metagRoot

F490214

General Info

Members	Datasets	Scaffolds	Average Seq Length
1110	817	558	109

Family's Representative Sequence

Representative Sequence	3300006353\|Ga0075370_10250373\|Ga0075370_102503732
Length	102
Sequence	MSEWKQVAALEDIPRLGSRVVKTATQDIAVFRTSEDKVFALHDHCPHKGGPLSQGIVHGDKVTCPLHGWNIGMCDGQAVAPDVGNTACFEVKLENGQVFLKV

Samples

	Sample ID	Description	Type	Environment
1	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
2	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
3	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
4	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
5	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
6	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
7	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
8	2510917026	Rhizobium sp. CF80	Isolate	Rhizosphere
9	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
10	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
11	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
12	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
13	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
14	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
15	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
16	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
17	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
18	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
19	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
20	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
21	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
22	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
23	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
24	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
25	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
26	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
27	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
28	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
29	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
30	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
31	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
32	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
33	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
34	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
35	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
36	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
37	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
38	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
39	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
40	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
41	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
42	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
43	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
44	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
45	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
46	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
47	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
48	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
49	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
50	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
51	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
52	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
53	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
54	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
55	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
56	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
57	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
58	2558860983	Allorhizobium undicola ATCC 700741	Isolate	Rhizoplane
59	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
60	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
61	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
62	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
63	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
64	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
65	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
66	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
67	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
68	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
69	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
70	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
71	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
72	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
73	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
74	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
75	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
76	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
77	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
78	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
79	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
80	2585427633	Neorhizobium galegae bv. officinalis HAMBI 1141	Isolate	Nodule
81	2585427634	Neorhizobium galegae bv. orientalis HAMBI 540	Isolate	Nodule
82	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
83	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
84	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
85	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
86	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
87	2600254933	Rhizobium sp. NFR12	Isolate	Rhizoplane
88	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
89	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
90	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
91	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
92	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
93	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
94	2643221557	Ensifer sp. Root558	Isolate	Unclassified
95	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
96	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
97	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
98	2643221610	Ensifer sp. Root74	Isolate	Unclassified
99	2643221618	Ensifer sp. Root231	Isolate	Unclassified
100	2643221626	Ensifer sp. Root31	Isolate	Unclassified
101	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
102	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
103	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
104	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
105	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
106	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
107	2643221659	Ensifer sp. Root127	Isolate	Unclassified
108	2643221668	Ensifer sp. Root423	Isolate	Unclassified
109	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
110	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
111	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
112	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
113	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
114	2643221698	Ensifer sp. Root142	Isolate	Unclassified
115	2643221712	Ensifer sp. Root258	Isolate	Unclassified
116	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
117	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
118	2643221723	Ensifer sp. Root278	Isolate	Unclassified
119	2643221726	Ensifer sp. Root954	Isolate	Unclassified
120	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
121	2693429783	Mesorhizobium sp. LCM 4577	Isolate	Rhizosphere
122	2693429784	Mesorhizobium sp. LCM 4576	Isolate	Rhizosphere
123	2718217882	Rhizobium sp. N741	Isolate	Nodule
124	2718217927	Rhizobium sp. N324	Isolate	Nodule
125	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
126	2718218009	Rhizobium sp. N561	Isolate	Nodule
127	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
128	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
129	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
130	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
131	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
132	2718218363	Rhizobium sp. N113	Isolate	Nodule
133	2718218365	Rhizobium sp. N731	Isolate	Nodule
134	2718218366	Rhizobium sp. N621	Isolate	Nodule
135	2718218423	Rhizobium sp. N941	Isolate	Nodule
136	2721755514	Rhizobium sp. N6212	Isolate	Nodule
137	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
138	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
139	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
140	2721755809	Rhizobium sp. N541	Isolate	Nodule
141	2721755810	Rhizobium sp. N871	Isolate	Nodule
142	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
143	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
144	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
145	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
146	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
147	2728369365	Rhizobium sp. N1341	Isolate	Nodule
148	2728369397	Rhizobium sp. N1314	Isolate	Nodule
149	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
150	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
151	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
152	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
153	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
154	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
155	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
156	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
157	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
