F490255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1112 | 377 | 2224 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10004499|Ga0157369_1000449916 |
| Length | 175 |
| Sequence | MRISVRVNGEEHQADCWEGESLLFALREKLGFPGSKNACEQGECGSCSVLLDGTLVCSCLVLAAQADGHEVTTVEGLAQGDHLHAVQQAFVDAGAVQCGFCTPGLVVATVDLLKRNASPTDDEIREALSGNLCRCTGYAKIFDAVRLAAAGVGWTEPAESGAAGFAGGESGASAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 225 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 234 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.88 |
| Rhizosphere | 88.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157369_10004499 | 3300013105 | Bacteria | 16424 |
| 2 | JGI25407J50210_10007085 | 3300003373 | Bacteria | 2806 |
| 3 | Ga0070658_10092060 | 3300005327 | Bacteria | 2499 |
| 4 | Ga0070658_10118883 | 3300005327 | Bacteria | 2195 |
| 5 | Ga0070658_10124746 | 3300005327 | Bacteria | 2142 |
| 6 | Ga0070658_10482896 | 3300005327 | Bacteria | 1069 |
| 7 | Ga0070683_100050130 | 3300005329 | Bacteria | 3863 |
| 8 | Ga0070683_100272919 | 3300005329 | Bacteria | 1609 |
| 9 | Ga0070683_100495927 | 3300005329 | Bacteria | 1166 |
| 10 | Ga0070683_101564350 | 3300005329 | Bacteria | 634 |
| 11 | Ga0070690_100859593 | 3300005330 | Bacteria | 707 |
| 12 | Ga0070680_100053848 | 3300005336 | Bacteria | 3284 |
| 13 | Ga0070680_100101092 | 3300005336 | Bacteria | 2393 |
| 14 | Ga0070680_100108456 | 3300005336 | Bacteria | 2310 |
| 15 | Ga0070680_100508824 | 3300005336 | Bacteria | 1031 |
| 16 | Ga0070682_100152865 | 3300005337 | Bacteria | 1586 |
| 17 | Ga0068868_100036832 | 3300005338 | Bacteria | 3789 |
| 18 | Ga0070660_100110092 | 3300005339 | Bacteria | 2190 |
| 19 | Ga0070660_100165585 | 3300005339 | Bacteria | 1784 |
| 20 | Ga0070660_100330820 | 3300005339 | Bacteria | 1253 |
| 21 | Ga0070660_100599982 | 3300005339 | Bacteria | 920 |
| 22 | Ga0070660_100745219 | 3300005339 | Bacteria | 822 |
| 23 | Ga0070689_100136273 | 3300005340 | Bacteria | 1971 |
| 24 | Ga0070691_10078192 | 3300005341 | Bacteria | 1616 |
| 25 | Ga0070691_10528816 | 3300005341 | Bacteria | 686 |
| 26 | Ga0070687_100057362 | 3300005343 | Bacteria | 2042 |
| 27 | Ga0070687_100245886 | 3300005343 | Bacteria | 1109 |
| 28 | Ga0070661_100033510 | 3300005344 | Bacteria | 3720 |
| 29 | Ga0070661_100061585 | 3300005344 | Bacteria | 2755 |
| 30 | Ga0070692_10015268 | 3300005345 | Bacteria | 3630 |
| 31 | Ga0070692_10099802 | 3300005345 | Bacteria | 1590 |
| 32 | Ga0070668_100091137 | 3300005347 | Bacteria | 2403 |
| 33 | Ga0070675_100071216 | 3300005354 | Bacteria | 2883 |
| 34 | Ga0070675_101283618 | 3300005354 | Bacteria | 674 |
| 35 | Ga0070671_100242954 | 3300005355 | Bacteria | 1529 |
| 36 | Ga0070671_100748029 | 3300005355 | Bacteria | 850 |
| 37 | Ga0070674_100001639 | 3300005356 | Bacteria | 12060 |
| 38 | Ga0070688_100012006 | 3300005365 | Bacteria | 4839 |
| 39 | Ga0070659_100219681 | 3300005366 | Bacteria | 1568 |
| 40 | Ga0070659_100241014 | 3300005366 | Bacteria | 1496 |
| 41 | Ga0070659_100475469 | 3300005366 | Bacteria | 1063 |
| 42 | Ga0070659_100962857 | 3300005366 | Bacteria | 748 |
| 43 | Ga0070659_101325316 | 3300005366 | Bacteria | 639 |
| 44 | Ga0070709_10024012 | 3300005434 | Bacteria | 3586 |
| 45 | Ga0070714_100053368 | 3300005435 | Bacteria | 3450 |
| 46 | Ga0070714_100092282 | 3300005435 | Bacteria | 2654 |
| 47 | Ga0070714_100361204 | 3300005435 | Bacteria | 1365 |
| 48 | Ga0070714_100429276 | 3300005435 | Bacteria | 1253 |
| 49 | Ga0070714_100453245 | 3300005435 | Bacteria | 1219 |
| 50 | Ga0070714_100691547 | 3300005435 | Bacteria | 984 |
| 51 | Ga0070714_100794008 | 3300005435 | Bacteria | 916 |
| 52 | Ga0070714_101747024 | 3300005435 | Bacteria | 607 |
| 53 | Ga0070713_100088433 | 3300005436 | Bacteria | 2659 |
| 54 | Ga0070713_100094513 | 3300005436 | Bacteria | 2577 |
| 55 | Ga0070713_100505707 | 3300005436 | Bacteria | 1140 |
| 56 | Ga0070713_100938597 | 3300005436 | Bacteria | 833 |
| 57 | Ga0070713_101237419 | 3300005436 | Bacteria | 723 |
| 58 | Ga0070710_10005124 | 3300005437 | Bacteria | 6200 |
| 59 | Ga0070710_10025539 | 3300005437 | Bacteria | 3129 |
| 60 | Ga0070711_100896904 | 3300005439 | Bacteria | 756 |
| 61 | Ga0070705_100072942 | 3300005440 | Bacteria | 2081 |
| 62 | Ga0070705_100117914 | 3300005440 | Bacteria | 1708 |
| 63 | Ga0070705_100347908 | 3300005440 | Bacteria | 1080 |
| 64 | Ga0070705_100894461 | 3300005440 | Bacteria | 714 |
| 65 | Ga0070705_101101782 | 3300005440 | Bacteria | 650 |
| 66 | Ga0070705_101107289 | 3300005440 | Bacteria | 648 |
| 67 | Ga0070700_100063569 | 3300005441 | Bacteria | 2335 |
| 68 | Ga0070694_100156515 | 3300005444 | Bacteria | 1669 |
| 69 | Ga0070694_100443972 | 3300005444 | Bacteria | 1023 |
| 70 | Ga0070708_100132367 | 3300005445 | Bacteria | 2309 |
| 71 | Ga0070708_100179564 | 3300005445 | Bacteria | 1978 |
| 72 | Ga0070708_100675518 | 3300005445 | Bacteria | 973 |
| 73 | Ga0070663_100670482 | 3300005455 | Bacteria | 879 |
| 74 | Ga0070663_100854919 | 3300005455 | Bacteria | 783 |
| 75 | Ga0070663_101685491 | 3300005455 | Bacteria | 566 |
| 76 | Ga0070678_100020686 | 3300005456 | Bacteria | 4322 |
| 77 | Ga0070678_100118341 | 3300005456 | Bacteria | 2085 |
| 78 | Ga0070678_100513407 | 3300005456 | Bacteria | 1059 |
| 79 | Ga0070681_10001129 | 3300005458 | Bacteria | 22933 |
| 80 | Ga0070681_10109636 | 3300005458 | Bacteria | 2700 |
| 81 | Ga0070681_10140248 | 3300005458 | Bacteria | 2347 |
| 82 | Ga0070681_10152188 | 3300005458 | Bacteria | 2240 |
| 83 | Ga0070681_10598725 | 3300005458 | Bacteria | 1017 |
| 84 | Ga0070681_10741668 | 3300005458 | Bacteria | 899 |
| 85 | Ga0070681_10778623 | 3300005458 | Bacteria | 873 |
| 86 | Ga0068867_100030890 | 3300005459 | Bacteria | 3865 |
| 87 | Ga0068867_100244804 | 3300005459 | Bacteria | 1456 |
| 88 | Ga0070685_10223648 | 3300005466 | Bacteria | 1234 |
| 89 | Ga0070685_10551013 | 3300005466 | Bacteria | 823 |
| 90 | Ga0070706_100049868 | 3300005467 | Bacteria | 3862 |
| 91 | Ga0070706_100258145 | 3300005467 | Bacteria | 1627 |
| 92 | Ga0070706_100405326 | 3300005467 | Bacteria | 1269 |
| 93 | Ga0070706_100864650 | 3300005467 | Bacteria | 836 |
| 94 | Ga0070707_100190723 | 3300005468 | Bacteria | 1998 |
| 95 | Ga0070707_100754205 | 3300005468 | Bacteria | 937 |
| 96 | Ga0070707_101046201 | 3300005468 | Bacteria | 782 |
| 97 | Ga0070707_101548580 | 3300005468 | Bacteria | 630 |
| 98 | Ga0070698_100073605 | 3300005471 | Bacteria | 3422 |
| 99 | Ga0070698_100128875 | 3300005471 | Bacteria | 2486 |
| 100 | Ga0070699_100158173 | 3300005518 | Bacteria | 2005 |
| 101 | Ga0070699_100622265 | 3300005518 | Bacteria | 985 |
| 102 | Ga0070699_100880570 | 3300005518 | Bacteria | 820 |
| 103 | Ga0070679_100160109 | 3300005530 | Bacteria | 2225 |
| 104 | Ga0070679_100199276 | 3300005530 | Bacteria | 1969 |
| 105 | Ga0070679_100305321 | 3300005530 | Bacteria | 1542 |
| 106 | Ga0070679_100792900 | 3300005530 | Bacteria | 890 |
| 107 | Ga0070684_100057188 | 3300005535 | Bacteria | 3405 |
| 108 | Ga0070684_100057250 | 3300005535 | Bacteria | 3403 |
| 109 | Ga0070684_100089966 | 3300005535 | Bacteria | 2728 |
| 110 | Ga0070684_100293223 | 3300005535 | Bacteria | 1492 |
| 111 | Ga0070684_100317442 | 3300005535 | Bacteria | 1431 |
| 112 | Ga0070684_100444650 | 3300005535 | Bacteria | 1198 |
| 113 | Ga0070684_100801332 | 3300005535 | Bacteria | 881 |
| 114 | Ga0070697_100102146 | 3300005536 | Bacteria | 2382 |
| 115 | Ga0070697_100109749 | 3300005536 | Bacteria | 2298 |
| 116 | Ga0070697_100385011 | 3300005536 | Bacteria | 1215 |
| 117 | Ga0070697_100829415 | 3300005536 | Bacteria | 819 |
| 118 | Ga0070697_101074971 | 3300005536 | Bacteria | 716 |
| 119 | Ga0068853_100306811 | 3300005539 | Bacteria | 1468 |
| 120 | Ga0070672_101034147 | 3300005543 | Bacteria | 729 |
| 121 | Ga0070686_100032900 | 3300005544 | Bacteria | 3182 |
| 122 | Ga0070695_100089217 | 3300005545 | Bacteria | 2055 |
| 123 | Ga0070695_100159593 | 3300005545 | Bacteria | 1581 |
| 124 | Ga0070695_100192979 | 3300005545 | Bacteria | 1451 |
| 125 | Ga0070696_100048066 | 3300005546 | Bacteria | 2961 |
| 126 | Ga0070696_100056669 | 3300005546 | Bacteria | 2733 |
| 127 | Ga0070696_100581900 | 3300005546 | Bacteria | 901 |
| 128 | Ga0070693_100604571 | 3300005547 | Bacteria | 792 |
| 129 | Ga0070693_100845452 | 3300005547 | Bacteria | 682 |
| 130 | Ga0070665_100053631 | 3300005548 | Bacteria | 4044 |
| 131 | Ga0070665_100870746 | 3300005548 | Bacteria | 914 |
| 132 | Ga0070665_100986248 | 3300005548 | Bacteria | 855 |
| 133 | Ga0070704_100002938 | 3300005549 | Bacteria | 9686 |
| 134 | Ga0068855_100072684 | 3300005563 | Bacteria | 3997 |
| 135 | Ga0068855_100108078 | 3300005563 | Bacteria | 3195 |
| 136 | Ga0068855_100233752 | 3300005563 | Bacteria | 2057 |
| 137 | Ga0068855_100302014 | 3300005563 | Bacteria | 1773 |
| 138 | Ga0068855_100351765 | 3300005563 | Bacteria | 1623 |
| 139 | Ga0068855_100425009 | 3300005563 | Bacteria | 1453 |
| 140 | Ga0070664_100165065 | 3300005564 | Bacteria | 1962 |
| 141 | Ga0070664_100716366 | 3300005564 | Bacteria | 933 |
| 142 | Ga0068857_100019391 | 3300005577 | Bacteria | 5971 |
| 143 | Ga0068857_100033041 | 3300005577 | Bacteria | 4574 |
| 144 | Ga0068857_100059894 | 3300005577 | Bacteria | 3383 |
| 145 | Ga0068857_100300411 | 3300005577 | Bacteria | 1480 |
| 146 | Ga0068854_100658541 | 3300005578 | Bacteria | 900 |
| 147 | Ga0068856_100062119 | 3300005614 | Bacteria | 3690 |
| 148 | Ga0068856_100134039 | 3300005614 | Bacteria | 2482 |
| 149 | Ga0068856_100512191 | 3300005614 | Bacteria | 1221 |
| 150 | Ga0070702_100069911 | 3300005615 | Bacteria | 2070 |
| 151 | Ga0070702_100170582 | 3300005615 | Bacteria | 1415 |
| 152 | Ga0070702_100747294 | 3300005615 | Bacteria | 751 |
| 153 | Ga0068852_100018025 | 3300005616 | Bacteria | 5553 |
| 154 | Ga0068852_100045532 | 3300005616 | Bacteria | 3732 |
| 155 | Ga0068852_100294898 | 3300005616 | Bacteria | 1568 |
| 156 | Ga0068859_100331513 | 3300005617 | Bacteria | 1616 |
| 157 | Ga0068859_101247572 | 3300005617 | Bacteria | 819 |
| 158 | Ga0068864_100129295 | 3300005618 | Bacteria | 2267 |
| 159 | Ga0068864_100669633 | 3300005618 | Bacteria | 1012 |
| 160 | Ga0068866_10045370 | 3300005718 | Bacteria | 2204 |
| 161 | Ga0068866_10104869 | 3300005718 | Bacteria | 1566 |
| 162 | Ga0068861_100222240 | 3300005719 | Bacteria | 1597 |
| 163 | Ga0068861_100572329 | 3300005719 | Bacteria | 1033 |
| 164 | Ga0068858_100832431 | 3300005842 | Bacteria | 901 |
| 165 | Ga0068862_100986186 | 3300005844 | Bacteria | 833 |
| 166 | Ga0068862_101099680 | 3300005844 | Bacteria | 790 |
| 167 | Ga0081455_10010251 | 3300005937 | Bacteria | 9529 |
| 168 | Ga0081455_10011450 | 3300005937 | Bacteria | 8912 |
| 169 | Ga0081455_10012609 | 3300005937 | Bacteria | 8423 |
| 170 | Ga0081455_10243025 | 3300005937 | Bacteria | 1321 |
| 171 | Ga0081455_10363616 | 3300005937 | Bacteria | 1016 |
| 172 | Ga0081455_10564750 | 3300005937 | Bacteria | 749 |
| 173 | Ga0081538_10000518 | 3300005981 | Bacteria | 43151 |
| 174 | Ga0081538_10051296 | 3300005981 | Bacteria | 2479 |
| 175 | Ga0081538_10173146 | 3300005981 | Bacteria | 938 |
| 176 | Ga0081538_10174882 | 3300005981 | Bacteria | 929 |
| 177 | Ga0081539_10018622 | 3300005985 | Bacteria | 4807 |
| 178 | Ga0070717_10014276 | 3300006028 | Bacteria | 6109 |
| 179 | Ga0070717_10521603 | 3300006028 | Bacteria | 1075 |
| 180 | Ga0070715_10011644 | 3300006163 | Bacteria | 3173 |
| 181 | Ga0070715_10510508 | 3300006163 | Bacteria | 690 |
| 182 | Ga0070715_10692049 | 3300006163 | Bacteria | 608 |
| 183 | Ga0070712_100030457 | 3300006175 | Bacteria | 3626 |
| 184 | Ga0070712_100110168 | 3300006175 | Bacteria | 2053 |
| 185 | Ga0070712_100177212 | 3300006175 | Bacteria | 1658 |
| 186 | Ga0070712_100211056 | 3300006175 | Bacteria | 1531 |
| 187 | Ga0070712_101030674 | 3300006175 | Bacteria | 713 |
| 188 | Ga0097621_100870685 | 3300006237 | Bacteria | 838 |
| 189 | Ga0068871_100026449 | 3300006358 | Bacteria | 4527 |
| 190 | Ga0075433_10004384 | 3300006852 | Bacteria | 10975 |
| 191 | Ga0075433_10024478 | 3300006852 | Bacteria | 5096 |
| 192 | Ga0075433_10456585 | 3300006852 | Bacteria | 1126 |
| 193 | Ga0075433_11051538 | 3300006852 | Bacteria | 708 |
| 194 | Ga0075434_100005135 | 3300006871 | Bacteria | 11890 |
| 195 | Ga0075434_100023021 | 3300006871 | Bacteria | 6065 |
| 196 | Ga0075434_100529470 | 3300006871 | Bacteria | 1199 |
| 197 | Ga0075434_101554258 | 3300006871 | Bacteria | 670 |
| 198 | Ga0075434_101591479 | 3300006871 | Bacteria | 662 |
| 199 | Ga0075429_100742484 | 3300006880 | Bacteria | 860 |
| 200 | Ga0068865_100017722 | 3300006881 | Bacteria | 4584 |
| 201 | Ga0075436_100009853 | 3300006914 | Bacteria | 6536 |
| 202 | Ga0097620_100331517 | 3300006931 | Bacteria | 1616 |
| 203 | Ga0097620_101247658 | 3300006931 | Bacteria | 819 |
| 204 | Ga0075435_100000140 | 3300007076 | Bacteria | 40976 |
| 205 | Ga0075435_100020149 | 3300007076 | Bacteria | 5103 |
| 206 | Ga0075435_100024269 | 3300007076 | Bacteria | 4703 |
| 207 | Ga0075435_100045328 | 3300007076 | Bacteria | 3525 |
| 208 | Ga0075435_100806250 | 3300007076 | Bacteria | 817 |
| 209 | Ga0105244_10238047 | 3300009036 | Bacteria | 850 |
| 210 | Ga0105240_10222720 | 3300009093 | Bacteria | 2197 |
