434_100023021
1308 Ga0075434_100529470
1309 Ga0075434_101554258
1310 Ga0075434_101591479
1311 Ga0075429_100742484
1312 Ga0068865_100017722
1313 Ga0075436_100009853
1314 Ga0097620_100331517
1315 Ga0097620_101247658
1316 Ga0075435_100000140
1317 Ga0075435_100020149
1318 Ga0075435_100024269
1319 Ga0075435_100045328
1320 Ga0075435_100806250
1321 Ga0105244_10238047
1322 Ga0105240_10222720
1323 Ga0105240_10439215
1324 Ga0105240_10637414
1325 Ga0105240_10708309
1326 Ga0105240_11069326
1327 Ga0105240_11110382
1328 Ga0111539_10031415
1329 Ga0111539_10089729
1330 Ga0111539_10867885
1331 Ga0105245_10011977
1332 Ga0105245_10119636
1333 Ga0105245_10431456
1334 Ga0105245_10746476
1335 Ga0105245_10864972
1336 Ga0105245_11650211
1337 Ga0105247_10203629
1338 Ga0114129_10009001
1339 Ga0114129_10048698
1340 Ga0114129_10056182
1341 Ga0114129_10385876
1342 Ga0114129_11103449
1343 Ga0114129_12821085
1344 Ga0105243_10032733
1345 Ga0105243_10080853
1346 Ga0105243_10513992
1347 Ga0105243_10581757
1348 Ga0105241_10043494
1349 Ga0105241_10268096
1350 Ga0105241_10405328
1351 Ga0105241_10816530
1352 Ga0105242_10006264
1353 Ga0105242_11961248
1354 Ga0105242_12274041
1355 Ga0105248_10008130
1356 Ga0105248_10056872
1357 Ga0105248_10194172
1358 Ga0105248_10951507
1359 Ga0105248_11117168
1360 Ga0105237_10492868
1361 Ga0105238_10023360
1362 Ga0105249_10017957
1363 Ga0105249_10686243
1364 Ga0105249_11153319
1365 Ga0105249_12218630
1366 Ga0105239_10096721
1367 Ga0105239_10515853
1368 Ga0105239_11824757
1369 Ga0105246_10322712
1370 Ga0157373_10164163
1371 Ga0157371_11027283
1372 Ga0157370_10008306
1373 Ga0157370_10300734
1374 Ga0157370_10347658
1375 Ga0157370_10833691
1376 Ga0157370_10932051
1377 Ga0157369_10032180
1378 Ga0157369_10045279
1379 Ga0157369_10046810
1380 Ga0157369_10336345
1381 Ga0157369_10382575
1382 Ga0157369_10462735
1383 Ga0157369_11585855
1384 Ga0157374_10033180
1385 Ga0157378_10018799
1386 Ga0157378_10345069
1387 Ga0157378_11503761
1388 Ga0163162_10030463
1389 Ga0163162_10263641
1390 Ga0163162_10736469
1391 Ga0157372_10029001
1392 Ga0157372_10140215
1393 Ga0157372_10304928
1394 Ga0157372_10524982
1395 Ga0157372_10741397
1396 Ga0157375_10064197
1397 Ga0157375_10263695
1398 Ga0157375_10510413
1399 Ga0157375_10569078
1400 Ga0157375_10839944
1401 Ga0163163_10208813
1402 Ga0163163_10351850
1403 Ga0157380_10134754
1404 Ga0157380_10692548
1405 Ga0182008_10413879
1406 Ga0157377_10003323
1407 Ga0157377_10562207
1408 Ga0157379_10097916
1409 Ga0157376_10013033
1410 Ga0157376_10077981
1411 Ga0182006_1141934
1412 Ga0182007_10231938
1413 Ga0182007_10367363
1414 Ga0197907_11047046
1415 Ga0197907_11349487
1416 Ga0206356_10777109
1417 Ga0206354_10741990
1418 Ga0206353_10780697
1419 Ga0206353_11185381
1420 Ga0206353_11283255
1421 Ga0206353_11751382
1422 Ga0206353_11789119
1423 Ga0213873_10039551
1424 Ga0213874_10142815
1425 Ga0213876_10273908