158	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
159	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
160	2791355256	Rhizobium sp. M10	Isolate	Nodule
161	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
162	2791355260	Rhizobium sp. L9	Isolate	Nodule
163	2791355261	Rhizobium sp. J15	Isolate	Nodule
164	2791355262	Rhizobium sp. M1	Isolate	Nodule
165	2791355263	Rhizobium chutanense C5	Isolate	Nodule
166	2791355264	Rhizobium sp. S9	Isolate	Nodule
167	2791355265	Rhizobium sp. H4	Isolate	Nodule
168	2791355266	Rhizobium sp. L43	Isolate	Nodule
169	2791355267	Rhizobium sp. L18	Isolate	Nodule
170	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
171	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
172	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
173	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
174	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
175	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
176	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
177	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
178	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
179	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
180	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
181	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
182	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
183	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
184	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
185	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
186	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
187	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
188	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
189	2838029111	Rhizobium tropici SEMIA 4079	Isolate	Nodule
190	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
191	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
192	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
193	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
194	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
195	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
196	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
197	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
198	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
199	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
200	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
201	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
202	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
203	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
204	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
205	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
206	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
207	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
208	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
209	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
210	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
211	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
212	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
213	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
214	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
215	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
216	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
217	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
218	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
219	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
220	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
221	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
222	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
223	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
224	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
225	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
226	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
227	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
228	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
229	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
230	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
231	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
232	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
233	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
234	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
235	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
236	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
237	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
238	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
239	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
240	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
241	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
242	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
243	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
244	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
245	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
246	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
247	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
248	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
249	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
250	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
251	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
252	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
253	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
254	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
255	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
256	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
257	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
258	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
259	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
260	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
261	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
262	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
263	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
264	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
265	2842475841	Rhizobium tropici SEMIA 4059	Isolate	Nodule
266	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
267	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
268	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
269	2842502639	Rhizobium tropici SEMIA 4063	Isolate	Nodule
270	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
271	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
272	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
273	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
274	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
275	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
276	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
277	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
278	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
279	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
280	2856349417	Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1	Isolate	Nodule
281	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
282	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
283	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
284	2876377896	Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1	Isolate	Nodule
285	2881155292	Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1	Isolate	Nodule
286	2881853255	Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1	Isolate	Nodule
287	2885318864	Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1	Isolate	Nodule
288	2885342637	Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1	Isolate	Nodule
289	2885350715	Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1	Isolate	Nodule
290	2888337043	Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1	Isolate	Nodule
291	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
292	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
293	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
294	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
295	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
296	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
297	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
298	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
299	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
300	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
301	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
302	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
303	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
304	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
305	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
306	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
307	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
308	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
309	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
310	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
311	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
312	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
313	2919171160	Neorhizobium sp. 2083	Isolate	Unclassified
314	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
315	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