| 211 | Ga0105240_10439215 | 3300009093 | Bacteria | 1463 |
| 212 | Ga0105240_10637414 | 3300009093 | Bacteria | 1170 |
| 213 | Ga0105240_10708309 | 3300009093 | Bacteria | 1098 |
| 214 | Ga0105240_11069326 | 3300009093 | Bacteria | 860 |
| 215 | Ga0105240_11110382 | 3300009093 | Bacteria | 841 |
| 216 | Ga0111539_10031415 | 3300009094 | Bacteria | 6451 |
| 217 | Ga0111539_10089729 | 3300009094 | Bacteria | 3612 |
| 218 | Ga0111539_10867885 | 3300009094 | Bacteria | 1050 |
| 219 | Ga0105245_10011977 | 3300009098 | Bacteria | 7541 |
| 220 | Ga0105245_10119636 | 3300009098 | Bacteria | 2459 |
| 221 | Ga0105245_10431456 | 3300009098 | Bacteria | 1323 |
| 222 | Ga0105245_10746476 | 3300009098 | Bacteria | 1014 |
| 223 | Ga0105245_10864972 | 3300009098 | Bacteria | 945 |
| 224 | Ga0105245_11650211 | 3300009098 | Bacteria | 693 |
| 225 | Ga0105247_10203629 | 3300009101 | Bacteria | 1331 |
| 226 | Ga0114129_10009001 | 3300009147 | Bacteria | 14238 |
| 227 | Ga0114129_10048698 | 3300009147 | Bacteria | 5955 |
| 228 | Ga0114129_10056182 | 3300009147 | Bacteria | 5514 |
| 229 | Ga0114129_10385876 | 3300009147 | Bacteria | 1849 |
| 230 | Ga0114129_11103449 | 3300009147 | Bacteria | 993 |
| 231 | Ga0114129_12821085 | 3300009147 | Bacteria | 577 |
| 232 | Ga0105243_10032733 | 3300009148 | Bacteria | 4019 |
| 233 | Ga0105243_10080853 | 3300009148 | Bacteria | 2651 |
| 234 | Ga0105243_10513992 | 3300009148 | Bacteria | 1137 |
| 235 | Ga0105243_10581757 | 3300009148 | Bacteria | 1075 |
| 236 | Ga0105241_10043494 | 3300009174 | Bacteria | 3402 |
| 237 | Ga0105241_10268096 | 3300009174 | Bacteria | 1454 |
| 238 | Ga0105241_10405328 | 3300009174 | Bacteria | 1197 |
| 239 | Ga0105241_10816530 | 3300009174 | Bacteria | 860 |
| 240 | Ga0105242_10006264 | 3300009176 | Bacteria | 9162 |
| 241 | Ga0105242_11961248 | 3300009176 | Bacteria | 627 |
| 242 | Ga0105242_12274041 | 3300009176 | Bacteria | 588 |
| 243 | Ga0105248_10008130 | 3300009177 | Bacteria | 11517 |
| 244 | Ga0105248_10056872 | 3300009177 | Bacteria | 4389 |
| 245 | Ga0105248_10194172 | 3300009177 | Bacteria | 2287 |
| 246 | Ga0105248_10951507 | 3300009177 | Bacteria | 970 |
| 247 | Ga0105248_11117168 | 3300009177 | Bacteria | 891 |
| 248 | Ga0105237_10492868 | 3300009545 | Bacteria | 1232 |
| 249 | Ga0105238_10023360 | 3300009551 | Bacteria | 6303 |
| 250 | Ga0105249_10017957 | 3300009553 | Bacteria | 6286 |
| 251 | Ga0105249_10686243 | 3300009553 | Bacteria | 1083 |
| 252 | Ga0105249_11153319 | 3300009553 | Bacteria | 846 |
| 253 | Ga0105249_12218630 | 3300009553 | Bacteria | 622 |
| 254 | Ga0105239_10096721 | 3300010375 | Bacteria | 3262 |
| 255 | Ga0105239_10515853 | 3300010375 | Bacteria | 1360 |
| 256 | Ga0105239_11824757 | 3300010375 | Bacteria | 705 |
| 257 | Ga0105246_10322712 | 3300011119 | Bacteria | 1255 |
| 258 | Ga0157373_10164163 | 3300013100 | Bacteria | 1563 |
| 259 | Ga0157371_11027283 | 3300013102 | Bacteria | 630 |
| 260 | Ga0157370_10008306 | 3300013104 | Bacteria | 11204 |
| 261 | Ga0157370_10300734 | 3300013104 | Bacteria | 1481 |
| 262 | Ga0157370_10347658 | 3300013104 | Bacteria | 1367 |
| 263 | Ga0157370_10833691 | 3300013104 | Bacteria | 838 |
| 264 | Ga0157370_10932051 | 3300013104 | Bacteria | 788 |
| 265 | Ga0157369_10032180 | 3300013105 | Bacteria | 5769 |
| 266 | Ga0157369_10045279 | 3300013105 | Bacteria | 4786 |
| 267 | Ga0157369_10046810 | 3300013105 | Bacteria | 4700 |
| 268 | Ga0157369_10336345 | 3300013105 | Bacteria | 1569 |
| 269 | Ga0157369_10382575 | 3300013105 | Bacteria | 1461 |
| 270 | Ga0157369_10462735 | 3300013105 | Bacteria | 1313 |
| 271 | Ga0157369_11585855 | 3300013105 | Bacteria | 666 |
| 272 | Ga0157374_10033180 | 3300013296 | Bacteria | 4709 |
| 273 | Ga0157378_10018799 | 3300013297 | Bacteria | 6075 |
| 274 | Ga0157378_10345069 | 3300013297 | Bacteria | 1453 |
| 275 | Ga0157378_11503761 | 3300013297 | Bacteria | 718 |
| 276 | Ga0163162_10030463 | 3300013306 | Bacteria | 5345 |
| 277 | Ga0163162_10263641 | 3300013306 | Bacteria | 1855 |
| 278 | Ga0163162_10736469 | 3300013306 | Bacteria | 1106 |
| 279 | Ga0157372_10029001 | 3300013307 | Bacteria | 6038 |
| 280 | Ga0157372_10140215 | 3300013307 | Bacteria | 2785 |
| 281 | Ga0157372_10304928 | 3300013307 | Bacteria | 1853 |
| 282 | Ga0157372_10524982 | 3300013307 | Bacteria | 1380 |
| 283 | Ga0157372_10741397 | 3300013307 | Bacteria | 1142 |
| 284 | Ga0157375_10064197 | 3300013308 | Bacteria | 3655 |
| 285 | Ga0157375_10263695 | 3300013308 | Bacteria | 1884 |
| 286 | Ga0157375_10510413 | 3300013308 | Bacteria | 1366 |
| 287 | Ga0157375_10569078 | 3300013308 | Bacteria | 1294 |
| 288 | Ga0157375_10839944 | 3300013308 | Bacteria | 1065 |
| 289 | Ga0163163_10208813 | 3300014325 | Bacteria | 2001 |
| 290 | Ga0163163_10351850 | 3300014325 | Bacteria | 1529 |
| 291 | Ga0157380_10134754 | 3300014326 | Bacteria | 2112 |
| 292 | Ga0157380_10692548 | 3300014326 | Bacteria | 1023 |
| 293 | Ga0182008_10413879 | 3300014497 | Bacteria | 726 |
| 294 | Ga0157377_10003323 | 3300014745 | Bacteria | 7271 |
| 295 | Ga0157377_10562207 | 3300014745 | Bacteria | 808 |
| 296 | Ga0157379_10097916 | 3300014968 | Bacteria | 2633 |
| 297 | Ga0157376_10013033 | 3300014969 | Bacteria | 6193 |
| 298 | Ga0157376_10077981 | 3300014969 | Bacteria | 2835 |
| 299 | Ga0182006_1141934 | 3300015261 | Bacteria | 820 |
| 300 | Ga0182007_10231938 | 3300015262 | Bacteria | 656 |
| 301 | Ga0182007_10367363 | 3300015262 | Bacteria | 544 |
| 302 | Ga0197907_11047046 | 3300020069 | Bacteria | 1367 |
| 303 | Ga0197907_11349487 | 3300020069 | Bacteria | 1293 |
| 304 | Ga0206356_10777109 | 3300020070 | Bacteria | 1701 |
| 305 | Ga0206354_10741990 | 3300020081 | Bacteria | 2595 |
| 306 | Ga0206353_10780697 | 3300020082 | Bacteria | 735 |
| 307 | Ga0206353_11185381 | 3300020082 | Bacteria | 2081 |
| 308 | Ga0206353_11283255 | 3300020082 | Bacteria | 4825 |
| 309 | Ga0206353_11751382 | 3300020082 | Bacteria | 1296 |
| 310 | Ga0206353_11789119 | 3300020082 | Bacteria | 2995 |
| 311 | Ga0213873_10039551 | 3300021358 | Bacteria | 1209 |
| 312 | Ga0213874_10142815 | 3300021377 | Bacteria | 830 |
| 313 | Ga0213876_10273908 | 3300021384 | Bacteria | 897 |
| 314 | Ga0213871_10077264 | 3300021441 | Bacteria | 949 |
| 315 | Ga0207692_10064075 | 3300025898 | Bacteria | 1912 |
| 316 | Ga0207692_10113744 | 3300025898 | Bacteria | 1505 |
| 317 | Ga0207710_10343985 | 3300025900 | Bacteria | 759 |
| 318 | Ga0207688_10072754 | 3300025901 | Bacteria | 1953 |
| 319 | Ga0207688_10143079 | 3300025901 | Bacteria | 1408 |
| 320 | Ga0207688_10228445 | 3300025901 | Bacteria | 1123 |
| 321 | Ga0207688_10639295 | 3300025901 | Bacteria | 671 |
| 322 | Ga0207688_10839980 | 3300025901 | Bacteria | 582 |
| 323 | Ga0207685_10003453 | 3300025905 | Bacteria | 3846 |
| 324 | Ga0207685_10042480 | 3300025905 | Bacteria | 1707 |
| 325 | Ga0207685_10429030 | 3300025905 | Bacteria | 683 |
| 326 | Ga0207685_10487818 | 3300025905 | Bacteria | 646 |
| 327 | Ga0207699_10612734 | 3300025906 | Bacteria | 793 |
| 328 | Ga0207684_10039896 | 3300025910 | Bacteria | 3980 |
| 329 | Ga0207684_10308549 | 3300025910 | Bacteria | 1364 |
| 330 | Ga0207684_10702501 | 3300025910 | Bacteria | 859 |
| 331 | Ga0207707_10014838 | 3300025912 | Bacteria | 6786 |
| 332 | Ga0207707_10111137 | 3300025912 | Bacteria | 2396 |
| 333 | Ga0207707_10146159 | 3300025912 | Bacteria | 2067 |
| 334 | Ga0207707_10198241 | 3300025912 | Bacteria | 1751 |
| 335 | Ga0207707_10584770 | 3300025912 | Bacteria | 946 |
| 336 | Ga0207695_10543070 | 3300025913 | Bacteria | 1044 |
| 337 | Ga0207695_11223259 | 3300025913 | Bacteria | 631 |
| 338 | Ga0207695_11391233 | 3300025913 | Bacteria | 582 |
| 339 | Ga0207671_10044114 | 3300025914 | Bacteria | 3297 |
| 340 | Ga0207693_10003565 | 3300025915 | Bacteria | 13299 |
| 341 | Ga0207693_10018792 | 3300025915 | Bacteria | 5500 |
| 342 | Ga0207693_10019938 | 3300025915 | Bacteria | 5333 |
| 343 | Ga0207693_10086334 | 3300025915 | Bacteria | 2459 |
| 344 | Ga0207693_10302964 | 3300025915 | Bacteria | 1252 |
| 345 | Ga0207693_10422443 | 3300025915 | Bacteria | 1042 |
| 346 | Ga0207693_10452898 | 3300025915 | Bacteria | 1003 |
| 347 | Ga0207693_10651909 | 3300025915 | Bacteria | 818 |
| 348 | Ga0207693_11210892 | 3300025915 | Bacteria | 569 |
| 349 | Ga0207663_10007094 | 3300025916 | Bacteria | 5786 |
| 350 | Ga0207663_10226444 | 3300025916 | Bacteria | 1363 |
| 351 | Ga0207663_10381228 | 3300025916 | Bacteria | 1074 |
| 352 | Ga0207660_10009367 | 3300025917 | Bacteria | 6338 |
| 353 | Ga0207660_10028394 | 3300025917 | Bacteria | 3826 |
| 354 | Ga0207660_10183140 | 3300025917 | Bacteria | 1628 |
| 355 | Ga0207660_10185704 | 3300025917 | Bacteria | 1617 |
| 356 | Ga0207660_10193902 | 3300025917 | Bacteria | 1583 |
| 357 | Ga0207660_10444825 | 3300025917 | Bacteria | 1047 |
| 358 | Ga0207662_10269070 | 3300025918 | Bacteria | 1124 |
| 359 | Ga0207657_10000416 | 3300025919 | Bacteria | 45222 |
| 360 | Ga0207657_10000610 | 3300025919 | Bacteria | 37898 |
| 361 | Ga0207657_10004617 | 3300025919 | Bacteria | 14547 |
| 362 | Ga0207657_10022825 | 3300025919 | Bacteria | 5842 |
| 363 | Ga0207657_10151254 | 3300025919 | Bacteria | 1890 |
| 364 | Ga0207657_10154164 | 3300025919 | Bacteria | 1869 |
| 365 | Ga0207657_10296287 | 3300025919 | Bacteria | 1282 |
| 366 | Ga0207657_10463485 | 3300025919 | Bacteria | 994 |
| 367 | Ga0207649_10034017 | 3300025920 | Bacteria | 3050 |
| 368 | Ga0207649_10058915 | 3300025920 | Bacteria | 2407 |
| 369 | Ga0207649_10261521 | 3300025920 | Bacteria | 1250 |
| 370 | Ga0207649_10517658 | 3300025920 | Bacteria | 909 |
| 371 | Ga0207652_10003206 | 3300025921 | Bacteria | 13597 |
| 372 | Ga0207652_10017952 | 3300025921 | Bacteria | 5797 |
| 373 | Ga0207652_10213248 | 3300025921 | Bacteria | 1739 |
| 374 | Ga0207652_10315648 | 3300025921 | Bacteria | 1411 |
| 375 | Ga0207652_11106148 | 3300025921 | Bacteria | 693 |
| 376 | Ga0207646_10116678 | 3300025922 | Bacteria | 2398 |
| 377 | Ga0207646_10140658 | 3300025922 | Bacteria | 2173 |
| 378 | Ga0207646_10480907 | 3300025922 | Bacteria | 1120 |
| 379 | Ga0207646_10956458 | 3300025922 | Bacteria | 758 |
| 380 | Ga0207646_11341739 | 3300025922 | Bacteria | 623 |
| 381 | Ga0207646_11371729 | 3300025922 | Bacteria | 616 |
| 382 | Ga0207646_11774333 | 3300025922 | Bacteria | 528 |
| 383 | Ga0207659_10032822 | 3300025926 | Bacteria | 3567 |
| 384 | Ga0207659_10350236 | 3300025926 | Bacteria | 1225 |
| 385 | Ga0207687_10016945 | 3300025927 | Bacteria | 4788 |
| 386 | Ga0207687_10403443 | 3300025927 | Bacteria | 1125 |
| 387 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 388 | Ga0207700_10126938 | 3300025928 | Bacteria | 2077 |
| 389 | Ga0207700_10205214 | 3300025928 | Bacteria | 1663 |
| 390 | Ga0207700_10223947 | 3300025928 | Bacteria | 1596 |
| 391 | Ga0207700_11029053 | 3300025928 | Bacteria | 737 |
| 392 | Ga0207664_10002557 | 3300025929 | Bacteria | 12026 |
| 393 | Ga0207664_10116950 | 3300025929 | Bacteria | 2225 |
| 394 | Ga0207664_10152546 | 3300025929 | Bacteria | 1964 |
| 395 | Ga0207664_10176820 | 3300025929 | Bacteria | 1830 |
| 396 | Ga0207664_10178321 | 3300025929 | Bacteria | 1823 |
| 397 | Ga0207664_10180407 | 3300025929 | Bacteria | 1812 |
| 398 | Ga0207664_11029652 | 3300025929 | Bacteria | 737 |
| 399 | Ga0207644_10178931 | 3300025931 | Bacteria | 1661 |
| 400 | Ga0207644_10423624 | 3300025931 | Bacteria | 1091 |
| 401 | Ga0207644_11057209 | 3300025931 | Bacteria | 682 |
| 402 | Ga0207690_10034236 | 3300025932 | Bacteria | 3272 |
| 403 | Ga0207690_10047168 | 3300025932 | Bacteria | 2857 |
| 404 | Ga0207690_10155708 | 3300025932 | Bacteria | 1698 |
| 405 | Ga0207690_10180276 | 3300025932 | Bacteria | 1590 |
| 406 | Ga0207690_10321389 | 3300025932 | Bacteria | 1217 |
| 407 | Ga0207706_10031346 | 3300025933 | Bacteria | 4737 |
| 408 | Ga0207706_10390263 | 3300025933 | Bacteria | 1207 |
| 409 | Ga0207686_10048195 | 3300025934 | Bacteria | 2638 |
| 410 | Ga0207686_10895129 | 3300025934 | Bacteria | 716 |
| 411 | Ga0207709_10496246 | 3300025935 | Bacteria | 952 |
| 412 | Ga0207669_10075065 | 3300025937 | Bacteria | 2141 |
| 413 | Ga0207669_10292088 | 3300025937 | Bacteria | 1235 |
| 414 | Ga0207669_10968653 | 3300025937 | Bacteria | 714 |
| 415 | Ga0207704_10004032 | 3300025938 | Bacteria | 6686 |
| 416 | Ga0207665_10070955 | 3300025939 | Bacteria | 2377 |
| 417 | Ga0207665_10502673 | 3300025939 | Bacteria | 937 |
| 418 | Ga0207691_10013728 | 3300025940 | Bacteria | 7739 |
| 419 | Ga0207691_10539009 | 3300025940 | Bacteria | 990 |
| 420 | Ga0207711_10090389 | 3300025941 | Bacteria | 2692 |
| 421 | Ga0207711_10096344 | 3300025941 | Bacteria | 2611 |
| 422 | Ga0207711_11140097 | 3300025941 | Bacteria | 721 |
| 423 | Ga0207661_10023738 | 3300025944 | Bacteria | 4638 |
| 424 | Ga0207661_10209783 | 3300025944 | Bacteria | 1716 |
| 425 | Ga0207661_10263049 | 3300025944 | Bacteria | 1537 |
| 426 | Ga0207661_10768524 | 3300025944 | Bacteria | 887 |
| 427 | Ga0207661_10837006 | 3300025944 | Bacteria | 847 |
| 428 | Ga0207667_10099837 | 3300025949 | Bacteria | 2995 |
| 429 | Ga0207667_10136696 | 3300025949 | Bacteria | 2524 |
| 430 | Ga0207667_10143680 | 3300025949 | Bacteria | 2456 |
| 431 | Ga0207667_10194294 | 3300025949 | Bacteria | 2082 |