1426 Ga0213871_10077264
1427 Ga0207692_10064075
1428 Ga0207692_10113744
1429 Ga0207710_10343985
1430 Ga0207688_10072754
1431 Ga0207688_10143079
1432 Ga0207688_10228445
1433 Ga0207688_10639295
1434 Ga0207688_10839980
1435 Ga0207685_10003453
1436 Ga0207685_10042480
1437 Ga0207685_10429030
1438 Ga0207685_10487818
1439 Ga0207699_10612734
1440 Ga0207684_10039896
1441 Ga0207684_10308549
1442 Ga0207684_10702501
1443 Ga0207707_10014838
1444 Ga0207707_10111137
1445 Ga0207707_10146159
1446 Ga0207707_10198241
1447 Ga0207707_10584770
1448 Ga0207695_10543070
1449 Ga0207695_11223259
1450 Ga0207695_11391233
1451 Ga0207671_10044114
1452 Ga0207693_10003565
1453 Ga0207693_10018792
1454 Ga0207693_10019938
1455 Ga0207693_10086334
1456 Ga0207693_10302964
1457 Ga0207693_10422443
1458 Ga0207693_10452898
1459 Ga0207693_10651909
1460 Ga0207693_11210892
1461 Ga0207663_10007094
1462 Ga0207663_10226444
1463 Ga0207663_10381228
1464 Ga0207660_10009367
1465 Ga0207660_10028394
1466 Ga0207660_10183140
1467 Ga0207660_10185704
1468 Ga0207660_10193902
1469 Ga0207660_10444825
1470 Ga0207662_10269070
1471 Ga0207657_10000416
1472 Ga0207657_10000610
1473 Ga0207657_10004617
1474 Ga0207657_10022825
1475 Ga0207657_10151254
1476 Ga0207657_10154164
1477 Ga0207657_10296287
1478 Ga0207657_10463485
1479 Ga0207649_10034017
1480 Ga0207649_10058915
1481 Ga0207649_10261521
1482 Ga0207649_10517658
1483 Ga0207652_10003206
1484 Ga0207652_10017952
1485 Ga0207652_10213248
1486 Ga0207652_10315648
1487 Ga0207652_11106148
1488 Ga0207646_10116678
1489 Ga0207646_10140658
1490 Ga0207646_10480907
1491 Ga0207646_10956458
1492 Ga0207646_11341739
1493 Ga0207646_11371729
1494 Ga0207646_11774333
1495 Ga0207659_10032822
1496 Ga0207659_10350236
1497 Ga0207687_10016945
1498 Ga0207687_10403443
1499 Ga0207700_10000004
1500 Ga0207700_10126938
1501 Ga0207700_10205214
1502 Ga0207700_10223947
1503 Ga0207700_11029053
1504 Ga0207664_10002557
1505 Ga0207664_10116950
1506 Ga0207664_10152546
1507 Ga0207664_10176820
1508 Ga0207664_10178321
1509 Ga0207664_10180407
1510 Ga0207664_11029652
1511 Ga0207644_10178931
1512 Ga0207644_10423624
1513 Ga0207644_11057209
1514 Ga0207690_10034236
1515 Ga0207690_10047168
1516 Ga0207690_10155708
1517 Ga0207690_10180276
1518 Ga0207690_10321389
1519 Ga0207706_10031346
1520 Ga0207706_10390263
1521 Ga0207686_10048195
1522 Ga0207686_10895129
1523 Ga0207709_10496246
1524 Ga0207669_10075065
1525 Ga0207669_10292088
1526 Ga0207669_10968653
1527 Ga0207704_10004032
1528 Ga0207665_10070955
1529 Ga0207665_10502673
1530 Ga0207691_10013728
1531 Ga0207691_10539009
1532 Ga0207711_10090389
1533 Ga0207711_10096344
1534 Ga0207711_11140097
1535 Ga0207661_10023738
1536 Ga0207661_10209783
1537 Ga0207661_10263049
1538 Ga0207661_10768524
1539 Ga0207661_10837006
1540 Ga0207667_10099837
1541 Ga0207667_10136696
1542 Ga0207667_10143680
1543 Ga0207667_10194294
1544 Ga0207667_10239947