316	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
317	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
318	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
319	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
320	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
321	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
322	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
323	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
324	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
325	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
326	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
327	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
328	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
329	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
330	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
331	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
332	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
333	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
334	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
335	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
336	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
337	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
338	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
339	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
340	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
341	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
342	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
343	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
344	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
345	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
346	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
347	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
348	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
349	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
350	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
351	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
352	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
353	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
354	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
355	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
356	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
357	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
358	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
359	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
360	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
361	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
362	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
363	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
364	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
365	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
366	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
367	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
368	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
369	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
370	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
371	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
372	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
373	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
374	2938014810	Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1	Isolate	Nodule
375	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
376	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
377	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
378	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
379	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
380	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
381	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
382	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
383	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
384	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
385	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
386	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
387	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
388	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
389	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
390	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
391	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
392	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
393	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
394	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
395	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
396	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
397	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
398	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
399	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
400	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
401	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
402	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
403	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
404	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
405	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
406	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
407	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
408	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
409	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
410	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
411	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
412	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
413	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
414	2961127735	Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1	Isolate	Nodule
415	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
416	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
417	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
418	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
419	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
420	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
421	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
422	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
423	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
424	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
425	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
426	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
427	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
428	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
429	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
430	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
431	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
432	2965062239	Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1	Isolate	Nodule
433	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
434	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
435	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
436	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
437	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
438	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
439	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
440	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
441	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
442	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
443	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
444	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
445	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
446	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
447	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
448	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
449	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
450	2968091066	Mesorhizobium sp. AA23	Isolate	Unclassified
451	2968128360	Mesorhizobium sp. WSM3873	Isolate	Unclassified
452	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
453	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
454	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
455	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
456	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
457	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
458	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
459	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
460	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
461	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
462	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
463	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
464	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
465	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
466	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
467	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
468	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
469	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
470	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
471	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
472	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
473	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
474	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