| 432 | Ga0207667_10239947 | 3300025949 | Bacteria | 1855 |
| 433 | Ga0207667_10253165 | 3300025949 | Bacteria | 1801 |
| 434 | Ga0207667_10594592 | 3300025949 | Bacteria | 1116 |
| 435 | Ga0207667_10884102 | 3300025949 | Bacteria | 886 |
| 436 | Ga0207667_11168952 | 3300025949 | Bacteria | 750 |
| 437 | Ga0207651_10159469 | 3300025960 | Bacteria | 1767 |
| 438 | Ga0207712_10032434 | 3300025961 | Bacteria | 3526 |
| 439 | Ga0207712_10863529 | 3300025961 | Bacteria | 798 |
| 440 | Ga0207668_10197019 | 3300025972 | Bacteria | 1601 |
| 441 | Ga0207640_10812205 | 3300025981 | Bacteria | 811 |
| 442 | Ga0207640_10939913 | 3300025981 | Bacteria | 757 |
| 443 | Ga0207640_11179175 | 3300025981 | Bacteria | 680 |
| 444 | Ga0207677_10094427 | 3300026023 | Bacteria | 2183 |
| 445 | Ga0207677_10568347 | 3300026023 | Bacteria | 991 |
| 446 | Ga0207677_10891209 | 3300026023 | Bacteria | 801 |
| 447 | Ga0207703_10355749 | 3300026035 | Bacteria | 1349 |
| 448 | Ga0207639_10068169 | 3300026041 | Bacteria | 2771 |
| 449 | Ga0207678_10018270 | 3300026067 | Bacteria | 6158 |
| 450 | Ga0207678_10194806 | 3300026067 | Bacteria | 1732 |
| 451 | Ga0207708_10022143 | 3300026075 | Bacteria | 4799 |
| 452 | Ga0207708_10024328 | 3300026075 | Bacteria | 4581 |
| 453 | Ga0207702_10022866 | 3300026078 | Bacteria | 5187 |
| 454 | Ga0207702_10199303 | 3300026078 | Bacteria | 1855 |
| 455 | Ga0207702_10307064 | 3300026078 | Bacteria | 1507 |
| 456 | Ga0207702_11335426 | 3300026078 | Bacteria | 711 |
| 457 | Ga0207641_10704317 | 3300026088 | Bacteria | 995 |
| 458 | Ga0207641_10820819 | 3300026088 | Bacteria | 921 |
| 459 | Ga0207648_10004050 | 3300026089 | Bacteria | 15221 |
| 460 | Ga0207648_10049380 | 3300026089 | Bacteria | 3681 |
| 461 | Ga0207648_10373785 | 3300026089 | Bacteria | 1288 |
| 462 | Ga0207676_10466005 | 3300026095 | Bacteria | 1194 |
| 463 | Ga0207676_10477664 | 3300026095 | Bacteria | 1180 |
| 464 | Ga0207674_10009649 | 3300026116 | Bacteria | 11008 |
| 465 | Ga0207674_10015268 | 3300026116 | Bacteria | 8445 |
| 466 | Ga0207674_10033571 | 3300026116 | Bacteria | 5372 |
| 467 | Ga0207674_10034595 | 3300026116 | Bacteria | 5280 |
| 468 | Ga0207675_100138731 | 3300026118 | Bacteria | 2309 |
| 469 | Ga0207675_101862906 | 3300026118 | Bacteria | 620 |
| 470 | Ga0207683_10002338 | 3300026121 | Bacteria | 16626 |
| 471 | Ga0207683_10105840 | 3300026121 | Bacteria | 2515 |
| 472 | Ga0207683_10206846 | 3300026121 | Bacteria | 1785 |
| 473 | Ga0207683_10703252 | 3300026121 | Bacteria | 937 |
| 474 | Ga0207698_10013668 | 3300026142 | Bacteria | 5365 |
| 475 | Ga0207698_10125784 | 3300026142 | Bacteria | 2179 |
| 476 | Ga0207698_10147953 | 3300026142 | Bacteria | 2034 |
| 477 | Ga0207698_10329570 | 3300026142 | Bacteria | 1433 |
| 478 | Ga0207698_10457688 | 3300026142 | Bacteria | 1233 |
| 479 | Ga0207428_10297768 | 3300027907 | Bacteria | 1194 |
| 480 | Ga0207428_10336607 | 3300027907 | Bacteria | 1112 |
| 481 | Ga0268266_10048959 | 3300028379 | Bacteria | 3623 |
| 482 | Ga0268266_10815941 | 3300028379 | Bacteria | 901 |
| 483 | Ga0268266_10938016 | 3300028379 | Bacteria | 837 |
| 484 | Ga0265319_1120671 | 3300028563 | Bacteria | 817 |
| 485 | Ga0265334_10015319 | 3300028573 | Bacteria | 3186 |
| 486 | Ga0265334_10033057 | 3300028573 | Bacteria | 2061 |
| 487 | Ga0265334_10114416 | 3300028573 | Bacteria | 968 |
| 488 | Ga0265334_10142860 | 3300028573 | Bacteria | 847 |
| 489 | Ga0265318_10010160 | 3300028577 | Bacteria | 4112 |
| 490 | Ga0265318_10025573 | 3300028577 | Bacteria | 2330 |
| 491 | Ga0265318_10266915 | 3300028577 | Bacteria | 624 |
| 492 | Ga0265322_10015344 | 3300028654 | Bacteria | 2214 |
| 493 | Ga0265338_10028139 | 3300028800 | Bacteria | 5615 |
| 494 | Ga0265328_10044387 | 3300031239 | Bacteria | 1635 |
| 495 | Ga0265320_10226574 | 3300031240 | Bacteria | 832 |
| 496 | Ga0265325_10029899 | 3300031241 | Bacteria | 2925 |
| 497 | Ga0265327_10097793 | 3300031251 | Bacteria | 1421 |
| 498 | Ga0265327_10413925 | 3300031251 | Bacteria | 584 |
| 499 | Ga0265316_10181661 | 3300031344 | Bacteria | 1566 |
| 500 | Ga0265316_10761147 | 3300031344 | Bacteria | 680 |
| 501 | Ga0307408_100015573 | 3300031548 | Bacteria | 5064 |
| 502 | Ga0307408_100287868 | 3300031548 | Bacteria | 1371 |
| 503 | Ga0307408_100384526 | 3300031548 | Bacteria | 1201 |
| 504 | Ga0307408_100533329 | 3300031548 | Bacteria | 1033 |
| 505 | Ga0265313_10055786 | 3300031595 | Bacteria | 1870 |
| 506 | Ga0265314_10012245 | 3300031711 | Bacteria | 7017 |
| 507 | Ga0265342_10150680 | 3300031712 | Bacteria | 1291 |
| 508 | Ga0265342_10332060 | 3300031712 | Bacteria | 795 |
| 509 | Ga0307405_10004812 | 3300031731 | Bacteria | 6440 |
| 510 | Ga0307405_10435309 | 3300031731 | Bacteria | 1036 |
| 511 | Ga0307405_11088093 | 3300031731 | Bacteria | 686 |
| 512 | Ga0307413_10597116 | 3300031824 | Bacteria | 903 |
| 513 | Ga0307410_10417627 | 3300031852 | Bacteria | 1087 |
| 514 | Ga0307406_10182313 | 3300031901 | Bacteria | 1530 |
| 515 | Ga0307406_11130915 | 3300031901 | Bacteria | 677 |
| 516 | Ga0307407_10031785 | 3300031903 | Bacteria | 2863 |
| 517 | Ga0307407_10502923 | 3300031903 | Bacteria | 889 |
| 518 | Ga0307412_10560373 | 3300031911 | Bacteria | 961 |
| 519 | Ga0307412_10940949 | 3300031911 | Bacteria | 760 |
| 520 | Ga0307412_11086437 | 3300031911 | Bacteria | 711 |
| 521 | Ga0307409_100025747 | 3300031995 | Bacteria | 4134 |
| 522 | Ga0307409_100061797 | 3300031995 | Bacteria | 2929 |
| 523 | Ga0307416_100040131 | 3300032002 | Bacteria | 3633 |
| 524 | Ga0307416_100118391 | 3300032002 | Bacteria | 2353 |
| 525 | Ga0307416_100222007 | 3300032002 | Bacteria | 1813 |
| 526 | Ga0307416_100360839 | 3300032002 | Bacteria | 1475 |
| 527 | Ga0307416_101218764 | 3300032002 | Bacteria | 858 |
| 528 | Ga0307414_10243475 | 3300032004 | Bacteria | 1490 |
| 529 | Ga0307411_10153998 | 3300032005 | Bacteria | 1712 |
| 530 | Ga0307415_100832037 | 3300032126 | Bacteria | 845 |
| 531 | Ga0307415_101273243 | 3300032126 | Bacteria | 695 |
| 532 | Ga0373959_0019332 | 3300034820 | Bacteria | 1290 |
| 533 | Ga0373926_0095199 | 3300035083 | Bacteria | 1110 |
| 534 | Ga0373934_0137215 | 3300035086 | Bacteria | 999 |
| 535 | Ga0373934_0430607 | 3300035086 | Bacteria | 552 |
| 536 | Ga0373944_0072406 | 3300035089 | Bacteria | 1125 |
| 537 | Ga0373936_0020681 | 3300035113 | Bacteria | 2558 |
| 538 | Ga0373953_0032746 | 3300035117 | Bacteria | 2030 |
| 539 | Ga0373953_0330680 | 3300035117 | Bacteria | 667 |
| 540 | Ga0373957_0025026 | 3300035120 | Bacteria | 2148 |
| 541 | Ga0373943_0000899 | 3300035170 | Bacteria | 13105 |
| 542 | Ga0373943_0039717 | 3300035170 | Bacteria | 2269 |
| 543 | Ga0373943_0087086 | 3300035170 | Bacteria | 1611 |
| 544 | Ga0373946_0044796 | 3300035171 | Bacteria | 1828 |
| 545 | Ga0373955_0008799 | 3300035172 | Bacteria | 4704 |
| 546 | Ga0373942_0049779 | 3300035207 | Bacteria | 1171 |
| 547 | Ga0373924_0079925 | 3300035410 | Bacteria | 1389 |
| 548 | Ga0373931_0039207 | 3300035691 | Bacteria | 2482 |
| 549 | Ga0373927_0135226 | 3300035695 | Bacteria | 1611 |
| 550 | Ga0373927_0281848 | 3300035695 | Bacteria | 1093 |
| 551 | Ga0373933_0297194 | 3300035724 | Bacteria | 1045 |
| 552 | Ga0373947_0003187 | 3300035725 | Bacteria | 9757 |
| 553 | Ga0373947_0033686 | 3300035725 | Bacteria | 3026 |
| 554 | Ga0373947_0060207 | 3300035725 | Bacteria | 2305 |
| 555 | Ga0373947_0760366 | 3300035725 | Bacteria | 661 |
| 556 | Ga0373937_0076296 | 3300036401 | Bacteria | 3095 |
| 557 | Ga0373937_0193836 | 3300036401 | Bacteria | 1910 |
| 558 | Ga0373925_0744518 | 3300037068 | Bacteria | 808 |
| 559 | Ga0395899_0001001 | 3300037312 | Bacteria | 25945 |
| 560 | Ga0395899_0015657 | 3300037312 | Bacteria | 5783 |
| 561 | Ga0395899_0018455 | 3300037312 | Bacteria | 5303 |
| 562 | Ga0395899_0032687 | 3300037312 | Bacteria | 3910 |
| 563 | Ga0395899_0035364 | 3300037312 | Bacteria | 3750 |
| 564 | Ga0395899_0041054 | 3300037312 | Bacteria | 3458 |
| 565 | Ga0395899_0081807 | 3300037312 | Bacteria | 2349 |
| 566 | Ga0395899_0090882 | 3300037312 | Bacteria | 2213 |
| 567 | Ga0395899_0091878 | 3300037312 | Bacteria | 2198 |
| 568 | Ga0395899_0094300 | 3300037312 | Bacteria | 2166 |
| 569 | Ga0395899_0146113 | 3300037312 | Bacteria | 1679 |
| 570 | Ga0395899_0212186 | 3300037312 | Bacteria | 1345 |
| 571 | Ga0395899_0272526 | 3300037312 | Bacteria | 1154 |
| 572 | Ga0395899_0650435 | 3300037312 | Bacteria | 666 |
| 573 | Ga0395899_0948472 | 3300037312 | Bacteria | 522 |
| 574 | Ga0395900_0004233 | 3300037418 | Bacteria | 15232 |
| 575 | Ga0395900_0004700 | 3300037418 | Bacteria | 14396 |
| 576 | Ga0395900_0004724 | 3300037418 | Bacteria | 14368 |
| 577 | Ga0395900_0014519 | 3300037418 | Bacteria | 8037 |
| 578 | Ga0395900_0015755 | 3300037418 | Bacteria | 7705 |
| 579 | Ga0395900_0015897 | 3300037418 | Bacteria | 7666 |
| 580 | Ga0395900_0025692 | 3300037418 | Bacteria | 6029 |
| 581 | Ga0395900_0028300 | 3300037418 | Bacteria | 5740 |
| 582 | Ga0395900_0029582 | 3300037418 | Bacteria | 5619 |
| 583 | Ga0395900_0032992 | 3300037418 | Bacteria | 5328 |
| 584 | Ga0395900_0086108 | 3300037418 | Bacteria | 3229 |
| 585 | Ga0395900_0109879 | 3300037418 | Bacteria | 2833 |
| 586 | Ga0395900_0116756 | 3300037418 | Bacteria | 2738 |
| 587 | Ga0395900_0172876 | 3300037418 | Bacteria | 2198 |
| 588 | Ga0395900_0173719 | 3300037418 | Bacteria | 2192 |
| 589 | Ga0395900_0187989 | 3300037418 | Bacteria | 2096 |
| 590 | Ga0395900_0201725 | 3300037418 | Bacteria | 2012 |
| 591 | Ga0395900_0229164 | 3300037418 | Bacteria | 1869 |
| 592 | Ga0395900_0315526 | 3300037418 | Bacteria | 1545 |
| 593 | Ga0395900_0424851 | 3300037418 | Bacteria | 1289 |
| 594 | Ga0395900_0654618 | 3300037418 | Bacteria | 987 |
| 595 | Ga0395898_0004894 | 3300037466 | Bacteria | 14544 |
| 596 | Ga0395898_0006542 | 3300037466 | Bacteria | 12435 |
| 597 | Ga0395898_0008982 | 3300037466 | Bacteria | 10525 |
| 598 | Ga0395898_0016102 | 3300037466 | Bacteria | 7659 |
| 599 | Ga0395898_0021780 | 3300037466 | Bacteria | 6494 |
| 600 | Ga0395898_0031400 | 3300037466 | Bacteria | 5307 |
| 601 | Ga0395898_0039643 | 3300037466 | Bacteria | 4661 |
| 602 | Ga0395898_0053413 | 3300037466 | Bacteria | 3946 |
| 603 | Ga0395898_0076712 | 3300037466 | Bacteria | 3227 |
| 604 | Ga0395898_0119682 | 3300037466 | Bacteria | 2523 |
| 605 | Ga0395898_0155740 | 3300037466 | Bacteria | 2185 |
| 606 | Ga0395898_0171390 | 3300037466 | Bacteria | 2075 |
| 607 | Ga0395898_0196487 | 3300037466 | Bacteria | 1927 |
| 608 | Ga0395898_0244556 | 3300037466 | Bacteria | 1711 |
| 609 | Ga0395898_0285893 | 3300037466 | Bacteria | 1573 |
| 610 | Ga0395898_0506784 | 3300037466 | Bacteria | 1148 |
| 611 | Ga0395898_0832280 | 3300037466 | Bacteria | 863 |
| 612 | Ga0395898_1158190 | 3300037466 | Bacteria | 705 |
| 613 | Ga0395905_0005063 | 3300037471 | Bacteria | 13564 |
| 614 | Ga0395905_0005451 | 3300037471 | Bacteria | 12987 |
| 615 | Ga0395905_0010082 | 3300037471 | Bacteria | 9209 |
| 616 | Ga0395905_0014689 | 3300037471 | Bacteria | 7468 |
| 617 | Ga0395905_0023069 | 3300037471 | Bacteria | 5883 |
| 618 | Ga0395905_0028306 | 3300037471 | Bacteria | 5281 |
| 619 | Ga0395905_0064605 | 3300037471 | Bacteria | 3425 |
| 620 | Ga0395905_0079795 | 3300037471 | Bacteria | 3067 |
| 621 | Ga0395905_0103737 | 3300037471 | Bacteria | 2669 |
| 622 | Ga0395905_0104764 | 3300037471 | Bacteria | 2656 |
| 623 | Ga0395905_0108622 | 3300037471 | Bacteria | 2604 |
| 624 | Ga0395905_0301032 | 3300037471 | Bacteria | 1491 |
| 625 | Ga0395905_0491894 | 3300037471 | Bacteria | 1126 |
| 626 | Ga0395905_0491959 | 3300037471 | Bacteria | 1126 |
| 627 | Ga0395905_0560368 | 3300037471 | Bacteria | 1044 |
| 628 | Ga0395905_0818853 | 3300037471 | Bacteria | 834 |
| 629 | Ga0395905_1026758 | 3300037471 | Bacteria | 728 |
| 630 | Ga0395901_0002221 | 3300038443 | Bacteria | 19812 |
| 631 | Ga0395901_0002468 | 3300038443 | Bacteria | 18763 |
| 632 | Ga0395901_0016661 | 3300038443 | Bacteria | 7487 |
| 633 | Ga0395901_0017935 | 3300038443 | Bacteria | 7225 |
| 634 | Ga0395901_0018242 | 3300038443 | Bacteria | 7164 |
| 635 | Ga0395901_0029987 | 3300038443 | Bacteria | 5603 |
| 636 | Ga0395901_0036111 | 3300038443 | Bacteria | 5105 |
| 637 | Ga0395901_0049122 | 3300038443 | Bacteria | 4382 |
| 638 | Ga0395901_0052058 | 3300038443 | Bacteria | 4256 |
| 639 | Ga0395901_0053242 | 3300038443 | Bacteria | 4205 |
| 640 | Ga0395901_0095541 | 3300038443 | Bacteria | 3114 |
| 641 | Ga0395901_0115220 | 3300038443 | Bacteria | 2823 |
| 642 | Ga0395901_0168721 | 3300038443 | Bacteria | 2297 |
| 643 | Ga0395901_0181430 | 3300038443 | Bacteria | 2208 |
| 644 | Ga0395901_0284494 | 3300038443 | Bacteria | 1717 |
| 645 | Ga0395901_0291567 | 3300038443 | Bacteria | 1693 |
| 646 | Ga0395901_0408991 | 3300038443 | Bacteria | 1393 |
| 647 | Ga0395901_0475947 | 3300038443 | Bacteria | 1274 |
| 648 | Ga0395901_0667355 | 3300038443 | Bacteria | 1041 |
| 649 | Ga0395901_0745974 | 3300038443 | Bacteria | 972 |
| 650 | Ga0395901_0817566 | 3300038443 | Bacteria | 919 |
| 651 | Ga0395901_1223430 | 3300038443 | Bacteria | 716 |
| 652 | Ga0436365_1553456 | 3300039437 | Bacteria | 1073 |
| 653 | Ga0436360_0506477 | 3300039438 | Bacteria | 5147 |
| 654 | Ga0436360_0511686 | 3300039438 | Bacteria | 594 |