1545 Ga0207667_10253165
1546 Ga0207667_10594592
1547 Ga0207667_10884102
1548 Ga0207667_11168952
1549 Ga0207651_10159469
1550 Ga0207712_10032434
1551 Ga0207712_10863529
1552 Ga0207668_10197019
1553 Ga0207640_10812205
1554 Ga0207640_10939913
1555 Ga0207640_11179175
1556 Ga0207677_10094427
1557 Ga0207677_10568347
1558 Ga0207677_10891209
1559 Ga0207703_10355749
1560 Ga0207639_10068169
1561 Ga0207678_10018270
1562 Ga0207678_10194806
1563 Ga0207708_10022143
1564 Ga0207708_10024328
1565 Ga0207702_10022866
1566 Ga0207702_10199303
1567 Ga0207702_10307064
1568 Ga0207702_11335426
1569 Ga0207641_10704317
1570 Ga0207641_10820819
1571 Ga0207648_10004050
1572 Ga0207648_10049380
1573 Ga0207648_10373785
1574 Ga0207676_10466005
1575 Ga0207676_10477664
1576 Ga0207674_10009649
1577 Ga0207674_10015268
1578 Ga0207674_10033571
1579 Ga0207674_10034595
1580 Ga0207675_100138731
1581 Ga0207675_101862906
1582 Ga0207683_10002338
1583 Ga0207683_10105840
1584 Ga0207683_10206846
1585 Ga0207683_10703252
1586 Ga0207698_10013668
1587 Ga0207698_10125784
1588 Ga0207698_10147953
1589 Ga0207698_10329570
1590 Ga0207698_10457688
1591 Ga0207428_10297768
1592 Ga0207428_10336607
1593 Ga0268266_10048959
1594 Ga0268266_10815941
1595 Ga0268266_10938016
1596 Ga0265319_1120671
1597 Ga0265334_10015319
1598 Ga0265334_10033057
1599 Ga0265334_10114416
1600 Ga0265334_10142860
1601 Ga0265318_10010160
1602 Ga0265318_10025573
1603 Ga0265318_10266915
1604 Ga0265322_10015344
1605 Ga0265338_10028139
1606 Ga0265328_10044387
1607 Ga0265320_10226574
1608 Ga0265325_10029899
1609 Ga0265327_10097793
1610 Ga0265327_10413925
1611 Ga0265316_10181661
1612 Ga0265316_10761147
1613 Ga0307408_100015573
1614 Ga0307408_100287868
1615 Ga0307408_100384526
1616 Ga0307408_100533329
1617 Ga0265313_10055786
1618 Ga0265314_10012245
1619 Ga0265342_10150680
1620 Ga0265342_10332060
1621 Ga0307405_10004812
1622 Ga0307405_10435309
1623 Ga0307405_11088093
1624 Ga0307413_10597116
1625 Ga0307410_10417627
1626 Ga0307406_10182313
1627 Ga0307406_11130915
1628 Ga0307407_10031785
1629 Ga0307407_10502923
1630 Ga0307412_10560373
1631 Ga0307412_10940949
1632 Ga0307412_11086437
1633 Ga0307409_100025747
1634 Ga0307409_100061797
1635 Ga0307416_100040131
1636 Ga0307416_100118391
1637 Ga0307416_100222007
1638 Ga0307416_100360839
1639 Ga0307416_101218764
1640 Ga0307414_10243475
1641 Ga0307411_10153998
1642 Ga0307415_100832037
1643 Ga0307415_101273243
1644 Ga0373959_0019332
1645 Ga0373926_0095199
1646 Ga0373934_0137215
1647 Ga0373934_0430607
1648 Ga0373944_0072406
1649 Ga0373936_0020681
1650 Ga0373953_0032746
1651 Ga0373953_0330680
1652 Ga0373957_0025026
1653 Ga0373943_0000899
1654 Ga0373943_0039717
1655 Ga0373943_0087086
1656 Ga0373946_0044796
1657 Ga0373955_0008799
1658 Ga0373942_0049779
1659 Ga0373924_0079925
1660 Ga0373931_0039207
1661 Ga0373927_0135226
1662 Ga0373927_0281848
1663 Ga0373933_0297194
1664 Ga0373947_0003187