475	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
476	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
477	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
478	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
479	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
480	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
481	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
482	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
483	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
484	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
485	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
486	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
487	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
488	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
489	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
490	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
491	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
492	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
493	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
494	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
495	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
496	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
497	2996887358	Rhizobium sp. R711	Isolate	Nodule
498	2996893221	Rhizobium sp. R635	Isolate	Nodule
499	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
500	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
501	3004289098	Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1	Isolate	Nodule
502	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
503	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
504	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
505	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
506	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
507	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
508	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
509	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
510	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
511	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
512	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
513	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
514	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
515	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
516	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
517	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
518	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
519	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
520	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
521	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
522	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
523	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
524	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
525	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
526	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
527	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
528	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
529	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
530	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
531	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
532	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
533	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
534	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
535	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
536	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
537	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
538	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
539	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
540	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
541	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
542	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
543	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
544	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
545	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
546	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
547	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
548	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
549	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
550	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
551	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
552	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
553	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
554	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
555	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
556	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
557	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
558	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
559	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
560	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
561	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
562	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
563	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
564	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
565	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
566	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
567	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
568	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
569	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
570	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
571	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
572	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
573	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
574	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
575	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
576	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
577	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
578	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
579	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
580	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
581	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
582	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
583	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
584	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
585	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
586	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
587	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
588	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
589	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
590	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
591	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
592	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
593	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
594	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
595	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
596	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
597	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
598	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
599	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
600	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
601	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
602	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
603	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
604	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
605	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
606	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
607	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
608	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
609	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
610	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
611	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
612	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
613	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
614	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
615	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
616	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
617	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
618	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
619	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
620	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
621	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
622	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
623	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
624	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
625	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
626	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
627	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
628	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
629	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
630	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
631	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
632	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
633	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
634	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
635	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