| 655 | Ga0436363_0668989 | 3300039450 | Bacteria | 616 |
| 656 | Ga0436363_1348640 | 3300039450 | Bacteria | 678 |
| 657 | Ga0436362_0327669 | 3300039453 | Bacteria | 2618 |
| 658 | Ga0439438_045069 | 3300041405 | Bacteria | 1135 |
| 659 | Ga0439438_120893 | 3300041405 | Bacteria | 630 |
| 660 | Ga0439461_0003605 | 3300041410 | Bacteria | 2553 |
| 661 | Ga0439465_0098857 | 3300041413 | Bacteria | 1006 |
| 662 | Ga0451835_0827407 | 3300041492 | Bacteria | 906 |
| 663 | Ga0439431_0130726 | 3300041997 | Bacteria | 705 |
| 664 | Ga0439441_012332 | 3300042001 | Bacteria | 1465 |
| 665 | Ga0439445_0242928 | 3300042004 | Bacteria | 537 |
| 666 | Ga0439463_043686 | 3300042016 | Bacteria | 1141 |
| 667 | Ga0450917_008674 | 3300042120 | Bacteria | 790 |
| 668 | Ga0450906_055882 | 3300042145 | Bacteria | 699 |
| 669 | Ga0450907_011944 | 3300042146 | Bacteria | 1443 |
| 670 | Ga0439446_0361271 | 3300042156 | Bacteria | 519 |
| 671 | Ga0450908_042915 | 3300042184 | Bacteria | 784 |
| 672 | Ga0439434_0015538 | 3300042435 | Bacteria | 2271 |
| 673 | Ga0466969_0103243 | 3300044656 | Bacteria | 1340 |
| 674 | Ga0466972_0455956 | 3300044658 | Bacteria | 601 |
| 675 | Ga0466966_0013321 | 3300044684 | Bacteria | 5444 |
| 676 | Ga0466966_0055786 | 3300044684 | Bacteria | 2500 |
| 677 | Ga0466966_0103961 | 3300044684 | Bacteria | 1755 |
| 678 | Ga0466966_0128302 | 3300044684 | Bacteria | 1554 |
| 679 | Ga0466966_0296909 | 3300044684 | Bacteria | 971 |
| 680 | Ga0466961_0001805 | 3300044693 | Bacteria | 13266 |
| 681 | Ga0466963_0003083 | 3300044694 | Bacteria | 9444 |
| 682 | Ga0466963_0041038 | 3300044694 | Bacteria | 3034 |
| 683 | Ga0466964_0003275 | 3300044706 | Bacteria | 5892 |
| 684 | Ga0466964_0004021 | 3300044706 | Bacteria | 5405 |
| 685 | Ga0466964_0006266 | 3300044706 | Bacteria | 4432 |
| 686 | Ga0466964_0007545 | 3300044706 | Bacteria | 4070 |
| 687 | Ga0466964_0125030 | 3300044706 | Bacteria | 1164 |
| 688 | Ga0466971_0026732 | 3300044719 | Bacteria | 2581 |
| 689 | Ga0466968_0026293 | 3300044735 | Bacteria | 2387 |
| 690 | Ga0466968_0265340 | 3300044735 | Bacteria | 818 |
| 691 | Ga0466957_0035461 | 3300044842 | Bacteria | 2993 |
| 692 | Ga0466957_0045276 | 3300044842 | Bacteria | 2669 |
| 693 | Ga0466957_0102563 | 3300044842 | Bacteria | 1805 |
| 694 | Ga0466957_0199451 | 3300044842 | Bacteria | 1314 |
| 695 | Ga0466957_0603646 | 3300044842 | Bacteria | 768 |
| 696 | Ga0466960_0026703 | 3300044901 | Bacteria | 2626 |
| 697 | Ga0466959_0059584 | 3300045049 | Bacteria | 2780 |
| 698 | Ga0466959_0138653 | 3300045049 | Bacteria | 1720 |
| 699 | Ga0466959_0148827 | 3300045049 | Bacteria | 1651 |
| 700 | Ga0466958_0007711 | 3300045836 | Bacteria | 5937 |
| 701 | Ga0466958_0066985 | 3300045836 | Bacteria | 2193 |
| 702 | Ga0466958_0214086 | 3300045836 | Bacteria | 1228 |
| 703 | Ga0466958_0220499 | 3300045836 | Bacteria | 1210 |
| 704 | Ga0466958_0853854 | 3300045836 | Bacteria | 594 |
| 705 | Ga0466967_0001914 | 3300045976 | Bacteria | 12584 |
| 706 | Ga0466967_0003262 | 3300045976 | Bacteria | 10507 |
| 707 | Ga0466967_0011854 | 3300045976 | Bacteria | 6631 |
| 708 | Ga0466967_0015468 | 3300045976 | Bacteria | 5982 |
| 709 | Ga0466967_0025617 | 3300045976 | Bacteria | 4867 |
| 710 | Ga0466967_0054908 | 3300045976 | Bacteria | 3508 |
| 711 | Ga0466967_0084997 | 3300045976 | Bacteria | 2864 |
| 712 | Ga0466967_0087121 | 3300045976 | Bacteria | 2830 |
| 713 | Ga0466967_0094124 | 3300045976 | Bacteria | 2727 |
| 714 | Ga0466967_0115898 | 3300045976 | Bacteria | 2468 |
| 715 | Ga0466967_0137708 | 3300045976 | Bacteria | 2271 |
| 716 | Ga0466967_0160751 | 3300045976 | Bacteria | 2108 |
| 717 | Ga0466967_0179667 | 3300045976 | Bacteria | 1995 |
| 718 | Ga0466967_0213864 | 3300045976 | Bacteria | 1829 |
| 719 | Ga0466967_0237608 | 3300045976 | Bacteria | 1737 |
| 720 | Ga0466967_0433146 | 3300045976 | Bacteria | 1283 |
| 721 | Ga0466967_0551817 | 3300045976 | Bacteria | 1134 |
| 722 | Ga0466967_0858283 | 3300045976 | Bacteria | 902 |
| 723 | Ga0466967_1476351 | 3300045976 | Bacteria | 677 |
| 724 | Ga0495592_0112947 | 3300046454 | Bacteria | 1920 |
| 725 | Ga0495592_0114033 | 3300046454 | Bacteria | 1909 |
| 726 | Ga0495592_0750564 | 3300046454 | Bacteria | 583 |
| 727 | Ga0495603_0023275 | 3300046455 | Bacteria | 3751 |
| 728 | Ga0495629_0046938 | 3300046459 | Bacteria | 3029 |
| 729 | Ga0495629_0114708 | 3300046459 | Bacteria | 1877 |
| 730 | Ga0495629_0483832 | 3300046459 | Bacteria | 836 |
| 731 | Ga0495629_0819019 | 3300046459 | Bacteria | 613 |
| 732 | Ga0495641_0001250 | 3300046461 | Bacteria | 21835 |
| 733 | Ga0495641_0023550 | 3300046461 | Bacteria | 3056 |
| 734 | Ga0495651_0012474 | 3300046462 | Bacteria | 6553 |
| 735 | Ga0495651_0040858 | 3300046462 | Bacteria | 3603 |
| 736 | Ga0495651_0248700 | 3300046462 | Bacteria | 1215 |
| 737 | Ga0495653_0061120 | 3300046463 | Bacteria | 2851 |
| 738 | Ga0495653_0587652 | 3300046463 | Bacteria | 686 |
| 739 | Ga0495582_0000397 | 3300046473 | Bacteria | 23729 |
| 740 | Ga0495582_0127741 | 3300046473 | Bacteria | 1435 |
| 741 | Ga0495605_0061489 | 3300046474 | Bacteria | 1797 |
| 742 | Ga0495605_0183141 | 3300046474 | Bacteria | 920 |
| 743 | Ga0495639_0002254 | 3300046475 | Bacteria | 8463 |
| 744 | Ga0495662_0035472 | 3300046476 | Bacteria | 2406 |
| 745 | Ga0495664_0016551 | 3300046477 | Bacteria | 4202 |
| 746 | Ga0495664_0276691 | 3300046477 | Bacteria | 1014 |
| 747 | Ga0495664_0496142 | 3300046477 | Bacteria | 729 |
| 748 | Ga0495584_0084022 | 3300046491 | Bacteria | 1603 |
| 749 | Ga0495584_0105889 | 3300046491 | Bacteria | 1422 |
| 750 | Ga0495584_0108216 | 3300046491 | Bacteria | 1406 |
| 751 | Ga0495585_0266184 | 3300046492 | Bacteria | 851 |
| 752 | Ga0495596_0074630 | 3300046500 | Bacteria | 1317 |
| 753 | Ga0495596_0105199 | 3300046500 | Bacteria | 1096 |
| 754 | Ga0495596_0156887 | 3300046500 | Bacteria | 884 |
| 755 | Ga0495596_0335123 | 3300046500 | Bacteria | 589 |
| 756 | Ga0495607_0099382 | 3300046501 | Bacteria | 1561 |
| 757 | Ga0495607_0225143 | 3300046501 | Bacteria | 915 |
| 758 | Ga0495607_0245655 | 3300046501 | Bacteria | 864 |
| 759 | Ga0495608_0029157 | 3300046511 | Bacteria | 3746 |
| 760 | Ga0495608_0052486 | 3300046511 | Bacteria | 2699 |
| 761 | Ga0495616_0088845 | 3300046513 | Bacteria | 1467 |
| 762 | Ga0495616_0428307 | 3300046513 | Bacteria | 539 |
| 763 | Ga0495618_0241671 | 3300046514 | Bacteria | 1135 |
| 764 | Ga0495618_0260148 | 3300046514 | Bacteria | 1087 |
| 765 | Ga0495628_0013424 | 3300046516 | Bacteria | 6891 |
| 766 | Ga0495628_0181249 | 3300046516 | Bacteria | 1593 |
| 767 | Ga0495630_0066836 | 3300046517 | Bacteria | 2702 |
| 768 | Ga0495630_0075867 | 3300046517 | Bacteria | 2532 |
| 769 | Ga0495630_0135334 | 3300046517 | Bacteria | 1872 |
| 770 | Ga0495630_0228121 | 3300046517 | Bacteria | 1422 |
| 771 | Ga0495630_0398463 | 3300046517 | Bacteria | 1054 |
| 772 | Ga0495630_0538046 | 3300046517 | Bacteria | 896 |
| 773 | Ga0495631_0325870 | 3300046518 | Bacteria | 654 |
| 774 | Ga0495637_0028523 | 3300046520 | Bacteria | 2493 |
| 775 | Ga0495644_0128343 | 3300046523 | Bacteria | 966 |
| 776 | Ga0495663_0154082 | 3300046525 | Bacteria | 786 |
| 777 | Ga0495663_0268888 | 3300046525 | Bacteria | 609 |
| 778 | Ga0495666_0019709 | 3300046526 | Bacteria | 3345 |
| 779 | Ga0495666_0100536 | 3300046526 | Bacteria | 1363 |
| 780 | Ga0495642_0235976 | 3300046528 | Bacteria | 799 |
| 781 | Ga0495652_0012598 | 3300046529 | Bacteria | 7623 |
| 782 | Ga0495652_0189526 | 3300046529 | Bacteria | 1570 |
| 783 | Ga0495652_0402912 | 3300046529 | Bacteria | 968 |
| 784 | Ga0495665_0026888 | 3300046531 | Bacteria | 3089 |
| 785 | Ga0495640_0035402 | 3300046533 | Bacteria | 3533 |
| 786 | Ga0495640_0044499 | 3300046533 | Bacteria | 3086 |
| 787 | Ga0495586_0103308 | 3300046535 | Bacteria | 1583 |
| 788 | Ga0495587_0022577 | 3300046536 | Bacteria | 3874 |
| 789 | Ga0495587_0048446 | 3300046536 | Bacteria | 2516 |
| 790 | Ga0495598_0102770 | 3300046537 | Bacteria | 948 |
| 791 | Ga0495598_0131980 | 3300046537 | Bacteria | 857 |
| 792 | Ga0495645_0060684 | 3300046543 | Bacteria | 2741 |
| 793 | Ga0495645_0096890 | 3300046543 | Bacteria | 2101 |
| 794 | Ga0495645_0180645 | 3300046543 | Bacteria | 1446 |
| 795 | Ga0495645_0626745 | 3300046543 | Bacteria | 659 |
| 796 | Ga0495667_0041845 | 3300046559 | Bacteria | 3037 |
| 797 | Ga0495667_0050247 | 3300046559 | Bacteria | 2753 |
| 798 | Ga0495667_0478577 | 3300046559 | Bacteria | 781 |
| 799 | Ga0495667_0502674 | 3300046559 | Bacteria | 759 |
| 800 | Ga0495656_0036803 | 3300046615 | Bacteria | 2018 |
| 801 | Ga0495656_0196125 | 3300046615 | Bacteria | 1000 |
| 802 | Ga0495634_0076063 | 3300046642 | Bacteria | 2204 |
| 803 | Ga0495634_0120097 | 3300046642 | Bacteria | 1683 |
| 804 | Ga0495611_0094636 | 3300046648 | Bacteria | 1382 |
| 805 | Ga0495635_0013378 | 3300046663 | Bacteria | 5743 |
| 806 | Ga0495635_0015938 | 3300046663 | Bacteria | 5250 |
| 807 | Ga0495659_0171023 | 3300046664 | Bacteria | 881 |
| 808 | Ga0495661_0370205 | 3300046665 | Bacteria | 702 |
| 809 | Ga0495661_0420876 | 3300046665 | Bacteria | 647 |
| 810 | Ga0495588_0059077 | 3300046674 | Bacteria | 1983 |
| 811 | Ga0495657_0038175 | 3300046675 | Bacteria | 3307 |
| 812 | Ga0495657_0116590 | 3300046675 | Bacteria | 1686 |
| 813 | Ga0495657_0175077 | 3300046675 | Bacteria | 1319 |
| 814 | Ga0495657_0390097 | 3300046675 | Bacteria | 820 |
| 815 | Ga0495657_0562755 | 3300046675 | Bacteria | 661 |
| 816 | Ga0495599_0101990 | 3300046678 | Bacteria | 1788 |
| 817 | Ga0495599_0317149 | 3300046678 | Bacteria | 939 |
| 818 | Ga0495599_0727878 | 3300046678 | Bacteria | 570 |
| 819 | Ga0495623_0041457 | 3300046679 | Bacteria | 2935 |
| 820 | Ga0495623_0118047 | 3300046679 | Bacteria | 1601 |
| 821 | Ga0495646_0101109 | 3300046680 | Bacteria | 1653 |
| 822 | Ga0495646_0105173 | 3300046680 | Bacteria | 1613 |
| 823 | Ga0495647_0001542 | 3300046681 | Bacteria | 7117 |
| 824 | Ga0495658_0001563 | 3300046683 | Bacteria | 11965 |
| 825 | Ga0495669_0300484 | 3300046684 | Bacteria | 774 |
| 826 | Ga0495613_0001506 | 3300046689 | Bacteria | 17725 |
| 827 | Ga0495613_0319079 | 3300046689 | Bacteria | 1073 |
| 828 | Ga0495613_0736123 | 3300046689 | Bacteria | 647 |
| 829 | Ga0495624_0494701 | 3300046690 | Bacteria | 732 |
| 830 | Ga0495649_0564922 | 3300046694 | Bacteria | 563 |
| 831 | Ga0495589_0107891 | 3300046794 | Bacteria | 1345 |
| 832 | Ga0495589_0426537 | 3300046794 | Bacteria | 608 |
| 833 | Ga0495600_0057459 | 3300046809 | Bacteria | 2541 |
| 834 | Ga0495600_0133015 | 3300046809 | Bacteria | 1616 |
| 835 | Ga0495581_0002960 | 3300047315 | Bacteria | 9722 |
| 836 | Ga0495581_0412987 | 3300047315 | Bacteria | 787 |
| 837 | Ga0495604_0003309 | 3300047317 | Bacteria | 12857 |
| 838 | Ga0495604_0163609 | 3300047317 | Bacteria | 1570 |
| 839 | Ga0495604_0166394 | 3300047317 | Bacteria | 1554 |
| 840 | Ga0495636_0246872 | 3300047318 | Bacteria | 825 |
| 841 | Ga0495674_0038374 | 3300047319 | Bacteria | 4300 |
| 842 | Ga0495674_0046005 | 3300047319 | Bacteria | 3875 |
| 843 | Ga0495674_0055190 | 3300047319 | Bacteria | 3485 |
| 844 | Ga0495674_0066253 | 3300047319 | Bacteria | 3134 |
| 845 | Ga0495676_0087650 | 3300047321 | Bacteria | 2338 |
| 846 | Ga0495680_0006197 | 3300047322 | Bacteria | 11149 |
| 847 | Ga0495680_0006671 | 3300047322 | Bacteria | 10691 |
| 848 | Ga0495680_0080049 | 3300047322 | Bacteria | 2469 |
| 849 | Ga0495680_0095433 | 3300047322 | Bacteria | 2223 |
| 850 | Ga0495680_0374265 | 3300047322 | Bacteria | 988 |
| 851 | Ga0495683_0432331 | 3300047323 | Bacteria | 543 |
| 852 | Ga0495675_0054671 | 3300047444 | Bacteria | 2533 |
| 853 | Ga0495684_0019345 | 3300047471 | Bacteria | 5242 |
| 854 | Ga0495684_0029105 | 3300047471 | Bacteria | 4239 |
| 855 | Ga0495593_0004029 | 3300047673 | Bacteria | 8758 |
| 856 | Ga0495602_0006483 | 3300048088 | Bacteria | 12277 |
| 857 | Ga0495602_0087030 | 3300048088 | Bacteria | 2606 |
| 858 | Ga0495602_0132184 | 3300048088 | Bacteria | 1988 |
| 859 | Ga0495602_0157092 | 3300048088 | Bacteria | 1780 |
| 860 | Ga0495614_0197046 | 3300048089 | Bacteria | 910 |
| 861 | Ga0496100_0008217 | 3300048903 | Bacteria | 5813 |
| 862 | Ga0496100_0013049 | 3300048903 | Bacteria | 4781 |
| 863 | Ga0496100_0017810 | 3300048903 | Bacteria | 4202 |
| 864 | Ga0496100_0082161 | 3300048903 | Bacteria | 2178 |
| 865 | Ga0496100_0287704 | 3300048903 | Bacteria | 1227 |
| 866 | Ga0496100_0426778 | 3300048903 | Bacteria | 1013 |
| 867 | Ga0496100_0679569 | 3300048903 | Bacteria | 803 |
| 868 | Ga0496100_0694590 | 3300048903 | Bacteria | 794 |
| 869 | Ga0496101_0001675 | 3300048904 | Bacteria | 13292 |
| 870 | Ga0496101_0003097 | 3300048904 | Bacteria | 10285 |
| 871 | Ga0496101_0088309 | 3300048904 | Bacteria | 2302 |
| 872 | Ga0496101_0159668 | 3300048904 | Bacteria | 1728 |
| 873 | Ga0496101_0167196 | 3300048904 | Bacteria | 1689 |
| 874 | Ga0496101_0285496 | 3300048904 | Bacteria | 1291 |
| 875 | Ga0496101_0465055 | 3300048904 | Bacteria | 998 |
| 876 | Ga0496102_0007218 | 3300048905 | Bacteria | 9482 |
| 877 | Ga0496102_0010358 | 3300048905 | Bacteria | 8019 |
| 878 | Ga0496102_0040337 | 3300048905 | Bacteria | 4222 |
| 879 | Ga0496102_0066040 | 3300048905 | Bacteria | 3316 |