1665 Ga0373947_0033686
1666 Ga0373947_0060207
1667 Ga0373947_0760366
1668 Ga0373937_0076296
1669 Ga0373937_0193836
1670 Ga0373925_0744518
1671 Ga0395899_0001001
1672 Ga0395899_0015657
1673 Ga0395899_0018455
1674 Ga0395899_0032687
1675 Ga0395899_0035364
1676 Ga0395899_0041054
1677 Ga0395899_0081807
1678 Ga0395899_0090882
1679 Ga0395899_0091878
1680 Ga0395899_0094300
1681 Ga0395899_0146113
1682 Ga0395899_0212186
1683 Ga0395899_0272526
1684 Ga0395899_0650435
1685 Ga0395899_0948472
1686 Ga0395900_0004233
1687 Ga0395900_0004700
1688 Ga0395900_0004724
1689 Ga0395900_0014519
1690 Ga0395900_0015755
1691 Ga0395900_0015897
1692 Ga0395900_0025692
1693 Ga0395900_0028300
1694 Ga0395900_0029582
1695 Ga0395900_0032992
1696 Ga0395900_0086108
1697 Ga0395900_0109879
1698 Ga0395900_0116756
1699 Ga0395900_0172876
1700 Ga0395900_0173719
1701 Ga0395900_0187989
1702 Ga0395900_0201725
1703 Ga0395900_0229164
1704 Ga0395900_0315526
1705 Ga0395900_0424851
1706 Ga0395900_0654618
1707 Ga0395898_0004894
1708 Ga0395898_0006542
1709 Ga0395898_0008982
1710 Ga0395898_0016102
1711 Ga0395898_0021780
1712 Ga0395898_0031400
1713 Ga0395898_0039643
1714 Ga0395898_0053413
1715 Ga0395898_0076712
1716 Ga0395898_0119682
1717 Ga0395898_0155740
1718 Ga0395898_0171390
1719 Ga0395898_0196487
1720 Ga0395898_0244556
1721 Ga0395898_0285893
1722 Ga0395898_0506784
1723 Ga0395898_0832280
1724 Ga0395898_1158190
1725 Ga0395905_0005063
1726 Ga0395905_0005451
1727 Ga0395905_0010082
1728 Ga0395905_0014689
1729 Ga0395905_0023069
1730 Ga0395905_0028306
1731 Ga0395905_0064605
1732 Ga0395905_0079795
1733 Ga0395905_0103737
1734 Ga0395905_0104764
1735 Ga0395905_0108622
1736 Ga0395905_0301032
1737 Ga0395905_0491894
1738 Ga0395905_0491959
1739 Ga0395905_0560368
1740 Ga0395905_0818853
1741 Ga0395905_1026758
1742 Ga0395901_0002221
1743 Ga0395901_0002468
1744 Ga0395901_0016661
1745 Ga0395901_0017935
1746 Ga0395901_0018242
1747 Ga0395901_0029987
1748 Ga0395901_0036111
1749 Ga0395901_0049122
1750 Ga0395901_0052058
1751 Ga0395901_0053242
1752 Ga0395901_0095541
1753 Ga0395901_0115220
1754 Ga0395901_0168721
1755 Ga0395901_0181430
1756 Ga0395901_0284494
1757 Ga0395901_0291567
1758 Ga0395901_0408991
1759 Ga0395901_0475947
1760 Ga0395901_0667355
1761 Ga0395901_0745974
1762 Ga0395901_0817566
1763 Ga0395901_1223430
1764 Ga0436365_1553456
1765 Ga0436360_0506477
1766 Ga0436360_0511686
1767 Ga0436363_0668989
1768 Ga0436363_1348640
1769 Ga0436362_0327669
1770 Ga0439438_045069
1771 Ga0439438_120893
1772 Ga0439461_0003605
1773 Ga0439465_0098857
1774 Ga0451835_0827407
1775 Ga0439431_0130726
1776 Ga0439441_012332
1777 Ga0439445_0242928
1778 Ga0439463_043686
1779 Ga0450917_008674
1780 Ga0450906_055882
1781 Ga0450907_011944
1782 Ga0439446_0361271
1783 Ga0450908_042915
1784 Ga0439434_0015538
1785 Ga0466969_0103243
1786 Ga0466972_0455956
1787 Ga0466966_0013321
1788 Ga0466966_0055786
1789 Ga0466966_0103961