636	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
637	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
638	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
639	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
640	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
641	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
642	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
643	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
644	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
645	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
646	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
647	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
648	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
649	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
650	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
651	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
652	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
653	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
654	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
655	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
656	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
657	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
658	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
659	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
660	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
661	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
662	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
663	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
664	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
665	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
666	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
667	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
668	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
669	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
670	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
671	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
672	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
673	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
674	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
675	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
676	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
677	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
678	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
679	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
680	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
681	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
682	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
683	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
684	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
685	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
686	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
687	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
688	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
689	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
690	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
691	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
692	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
693	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
694	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
695	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
696	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
697	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
698	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
699	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
700	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
701	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
702	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
703	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
704	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
705	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
706	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
707	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
708	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
709	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
710	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
711	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
712	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
713	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
714	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
715	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
716	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
717	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
718	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
719	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
720	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
721	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
722	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
723	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
724	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
725	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
726	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
727	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
728	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
729	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
730	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
731	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
732	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
733	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
734	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
735	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
736	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
737	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
738	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
739	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
740	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
741	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
742	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
743	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
744	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
745	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
746	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
747	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
748	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
749	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
750	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
751	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
752	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
753	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
754	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
755	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
756	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
757	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
758	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
759	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
760	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
761	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
762	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
763	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
764	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
765	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
766	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
767	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
768	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
769	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
770	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
771	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
772	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
773	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
774	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
775	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
776	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
777	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
778	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
779	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
780	8005258706	Rhizobium sp. R693	Isolate	Nodule
781	8005275841	Rhizobium sp. N4311	Isolate	Nodule
782	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
783	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
784	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
785	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
786	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
787	8005321885	Rhizobium sp. R72	Isolate	Nodule
788	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
789	8005382845	Rhizobium sp. R634	Isolate	Nodule
790	8005395548	Rhizobium sp. R339	Isolate	Nodule
791	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
792	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
793	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
794	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
795	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
796	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