| 880 | Ga0496102_0327479 | 3300048905 | Bacteria | 1443 |
| 881 | Ga0496102_0525111 | 3300048905 | Bacteria | 1106 |
| 882 | Ga0496102_0574841 | 3300048905 | Bacteria | 1050 |
| 883 | Ga0496103_0011909 | 3300048906 | Bacteria | 5163 |
| 884 | Ga0496103_0124345 | 3300048906 | Bacteria | 1644 |
| 885 | Ga0496103_0194786 | 3300048906 | Bacteria | 1303 |
| 886 | Ga0496103_0244348 | 3300048906 | Bacteria | 1155 |
| 887 | Ga0496103_0345080 | 3300048906 | Bacteria | 957 |
| 888 | Ga0496104_0000134 | 3300048907 | Bacteria | 68737 |
| 889 | Ga0496104_0002226 | 3300048907 | Bacteria | 16741 |
| 890 | Ga0496104_0009373 | 3300048907 | Bacteria | 8706 |
| 891 | Ga0496104_0079872 | 3300048907 | Bacteria | 3118 |
| 892 | Ga0496104_0124098 | 3300048907 | Bacteria | 2479 |
| 893 | Ga0496104_0143093 | 3300048907 | Bacteria | 2297 |
| 894 | Ga0496104_0298791 | 3300048907 | Bacteria | 1522 |
| 895 | Ga0496104_0903148 | 3300048907 | Bacteria | 788 |
| 896 | Ga0496104_1156832 | 3300048907 | Bacteria | 677 |
| 897 | Ga0496105_0000334 | 3300048908 | Bacteria | 30835 |
| 898 | Ga0496105_0000429 | 3300048908 | Bacteria | 27568 |
| 899 | Ga0496105_0003332 | 3300048908 | Bacteria | 11871 |
| 900 | Ga0496105_0072352 | 3300048908 | Bacteria | 2849 |
| 901 | Ga0496105_0129599 | 3300048908 | Bacteria | 2080 |
| 902 | Ga0496105_0695540 | 3300048908 | Bacteria | 781 |
| 903 | Ga0496106_0009788 | 3300048909 | Bacteria | 7082 |
| 904 | Ga0496106_0115864 | 3300048909 | Bacteria | 2090 |
| 905 | Ga0496106_0207466 | 3300048909 | Bacteria | 1560 |
| 906 | Ga0496106_0284268 | 3300048909 | Bacteria | 1325 |
| 907 | Ga0496106_0309841 | 3300048909 | Bacteria | 1266 |
| 908 | Ga0496107_0033042 | 3300048910 | Bacteria | 3700 |
| 909 | Ga0496107_0050773 | 3300048910 | Bacteria | 2991 |
| 910 | Ga0496107_0055898 | 3300048910 | Bacteria | 2850 |
| 911 | Ga0496107_0233644 | 3300048910 | Bacteria | 1368 |
| 912 | Ga0496107_0235471 | 3300048910 | Bacteria | 1362 |
| 913 | Ga0496107_0503341 | 3300048910 | Bacteria | 898 |
| 914 | Ga0496108_0003536 | 3300048911 | Bacteria | 12533 |
| 915 | Ga0496108_0017704 | 3300048911 | Bacteria | 5829 |
| 916 | Ga0496108_0033079 | 3300048911 | Bacteria | 4295 |
| 917 | Ga0496108_0129163 | 3300048911 | Bacteria | 2172 |
| 918 | Ga0496108_0138388 | 3300048911 | Bacteria | 2097 |
| 919 | Ga0496108_0466152 | 3300048911 | Bacteria | 1104 |
| 920 | Ga0496108_1372233 | 3300048911 | Bacteria | 592 |
| 921 | Ga0496108_1380347 | 3300048911 | Bacteria | 590 |
| 922 | Ga0496108_1534265 | 3300048911 | Bacteria | 553 |
| 923 | Ga0496109_0000898 | 3300048912 | Bacteria | 24813 |
| 924 | Ga0496109_0004403 | 3300048912 | Bacteria | 11769 |
| 925 | Ga0496109_0023182 | 3300048912 | Bacteria | 5507 |
| 926 | Ga0496109_0042839 | 3300048912 | Bacteria | 4102 |
| 927 | Ga0496109_0070787 | 3300048912 | Bacteria | 3201 |
| 928 | Ga0496109_0078645 | 3300048912 | Bacteria | 3037 |
| 929 | Ga0496109_0112373 | 3300048912 | Bacteria | 2533 |
| 930 | Ga0496109_0187673 | 3300048912 | Bacteria | 1942 |
| 931 | Ga0496109_0213280 | 3300048912 | Bacteria | 1816 |
| 932 | Ga0496109_0252758 | 3300048912 | Bacteria | 1660 |
| 933 | Ga0496110_0000164 | 3300048913 | Bacteria | 40268 |
| 934 | Ga0496110_0006694 | 3300048913 | Bacteria | 9159 |
| 935 | Ga0496110_0014588 | 3300048913 | Bacteria | 6528 |
| 936 | Ga0496110_0015943 | 3300048913 | Bacteria | 6266 |
| 937 | Ga0496110_0108442 | 3300048913 | Bacteria | 2493 |
| 938 | Ga0496110_0117827 | 3300048913 | Bacteria | 2391 |
| 939 | Ga0496110_0139077 | 3300048913 | Bacteria | 2195 |
| 940 | Ga0496110_0198647 | 3300048913 | Bacteria | 1822 |
| 941 | Ga0496110_1237352 | 3300048913 | Bacteria | 655 |
| 942 | Ga0496111_0000228 | 3300048914 | Bacteria | 26792 |
| 943 | Ga0496111_0000295 | 3300048914 | Bacteria | 24339 |
| 944 | Ga0496111_0002679 | 3300048914 | Bacteria | 10821 |
| 945 | Ga0496111_0015328 | 3300048914 | Bacteria | 5259 |
| 946 | Ga0496111_0031537 | 3300048914 | Bacteria | 3776 |
| 947 | Ga0496111_0032440 | 3300048914 | Bacteria | 3724 |
| 948 | Ga0496111_0048024 | 3300048914 | Bacteria | 3074 |
| 949 | Ga0496111_0067212 | 3300048914 | Bacteria | 2604 |
| 950 | Ga0496111_0089012 | 3300048914 | Bacteria | 2261 |
| 951 | Ga0496111_0162974 | 3300048914 | Bacteria | 1656 |
| 952 | Ga0496112_0000291 | 3300048915 | Bacteria | 32578 |
| 953 | Ga0496112_0000443 | 3300048915 | Bacteria | 27533 |
| 954 | Ga0496112_0012008 | 3300048915 | Bacteria | 7943 |
| 955 | Ga0496112_0027889 | 3300048915 | Bacteria | 5447 |
| 956 | Ga0496112_0175579 | 3300048915 | Bacteria | 2107 |
| 957 | Ga0496112_0825665 | 3300048915 | Bacteria | 851 |
| 958 | Ga0496112_1218375 | 3300048915 | Bacteria | 669 |
| 959 | Ga0496113_0001618 | 3300048916 | Bacteria | 12672 |
| 960 | Ga0496113_0158435 | 3300048916 | Bacteria | 1789 |
| 961 | Ga0496113_0263470 | 3300048916 | Bacteria | 1377 |
| 962 | Ga0496113_0307251 | 3300048916 | Bacteria | 1270 |
| 963 | Ga0496113_0335155 | 3300048916 | Bacteria | 1213 |
| 964 | Ga0496113_0569826 | 3300048916 | Bacteria | 908 |
| 965 | Ga0496114_0000281 | 3300048917 | Bacteria | 37054 |
| 966 | Ga0496114_0002188 | 3300048917 | Bacteria | 14888 |
| 967 | Ga0496114_0003176 | 3300048917 | Bacteria | 12601 |
| 968 | Ga0496114_0026662 | 3300048917 | Bacteria | 4733 |
| 969 | Ga0496114_0055144 | 3300048917 | Bacteria | 3315 |
| 970 | Ga0496114_0354314 | 3300048917 | Bacteria | 1298 |
| 971 | Ga0496114_0371130 | 3300048917 | Bacteria | 1266 |
| 972 | Ga0496114_0438328 | 3300048917 | Bacteria | 1157 |
| 973 | Ga0496114_0584784 | 3300048917 | Bacteria | 985 |
| 974 | Ga0496114_0985169 | 3300048917 | Bacteria | 726 |
| 975 | Ga0496115_0015385 | 3300048918 | Bacteria | 5803 |
| 976 | Ga0496115_0022334 | 3300048918 | Bacteria | 4900 |
| 977 | Ga0496115_0027454 | 3300048918 | Bacteria | 4452 |
| 978 | Ga0496115_0057152 | 3300048918 | Bacteria | 3137 |
| 979 | Ga0496115_0060452 | 3300048918 | Bacteria | 3053 |
| 980 | Ga0496115_0231042 | 3300048918 | Bacteria | 1525 |
| 981 | Ga0496115_0380090 | 3300048918 | Bacteria | 1149 |
| 982 | Ga0501031_0005532 | 3300049568 | Bacteria | 8224 |
| 983 | Ga0501031_0104493 | 3300049568 | Bacteria | 1848 |
| 984 | Ga0501031_0342915 | 3300049568 | Bacteria | 967 |
| 985 | Ga0501032_0063899 | 3300049569 | Bacteria | 2464 |
| 986 | Ga0501033_0002824 | 3300049570 | Bacteria | 14539 |
| 987 | Ga0501033_0048171 | 3300049570 | Bacteria | 3166 |
| 988 | Ga0501034_1528207 | 3300049571 | Bacteria | 541 |
| 989 | Ga0501036_0004455 | 3300049572 | Bacteria | 11320 |
| 990 | Ga0501036_0075063 | 3300049572 | Bacteria | 2859 |
| 991 | Ga0501037_0000851 | 3300049573 | Bacteria | 22750 |
| 992 | Ga0501037_0137364 | 3300049573 | Bacteria | 1751 |
| 993 | Ga0501038_0000817 | 3300049574 | Bacteria | 27664 |
| 994 | Ga0501038_0072163 | 3300049574 | Bacteria | 2926 |
| 995 | Ga0501039_0009773 | 3300049575 | Bacteria | 7309 |
| 996 | Ga0501039_0018588 | 3300049575 | Bacteria | 5335 |
| 997 | Ga0501040_0028879 | 3300049576 | Bacteria | 3740 |
| 998 | Ga0501040_0166336 | 3300049576 | Bacteria | 1560 |
| 999 | Ga0501041_0001581 | 3300049577 | Bacteria | 12684 |
| 1000 | Ga0501041_0001675 | 3300049577 | Bacteria | 12408 |
| 1001 | Ga0501042_0013943 | 3300049578 | Bacteria | 5476 |
| 1002 | Ga0501042_0096600 | 3300049578 | Bacteria | 2123 |
| 1003 | Ga0501042_0282203 | 3300049578 | Bacteria | 1199 |
| 1004 | Ga0501043_0016623 | 3300049579 | Bacteria | 5767 |
| 1005 | Ga0501043_0059002 | 3300049579 | Bacteria | 3011 |
| 1006 | Ga0501046_0015550 | 3300049580 | Bacteria | 6391 |
| 1007 | Ga0501046_0017207 | 3300049580 | Bacteria | 6040 |
| 1008 | Ga0501047_0269834 | 3300049581 | Bacteria | 1548 |
| 1009 | Ga0501047_0503782 | 3300049581 | Bacteria | 1037 |
| 1010 | Ga0501048_0054653 | 3300049582 | Bacteria | 2836 |
| 1011 | Ga0501048_0092101 | 3300049582 | Bacteria | 2137 |
| 1012 | Ga0501067_0000154 | 3300049583 | Bacteria | 38151 |
| 1013 | Ga0501067_0018163 | 3300049583 | Bacteria | 3895 |
| 1014 | Ga0501068_0037044 | 3300049584 | Bacteria | 2919 |
| 1015 | Ga0501068_0114948 | 3300049584 | Bacteria | 1675 |
| 1016 | Ga0501069_0006471 | 3300049585 | Bacteria | 6125 |
| 1017 | Ga0501069_0008732 | 3300049585 | Bacteria | 5336 |
| 1018 | Ga0501069_0045665 | 3300049585 | Bacteria | 2427 |
| 1019 | Ga0501069_0136062 | 3300049585 | Bacteria | 1408 |
| 1020 | Ga0501069_0264669 | 3300049585 | Bacteria | 1004 |
| 1021 | Ga0501070_0000243 | 3300049586 | Bacteria | 51201 |
| 1022 | Ga0501070_0029959 | 3300049586 | Bacteria | 4559 |
| 1023 | Ga0501070_0040388 | 3300049586 | Bacteria | 3890 |
| 1024 | Ga0501070_0084234 | 3300049586 | Bacteria | 2632 |
| 1025 | Ga0501070_0478804 | 3300049586 | Bacteria | 1001 |
| 1026 | Ga0501071_0001272 | 3300049587 | Bacteria | 14323 |
| 1027 | Ga0501071_0340956 | 3300049587 | Bacteria | 1139 |
| 1028 | Ga0501072_0106992 | 3300049588 | Bacteria | 2224 |
| 1029 | Ga0501072_0116752 | 3300049588 | Bacteria | 2125 |
| 1030 | Ga0501073_0004374 | 3300049589 | Bacteria | 10610 |
| 1031 | Ga0501074_0012526 | 3300049590 | Bacteria | 6166 |
| 1032 | Ga0501074_0018826 | 3300049590 | Bacteria | 5015 |
| 1033 | Ga0501074_0040111 | 3300049590 | Bacteria | 3391 |
| 1034 | Ga0501074_0165560 | 3300049590 | Bacteria | 1578 |
| 1035 | Ga0501074_0326934 | 3300049590 | Bacteria | 1089 |
| 1036 | Ga0501074_1011591 | 3300049590 | Bacteria | 584 |
| 1037 | Ga0501074_1137081 | 3300049590 | Bacteria | 548 |
| 1038 | Ga0501075_0028059 | 3300049591 | Bacteria | 4152 |
| 1039 | Ga0501076_0009936 | 3300049592 | Bacteria | 7035 |
| 1040 | Ga0501076_0099117 | 3300049592 | Bacteria | 2347 |
| 1041 | Ga0501077_0002323 | 3300049593 | Bacteria | 11449 |
| 1042 | Ga0501077_0002523 | 3300049593 | Bacteria | 10961 |
| 1043 | Ga0501077_0014680 | 3300049593 | Bacteria | 4922 |
| 1044 | Ga0501079_0004378 | 3300049741 | Bacteria | 10459 |
| 1045 | Ga0501079_0178252 | 3300049741 | Bacteria | 1658 |
| 1046 | Ga0501079_0179793 | 3300049741 | Bacteria | 1650 |
| 1047 | Ga0501079_0929063 | 3300049741 | Bacteria | 685 |
| 1048 | Ga0501080_0001996 | 3300049742 | Bacteria | 17609 |
| 1049 | Ga0501080_0153899 | 3300049742 | Bacteria | 2124 |
| 1050 | Ga0501080_0160365 | 3300049742 | Bacteria | 2077 |
| 1051 | Ga0501080_0222874 | 3300049742 | Bacteria | 1725 |
| 1052 | Ga0501080_0252296 | 3300049742 | Bacteria | 1609 |
| 1053 | Ga0501080_0400347 | 3300049742 | Bacteria | 1235 |
| 1054 | Ga0501081_0001229 | 3300049743 | Bacteria | 15580 |
| 1055 | Ga0501083_0083099 | 3300049744 | Bacteria | 2121 |
| 1056 | Ga0501035_0002330 | 3300049822 | Bacteria | 18722 |
| 1057 | Ga0501035_0127654 | 3300049822 | Bacteria | 2219 |
| 1058 | Ga0501035_1171300 | 3300049822 | Bacteria | 597 |
| 1059 | Ga0501044_0103343 | 3300049823 | Bacteria | 2864 |
| 1060 | Ga0501045_0002724 | 3300049824 | Bacteria | 12060 |
| 1061 | Ga0501045_0168652 | 3300049824 | Bacteria | 1630 |
| 1062 | nmdc:mga05p37_105308_c1 | 3300050507 | Bacteria | 3470 |
| 1063 | nmdc:mga05p37_23411_c1 | 3300050507 | Bacteria | 7494 |
| 1064 | nmdc:mga05p37_30852_c1 | 3300050507 | Bacteria | 6543 |
| 1065 | nmdc:mga05p37_374784_c1 | 3300050507 | Bacteria | 1669 |
| 1066 | nmdc:mga06r32_14701_c1 | 3300050510 | Bacteria | 7104 |
| 1067 | nmdc:mga06r32_729328_c1 | 3300050510 | Bacteria | 955 |
| 1068 | nmdc:mga08y16_1054378_c1 | 3300050511 | Bacteria | 790 |
| 1069 | nmdc:mga08y16_1695176_c1 | 3300050511 | Bacteria | 587 |
| 1070 | nmdc:mga08y16_242066_c1 | 3300050511 | Bacteria | 1865 |
| 1071 | nmdc:mga08y16_325712_c1 | 3300050511 | Bacteria | 1581 |
| 1072 | nmdc:mga08y16_95124_c1 | 3300050511 | Bacteria | 3103 |
| 1073 | nmdc:mga0n895_11292_c1 | 3300050512 | Bacteria | 7960 |
| 1074 | nmdc:mga0n895_1345301_c1 | 3300050512 | Bacteria | 684 |
| 1075 | nmdc:mga0n895_2045985_c1 | 3300050512 | Bacteria | 530 |
| 1076 | nmdc:mga0n895_304032_c1 | 3300050512 | Bacteria | 1617 |
| 1077 | nmdc:mga0n895_58476_c1 | 3300050512 | Bacteria | 3801 |
| 1078 | nmdc:mga0n895_8613_c1 | 3300050512 | Bacteria | 8850 |
| 1079 | nmdc:mga0rr50_10287_c1 | 3300050513 | Bacteria | 5930 |
| 1080 | nmdc:mga0rr50_214893_c1 | 3300050513 | Bacteria | 1586 |
| 1081 | nmdc:mga0rr50_225_c1 | 3300050513 | Bacteria | 30540 |
| 1082 | nmdc:mga0rr50_878172_c1 | 3300050513 | Bacteria | 765 |
| 1083 | nmdc:mga08x19_10123_c1 | 3300050514 | Bacteria | 5657 |
| 1084 | nmdc:mga08x19_39705_c1 | 3300050514 | Bacteria | 2993 |
| 1085 | nmdc:mga0a205_181837_c1 | 3300050515 | Bacteria | 1997 |
| 1086 | nmdc:mga0a205_3153_c1 | 3300050515 | Bacteria | 14634 |
| 1087 | nmdc:mga0a205_553517_c1 | 3300050515 | Bacteria | 1005 |
| 1088 | Ga0495601_0073913 | 3300053077 | Bacteria | 2180 |
| 1089 | Ga0495601_0276367 | 3300053077 | Bacteria | 1095 |
| 1090 | Ga0495601_0392264 | 3300053077 | Bacteria | 900 |
| 1091 | Ga0495601_0476578 | 3300053077 | Bacteria | 806 |
| 1092 | Ga0495612_0021233 | 3300053078 | Bacteria | 2605 |
| 1093 | Ga0495612_0202884 | 3300053078 | Bacteria | 875 |
| 1094 | Ga0495655_0017692 | 3300053083 | Bacteria | 1556 |
| 1095 | Ga0495655_0131140 | 3300053083 | Bacteria | 772 |
| 1096 | Ga0495619_0002264 | 3300053085 | Bacteria | 12718 |
| 1097 | Ga0495619_0060049 | 3300053085 | Bacteria | 2526 |
| 1098 | Ga0495619_0664531 | 3300053085 | Bacteria | 710 |
| 1099 | Ga0501084_0000859 | 3300054114 | Bacteria | 23456 |