1790 Ga0466966_0128302
1791 Ga0466966_0296909
1792 Ga0466961_0001805
1793 Ga0466963_0003083
1794 Ga0466963_0041038
1795 Ga0466964_0003275
1796 Ga0466964_0004021
1797 Ga0466964_0006266
1798 Ga0466964_0007545
1799 Ga0466964_0125030
1800 Ga0466971_0026732
1801 Ga0466968_0026293
1802 Ga0466968_0265340
1803 Ga0466957_0035461
1804 Ga0466957_0045276
1805 Ga0466957_0102563
1806 Ga0466957_0199451
1807 Ga0466957_0603646
1808 Ga0466960_0026703
1809 Ga0466959_0059584
1810 Ga0466959_0138653
1811 Ga0466959_0148827
1812 Ga0466958_0007711
1813 Ga0466958_0066985
1814 Ga0466958_0214086
1815 Ga0466958_0220499
1816 Ga0466958_0853854
1817 Ga0466967_0001914
1818 Ga0466967_0003262
1819 Ga0466967_0011854
1820 Ga0466967_0015468
1821 Ga0466967_0025617
1822 Ga0466967_0054908
1823 Ga0466967_0084997
1824 Ga0466967_0087121
1825 Ga0466967_0094124
1826 Ga0466967_0115898
1827 Ga0466967_0137708
1828 Ga0466967_0160751
1829 Ga0466967_0179667
1830 Ga0466967_0213864
1831 Ga0466967_0237608
1832 Ga0466967_0433146
1833 Ga0466967_0551817
1834 Ga0466967_0858283
1835 Ga0466967_1476351
1836 Ga0495592_0112947
1837 Ga0495592_0114033
1838 Ga0495592_0750564
1839 Ga0495603_0023275
1840 Ga0495629_0046938
1841 Ga0495629_0114708
1842 Ga0495629_0483832
1843 Ga0495629_0819019
1844 Ga0495641_0001250
1845 Ga0495641_0023550
1846 Ga0495651_0012474
1847 Ga0495651_0040858
1848 Ga0495651_0248700
1849 Ga0495653_0061120
1850 Ga0495653_0587652
1851 Ga0495582_0000397
1852 Ga0495582_0127741
1853 Ga0495605_0061489
1854 Ga0495605_0183141
1855 Ga0495639_0002254
1856 Ga0495662_0035472
1857 Ga0495664_0016551
1858 Ga0495664_0276691
1859 Ga0495664_0496142
1860 Ga0495584_0084022
1861 Ga0495584_0105889
1862 Ga0495584_0108216
1863 Ga0495585_0266184
1864 Ga0495596_0074630
1865 Ga0495596_0105199
1866 Ga0495596_0156887
1867 Ga0495596_0335123
1868 Ga0495607_0099382
1869 Ga0495607_0225143
1870 Ga0495607_0245655
1871 Ga0495608_0029157
1872 Ga0495608_0052486
1873 Ga0495616_0088845
1874 Ga0495616_0428307
1875 Ga0495618_0241671
1876 Ga0495618_0260148
1877 Ga0495628_0013424
1878 Ga0495628_0181249
1879 Ga0495630_0066836
1880 Ga0495630_0075867
1881 Ga0495630_0135334
1882 Ga0495630_0228121
1883 Ga0495630_0398463
1884 Ga0495630_0538046
1885 Ga0495631_0325870
1886 Ga0495637_0028523
1887 Ga0495644_0128343
1888 Ga0495663_0154082
1889 Ga0495663_0268888
1890 Ga0495666_0019709
1891 Ga0495666_0100536
1892 Ga0495642_0235976
1893 Ga0495652_0012598
1894 Ga0495652_0189526
1895 Ga0495652_0402912
1896 Ga0495665_0026888
1897 Ga0495640_0035402
1898 Ga0495640_0044499
1899 Ga0495586_0103308
1900 Ga0495587_0022577
1901 Ga0495587_0048446
1902 Ga0495598_0102770
1903 Ga0495598_0131980
1904 Ga0495645_0060684
1905 Ga0495645_0096890
1906 Ga0495645_0180645
1907 Ga0495645_0626745
1908 Ga0495667_0041845
1909 Ga0495667_0050247
1910 Ga0495667_0478577
1911 Ga0495667_0502674
1912 Ga0495656_0036803
1913 Ga0495656_0196125