797	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
798	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
799	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
800	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
801	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
802	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
803	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
804	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
805	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
806	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
807	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
808	8018176218	Rhizobium sp. N122	Isolate	Nodule
809	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
810	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
811	8024501048	Rhizobium sp. H4	Isolate	Nodule
812	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
813	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
814	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
815	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
816	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
817	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	49.91
Metatranscriptomes	0.36
Isolates	49.73

Biome Distribution

Category	Percentage (%)
Aerial Root	0.36
Bulb	0
Endosphere	18.92
Nodule	38.92
Rhizoplane	2.16
Rhizosphere	24.77
Stem	0
Stem Tuber	0
Unclassified	14.86

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10030734	3300001979	Bacteria	1742
2	JGI25155J39150_1000046	3300002704	Bacteria	80685
3	JGI25156J39149_1000070	3300002705	Bacteria	80840
4	JGI25162J39368_1001472	3300002737	Bacteria	12352
5	JGI25162J39368_1002141	3300002737	Bacteria	8281
6	JGI25154J39366_1000092	3300002738	Bacteria	80685
7	JGI25158J39367_1005879	3300002739	Bacteria	1777
8	JGI25157J39369_1000087	3300002741	Bacteria	80840
9	JGI25152J39213_1000256	3300002773	Bacteria	35313
10	JGI25152J39213_1001609	3300002773	Bacteria	9463
11	JGI25152J39213_1010989	3300002773	Bacteria	2029
12	JGI25152J39213_1014694	3300002773	Bacteria	1576
13	JGI25150J39212_1000501	3300002774	Bacteria	16267
14	JGI25150J39212_1009161	3300002774	Bacteria	1902
15	JGI25159J45721_1000171	3300002987	Bacteria	30376
16	JGI25159J45721_1001786	3300002987	Bacteria	8625
17	JGI25151J46595_10000007	3300003187	Bacteria	411751
18	JGI25151J46595_10000326	3300003187	Bacteria	51646
19	JGI25151J46595_10001095	3300003187	Bacteria	20016
20	JGI25151J46595_10028501	3300003187	Bacteria	2223
21	JGI25151J46595_10071192	3300003187	Bacteria	1052
22	JGI25151J46595_10138869	3300003187	Bacteria	595
23	JGI25151J46595_10142763	3300003187	Bacteria	582
24	JGI25165J46597_1001164	3300003214	Bacteria	16187
25	JGI25165J46597_1001468	3300003214	Bacteria	12294
26	JGI25165J46597_1008606	3300003214	Bacteria	1589
27	JGI25153J46596_10000313	3300003215	Bacteria	35777
28	JGI25153J46596_10004044	3300003215	Bacteria	7994
29	rootH2_10004653	3300003320	Bacteria	2154
30	rootL2_10007576	3300003322	Bacteria	5846
31	JGI25160J50197_1000032	3300003354	Bacteria	174525
32	JGI25160J50197_1000355	3300003354	Bacteria	30376
33	JGI25160J50197_1000444	3300003354	Bacteria	25877
34	JGI25160J50197_1014251	3300003354	Bacteria	2667
35	JGI25161J50226_1000017	3300003374	Bacteria	174525
36	JGI25161J50226_1000398	3300003374	Bacteria	21569
37	Ga0055539_1004625	3300003752	Bacteria	1827
38	Ga0055526_1000613	3300003771	Bacteria	27657
39	Ga0055526_1001408	3300003771	Bacteria	17103
40	Ga0055526_1014425	3300003771	Bacteria	3251
41	Ga0055526_1018247	3300003771	Bacteria	2629
42	Ga0055526_1018453	3300003771	Bacteria	2602
43	Ga0055526_1037737	3300003771	Bacteria	1258
44	Ga0055524_1000609	3300003775	Bacteria	25646
45	Ga0055524_1004562	3300003775	Bacteria	6373
46	Ga0055524_1005279	3300003775	Bacteria	5802
47	Ga0055524_1006471	3300003775	Bacteria	5076
48	Ga0055524_1030456	3300003775	Bacteria	1573
49	Ga0055524_1033762	3300003775	Bacteria	1426
50	Ga0055524_1052009	3300003775	Bacteria	920
51	Ga0055536_1016298	3300003781	Bacteria	2491
52	Ga0055528_1000067	3300003790	Bacteria	83853
53	Ga0055528_1000515	3300003790	Bacteria	30346
54	Ga0055528_1002522	3300003790	Bacteria	9747
55	Ga0055528_1007333	3300003790	Bacteria	4891
56	Ga0055528_1008809	3300003790	Bacteria	4276
57	Ga0055528_1020714	3300003790	Bacteria	2122
58	Ga0055528_1042170	3300003790	Bacteria	1008
59	Ga0055540_1000313	3300003792	Bacteria	42979
60	Ga0055540_1006328	3300003792	Bacteria	4723
61	Ga0055531_10019248	3300003794	Bacteria	2773
62	Ga0055531_10058386	3300003794	Bacteria	960
63	Ga0055531_10073172	3300003794	Bacteria	782
64	Ga0055531_10077444	3300003794	Bacteria	744
65	Ga0055531_10086020	3300003794	Bacteria	679
66	Ga0058692_1016544	3300003856	Bacteria	1635
67	Ga0058692_1043951	3300003856	Bacteria	769
68	Ga0058692_1074842	3300003856	Bacteria	506
69	Ga0055543_1000039	3300004625	Bacteria	123885
70	Ga0055543_1000148	3300004625	Bacteria	58420
71	Ga0055543_1000362	3300004625	Bacteria	30192
72	Ga0065165_1000179	3300005262	Bacteria	112568
73	Ga0065165_1001187	3300005262	Bacteria	30192
74	Ga0065165_1009714	3300005262	Bacteria	4263
75	Ga0065165_1145841	3300005262	Bacteria	556
76	Ga0070658_10348794	3300005327	Bacteria	1267
77	Ga0070658_10580195	3300005327	Bacteria	971
78	Ga0070666_10374203	3300005335	Bacteria	1022
79	Ga0070668_100041024	3300005347	Bacteria	3545
80	Ga0070668_100601849	3300005347	Bacteria	962
81	Ga0070668_100928853	3300005347	Bacteria	779
82	Ga0070671_100030311	3300005355	Bacteria	4464
83	Ga0070678_101880424	3300005456	Bacteria	565
84	Ga0070665_100069298	3300005548	Bacteria	3535
85	Ga0070665_101122167	3300005548	Bacteria	798
86	Ga0068855_100995341	3300005563	Bacteria	881
87	Ga0068856_100058142	3300005614	Bacteria	3818
88	Ga0068856_100451827	3300005614	Bacteria	1306
89	Ga0068852_100448518	3300005616	Bacteria	1277
90	Ga0068861_100648235	3300005719	Bacteria	975
91	Ga0068851_10149718	3300005834	Bacteria	1275
92	Ga0075365_10001066	3300006038	Bacteria	11870
93	Ga0075365_10001685	3300006038	Bacteria	10226
94	Ga0075365_10034040	3300006038	Bacteria	3288
95	Ga0075365_10258476	3300006038	Bacteria	1224
96	Ga0075365_10729961	3300006038	Bacteria	700
97	Ga0075363_100026827	3300006048	Bacteria	2949
98	Ga0075363_100196537	3300006048	Bacteria	1151
99	Ga0075363_100562963	3300006048	Bacteria	681
100	Ga0075364_10025538	3300006051	Bacteria	3761
101	Ga0075364_10286879	3300006051	Bacteria	1120
102	Ga0075362_10003089	3300006177	Bacteria	5739
103	Ga0075362_10154742	3300006177	Bacteria	1101
104	Ga0075367_10001422	3300006178	Bacteria	10262
105	Ga0075367_10041457	3300006178	Bacteria	2691
106	Ga0075367_10245288	3300006178	Bacteria	1123
107	Ga0075369_10029934	3300006186	Bacteria	2291
108	Ga0075369_10047699	3300006186	Bacteria	1847
109	Ga0075369_10117527	3300006186	Bacteria	1202
110	Ga0075369_10159368	3300006186	Bacteria	1034
111	Ga0075369_10278620	3300006186	Bacteria	779
112	Ga0075369_10497015	3300006186	Bacteria	579
113	Ga0075366_10804396	3300006195	Bacteria	585
114	Ga0075370_10044436	3300006353	Bacteria	2512
115	Ga0075370_10151421	3300006353	Bacteria	1359
116	Ga0075370_10250373	3300006353	Bacteria	1050
117	Ga0075370_10300406	3300006353	Bacteria	955
118	Ga0075370_10349835	3300006353	Bacteria	883
119	Ga0075370_10972759	3300006353	Bacteria	520
120	Ga0068865_101115934	3300006881	Bacteria	695
121	Ga0079104_1007475	3300006946	Bacteria	3954
122	Ga0099826_10000297	3300006948	Bacteria	22278
123	Ga0099826_10501872	3300006948	Bacteria	567
124	Ga0105251_10002612	3300009011	Bacteria	13932
125	Ga0105240_10000376	3300009093	Bacteria	83903
126	Ga0105240_12205097	3300009093	Bacteria	571
127	Ga0105243_11234781	3300009148	Bacteria	762
128	Ga0105248_10077619	3300009177	Bacteria	3734
129	Ga0105248_10432804	3300009177	Bacteria	1482
130	Ga0105237_10000038	3300009545	Bacteria	190707
131	Ga0105237_10006761	3300009545	Bacteria	12655
132	Ga0105238_10188595	3300009551	Bacteria	2038
133	Ga0105238_11659514	3300009551	Bacteria	670
134	Ga0105249_10866160	3300009553	Bacteria	969
135	Ga0123341_1000001	3300009765	Bacteria	314908
136	Ga0123342_1023820	3300009766	Bacteria	3916
137	Ga0105239_10005625	3300010375	Bacteria	14646
138	Ga0105239_10182049	3300010375	Bacteria	2351
139	Ga0105239_10502279	3300010375	Bacteria	1379
140	Ga0105239_10737860	3300010375	Bacteria	1127
141	Ga0157326_1013347	3300012513	Bacteria	947
142	Ga0157373_10063952	3300013100	Bacteria	2604
143	Ga0157373_10588352	3300013100	Bacteria	809
144	Ga0157371_10972523	3300013102	Bacteria	646
145	Ga0157370_10045900	3300013104	Bacteria	4191
146	Ga0157370_10610911	3300013104	Bacteria	998
147	Ga0157369_10221045	3300013105	Bacteria	1983
148	Ga0157369_10604413	3300013105	Bacteria	1132
149	Ga0171463_1001	3300013249	Bacteria	1406070
150	Ga0157378_12999531	3300013297	Bacteria	524
151	Ga0182008_10027407	3300014497	Bacteria	2886
152	Ga0182007_10002126	3300015262	Bacteria	10116
153	Ga0182005_1090210	3300015265	Bacteria	852
154	Ga0183363_1108	3300015690	Bacteria	23177
155	Ga0228711_1018920	3300022739	Bacteria	6424
156	Ga0228710_1008176	3300022740	Bacteria	15103
157	Ga0209435_100059	3300025206	Bacteria	80744
158	Ga0209760_102686	3300025207	Bacteria	1638
159	Ga0209436_100102	3300025208	Bacteria	42263
160	Ga0209436_125777	3300025208	Bacteria	696
161	Ga0207427_106451	3300025231	Bacteria	1486
162	Ga0209437_100023	3300025233	Bacteria	614195
163	Ga0209437_100341	3300025233	Bacteria	56114
164	Ga0209437_115546	3300025233	Bacteria	1037