| 1100 | Ga0501084_0761815 | 3300054114 | Bacteria | 815 |
| 1101 | Ga0590077_129034 | 3300059426 | Bacteria | 600 |
| 1102 | Ga0501082_0008383 | 3300060353 | Bacteria | 8916 |
| 1103 | Ga0501082_0375404 | 3300060353 | Bacteria | 1240 |
| 1104 | Ga0501082_0568272 | 3300060353 | Bacteria | 992 |
| 1105 | Ga0466962_0188099 | 3300061719 | Bacteria | 1007 |
| 1106 | Ga0530510_0022663 | 3300061734 | Bacteria | 4474 |
| 1107 | Ga0530510_0055552 | 3300061734 | Bacteria | 2860 |
| 1108 | Ga0530510_0135001 | 3300061734 | Bacteria | 1816 |
| 1109 | Ga0530510_0248814 | 3300061734 | Bacteria | 1324 |
| 1110 | Ga0530510_0313558 | 3300061734 | Bacteria | 1175 |
| 1111 | Ga0530510_0683490 | 3300061734 | Bacteria | 782 |
| 1112 | Ga0530510_1367719 | 3300061734 | Bacteria | 543 |
| 1113 | Ga0157369_10004499 | |||
| 1114 | JGI25407J50210_10007085 | |||
| 1115 | Ga0070658_10092060 | |||
| 1116 | Ga0070658_10118883 | |||
| 1117 | Ga0070658_10124746 | |||
| 1118 | Ga0070658_10482896 | |||
| 1119 | Ga0070683_100050130 | |||
| 1120 | Ga0070683_100272919 | |||
| 1121 | Ga0070683_100495927 | |||
| 1122 | Ga0070683_101564350 | |||
| 1123 | Ga0070690_100859593 | |||
| 1124 | Ga0070680_100053848 | |||
| 1125 | Ga0070680_100101092 | |||
| 1126 | Ga0070680_100108456 | |||
| 1127 | Ga0070680_100508824 | |||
| 1128 | Ga0070682_100152865 | |||
| 1129 | Ga0068868_100036832 | |||
| 1130 | Ga0070660_100110092 | |||
| 1131 | Ga0070660_100165585 | |||
| 1132 | Ga0070660_100330820 | |||
| 1133 | Ga0070660_100599982 | |||
| 1134 | Ga0070660_100745219 | |||
| 1135 | Ga0070689_100136273 | |||
| 1136 | Ga0070691_10078192 | |||
| 1137 | Ga0070691_10528816 | |||
| 1138 | Ga0070687_100057362 | |||
| 1139 | Ga0070687_100245886 | |||
| 1140 | Ga0070661_100033510 | |||
| 1141 | Ga0070661_100061585 | |||
| 1142 | Ga0070692_10015268 | |||
| 1143 | Ga0070692_10099802 | |||
| 1144 | Ga0070668_100091137 | |||
| 1145 | Ga0070675_100071216 | |||
| 1146 | Ga0070675_101283618 | |||
| 1147 | Ga0070671_100242954 | |||
| 1148 | Ga0070671_100748029 | |||
| 1149 | Ga0070674_100001639 | |||
| 1150 | Ga0070688_100012006 | |||
| 1151 | Ga0070659_100219681 | |||
| 1152 | Ga0070659_100241014 | |||
| 1153 | Ga0070659_100475469 | |||
| 1154 | Ga0070659_100962857 | |||
| 1155 | Ga0070659_101325316 | |||
| 1156 | Ga0070709_10024012 | |||
| 1157 | Ga0070714_100053368 | |||
| 1158 | Ga0070714_100092282 | |||
| 1159 | Ga0070714_100361204 | |||
| 1160 | Ga0070714_100429276 | |||
| 1161 | Ga0070714_100453245 | |||
| 1162 | Ga0070714_100691547 | |||
| 1163 | Ga0070714_100794008 | |||
| 1164 | Ga0070714_101747024 | |||
| 1165 | Ga0070713_100088433 | |||
| 1166 | Ga0070713_100094513 | |||
| 1167 | Ga0070713_100505707 | |||
| 1168 | Ga0070713_100938597 | |||
| 1169 | Ga0070713_101237419 | |||
| 1170 | Ga0070710_10005124 | |||
| 1171 | Ga0070710_10025539 | |||
| 1172 | Ga0070711_100896904 | |||
| 1173 | Ga0070705_100072942 | |||
| 1174 | Ga0070705_100117914 | |||
| 1175 | Ga0070705_100347908 | |||
| 1176 | Ga0070705_100894461 | |||
| 1177 | Ga0070705_101101782 | |||
| 1178 | Ga0070705_101107289 | |||
| 1179 | Ga0070700_100063569 | |||
| 1180 | Ga0070694_100156515 | |||
| 1181 | Ga0070694_100443972 | |||
| 1182 | Ga0070708_100132367 | |||
| 1183 | Ga0070708_100179564 | |||
| 1184 | Ga0070708_100675518 | |||
| 1185 | Ga0070663_100670482 | |||
| 1186 | Ga0070663_100854919 | |||
| 1187 | Ga0070663_101685491 | |||
| 1188 | Ga0070678_100020686 | |||
| 1189 | Ga0070678_100118341 | |||
| 1190 | Ga0070678_100513407 | |||
| 1191 | Ga0070681_10001129 | |||
| 1192 | Ga0070681_10109636 | |||
| 1193 | Ga0070681_10140248 | |||
| 1194 | Ga0070681_10152188 | |||
| 1195 | Ga0070681_10598725 | |||
| 1196 | Ga0070681_10741668 | |||
| 1197 | Ga0070681_10778623 | |||
| 1198 | Ga0068867_100030890 | |||
| 1199 | Ga0068867_100244804 | |||
| 1200 | Ga0070685_10223648 | |||
| 1201 | Ga0070685_10551013 | |||
| 1202 | Ga0070706_100049868 | |||
| 1203 | Ga0070706_100258145 | |||
| 1204 | Ga0070706_100405326 | |||
| 1205 | Ga0070706_100864650 | |||
| 1206 | Ga0070707_100190723 | |||
| 1207 | Ga0070707_100754205 | |||
| 1208 | Ga0070707_101046201 | |||
| 1209 | Ga0070707_101548580 | |||
| 1210 | Ga0070698_100073605 | |||
| 1211 | Ga0070698_100128875 | |||
| 1212 | Ga0070699_100158173 | |||
| 1213 | Ga0070699_100622265 | |||
| 1214 | Ga0070699_100880570 | |||
| 1215 | Ga0070679_100160109 | |||
| 1216 | Ga0070679_100199276 | |||
| 1217 | Ga0070679_100305321 | |||
| 1218 | Ga0070679_100792900 | |||
| 1219 | Ga0070684_100057188 | |||
| 1220 | Ga0070684_100057250 | |||
| 1221 | Ga0070684_100089966 | |||
| 1222 | Ga0070684_100293223 | |||
| 1223 | Ga0070684_100317442 | |||
| 1224 | Ga0070684_100444650 | |||
| 1225 | Ga0070684_100801332 | |||
| 1226 | Ga0070697_100102146 | |||
| 1227 | Ga0070697_100109749 | |||
| 1228 | Ga0070697_100385011 | |||
| 1229 | Ga0070697_100829415 | |||
| 1230 | Ga0070697_101074971 | |||
| 1231 | Ga0068853_100306811 | |||
| 1232 | Ga0070672_101034147 | |||
| 1233 | Ga0070686_100032900 | |||
| 1234 | Ga0070695_100089217 | |||
| 1235 | Ga0070695_100159593 | |||
| 1236 | Ga0070695_100192979 | |||
| 1237 | Ga0070696_100048066 | |||
| 1238 | Ga0070696_100056669 | |||
| 1239 | Ga0070696_100581900 | |||
| 1240 | Ga0070693_100604571 | |||
| 1241 | Ga0070693_100845452 | |||
| 1242 | Ga0070665_100053631 | |||
| 1243 | Ga0070665_100870746 | |||
| 1244 | Ga0070665_100986248 | |||
| 1245 | Ga0070704_100002938 | |||
| 1246 | Ga0068855_100072684 | |||
| 1247 | Ga0068855_100108078 | |||
| 1248 | Ga0068855_100233752 | |||
| 1249 | Ga0068855_100302014 | |||
| 1250 | Ga0068855_100351765 | |||
| 1251 | Ga0068855_100425009 | |||
| 1252 | Ga0070664_100165065 | |||
| 1253 | Ga0070664_100716366 | |||
| 1254 | Ga0068857_100019391 | |||
| 1255 | Ga0068857_100033041 | |||
| 1256 | Ga0068857_100059894 | |||
| 1257 | Ga0068857_100300411 | |||
| 1258 | Ga0068854_100658541 | |||
| 1259 | Ga0068856_100062119 | |||
| 1260 | Ga0068856_100134039 | |||
| 1261 | Ga0068856_100512191 | |||
| 1262 | Ga0070702_100069911 | |||
| 1263 | Ga0070702_100170582 | |||
| 1264 | Ga0070702_100747294 | |||
| 1265 | Ga0068852_100018025 | |||
| 1266 | Ga0068852_100045532 | |||
| 1267 | Ga0068852_100294898 | |||
| 1268 | Ga0068859_100331513 | |||
| 1269 | Ga0068859_101247572 | |||
| 1270 | Ga0068864_100129295 | |||
| 1271 | Ga0068864_100669633 | |||
| 1272 | Ga0068866_10045370 | |||
| 1273 | Ga0068866_10104869 | |||
| 1274 | Ga0068861_100222240 | |||
| 1275 | Ga0068861_100572329 | |||
| 1276 | Ga0068858_100832431 | |||
| 1277 | Ga0068862_100986186 | |||
| 1278 | Ga0068862_101099680 | |||
| 1279 | Ga0081455_10010251 | |||
| 1280 | Ga0081455_10011450 | |||
| 1281 | Ga0081455_10012609 | |||
| 1282 | Ga0081455_10243025 | |||
| 1283 | Ga0081455_10363616 | |||
| 1284 | Ga0081455_10564750 | |||
| 1285 | Ga0081538_10000518 | |||
| 1286 | Ga0081538_10051296 | |||
| 1287 | Ga0081538_10173146 | |||
| 1288 | Ga0081538_10174882 | |||
| 1289 | Ga0081539_10018622 | |||
| 1290 | Ga0070717_10014276 | |||
| 1291 | Ga0070717_10521603 | |||
| 1292 | Ga0070715_10011644 | |||
| 1293 | Ga0070715_10510508 | |||
| 1294 | Ga0070715_10692049 | |||
| 1295 | Ga0070712_100030457 | |||
| 1296 | Ga0070712_100110168 | |||
| 1297 | Ga0070712_100177212 | |||
| 1298 | Ga0070712_100211056 | |||
| 1299 | Ga0070712_101030674 | |||
| 1300 | Ga0097621_100870685 | |||
| 1301 | Ga0068871_100026449 | |||
| 1302 | Ga0075433_10004384 | |||
| 1303 | Ga0075433_10024478 | |||
| 1304 | Ga0075433_10456585 | |||
| 1305 | Ga0075433_11051538 | |||
| 1306 | Ga0075434_100005135 | |||
| 1307 | Ga0075434_100023021 | |||
| 1308 | Ga0075434_100529470 | |||
| 1309 | Ga0075434_101554258 | |||
| 1310 | Ga0075434_101591479 | |||
| 1311 | Ga0075429_100742484 | |||
| 1312 | Ga0068865_100017722 | |||
| 1313 | Ga0075436_100009853 | |||
| 1314 | Ga0097620_100331517 | |||
| 1315 | Ga0097620_101247658 | |||
| 1316 | Ga0075435_100000140 | |||
| 1317 | Ga0075435_100020149 | |||
| 1318 | Ga0075435_100024269 | |||
| 1319 | Ga0075435_100045328 | |||
| 1320 | Ga0075435_100806250 | |||
| 1321 | Ga0105244_10238047 | |||
| 1322 | Ga0105240_10222720 | |||
| 1323 | Ga0105240_10439215 | |||
| 1324 | Ga0105240_10637414 | |||
| 1325 | Ga0105240_10708309 | |||
| 1326 | Ga0105240_11069326 | |||
| 1327 | Ga0105240_11110382 | |||
| 1328 | Ga0111539_10031415 | |||
| 1329 | Ga0111539_10089729 | |||
| 1330 | Ga0111539_10867885 | |||
| 1331 | Ga0105245_10011977 | |||
| 1332 | Ga0105245_10119636 | |||
| 1333 | Ga0105245_10431456 | |||
| 1334 | Ga0105245_10746476 | |||
| 1335 | Ga0105245_10864972 | |||
| 1336 | Ga0105245_11650211 | |||
| 1337 | Ga0105247_10203629 | |||
| 1338 | Ga0114129_10009001 | |||
| 1339 | Ga0114129_10048698 | |||
| 1340 | Ga0114129_10056182 | |||
| 1341 | Ga0114129_10385876 | |||
| 1342 | Ga0114129_11103449 | |||
| 1343 | Ga0114129_12821085 | |||
| 1344 | Ga0105243_10032733 | |||
| 1345 | Ga0105243_10080853 | |||
| 1346 | Ga0105243_10513992 | |||
| 1347 | Ga0105243_10581757 | |||
| 1348 | Ga0105241_10043494 | |||
| 1349 | Ga0105241_10268096 | |||
| 1350 | Ga0105241_10405328 | |||
| 1351 | Ga0105241_10816530 | |||
| 1352 | Ga0105242_10006264 | |||
| 1353 | Ga0105242_11961248 | |||
| 1354 | Ga0105242_12274041 | |||
| 1355 | Ga0105248_10008130 | |||
| 1356 | Ga0105248_10056872 | |||
| 1357 | Ga0105248_10194172 | |||
| 1358 | Ga0105248_10951507 | |||
| 1359 | Ga0105248_11117168 | |||
| 1360 | Ga0105237_10492868 | |||
| 1361 | Ga0105238_10023360 | |||
| 1362 | Ga0105249_10017957 | |||
| 1363 | Ga0105249_10686243 | |||
| 1364 | Ga0105249_11153319 | |||
| 1365 | Ga0105249_12218630 | |||
| 1366 | Ga0105239_10096721 | |||
| 1367 | Ga0105239_10515853 | |||
| 1368 | Ga0105239_11824757 | |||
| 1369 | Ga0105246_10322712 | |||
| 1370 | Ga0157373_10164163 | |||
| 1371 | Ga0157371_11027283 | |||
| 1372 | Ga0157370_10008306 | |||
| 1373 | Ga0157370_10300734 | |||
| 1374 | Ga0157370_10347658 | |||
| 1375 | Ga0157370_10833691 | |||
| 1376 | Ga0157370_10932051 | |||
| 1377 | Ga0157369_10032180 | |||
| 1378 | Ga0157369_10045279 | |||
| 1379 | Ga0157369_10046810 | |||
| 1380 | Ga0157369_10336345 | |||
| 1381 | Ga0157369_10382575 | |||
| 1382 | Ga0157369_10462735 | |||
| 1383 | Ga0157369_11585855 | |||
| 1384 | Ga0157374_10033180 | |||
| 1385 | Ga0157378_10018799 | |||
| 1386 | Ga0157378_10345069 | |||
| 1387 | Ga0157378_11503761 | |||
| 1388 | Ga0163162_10030463 | |||
| 1389 | Ga0163162_10263641 | |||
| 1390 | Ga0163162_10736469 | |||
| 1391 | Ga0157372_10029001 | |||
| 1392 | Ga0157372_10140215 | |||
| 1393 | Ga0157372_10304928 | |||
| 1394 | Ga0157372_10524982 | |||
| 1395 | Ga0157372_10741397 | |||
| 1396 | Ga0157375_10064197 | |||
| 1397 | Ga0157375_10263695 | |||
| 1398 | Ga0157375_10510413 | |||
| 1399 | Ga0157375_10569078 | |||
| 1400 | Ga0157375_10839944 | |||
| 1401 | Ga0163163_10208813 | |||
| 1402 | Ga0163163_10351850 | |||
| 1403 | Ga0157380_10134754 | |||
| 1404 | Ga0157380_10692548 | |||
| 1405 | Ga0182008_10413879 | |||
| 1406 | Ga0157377_10003323 | |||
| 1407 | Ga0157377_10562207 | |||
| 1408 | Ga0157379_10097916 | |||
| 1409 | Ga0157376_10013033 | |||
| 1410 | Ga0157376_10077981 | |||
| 1411 | Ga0182006_1141934 | |||
| 1412 | Ga0182007_10231938 | |||
| 1413 | Ga0182007_10367363 | |||
| 1414 | Ga0197907_11047046 | |||
| 1415 | Ga0197907_11349487 | |||
| 1416 | Ga0206356_10777109 | |||
| 1417 | Ga0206354_10741990 | |||
| 1418 | Ga0206353_10780697 | |||
| 1419 | Ga0206353_11185381 | |||
| 1420 | Ga0206353_11283255 | |||
| 1421 | Ga0206353_11751382 | |||
| 1422 | Ga0206353_11789119 | |||
| 1423 | Ga0213873_10039551 | |||
| 1424 | Ga0213874_10142815 | |||
| 1425 | Ga0213876_10273908 | |||
| 1426 | Ga0213871_10077264 | |||
| 1427 | Ga0207692_10064075 | |||
| 1428 | Ga0207692_10113744 | |||
| 1429 | Ga0207710_10343985 | |||
| 1430 | Ga0207688_10072754 | |||
| 1431 | Ga0207688_10143079 | |||
| 1432 | Ga0207688_10228445 | |||
| 1433 | Ga0207688_10639295 | |||
| 1434 | Ga0207688_10839980 | |||
| 1435 | Ga0207685_10003453 | |||
| 1436 | Ga0207685_10042480 | |||
| 1437 | Ga0207685_10429030 | |||
| 1438 | Ga0207685_10487818 | |||
| 1439 | Ga0207699_10612734 | |||
| 1440 | Ga0207684_10039896 | |||
| 1441 | Ga0207684_10308549 | |||
| 1442 | Ga0207684_10702501 | |||
| 1443 | Ga0207707_10014838 | |||
| 1444 | Ga0207707_10111137 | |||
| 1445 | Ga0207707_10146159 | |||
| 1446 | Ga0207707_10198241 | |||
| 1447 | Ga0207707_10584770 | |||
| 1448 | Ga0207695_10543070 | |||
| 1449 | Ga0207695_11223259 | |||
| 1450 | Ga0207695_11391233 | |||
| 1451 | Ga0207671_10044114 | |||
| 1452 | Ga0207693_10003565 | |||
| 1453 | Ga0207693_10018792 | |||
| 1454 | Ga0207693_10019938 | |||
| 1455 | Ga0207693_10086334 | |||
| 1456 | Ga0207693_10302964 | |||
| 1457 | Ga0207693_10422443 | |||
| 1458 | Ga0207693_10452898 | |||
| 1459 | Ga0207693_10651909 | |||
| 1460 | Ga0207693_11210892 | |||
| 1461 | Ga0207663_10007094 | |||
| 1462 | Ga0207663_10226444 | |||
| 1463 | Ga0207663_10381228 | |||
| 1464 | Ga0207660_10009367 | |||
| 1465 | Ga0207660_10028394 | |||
| 1466 | Ga0207660_10183140 | |||
| 1467 | Ga0207660_10185704 | |||
| 1468 | Ga0207660_10193902 | |||
| 1469 | Ga0207660_10444825 | |||
| 1470 | Ga0207662_10269070 | |||
| 1471 | Ga0207657_10000416 | |||
| 1472 | Ga0207657_10000610 | |||