1914 Ga0495634_0076063
1915 Ga0495634_0120097
1916 Ga0495611_0094636
1917 Ga0495635_0013378
1918 Ga0495635_0015938
1919 Ga0495659_0171023
1920 Ga0495661_0370205
1921 Ga0495661_0420876
1922 Ga0495588_0059077
1923 Ga0495657_0038175
1924 Ga0495657_0116590
1925 Ga0495657_0175077
1926 Ga0495657_0390097
1927 Ga0495657_0562755
1928 Ga0495599_0101990
1929 Ga0495599_0317149
1930 Ga0495599_0727878
1931 Ga0495623_0041457
1932 Ga0495623_0118047
1933 Ga0495646_0101109
1934 Ga0495646_0105173
1935 Ga0495647_0001542
1936 Ga0495658_0001563
1937 Ga0495669_0300484
1938 Ga0495613_0001506
1939 Ga0495613_0319079
1940 Ga0495613_0736123
1941 Ga0495624_0494701
1942 Ga0495649_0564922
1943 Ga0495589_0107891
1944 Ga0495589_0426537
1945 Ga0495600_0057459
1946 Ga0495600_0133015
1947 Ga0495581_0002960
1948 Ga0495581_0412987
1949 Ga0495604_0003309
1950 Ga0495604_0163609
1951 Ga0495604_0166394
1952 Ga0495636_0246872
1953 Ga0495674_0038374
1954 Ga0495674_0046005
1955 Ga0495674_0055190
1956 Ga0495674_0066253
1957 Ga0495676_0087650
1958 Ga0495680_0006197
1959 Ga0495680_0006671
1960 Ga0495680_0080049
1961 Ga0495680_0095433
1962 Ga0495680_0374265
1963 Ga0495683_0432331
1964 Ga0495675_0054671
1965 Ga0495684_0019345
1966 Ga0495684_0029105
1967 Ga0495593_0004029
1968 Ga0495602_0006483
1969 Ga0495602_0087030
1970 Ga0495602_0132184
1971 Ga0495602_0157092
1972 Ga0495614_0197046
1973 Ga0496100_0008217
1974 Ga0496100_0013049
1975 Ga0496100_0017810
1976 Ga0496100_0082161
1977 Ga0496100_0287704
1978 Ga0496100_0426778
1979 Ga0496100_0679569
1980 Ga0496100_0694590
1981 Ga0496101_0001675
1982 Ga0496101_0003097
1983 Ga0496101_0088309
1984 Ga0496101_0159668
1985 Ga0496101_0167196
1986 Ga0496101_0285496
1987 Ga0496101_0465055
1988 Ga0496102_0007218
1989 Ga0496102_0010358
1990 Ga0496102_0040337
1991 Ga0496102_0066040
1992 Ga0496102_0327479
1993 Ga0496102_0525111
1994 Ga0496102_0574841
1995 Ga0496103_0011909
1996 Ga0496103_0124345
1997 Ga0496103_0194786
1998 Ga0496103_0244348
1999 Ga0496103_0345080
2000 Ga0496104_0000134
2001 Ga0496104_0002226
2002 Ga0496104_0009373
2003 Ga0496104_0079872
2004 Ga0496104_0124098
2005 Ga0496104_0143093
2006 Ga0496104_0298791
2007 Ga0496104_0903148
2008 Ga0496104_1156832
2009 Ga0496105_0000334
2010 Ga0496105_0000429
2011 Ga0496105_0003332
2012 Ga0496105_0072352
2013 Ga0496105_0129599
2014 Ga0496105_0695540
2015 Ga0496106_0009788
2016 Ga0496106_0115864
2017 Ga0496106_0207466
2018 Ga0496106_0284268
2019 Ga0496106_0309841
2020 Ga0496107_0033042
2021 Ga0496107_0050773
2022 Ga0496107_0055898
2023 Ga0496107_0233644
2024 Ga0496107_0235471
2025 Ga0496107_0503341
2026 Ga0496108_0003536
2027 Ga0496108_0017704
2028 Ga0496108_0033079
2029 Ga0496108_0129163
2030 Ga0496108_0138388
2031 Ga0496108_0466152
2032 Ga0496108_1372233
2033 Ga0496108_1380347
2034 Ga0496108_1534265
2035 Ga0496109_0000898
2036 Ga0496109_0004403
2037 Ga0496109_0023182
2038 Ga0496109_0042839