165	Ga0207425_1000018	3300025245	Bacteria	411841
166	Ga0207425_1004085	3300025245	Bacteria	4468
167	Ga0207425_1038773	3300025245	Bacteria	914
168	Ga0207425_1042827	3300025245	Bacteria	855
169	Ga0209646_1000179	3300025246	Bacteria	80892
170	Ga0209646_1010633	3300025246	Bacteria	1439
171	Ga0209646_1021194	3300025246	Bacteria	935
172	Ga0209026_1000212	3300025250	Bacteria	80892
173	Ga0209677_100218	3300025253	Bacteria	41903
174	Ga0209759_1000246	3300025256	Bacteria	80892
175	Ga0209759_1050701	3300025256	Bacteria	641
176	Ga0209129_1000026	3300025258	Bacteria	411839
177	Ga0209129_1000045	3300025258	Bacteria	272407
178	Ga0209129_1001008	3300025258	Bacteria	16773
179	Ga0209129_1002750	3300025258	Bacteria	8225
180	Ga0209129_1015648	3300025258	Bacteria	1553
181	Ga0209233_1000062	3300025261	Bacteria	399685
182	Ga0209233_1000097	3300025261	Bacteria	295452
183	Ga0209233_1000970	3300025261	Bacteria	12354
184	Ga0209455_1027488	3300025272	Bacteria	1007
185	Ga0209673_1000005	3300025273	Bacteria	692788
186	Ga0209673_1000310	3300025273	Bacteria	89821
187	Ga0209673_1000852	3300025273	Bacteria	39696
188	Ga0209673_1000877	3300025273	Bacteria	39066
189	Ga0209673_1002482	3300025273	Bacteria	12736
190	Ga0209673_1007638	3300025273	Bacteria	4938
191	Ga0209673_1009627	3300025273	Bacteria	4155
192	Ga0209130_1000092	3300025284	Bacteria	149162
193	Ga0209130_1000670	3300025284	Bacteria	31097
194	Ga0209130_1026631	3300025284	Bacteria	1237
195	Ga0209676_1032246	3300025292	Bacteria	1578
196	Ga0209676_1044674	3300025292	Bacteria	1213
197	Ga0209676_1098095	3300025292	Bacteria	630
198	Ga0209025_1000035	3300025294	Bacteria	411841
199	Ga0209025_1000097	3300025294	Bacteria	236632
200	Ga0209025_1000376	3300025294	Bacteria	92939
201	Ga0209025_1001368	3300025294	Bacteria	32734
202	Ga0209025_1007209	3300025294	Bacteria	8376
203	Ga0209025_1008586	3300025294	Bacteria	7319
204	Ga0209025_1011225	3300025294	Bacteria	5938
205	Ga0209025_1078177	3300025294	Bacteria	1137
206	Ga0209025_1108448	3300025294	Bacteria	859
207	Ga0209564_1000137	3300025295	Bacteria	183874
208	Ga0209564_1000827	3300025295	Bacteria	42062
209	Ga0209564_1003453	3300025295	Bacteria	10790
210	Ga0209564_1009878	3300025295	Bacteria	4471
211	Ga0209564_1018644	3300025295	Bacteria	2634
212	Ga0209564_1027339	3300025295	Bacteria	1856
213	Ga0209758_1000040	3300025297	Bacteria	411841
214	Ga0209758_1000652	3300025297	Bacteria	52407
215	Ga0209758_1001596	3300025297	Bacteria	25926
216	Ga0209758_1006004	3300025297	Bacteria	8982
217	Ga0209758_1010387	3300025297	Bacteria	5582
218	Ga0209758_1065005	3300025297	Bacteria	1179
219	Ga0209050_1001525	3300025298	Bacteria	24412
220	Ga0209050_1016113	3300025298	Bacteria	3081
221	Ga0209256_1000397	3300025299	Bacteria	68947
222	Ga0209256_1000948	3300025299	Bacteria	35150
223	Ga0209256_1003072	3300025299	Bacteria	12269
224	Ga0209256_1005174	3300025299	Bacteria	7682
225	Ga0209256_1005462	3300025299	Bacteria	7304
226	Ga0209256_1009630	3300025299	Bacteria	4198
227	Ga0209256_1018814	3300025299	Bacteria	2225
228	Ga0209256_1061014	3300025299	Bacteria	878
229	Ga0207426_1000022	3300025302	Bacteria	547377
230	Ga0207426_1000094	3300025302	Bacteria	275293
231	Ga0207426_1000677	3300025302	Bacteria	41245
232	Ga0207426_1001886	3300025302	Bacteria	15307
233	Ga0209051_1000166	3300025303	Bacteria	120265
234	Ga0209051_1002823	3300025303	Bacteria	11969
235	Ga0209051_1027181	3300025303	Bacteria	2286
236	Ga0209051_1068095	3300025303	Bacteria	1085
237	Ga0209051_1143367	3300025303	Bacteria	571
238	Ga0209257_1006883	3300025304	Bacteria	7129
239	Ga0209257_1008917	3300025304	Bacteria	5523
240	Ga0209257_1009354	3300025304	Bacteria	5275
241	Ga0209257_1027351	3300025304	Bacteria	1900
242	Ga0209257_1050499	3300025304	Bacteria	1177
243	Ga0207656_10289125	3300025321	Bacteria	810
244	Ga0207680_10949295	3300025903	Bacteria	616
245	Ga0207705_10439529	3300025909	Bacteria	1011
246	Ga0207695_10000495	3300025913	Bacteria	83911
247	Ga0207671_10000045	3300025914	Bacteria	201245
248	Ga0207671_10000568	3300025914	Bacteria	49545
249	Ga0207694_10925660	3300025924	Bacteria	737
250	Ga0207644_10098968	3300025931	Bacteria	2187
251	Ga0207704_10960816	3300025938	Bacteria	721
252	Ga0207711_10437931	3300025941	Bacteria	1216
253	Ga0207711_10810849	3300025941	Bacteria	872
254	Ga0207667_11020230	3300025949	Bacteria	814
255	Ga0207712_10355471	3300025961	Bacteria	1219
256	Ga0207668_10145331	3300025972	Bacteria	1829
257	Ga0207668_10167054	3300025972	Bacteria	1721
258	Ga0207658_11238119	3300025986	Bacteria	682
259	Ga0207678_10559568	3300026067	Bacteria	1001
260	Ga0207702_10241882	3300026078	Bacteria	1691
261	Ga0207702_10478169	3300026078	Bacteria	1212
262	Ga0207683_11393888	3300026121	Bacteria	648
263	Ga0207698_10374821	3300026142	Bacteria	1352
264	Ga0209281_1000190	3300027111	Bacteria	140658
265	Ga0209281_1000314	3300027111	Bacteria	86424
266	Ga0209371_1000035	3300027312	Bacteria	368979
267	Ga0209371_1005219	3300027312	Bacteria	5252
268	Ga0209371_1012102	3300027312	Bacteria	2520
269	Ga0209984_1012238	3300027424	Bacteria	1117
270	Ga0209282_1000068	3300027666	Bacteria	85817
271	Ga0209282_1001209	3300027666	Bacteria	13945
272	Ga0209813_10115411	3300027866	Bacteria	929
273	Ga0268266_10013382	3300028379	Bacteria	7068
274	Ga0268266_11188630	3300028379	Bacteria	738
275	Ga0268265_12088718	3300028380	Bacteria	574
276	Ga0307515_10001947	3300028794	Bacteria	45737
277	Ga0307515_10002407	3300028794	Bacteria	40813
278	Ga0307515_10025212	3300028794	Bacteria	10304
279	Ga0307515_10372802	3300028794	Bacteria	1063
280	Ga0268256_1003172	3300030500	Bacteria	7645
281	Ga0268256_1004450	3300030500	Bacteria	5804
282	Ga0268256_1046620	3300030500	Bacteria	937
283	Ga0316181_1259793	3300030744	Bacteria	3232
284	Ga0307513_10118948	3300031456	Bacteria	2615
285	Ga0307513_10462287	3300031456	Bacteria	992
286	Ga0307513_10975862	3300031456	Bacteria	556
287	Ga0307408_100172175	3300031548	Bacteria	1729
288	Ga0307408_100309956	3300031548	Bacteria	1326
289	Ga0307408_100404391	3300031548	Bacteria	1173
290	Ga0307408_100413440	3300031548	Bacteria	1161
291	Ga0307408_100931271	3300031548	Bacteria	797
292	Ga0307408_101122751	3300031548	Bacteria	730
293	Ga0307516_10190246	3300031730	Bacteria	1779
294	Ga0307405_10002301	3300031731	Bacteria	8376
295	Ga0307405_10577080	3300031731	Bacteria	914
296	Ga0307405_11036814	3300031731	Bacteria	702
297	Ga0307413_10843083	3300031824	Bacteria	774
298	Ga0307410_10180013	3300031852	Bacteria	1600
299	Ga0307406_10016639	3300031901	Bacteria	4279
300	Ga0307406_11179929	3300031901	Bacteria	664
301	Ga0307412_10006984	3300031911	Bacteria	6407
302	Ga0307412_10102704	3300031911	Bacteria	2025
303	Ga0307412_10600413	3300031911	Bacteria	932
304	Ga0307412_10801290	3300031911	Bacteria	818
305	Ga0307412_11002547	3300031911	Bacteria	738
306	Ga0315914_1008613	3300031967	Bacteria	13502
307	Ga0307409_100452653	3300031995	Bacteria	1239
308	Ga0307416_100197955	3300032002	Bacteria	1903
309	Ga0307416_101266807	3300032002	Bacteria	843
310	Ga0307416_103781014	3300032002	Bacteria	507
311	Ga0307414_11161982	3300032004	Bacteria	714
312	Ga0307414_11352620	3300032004	Bacteria	661
313	Ga0307411_10714633	3300032005	Bacteria	874
314	Ga0307415_100438721	3300032126	Bacteria	1126
315	Ga0315913_1000094	3300033430	Bacteria	51134
316	Ga0315915_1000007	3300033464	Bacteria	319225
317	Ga0395898_0331974	3300037466	Bacteria	1450
318	Ga0395905_0000790	3300037471	Bacteria	41600
319	Ga0395905_0243894	3300037471	Bacteria	1678
320	Ga0395905_0351773	3300037471	Bacteria	1365
321	Ga0237819_20481	3300038705	Bacteria	689
322	Ga0439436_0179364	3300041404	Bacteria	602
323	Ga0439439_0139883	3300041406	Bacteria	683
324	Ga0439465_0014825	3300041413	Bacteria	2431
325	Ga0451789_1365962	3300041443	Bacteria	894
326	Ga0451793_0716888	3300041452	Bacteria	963
327	Ga0451798_0577066	3300041458	Bacteria	1228
328	Ga0451807_0647986	3300041486	Bacteria	1539
329	Ga0451835_0899831	3300041492	Bacteria	1451
330	Ga0451837_1776210	3300041494	Bacteria	1773
331	Ga0451839_1650530	3300041496	Bacteria	1805
332	Ga0451841_1233672	3300041498	Bacteria	851
333	Ga0451849_1417950	3300041505	Bacteria	1443
334	Ga0451851_1328210	3300041507	Bacteria	1755
335	Ga0451855_0935236	3300041511	Bacteria	924
336	Ga0451853_0089417	3300041512	Bacteria	689
337	Ga0451853_2883727	3300041512	Bacteria	688
338	Ga0439431_0122488	3300041997	Bacteria	726
339	Ga0439449_0017835	3300042007	Bacteria	2664
340	Ga0439462_0144938	3300042015	Bacteria	666
341	Ga0439462_0165970	3300042015	Bacteria	624
342	Ga0450920_071195	3300042122	Bacteria	708
343	Ga0450907_081790	3300042146	Bacteria	561
344	Ga0439446_0211616	3300042156	Bacteria	658
345	Ga0450909_006353	3300042185	Bacteria	1705
346	Ga0439434_0293844	3300042435	Bacteria	561
347	Ga0450918_042427	3300042531	Bacteria	818
348	Ga0466966_0053469	3300044684	Bacteria	2562
349	Ga0466971_0636161	3300044719	Bacteria	534
350	Ga0466970_0000129	3300044765	Bacteria	34329
351	Ga0466957_0083919	3300044842	Bacteria	1988
352	Ga0466958_0516060	3300045836	Bacteria	776
353	Ga0466967_0602672	3300045976	Bacteria	1084
354	Ga0495592_0019844	3300046454	Bacteria	5111
355	Ga0495603_0780304	3300046455	Bacteria	545
356	Ga0495590_0075995	3300046457	Bacteria	1182
357	Ga0495638_0001230	3300046460	Bacteria	24246
358	Ga0495638_0073459	3300046460	Bacteria	2087
359	Ga0495638_0170164	3300046460	Bacteria	1250
360	Ga0495638_0311523	3300046460	Bacteria	844