| 1473 | Ga0207657_10004617 | |||
| 1474 | Ga0207657_10022825 | |||
| 1475 | Ga0207657_10151254 | |||
| 1476 | Ga0207657_10154164 | |||
| 1477 | Ga0207657_10296287 | |||
| 1478 | Ga0207657_10463485 | |||
| 1479 | Ga0207649_10034017 | |||
| 1480 | Ga0207649_10058915 | |||
| 1481 | Ga0207649_10261521 | |||
| 1482 | Ga0207649_10517658 | |||
| 1483 | Ga0207652_10003206 | |||
| 1484 | Ga0207652_10017952 | |||
| 1485 | Ga0207652_10213248 | |||
| 1486 | Ga0207652_10315648 | |||
| 1487 | Ga0207652_11106148 | |||
| 1488 | Ga0207646_10116678 | |||
| 1489 | Ga0207646_10140658 | |||
| 1490 | Ga0207646_10480907 | |||
| 1491 | Ga0207646_10956458 | |||
| 1492 | Ga0207646_11341739 | |||
| 1493 | Ga0207646_11371729 | |||
| 1494 | Ga0207646_11774333 | |||
| 1495 | Ga0207659_10032822 | |||
| 1496 | Ga0207659_10350236 | |||
| 1497 | Ga0207687_10016945 | |||
| 1498 | Ga0207687_10403443 | |||
| 1499 | Ga0207700_10000004 | |||
| 1500 | Ga0207700_10126938 | |||
| 1501 | Ga0207700_10205214 | |||
| 1502 | Ga0207700_10223947 | |||
| 1503 | Ga0207700_11029053 | |||
| 1504 | Ga0207664_10002557 | |||
| 1505 | Ga0207664_10116950 | |||
| 1506 | Ga0207664_10152546 | |||
| 1507 | Ga0207664_10176820 | |||
| 1508 | Ga0207664_10178321 | |||
| 1509 | Ga0207664_10180407 | |||
| 1510 | Ga0207664_11029652 | |||
| 1511 | Ga0207644_10178931 | |||
| 1512 | Ga0207644_10423624 | |||
| 1513 | Ga0207644_11057209 | |||
| 1514 | Ga0207690_10034236 | |||
| 1515 | Ga0207690_10047168 | |||
| 1516 | Ga0207690_10155708 | |||
| 1517 | Ga0207690_10180276 | |||
| 1518 | Ga0207690_10321389 | |||
| 1519 | Ga0207706_10031346 | |||
| 1520 | Ga0207706_10390263 | |||
| 1521 | Ga0207686_10048195 | |||
| 1522 | Ga0207686_10895129 | |||
| 1523 | Ga0207709_10496246 | |||
| 1524 | Ga0207669_10075065 | |||
| 1525 | Ga0207669_10292088 | |||
| 1526 | Ga0207669_10968653 | |||
| 1527 | Ga0207704_10004032 | |||
| 1528 | Ga0207665_10070955 | |||
| 1529 | Ga0207665_10502673 | |||
| 1530 | Ga0207691_10013728 | |||
| 1531 | Ga0207691_10539009 | |||
| 1532 | Ga0207711_10090389 | |||
| 1533 | Ga0207711_10096344 | |||
| 1534 | Ga0207711_11140097 | |||
| 1535 | Ga0207661_10023738 | |||
| 1536 | Ga0207661_10209783 | |||
| 1537 | Ga0207661_10263049 | |||
| 1538 | Ga0207661_10768524 | |||
| 1539 | Ga0207661_10837006 | |||
| 1540 | Ga0207667_10099837 | |||
| 1541 | Ga0207667_10136696 | |||
| 1542 | Ga0207667_10143680 | |||
| 1543 | Ga0207667_10194294 | |||
| 1544 | Ga0207667_10239947 | |||
| 1545 | Ga0207667_10253165 | |||
| 1546 | Ga0207667_10594592 | |||
| 1547 | Ga0207667_10884102 | |||
| 1548 | Ga0207667_11168952 | |||
| 1549 | Ga0207651_10159469 | |||
| 1550 | Ga0207712_10032434 | |||
| 1551 | Ga0207712_10863529 | |||
| 1552 | Ga0207668_10197019 | |||
| 1553 | Ga0207640_10812205 | |||
| 1554 | Ga0207640_10939913 | |||
| 1555 | Ga0207640_11179175 | |||
| 1556 | Ga0207677_10094427 | |||
| 1557 | Ga0207677_10568347 | |||
| 1558 | Ga0207677_10891209 | |||
| 1559 | Ga0207703_10355749 | |||
| 1560 | Ga0207639_10068169 | |||
| 1561 | Ga0207678_10018270 | |||
| 1562 | Ga0207678_10194806 | |||
| 1563 | Ga0207708_10022143 | |||
| 1564 | Ga0207708_10024328 | |||
| 1565 | Ga0207702_10022866 | |||
| 1566 | Ga0207702_10199303 | |||
| 1567 | Ga0207702_10307064 | |||
| 1568 | Ga0207702_11335426 | |||
| 1569 | Ga0207641_10704317 | |||
| 1570 | Ga0207641_10820819 | |||
| 1571 | Ga0207648_10004050 | |||
| 1572 | Ga0207648_10049380 | |||
| 1573 | Ga0207648_10373785 | |||
| 1574 | Ga0207676_10466005 | |||
| 1575 | Ga0207676_10477664 | |||
| 1576 | Ga0207674_10009649 | |||
| 1577 | Ga0207674_10015268 | |||
| 1578 | Ga0207674_10033571 | |||
| 1579 | Ga0207674_10034595 | |||
| 1580 | Ga0207675_100138731 | |||
| 1581 | Ga0207675_101862906 | |||
| 1582 | Ga0207683_10002338 | |||
| 1583 | Ga0207683_10105840 | |||
| 1584 | Ga0207683_10206846 | |||
| 1585 | Ga0207683_10703252 | |||
| 1586 | Ga0207698_10013668 | |||
| 1587 | Ga0207698_10125784 | |||
| 1588 | Ga0207698_10147953 | |||
| 1589 | Ga0207698_10329570 | |||
| 1590 | Ga0207698_10457688 | |||
| 1591 | Ga0207428_10297768 | |||
| 1592 | Ga0207428_10336607 | |||
| 1593 | Ga0268266_10048959 | |||
| 1594 | Ga0268266_10815941 | |||
| 1595 | Ga0268266_10938016 | |||
| 1596 | Ga0265319_1120671 | |||
| 1597 | Ga0265334_10015319 | |||
| 1598 | Ga0265334_10033057 | |||
| 1599 | Ga0265334_10114416 | |||
| 1600 | Ga0265334_10142860 | |||
| 1601 | Ga0265318_10010160 | |||
| 1602 | Ga0265318_10025573 | |||
| 1603 | Ga0265318_10266915 | |||
| 1604 | Ga0265322_10015344 | |||
| 1605 | Ga0265338_10028139 | |||
| 1606 | Ga0265328_10044387 | |||
| 1607 | Ga0265320_10226574 | |||
| 1608 | Ga0265325_10029899 | |||
| 1609 | Ga0265327_10097793 | |||
| 1610 | Ga0265327_10413925 | |||
| 1611 | Ga0265316_10181661 | |||
| 1612 | Ga0265316_10761147 | |||
| 1613 | Ga0307408_100015573 | |||
| 1614 | Ga0307408_100287868 | |||
| 1615 | Ga0307408_100384526 | |||
| 1616 | Ga0307408_100533329 | |||
| 1617 | Ga0265313_10055786 | |||
| 1618 | Ga0265314_10012245 | |||
| 1619 | Ga0265342_10150680 | |||
| 1620 | Ga0265342_10332060 | |||
| 1621 | Ga0307405_10004812 | |||
| 1622 | Ga0307405_10435309 | |||
| 1623 | Ga0307405_11088093 | |||
| 1624 | Ga0307413_10597116 | |||
| 1625 | Ga0307410_10417627 | |||
| 1626 | Ga0307406_10182313 | |||
| 1627 | Ga0307406_11130915 | |||
| 1628 | Ga0307407_10031785 | |||
| 1629 | Ga0307407_10502923 | |||
| 1630 | Ga0307412_10560373 | |||
| 1631 | Ga0307412_10940949 | |||
| 1632 | Ga0307412_11086437 | |||
| 1633 | Ga0307409_100025747 | |||
| 1634 | Ga0307409_100061797 | |||
| 1635 | Ga0307416_100040131 | |||
| 1636 | Ga0307416_100118391 | |||
| 1637 | Ga0307416_100222007 | |||
| 1638 | Ga0307416_100360839 | |||
| 1639 | Ga0307416_101218764 | |||
| 1640 | Ga0307414_10243475 | |||
| 1641 | Ga0307411_10153998 | |||
| 1642 | Ga0307415_100832037 | |||
| 1643 | Ga0307415_101273243 | |||
| 1644 | Ga0373959_0019332 | |||
| 1645 | Ga0373926_0095199 | |||
| 1646 | Ga0373934_0137215 | |||
| 1647 | Ga0373934_0430607 | |||
| 1648 | Ga0373944_0072406 | |||
| 1649 | Ga0373936_0020681 | |||
| 1650 | Ga0373953_0032746 | |||
| 1651 | Ga0373953_0330680 | |||
| 1652 | Ga0373957_0025026 | |||
| 1653 | Ga0373943_0000899 | |||
| 1654 | Ga0373943_0039717 | |||
| 1655 | Ga0373943_0087086 | |||
| 1656 | Ga0373946_0044796 | |||
| 1657 | Ga0373955_0008799 | |||
| 1658 | Ga0373942_0049779 | |||
| 1659 | Ga0373924_0079925 | |||
| 1660 | Ga0373931_0039207 | |||
| 1661 | Ga0373927_0135226 | |||
| 1662 | Ga0373927_0281848 | |||
| 1663 | Ga0373933_0297194 | |||
| 1664 | Ga0373947_0003187 | |||
| 1665 | Ga0373947_0033686 | |||
| 1666 | Ga0373947_0060207 | |||
| 1667 | Ga0373947_0760366 | |||
| 1668 | Ga0373937_0076296 | |||
| 1669 | Ga0373937_0193836 | |||
| 1670 | Ga0373925_0744518 | |||
| 1671 | Ga0395899_0001001 | |||
| 1672 | Ga0395899_0015657 | |||
| 1673 | Ga0395899_0018455 | |||
| 1674 | Ga0395899_0032687 | |||
| 1675 | Ga0395899_0035364 | |||
| 1676 | Ga0395899_0041054 | |||
| 1677 | Ga0395899_0081807 | |||
| 1678 | Ga0395899_0090882 | |||
| 1679 | Ga0395899_0091878 | |||
| 1680 | Ga0395899_0094300 | |||
| 1681 | Ga0395899_0146113 | |||
| 1682 | Ga0395899_0212186 | |||
| 1683 | Ga0395899_0272526 | |||
| 1684 | Ga0395899_0650435 | |||
| 1685 | Ga0395899_0948472 | |||
| 1686 | Ga0395900_0004233 | |||
| 1687 | Ga0395900_0004700 | |||
| 1688 | Ga0395900_0004724 | |||
| 1689 | Ga0395900_0014519 | |||
| 1690 | Ga0395900_0015755 | |||
| 1691 | Ga0395900_0015897 | |||
| 1692 | Ga0395900_0025692 | |||
| 1693 | Ga0395900_0028300 | |||
| 1694 | Ga0395900_0029582 | |||
| 1695 | Ga0395900_0032992 | |||
| 1696 | Ga0395900_0086108 | |||
| 1697 | Ga0395900_0109879 | |||
| 1698 | Ga0395900_0116756 | |||
| 1699 | Ga0395900_0172876 | |||
| 1700 | Ga0395900_0173719 | |||
| 1701 | Ga0395900_0187989 | |||
| 1702 | Ga0395900_0201725 | |||
| 1703 | Ga0395900_0229164 | |||
| 1704 | Ga0395900_0315526 | |||
| 1705 | Ga0395900_0424851 | |||
| 1706 | Ga0395900_0654618 | |||
| 1707 | Ga0395898_0004894 | |||
| 1708 | Ga0395898_0006542 | |||
| 1709 | Ga0395898_0008982 | |||
| 1710 | Ga0395898_0016102 | |||
| 1711 | Ga0395898_0021780 | |||
| 1712 | Ga0395898_0031400 | |||
| 1713 | Ga0395898_0039643 | |||
| 1714 | Ga0395898_0053413 | |||
| 1715 | Ga0395898_0076712 | |||
| 1716 | Ga0395898_0119682 | |||
| 1717 | Ga0395898_0155740 | |||
| 1718 | Ga0395898_0171390 | |||
| 1719 | Ga0395898_0196487 | |||
| 1720 | Ga0395898_0244556 | |||
| 1721 | Ga0395898_0285893 | |||
| 1722 | Ga0395898_0506784 | |||
| 1723 | Ga0395898_0832280 | |||
| 1724 | Ga0395898_1158190 | |||
| 1725 | Ga0395905_0005063 | |||
| 1726 | Ga0395905_0005451 | |||
| 1727 | Ga0395905_0010082 | |||
| 1728 | Ga0395905_0014689 | |||
| 1729 | Ga0395905_0023069 | |||
| 1730 | Ga0395905_0028306 | |||
| 1731 | Ga0395905_0064605 | |||
| 1732 | Ga0395905_0079795 | |||
| 1733 | Ga0395905_0103737 | |||
| 1734 | Ga0395905_0104764 | |||
| 1735 | Ga0395905_0108622 | |||
| 1736 | Ga0395905_0301032 | |||
| 1737 | Ga0395905_0491894 | |||
| 1738 | Ga0395905_0491959 | |||
| 1739 | Ga0395905_0560368 | |||
| 1740 | Ga0395905_0818853 | |||
| 1741 | Ga0395905_1026758 | |||
| 1742 | Ga0395901_0002221 | |||
| 1743 | Ga0395901_0002468 | |||
| 1744 | Ga0395901_0016661 | |||
| 1745 | Ga0395901_0017935 | |||
| 1746 | Ga0395901_0018242 | |||
| 1747 | Ga0395901_0029987 | |||
| 1748 | Ga0395901_0036111 | |||
| 1749 | Ga0395901_0049122 | |||
| 1750 | Ga0395901_0052058 | |||
| 1751 | Ga0395901_0053242 | |||
| 1752 | Ga0395901_0095541 | |||
| 1753 | Ga0395901_0115220 | |||
| 1754 | Ga0395901_0168721 | |||
| 1755 | Ga0395901_0181430 | |||
| 1756 | Ga0395901_0284494 | |||
| 1757 | Ga0395901_0291567 | |||
| 1758 | Ga0395901_0408991 | |||
| 1759 | Ga0395901_0475947 | |||
| 1760 | Ga0395901_0667355 | |||
| 1761 | Ga0395901_0745974 | |||
| 1762 | Ga0395901_0817566 | |||
| 1763 | Ga0395901_1223430 | |||
| 1764 | Ga0436365_1553456 | |||
| 1765 | Ga0436360_0506477 | |||
| 1766 | Ga0436360_0511686 | |||
| 1767 | Ga0436363_0668989 | |||
| 1768 | Ga0436363_1348640 | |||
| 1769 | Ga0436362_0327669 | |||
| 1770 | Ga0439438_045069 | |||
| 1771 | Ga0439438_120893 | |||
| 1772 | Ga0439461_0003605 | |||
| 1773 | Ga0439465_0098857 | |||
| 1774 | Ga0451835_0827407 | |||
| 1775 | Ga0439431_0130726 | |||
| 1776 | Ga0439441_012332 | |||
| 1777 | Ga0439445_0242928 | |||
| 1778 | Ga0439463_043686 | |||
| 1779 | Ga0450917_008674 | |||
| 1780 | Ga0450906_055882 | |||
| 1781 | Ga0450907_011944 | |||
| 1782 | Ga0439446_0361271 | |||
| 1783 | Ga0450908_042915 | |||
| 1784 | Ga0439434_0015538 | |||
| 1785 | Ga0466969_0103243 | |||
| 1786 | Ga0466972_0455956 | |||
| 1787 | Ga0466966_0013321 | |||
| 1788 | Ga0466966_0055786 | |||
| 1789 | Ga0466966_0103961 | |||
| 1790 | Ga0466966_0128302 | |||
| 1791 | Ga0466966_0296909 | |||
| 1792 | Ga0466961_0001805 | |||
| 1793 | Ga0466963_0003083 | |||
| 1794 | Ga0466963_0041038 | |||
| 1795 | Ga0466964_0003275 | |||
| 1796 | Ga0466964_0004021 | |||
| 1797 | Ga0466964_0006266 | |||
| 1798 | Ga0466964_0007545 | |||
| 1799 | Ga0466964_0125030 | |||
| 1800 | Ga0466971_0026732 | |||
| 1801 | Ga0466968_0026293 | |||
| 1802 | Ga0466968_0265340 | |||
| 1803 | Ga0466957_0035461 | |||
| 1804 | Ga0466957_0045276 | |||
| 1805 | Ga0466957_0102563 | |||
| 1806 | Ga0466957_0199451 | |||
| 1807 | Ga0466957_0603646 | |||
| 1808 | Ga0466960_0026703 | |||
| 1809 | Ga0466959_0059584 | |||
| 1810 | Ga0466959_0138653 | |||
| 1811 | Ga0466959_0148827 | |||
| 1812 | Ga0466958_0007711 | |||
| 1813 | Ga0466958_0066985 | |||
| 1814 | Ga0466958_0214086 | |||
| 1815 | Ga0466958_0220499 | |||
| 1816 | Ga0466958_0853854 | |||
| 1817 | Ga0466967_0001914 | |||
| 1818 | Ga0466967_0003262 | |||
| 1819 | Ga0466967_0011854 | |||
| 1820 | Ga0466967_0015468 | |||
| 1821 | Ga0466967_0025617 | |||
| 1822 | Ga0466967_0054908 | |||
| 1823 | Ga0466967_0084997 | |||
| 1824 | Ga0466967_0087121 | |||
| 1825 | Ga0466967_0094124 | |||
| 1826 | Ga0466967_0115898 | |||
| 1827 | Ga0466967_0137708 | |||
| 1828 | Ga0466967_0160751 | |||
| 1829 | Ga0466967_0179667 | |||
| 1830 | Ga0466967_0213864 | |||
| 1831 | Ga0466967_0237608 | |||
| 1832 | Ga0466967_0433146 | |||
| 1833 | Ga0466967_0551817 | |||
| 1834 | Ga0466967_0858283 | |||
| 1835 | Ga0466967_1476351 | |||
| 1836 | Ga0495592_0112947 | |||
| 1837 | Ga0495592_0114033 | |||
| 1838 | Ga0495592_0750564 | |||
| 1839 | Ga0495603_0023275 | |||
| 1840 | Ga0495629_0046938 | |||
| 1841 | Ga0495629_0114708 | |||
| 1842 | Ga0495629_0483832 | |||
| 1843 | Ga0495629_0819019 | |||
| 1844 | Ga0495641_0001250 | |||
| 1845 | Ga0495641_0023550 | |||
| 1846 | Ga0495651_0012474 | |||
| 1847 | Ga0495651_0040858 | |||
| 1848 | Ga0495651_0248700 | |||
| 1849 | Ga0495653_0061120 | |||
| 1850 | Ga0495653_0587652 | |||
| 1851 | Ga0495582_0000397 | |||
| 1852 | Ga0495582_0127741 | |||
| 1853 | Ga0495605_0061489 | |||
| 1854 | Ga0495605_0183141 | |||
| 1855 | Ga0495639_0002254 | |||
| 1856 | Ga0495662_0035472 | |||
| 1857 | Ga0495664_0016551 | |||
| 1858 | Ga0495664_0276691 | |||
| 1859 | Ga0495664_0496142 | |||
| 1860 | Ga0495584_0084022 | |||
| 1861 | Ga0495584_0105889 | |||
| 1862 | Ga0495584_0108216 | |||
| 1863 | Ga0495585_0266184 | |||
| 1864 | Ga0495596_0074630 | |||
| 1865 | Ga0495596_0105199 | |||
| 1866 | Ga0495596_0156887 | |||
| 1867 | Ga0495596_0335123 | |||