2039 Ga0496109_0070787
2040 Ga0496109_0078645
2041 Ga0496109_0112373
2042 Ga0496109_0187673
2043 Ga0496109_0213280
2044 Ga0496109_0252758
2045 Ga0496110_0000164
2046 Ga0496110_0006694
2047 Ga0496110_0014588
2048 Ga0496110_0015943
2049 Ga0496110_0108442
2050 Ga0496110_0117827
2051 Ga0496110_0139077
2052 Ga0496110_0198647
2053 Ga0496110_1237352
2054 Ga0496111_0000228
2055 Ga0496111_0000295
2056 Ga0496111_0002679
2057 Ga0496111_0015328
2058 Ga0496111_0031537
2059 Ga0496111_0032440
2060 Ga0496111_0048024
2061 Ga0496111_0067212
2062 Ga0496111_0089012
2063 Ga0496111_0162974
2064 Ga0496112_0000291
2065 Ga0496112_0000443
2066 Ga0496112_0012008
2067 Ga0496112_0027889
2068 Ga0496112_0175579
2069 Ga0496112_0825665
2070 Ga0496112_1218375
2071 Ga0496113_0001618
2072 Ga0496113_0158435
2073 Ga0496113_0263470
2074 Ga0496113_0307251
2075 Ga0496113_0335155
2076 Ga0496113_0569826
2077 Ga0496114_0000281
2078 Ga0496114_0002188
2079 Ga0496114_0003176
2080 Ga0496114_0026662
2081 Ga0496114_0055144
2082 Ga0496114_0354314
2083 Ga0496114_0371130
2084 Ga0496114_0438328
2085 Ga0496114_0584784
2086 Ga0496114_0985169
2087 Ga0496115_0015385
2088 Ga0496115_0022334
2089 Ga0496115_0027454
2090 Ga0496115_0057152
2091 Ga0496115_0060452
2092 Ga0496115_0231042
2093 Ga0496115_0380090
2094 Ga0501031_0005532
2095 Ga0501031_0104493
2096 Ga0501031_0342915
2097 Ga0501032_0063899
2098 Ga0501033_0002824
2099 Ga0501033_0048171
2100 Ga0501034_1528207
2101 Ga0501036_0004455
2102 Ga0501036_0075063
2103 Ga0501037_0000851
2104 Ga0501037_0137364
2105 Ga0501038_0000817
2106 Ga0501038_0072163
2107 Ga0501039_0009773
2108 Ga0501039_0018588
2109 Ga0501040_0028879
2110 Ga0501040_0166336
2111 Ga0501041_0001581
2112 Ga0501041_0001675
2113 Ga0501042_0013943
2114 Ga0501042_0096600
2115 Ga0501042_0282203
2116 Ga0501043_0016623
2117 Ga0501043_0059002
2118 Ga0501046_0015550
2119 Ga0501046_0017207
2120 Ga0501047_0269834
2121 Ga0501047_0503782
2122 Ga0501048_0054653
2123 Ga0501048_0092101
2124 Ga0501067_0000154
2125 Ga0501067_0018163
2126 Ga0501068_0037044
2127 Ga0501068_0114948
2128 Ga0501069_0006471
2129 Ga0501069_0008732
2130 Ga0501069_0045665
2131 Ga0501069_0136062
2132 Ga0501069_0264669
2133 Ga0501070_0000243
2134 Ga0501070_0029959
2135 Ga0501070_0040388
2136 Ga0501070_0084234
2137 Ga0501070_0478804
2138 Ga0501071_0001272
2139 Ga0501071_0340956
2140 Ga0501072_0106992
2141 Ga0501072_0116752
2142 Ga0501073_0004374
2143 Ga0501074_0012526
2144 Ga0501074_0018826
2145 Ga0501074_0040111
2146 Ga0501074_0165560
2147 Ga0501074_0326934
2148 Ga0501074_1011591
2149 Ga0501074_1137081
2150 Ga0501075_0028059
2151 Ga0501076_0009936
2152 Ga0501076_0099117
2153 Ga0501077_0002323
2154 Ga0501077_0002523
2155 Ga0501077_0014680
2156 Ga0501079_0004378
2157 Ga0501079_0178252
2158 Ga0501079_0179793
2159 Ga0501079_0929063
2160 Ga0501080_0001996
2161 Ga0501080_0153899
2162 Ga0501080_0160365