| 1868 | Ga0495607_0099382 | |||
| 1869 | Ga0495607_0225143 | |||
| 1870 | Ga0495607_0245655 | |||
| 1871 | Ga0495608_0029157 | |||
| 1872 | Ga0495608_0052486 | |||
| 1873 | Ga0495616_0088845 | |||
| 1874 | Ga0495616_0428307 | |||
| 1875 | Ga0495618_0241671 | |||
| 1876 | Ga0495618_0260148 | |||
| 1877 | Ga0495628_0013424 | |||
| 1878 | Ga0495628_0181249 | |||
| 1879 | Ga0495630_0066836 | |||
| 1880 | Ga0495630_0075867 | |||
| 1881 | Ga0495630_0135334 | |||
| 1882 | Ga0495630_0228121 | |||
| 1883 | Ga0495630_0398463 | |||
| 1884 | Ga0495630_0538046 | |||
| 1885 | Ga0495631_0325870 | |||
| 1886 | Ga0495637_0028523 | |||
| 1887 | Ga0495644_0128343 | |||
| 1888 | Ga0495663_0154082 | |||
| 1889 | Ga0495663_0268888 | |||
| 1890 | Ga0495666_0019709 | |||
| 1891 | Ga0495666_0100536 | |||
| 1892 | Ga0495642_0235976 | |||
| 1893 | Ga0495652_0012598 | |||
| 1894 | Ga0495652_0189526 | |||
| 1895 | Ga0495652_0402912 | |||
| 1896 | Ga0495665_0026888 | |||
| 1897 | Ga0495640_0035402 | |||
| 1898 | Ga0495640_0044499 | |||
| 1899 | Ga0495586_0103308 | |||
| 1900 | Ga0495587_0022577 | |||
| 1901 | Ga0495587_0048446 | |||
| 1902 | Ga0495598_0102770 | |||
| 1903 | Ga0495598_0131980 | |||
| 1904 | Ga0495645_0060684 | |||
| 1905 | Ga0495645_0096890 | |||
| 1906 | Ga0495645_0180645 | |||
| 1907 | Ga0495645_0626745 | |||
| 1908 | Ga0495667_0041845 | |||
| 1909 | Ga0495667_0050247 | |||
| 1910 | Ga0495667_0478577 | |||
| 1911 | Ga0495667_0502674 | |||
| 1912 | Ga0495656_0036803 | |||
| 1913 | Ga0495656_0196125 | |||
| 1914 | Ga0495634_0076063 | |||
| 1915 | Ga0495634_0120097 | |||
| 1916 | Ga0495611_0094636 | |||
| 1917 | Ga0495635_0013378 | |||
| 1918 | Ga0495635_0015938 | |||
| 1919 | Ga0495659_0171023 | |||
| 1920 | Ga0495661_0370205 | |||
| 1921 | Ga0495661_0420876 | |||
| 1922 | Ga0495588_0059077 | |||
| 1923 | Ga0495657_0038175 | |||
| 1924 | Ga0495657_0116590 | |||
| 1925 | Ga0495657_0175077 | |||
| 1926 | Ga0495657_0390097 | |||
| 1927 | Ga0495657_0562755 | |||
| 1928 | Ga0495599_0101990 | |||
| 1929 | Ga0495599_0317149 | |||
| 1930 | Ga0495599_0727878 | |||
| 1931 | Ga0495623_0041457 | |||
| 1932 | Ga0495623_0118047 | |||
| 1933 | Ga0495646_0101109 | |||
| 1934 | Ga0495646_0105173 | |||
| 1935 | Ga0495647_0001542 | |||
| 1936 | Ga0495658_0001563 | |||
| 1937 | Ga0495669_0300484 | |||
| 1938 | Ga0495613_0001506 | |||
| 1939 | Ga0495613_0319079 | |||
| 1940 | Ga0495613_0736123 | |||
| 1941 | Ga0495624_0494701 | |||
| 1942 | Ga0495649_0564922 | |||
| 1943 | Ga0495589_0107891 | |||
| 1944 | Ga0495589_0426537 | |||
| 1945 | Ga0495600_0057459 | |||
| 1946 | Ga0495600_0133015 | |||
| 1947 | Ga0495581_0002960 | |||
| 1948 | Ga0495581_0412987 | |||
| 1949 | Ga0495604_0003309 | |||
| 1950 | Ga0495604_0163609 | |||
| 1951 | Ga0495604_0166394 | |||
| 1952 | Ga0495636_0246872 | |||
| 1953 | Ga0495674_0038374 | |||
| 1954 | Ga0495674_0046005 | |||
| 1955 | Ga0495674_0055190 | |||
| 1956 | Ga0495674_0066253 | |||
| 1957 | Ga0495676_0087650 | |||
| 1958 | Ga0495680_0006197 | |||
| 1959 | Ga0495680_0006671 | |||
| 1960 | Ga0495680_0080049 | |||
| 1961 | Ga0495680_0095433 | |||
| 1962 | Ga0495680_0374265 | |||
| 1963 | Ga0495683_0432331 | |||
| 1964 | Ga0495675_0054671 | |||
| 1965 | Ga0495684_0019345 | |||
| 1966 | Ga0495684_0029105 | |||
| 1967 | Ga0495593_0004029 | |||
| 1968 | Ga0495602_0006483 | |||
| 1969 | Ga0495602_0087030 | |||
| 1970 | Ga0495602_0132184 | |||
| 1971 | Ga0495602_0157092 | |||
| 1972 | Ga0495614_0197046 | |||
| 1973 | Ga0496100_0008217 | |||
| 1974 | Ga0496100_0013049 | |||
| 1975 | Ga0496100_0017810 | |||
| 1976 | Ga0496100_0082161 | |||
| 1977 | Ga0496100_0287704 | |||
| 1978 | Ga0496100_0426778 | |||
| 1979 | Ga0496100_0679569 | |||
| 1980 | Ga0496100_0694590 | |||
| 1981 | Ga0496101_0001675 | |||
| 1982 | Ga0496101_0003097 | |||
| 1983 | Ga0496101_0088309 | |||
| 1984 | Ga0496101_0159668 | |||
| 1985 | Ga0496101_0167196 | |||
| 1986 | Ga0496101_0285496 | |||
| 1987 | Ga0496101_0465055 | |||
| 1988 | Ga0496102_0007218 | |||
| 1989 | Ga0496102_0010358 | |||
| 1990 | Ga0496102_0040337 | |||
| 1991 | Ga0496102_0066040 | |||
| 1992 | Ga0496102_0327479 | |||
| 1993 | Ga0496102_0525111 | |||
| 1994 | Ga0496102_0574841 | |||
| 1995 | Ga0496103_0011909 | |||
| 1996 | Ga0496103_0124345 | |||
| 1997 | Ga0496103_0194786 | |||
| 1998 | Ga0496103_0244348 | |||
| 1999 | Ga0496103_0345080 | |||
| 2000 | Ga0496104_0000134 | |||
| 2001 | Ga0496104_0002226 | |||
| 2002 | Ga0496104_0009373 | |||
| 2003 | Ga0496104_0079872 | |||
| 2004 | Ga0496104_0124098 | |||
| 2005 | Ga0496104_0143093 | |||
| 2006 | Ga0496104_0298791 | |||
| 2007 | Ga0496104_0903148 | |||
| 2008 | Ga0496104_1156832 | |||
| 2009 | Ga0496105_0000334 | |||
| 2010 | Ga0496105_0000429 | |||
| 2011 | Ga0496105_0003332 | |||
| 2012 | Ga0496105_0072352 | |||
| 2013 | Ga0496105_0129599 | |||
| 2014 | Ga0496105_0695540 | |||
| 2015 | Ga0496106_0009788 | |||
| 2016 | Ga0496106_0115864 | |||
| 2017 | Ga0496106_0207466 | |||
| 2018 | Ga0496106_0284268 | |||
| 2019 | Ga0496106_0309841 | |||
| 2020 | Ga0496107_0033042 | |||
| 2021 | Ga0496107_0050773 | |||
| 2022 | Ga0496107_0055898 | |||
| 2023 | Ga0496107_0233644 | |||
| 2024 | Ga0496107_0235471 | |||
| 2025 | Ga0496107_0503341 | |||
| 2026 | Ga0496108_0003536 | |||
| 2027 | Ga0496108_0017704 | |||
| 2028 | Ga0496108_0033079 | |||
| 2029 | Ga0496108_0129163 | |||
| 2030 | Ga0496108_0138388 | |||
| 2031 | Ga0496108_0466152 | |||
| 2032 | Ga0496108_1372233 | |||
| 2033 | Ga0496108_1380347 | |||
| 2034 | Ga0496108_1534265 | |||
| 2035 | Ga0496109_0000898 | |||
| 2036 | Ga0496109_0004403 | |||
| 2037 | Ga0496109_0023182 | |||
| 2038 | Ga0496109_0042839 | |||
| 2039 | Ga0496109_0070787 | |||
| 2040 | Ga0496109_0078645 | |||
| 2041 | Ga0496109_0112373 | |||
| 2042 | Ga0496109_0187673 | |||
| 2043 | Ga0496109_0213280 | |||
| 2044 | Ga0496109_0252758 | |||
| 2045 | Ga0496110_0000164 | |||
| 2046 | Ga0496110_0006694 | |||
| 2047 | Ga0496110_0014588 | |||
| 2048 | Ga0496110_0015943 | |||
| 2049 | Ga0496110_0108442 | |||
| 2050 | Ga0496110_0117827 | |||
| 2051 | Ga0496110_0139077 | |||
| 2052 | Ga0496110_0198647 | |||
| 2053 | Ga0496110_1237352 | |||
| 2054 | Ga0496111_0000228 | |||
| 2055 | Ga0496111_0000295 | |||
| 2056 | Ga0496111_0002679 | |||
| 2057 | Ga0496111_0015328 | |||
| 2058 | Ga0496111_0031537 | |||
| 2059 | Ga0496111_0032440 | |||
| 2060 | Ga0496111_0048024 | |||
| 2061 | Ga0496111_0067212 | |||
| 2062 | Ga0496111_0089012 | |||
| 2063 | Ga0496111_0162974 | |||
| 2064 | Ga0496112_0000291 | |||
| 2065 | Ga0496112_0000443 | |||
| 2066 | Ga0496112_0012008 | |||
| 2067 | Ga0496112_0027889 | |||
| 2068 | Ga0496112_0175579 | |||
| 2069 | Ga0496112_0825665 | |||
| 2070 | Ga0496112_1218375 | |||
| 2071 | Ga0496113_0001618 | |||
| 2072 | Ga0496113_0158435 | |||
| 2073 | Ga0496113_0263470 | |||
| 2074 | Ga0496113_0307251 | |||
| 2075 | Ga0496113_0335155 | |||
| 2076 | Ga0496113_0569826 | |||
| 2077 | Ga0496114_0000281 | |||
| 2078 | Ga0496114_0002188 | |||
| 2079 | Ga0496114_0003176 | |||
| 2080 | Ga0496114_0026662 | |||
| 2081 | Ga0496114_0055144 | |||
| 2082 | Ga0496114_0354314 | |||
| 2083 | Ga0496114_0371130 | |||
| 2084 | Ga0496114_0438328 | |||
| 2085 | Ga0496114_0584784 | |||
| 2086 | Ga0496114_0985169 | |||
| 2087 | Ga0496115_0015385 | |||
| 2088 | Ga0496115_0022334 | |||
| 2089 | Ga0496115_0027454 | |||
| 2090 | Ga0496115_0057152 | |||
| 2091 | Ga0496115_0060452 | |||
| 2092 | Ga0496115_0231042 | |||
| 2093 | Ga0496115_0380090 | |||
| 2094 | Ga0501031_0005532 | |||
| 2095 | Ga0501031_0104493 | |||
| 2096 | Ga0501031_0342915 | |||
| 2097 | Ga0501032_0063899 | |||
| 2098 | Ga0501033_0002824 | |||
| 2099 | Ga0501033_0048171 | |||
| 2100 | Ga0501034_1528207 | |||
| 2101 | Ga0501036_0004455 | |||
| 2102 | Ga0501036_0075063 | |||
| 2103 | Ga0501037_0000851 | |||
| 2104 | Ga0501037_0137364 | |||
| 2105 | Ga0501038_0000817 | |||
| 2106 | Ga0501038_0072163 | |||
| 2107 | Ga0501039_0009773 | |||
| 2108 | Ga0501039_0018588 | |||
| 2109 | Ga0501040_0028879 | |||
| 2110 | Ga0501040_0166336 | |||
| 2111 | Ga0501041_0001581 | |||
| 2112 | Ga0501041_0001675 | |||
| 2113 | Ga0501042_0013943 | |||
| 2114 | Ga0501042_0096600 | |||
| 2115 | Ga0501042_0282203 | |||
| 2116 | Ga0501043_0016623 | |||
| 2117 | Ga0501043_0059002 | |||
| 2118 | Ga0501046_0015550 | |||
| 2119 | Ga0501046_0017207 | |||
| 2120 | Ga0501047_0269834 | |||
| 2121 | Ga0501047_0503782 | |||
| 2122 | Ga0501048_0054653 | |||
| 2123 | Ga0501048_0092101 | |||
| 2124 | Ga0501067_0000154 | |||
| 2125 | Ga0501067_0018163 | |||
| 2126 | Ga0501068_0037044 | |||
| 2127 | Ga0501068_0114948 | |||
| 2128 | Ga0501069_0006471 | |||
| 2129 | Ga0501069_0008732 | |||
| 2130 | Ga0501069_0045665 | |||
| 2131 | Ga0501069_0136062 | |||
| 2132 | Ga0501069_0264669 | |||
| 2133 | Ga0501070_0000243 | |||
| 2134 | Ga0501070_0029959 | |||
| 2135 | Ga0501070_0040388 | |||
| 2136 | Ga0501070_0084234 | |||
| 2137 | Ga0501070_0478804 | |||
| 2138 | Ga0501071_0001272 | |||
| 2139 | Ga0501071_0340956 | |||
| 2140 | Ga0501072_0106992 | |||
| 2141 | Ga0501072_0116752 | |||
| 2142 | Ga0501073_0004374 | |||
| 2143 | Ga0501074_0012526 | |||
| 2144 | Ga0501074_0018826 | |||
| 2145 | Ga0501074_0040111 | |||
| 2146 | Ga0501074_0165560 | |||
| 2147 | Ga0501074_0326934 | |||
| 2148 | Ga0501074_1011591 | |||
| 2149 | Ga0501074_1137081 | |||
| 2150 | Ga0501075_0028059 | |||
| 2151 | Ga0501076_0009936 | |||
| 2152 | Ga0501076_0099117 | |||
| 2153 | Ga0501077_0002323 | |||
| 2154 | Ga0501077_0002523 | |||
| 2155 | Ga0501077_0014680 | |||
| 2156 | Ga0501079_0004378 | |||
| 2157 | Ga0501079_0178252 | |||
| 2158 | Ga0501079_0179793 | |||
| 2159 | Ga0501079_0929063 | |||
| 2160 | Ga0501080_0001996 | |||
| 2161 | Ga0501080_0153899 | |||
| 2162 | Ga0501080_0160365 | |||
| 2163 | Ga0501080_0222874 | |||
| 2164 | Ga0501080_0252296 | |||
| 2165 | Ga0501080_0400347 | |||
| 2166 | Ga0501081_0001229 | |||
| 2167 | Ga0501083_0083099 | |||
| 2168 | Ga0501035_0002330 | |||
| 2169 | Ga0501035_0127654 | |||
| 2170 | Ga0501035_1171300 | |||
| 2171 | Ga0501044_0103343 | |||
| 2172 | Ga0501045_0002724 | |||
| 2173 | Ga0501045_0168652 | |||
| 2174 | nmdc:mga05p37_105308_c1 | |||
| 2175 | nmdc:mga05p37_23411_c1 | |||
| 2176 | nmdc:mga05p37_30852_c1 | |||
| 2177 | nmdc:mga05p37_374784_c1 | |||
| 2178 | nmdc:mga06r32_14701_c1 | |||
| 2179 | nmdc:mga06r32_729328_c1 | |||
| 2180 | nmdc:mga08y16_1054378_c1 | |||
| 2181 | nmdc:mga08y16_1695176_c1 | |||
| 2182 | nmdc:mga08y16_242066_c1 | |||
| 2183 | nmdc:mga08y16_325712_c1 | |||
| 2184 | nmdc:mga08y16_95124_c1 | |||
| 2185 | nmdc:mga0n895_11292_c1 | |||
| 2186 | nmdc:mga0n895_1345301_c1 | |||
| 2187 | nmdc:mga0n895_2045985_c1 | |||
| 2188 | nmdc:mga0n895_304032_c1 | |||
| 2189 | nmdc:mga0n895_58476_c1 | |||
| 2190 | nmdc:mga0n895_8613_c1 | |||
| 2191 | nmdc:mga0rr50_10287_c1 | |||
| 2192 | nmdc:mga0rr50_214893_c1 | |||
| 2193 | nmdc:mga0rr50_225_c1 | |||
| 2194 | nmdc:mga0rr50_878172_c1 | |||
| 2195 | nmdc:mga08x19_10123_c1 | |||
| 2196 | nmdc:mga08x19_39705_c1 | |||
| 2197 | nmdc:mga0a205_181837_c1 | |||
| 2198 | nmdc:mga0a205_3153_c1 | |||
| 2199 | nmdc:mga0a205_553517_c1 | |||
| 2200 | Ga0495601_0073913 | |||
| 2201 | Ga0495601_0276367 | |||
| 2202 | Ga0495601_0392264 | |||
| 2203 | Ga0495601_0476578 | |||
| 2204 | Ga0495612_0021233 | |||
| 2205 | Ga0495612_0202884 | |||
| 2206 | Ga0495655_0017692 | |||
| 2207 | Ga0495655_0131140 | |||
| 2208 | Ga0495619_0002264 | |||
| 2209 | Ga0495619_0060049 | |||
| 2210 | Ga0495619_0664531 | |||
| 2211 | Ga0501084_0000859 | |||
| 2212 | Ga0501084_0761815 | |||
| 2213 | Ga0590077_129034 | |||
| 2214 | Ga0501082_0008383 | |||
| 2215 | Ga0501082_0375404 | |||
| 2216 | Ga0501082_0568272 | |||
| 2217 | Ga0466962_0188099 | |||
| 2218 | Ga0530510_0022663 | |||
| 2219 | Ga0530510_0055552 | |||
| 2220 | Ga0530510_0135001 | |||
| 2221 | Ga0530510_0248814 | |||
| 2222 | Ga0530510_0313558 | |||
| 2223 | Ga0530510_0683490 | |||
| 2224 | Ga0530510_1367719 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9725 | 1 | 151 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9649 | 1 | 151 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9633 | 1 | 151 |
| 1t3q-assembly1.cif.gz_D | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.958 | 1 | 150 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9538 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9833 | 1 | 73 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9752 | 1 | 75 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9705 | 1 | 75 | 3.10.20.30 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9587 | 78 | 151 | 1.10.150.120 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9568 | 1 | 75 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2XY32-F1-model_v4 | (2Fe-2S)-binding protein | 0.9875 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A538BUE3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9861 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A536R2F2-F1-model_v4 | (2Fe-2S)-binding protein | 0.9824 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A535DQ93-F1-model_v4 | (2Fe-2S)-binding protein | 0.9818 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2V6YN69-F1-model_v4 | Ferredoxin | 0.9815 | 1 | 151 |
GO:0016903
GO:0046872 GO:0051537 |