2163 Ga0501080_0222874
2164 Ga0501080_0252296
2165 Ga0501080_0400347
2166 Ga0501081_0001229
2167 Ga0501083_0083099
2168 Ga0501035_0002330
2169 Ga0501035_0127654
2170 Ga0501035_1171300
2171 Ga0501044_0103343
2172 Ga0501045_0002724
2173 Ga0501045_0168652
2174 nmdc:mga05p37_105308_c1
2175 nmdc:mga05p37_23411_c1
2176 nmdc:mga05p37_30852_c1
2177 nmdc:mga05p37_374784_c1
2178 nmdc:mga06r32_14701_c1
2179 nmdc:mga06r32_729328_c1
2180 nmdc:mga08y16_1054378_c1
2181 nmdc:mga08y16_1695176_c1
2182 nmdc:mga08y16_242066_c1
2183 nmdc:mga08y16_325712_c1
2184 nmdc:mga08y16_95124_c1
2185 nmdc:mga0n895_11292_c1
2186 nmdc:mga0n895_1345301_c1
2187 nmdc:mga0n895_2045985_c1
2188 nmdc:mga0n895_304032_c1
2189 nmdc:mga0n895_58476_c1
2190 nmdc:mga0n895_8613_c1
2191 nmdc:mga0rr50_10287_c1
2192 nmdc:mga0rr50_214893_c1
2193 nmdc:mga0rr50_225_c1
2194 nmdc:mga0rr50_878172_c1
2195 nmdc:mga08x19_10123_c1
2196 nmdc:mga08x19_39705_c1
2197 nmdc:mga0a205_181837_c1
2198 nmdc:mga0a205_3153_c1
2199 nmdc:mga0a205_553517_c1
2200 Ga0495601_0073913
2201 Ga0495601_0276367
2202 Ga0495601_0392264
2203 Ga0495601_0476578
2204 Ga0495612_0021233
2205 Ga0495612_0202884
2206 Ga0495655_0017692
2207 Ga0495655_0131140
2208 Ga0495619_0002264
2209 Ga0495619_0060049
2210 Ga0495619_0664531
2211 Ga0501084_0000859
2212 Ga0501084_0761815
2213 Ga0590077_129034
2214 Ga0501082_0008383
2215 Ga0501082_0375404
2216 Ga0501082_0568272
2217 Ga0466962_0188099
2218 Ga0530510_0022663
2219 Ga0530510_0055552
2220 Ga0530510_0135001
2221 Ga0530510_0248814
2222 Ga0530510_0313558
2223 Ga0530510_0683490
2224 Ga0530510_1367719

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

146

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

83

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9725 1 151
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9649 1 151
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9633 1 151
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.958 1 150
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9538 1 151
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9833 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9752 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9705 1 75 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9587 78 151 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9568 1 75 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F2XY32-F1-model_v4 (2Fe-2S)-binding protein 0.9875 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A538BUE3-F1-model_v4 (2Fe-2S)-binding protein 0.9861 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A536R2F2-F1-model_v4 (2Fe-2S)-binding protein 0.9824 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A535DQ93-F1-model_v4 (2Fe-2S)-binding protein 0.9818 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V6YN69-F1-model_v4 Ferredoxin 0.9815 1 151 GO:0016903
GO:0046872
GO:0051537

Map