361	Ga0495638_0531424	3300046460	Bacteria	587
362	Ga0495651_0783423	3300046462	Bacteria	589
363	Ga0495650_0045946	3300046471	Bacteria	1835
364	Ga0495605_0058837	3300046474	Bacteria	1846
365	Ga0495605_0103857	3300046474	Bacteria	1303
366	Ga0495605_0232663	3300046474	Bacteria	793
367	Ga0495585_0059552	3300046492	Bacteria	2104
368	Ga0495585_0195591	3300046492	Bacteria	1032
369	Ga0495585_0266857	3300046492	Bacteria	849
370	Ga0495585_0313644	3300046492	Bacteria	768
371	Ga0495596_0300718	3300046500	Bacteria	624
372	Ga0495607_0087649	3300046501	Bacteria	1694
373	Ga0495607_0333614	3300046501	Bacteria	704
374	Ga0495583_0052748	3300046506	Bacteria	1848
375	Ga0495583_0068228	3300046506	Bacteria	1569
376	Ga0495583_0381845	3300046506	Bacteria	554
377	Ga0495606_0019140	3300046507	Bacteria	5105
378	Ga0495606_0031736	3300046507	Bacteria	3668
379	Ga0495606_0188484	3300046507	Bacteria	1184
380	Ga0495606_0418085	3300046507	Bacteria	694
381	Ga0495610_0005376	3300046512	Bacteria	9134
382	Ga0495610_0121862	3300046512	Bacteria	1142
383	Ga0495616_0045124	3300046513	Bacteria	2233
384	Ga0495616_0267457	3300046513	Bacteria	730
385	Ga0495620_0097545	3300046515	Bacteria	1174
386	Ga0495620_0098516	3300046515	Bacteria	1167
387	Ga0495620_0155095	3300046515	Bacteria	891
388	Ga0495628_0479976	3300046516	Bacteria	900
389	Ga0495631_0097082	3300046518	Bacteria	1268
390	Ga0495631_0211170	3300046518	Bacteria	829
391	Ga0495632_0006764	3300046519	Bacteria	7327
392	Ga0495632_0351858	3300046519	Bacteria	647
393	Ga0495643_0009372	3300046522	Bacteria	6087
394	Ga0495644_0286955	3300046523	Bacteria	643
395	Ga0495648_0309159	3300046524	Bacteria	737
396	Ga0495648_0349181	3300046524	Bacteria	676
397	Ga0495648_0519496	3300046524	Bacteria	507
398	Ga0495654_0180508	3300046530	Bacteria	914
399	Ga0495654_0358620	3300046530	Bacteria	585
400	Ga0495587_0375863	3300046536	Bacteria	791
401	Ga0495609_0075478	3300046538	Bacteria	1478
402	Ga0495609_0309780	3300046538	Bacteria	642
403	Ga0495622_0005933	3300046557	Bacteria	5676
404	Ga0495622_0356302	3300046557	Bacteria	633
405	Ga0495633_0014979	3300046558	Bacteria	4032
406	Ga0495633_0084709	3300046558	Bacteria	1474
407	Ga0495633_0102963	3300046558	Bacteria	1325
408	Ga0495633_0433189	3300046558	Bacteria	594
409	Ga0495668_0037979	3300046616	Bacteria	2692
410	Ga0495668_0094148	3300046616	Bacteria	1640
411	Ga0495634_0021463	3300046642	Bacteria	4564
412	Ga0495611_0031622	3300046648	Bacteria	2330
413	Ga0495611_0390517	3300046648	Bacteria	636
414	Ga0495625_0042561	3300046660	Bacteria	3299
415	Ga0495625_0050483	3300046660	Bacteria	2985
416	Ga0495625_0066953	3300046660	Bacteria	2529
417	Ga0495625_0077857	3300046660	Bacteria	2316
418	Ga0495625_0717822	3300046660	Bacteria	589
419	Ga0495625_0884962	3300046660	Bacteria	513
420	Ga0495588_0021138	3300046674	Bacteria	3203
421	Ga0495588_0220850	3300046674	Bacteria	1000
422	Ga0495588_0319710	3300046674	Bacteria	816
423	Ga0495670_0512502	3300046691	Bacteria	652
424	Ga0495670_0528523	3300046691	Bacteria	641
425	Ga0495671_0086501	3300046692	Bacteria	1536
426	Ga0495671_0158736	3300046692	Bacteria	1100
427	Ga0495660_0032637	3300046810	Bacteria	2923
428	Ga0495660_0152858	3300046810	Bacteria	1138
429	Ga0495636_0113933	3300047318	Bacteria	1192
430	Ga0495636_0250282	3300047318	Bacteria	819
431	Ga0495687_071738	3300047443	Bacteria	1386
432	Ga0495673_0296938	3300047469	Bacteria	580
433	Ga0495681_0071015	3300047470	Bacteria	1577
434	Ga0495686_0001114	3300047472	Bacteria	31829
435	Ga0495686_0205720	3300047472	Bacteria	1127
436	Ga0495615_0062967	3300048090	Bacteria	983
437	Ga0496100_0013991	3300048903	Bacteria	4646
438	Ga0496101_0006718	3300048904	Bacteria	7419
439	Ga0496101_0055225	3300048904	Bacteria	2868
440	Ga0496102_0001638	3300048905	Bacteria	19737
441	Ga0496103_0438971	3300048906	Bacteria	837
442	Ga0496104_0109413	3300048907	Bacteria	2648
443	Ga0496106_0503839	3300048909	Bacteria	972
444	Ga0496106_0824100	3300048909	Bacteria	735
445	Ga0496110_1821442	3300048913	Bacteria	519
446	Ga0496116_0003895	3300048919	Bacteria	14544
447	Ga0496116_0012692	3300048919	Bacteria	6854
448	Ga0496116_0041415	3300048919	Bacteria	3160
449	Ga0496116_0059934	3300048919	Bacteria	2471
450	Ga0496117_0002435	3300048920	Bacteria	23487
451	Ga0496117_0003618	3300048920	Bacteria	17807
452	Ga0496117_0009706	3300048920	Bacteria	8895
453	Ga0496117_0295041	3300048920	Bacteria	861
454	Ga0496118_0002792	3300048921	Bacteria	22868
455	Ga0496118_0016898	3300048921	Bacteria	6666
456	Ga0496118_0022582	3300048921	Bacteria	5494
457	Ga0496118_0271328	3300048921	Bacteria	950
458	Ga0496118_0384681	3300048921	Bacteria	735
459	Ga0496119_0002764	3300048922	Bacteria	18876
460	Ga0496119_0006926	3300048922	Bacteria	10339
461	Ga0496119_0017586	3300048922	Bacteria	5371
462	Ga0496119_0079220	3300048922	Bacteria	1898
463	Ga0496119_0168670	3300048922	Bacteria	1158
464	Ga0496119_0189462	3300048922	Bacteria	1073
465	Ga0496119_0434168	3300048922	Bacteria	621
466	Ga0496119_0574791	3300048922	Bacteria	515
467	Ga0496120_0001857	3300048923	Bacteria	23511
468	Ga0496120_0042072	3300048923	Bacteria	2670
469	Ga0496120_0187369	3300048923	Bacteria	1011
470	Ga0496121_0006830	3300048924	Bacteria	13960
471	Ga0496121_0050736	3300048924	Bacteria	3501
472	Ga0496121_0092209	3300048924	Bacteria	2362
473	Ga0496121_0115035	3300048924	Bacteria	2043
474	Ga0496121_0137549	3300048924	Bacteria	1817
475	Ga0496121_0260379	3300048924	Bacteria	1198
476	Ga0496121_0314384	3300048924	Bacteria	1057
477	Ga0496121_0469386	3300048924	Bacteria	806
478	Ga0496121_0553679	3300048924	Bacteria	719
479	Ga0496122_0000505	3300048925	Bacteria	80571
480	Ga0496122_0003439	3300048925	Bacteria	20818
481	Ga0496122_0010316	3300048925	Bacteria	9662
482	Ga0496122_0015265	3300048925	Bacteria	7349
483	Ga0496122_0039778	3300048925	Bacteria	3745
484	Ga0496123_0000400	3300048926	Bacteria	80571
485	Ga0496123_0002783	3300048926	Bacteria	20818
486	Ga0496123_0006886	3300048926	Bacteria	10877
487	Ga0496123_0033433	3300048926	Bacteria	3700
488	Ga0496123_0129784	3300048926	Bacteria	1399
489	Ga0496123_0330709	3300048926	Bacteria	716
490	Ga0496124_0000610	3300048927	Bacteria	60097
491	Ga0496124_0017255	3300048927	Bacteria	6809
492	Ga0496124_0042301	3300048927	Bacteria	3924
493	Ga0496124_0543274	3300048927	Bacteria	769
494	Ga0496125_0000765	3300048928	Bacteria	52600
495	Ga0496125_0029958	3300048928	Bacteria	4877
496	Ga0496125_0048805	3300048928	Bacteria	3525
497	Ga0496125_0050433	3300048928	Bacteria	3446
498	Ga0496125_0316121	3300048928	Bacteria	949
499	Ga0496125_0712954	3300048928	Bacteria	531
500	Ga0496126_0036607	3300048929	Bacteria	4586
501	Ga0496126_0069300	3300048929	Bacteria	3147
502	Ga0496126_0462825	3300048929	Bacteria	1019
503	Ga0496126_0777120	3300048929	Bacteria	737
504	Ga0495678_015476	3300049459	Bacteria	3507
505	Ga0495678_034527	3300049459	Bacteria	2080
506	Ga0495682_0134631	3300049460	Bacteria	883
507	Ga0501300_029112	3300049523	Bacteria	813
508	Ga0501031_0268152	3300049568	Bacteria	1109
509	Ga0501032_0733058	3300049569	Bacteria	626
510	Ga0501033_0477695	3300049570	Bacteria	864
511	Ga0501034_1244442	3300049571	Bacteria	622
512	Ga0501043_0860195	3300049579	Bacteria	652
513	Ga0501241_042532	3300049758	Bacteria	883
514	Ga0501280_001000	3300049776	Bacteria	5866
515	Ga0501035_0046976	3300049822	Bacteria	3879
516	Ga0501035_1156397	3300049822	Bacteria	602
517	nmdc:mga03683_58945_c1	3300050489	Bacteria	1619
518	nmdc:mga03n38_91558_c1	3300050490	Bacteria	1449
519	nmdc:mga00v17_326332_c1	3300050491	Bacteria	997
520	nmdc:mga00v17_587888_c1	3300050491	Bacteria	718
521	nmdc:mga0yw44_151479_c1	3300050492	Bacteria	1513
522	nmdc:mga0yw44_27050_c1	3300050492	Bacteria	3282
523	nmdc:mga0k408_177551_c1	3300050493	Bacteria	1270
524	nmdc:mga06z11_105348_c1	3300050494	Bacteria	1554
525	nmdc:mga07m45_140404_c1	3300050496	Bacteria	1399
526	nmdc:mga07m45_407924_c1	3300050496	Bacteria	788
527	nmdc:mga07m45_680291_c1	3300050496	Bacteria	592
528	nmdc:mga07m45_7220_c1	3300050496	Bacteria	5666
529	nmdc:mga0sz30_35367_c1	3300050516	Bacteria	2084
530	nmdc:mga0sz30_405535_c1	3300050516	Bacteria	611
531	nmdc:mga0sz30_555189_c1	3300050516	Bacteria	518
532	nmdc:mga0sz30_59031_c1	3300050516	Bacteria	1636
533	Ga0500610_0078108	3300053079	Bacteria	1725
534	Ga0500578_0251829	3300053086	Bacteria	1063
535	Ga0500646_0119194	3300053090	Bacteria	847
536	Ga0500641_0139054	3300053096	Bacteria	1049
537	Ga0500556_0175371	3300053104	Bacteria	847
538	Ga0500557_033996	3300053105	Bacteria	1563
539	Ga0500560_180544	3300053107	Bacteria	690
540	Ga0500594_0077965	3300053118	Bacteria	986
541	Ga0500658_0000846	3300053134	Bacteria	12591
542	Ga0500568_0000980	3300053139	Bacteria	19644
543	Ga0500573_0552064	3300053140	Bacteria	510
544	Ga0500590_058655	3300053148	Bacteria	1938
545	Ga0500616_0000324	3300053153	Bacteria	68394
546	Ga0500616_0004151	3300053153	Bacteria	10459
547	Ga0500616_0090553	3300053153	Bacteria	1516
548	Ga0500616_0163878	3300053153	Bacteria	1016
549	Ga0500616_0231226	3300053153	Bacteria	800
550	Ga0500622_0206994	3300053156	Bacteria	888
551	Ga0500624_003062	3300053157	Bacteria	2206
552	Ga0500627_0110953	3300053158	Bacteria	1235
553	Ga0500627_0129026	3300053158	Bacteria	1142
554	Ga0587080_016745	3300059503	Bacteria	1160
555	Ga0587080_081725	3300059503	Bacteria	664
556	Ga0587083_0006550	3300059505	Bacteria	1741
557	Ga0587075_122498	3300059644	Bacteria	540
558	Ga0466962_0223361	3300061719	Bacteria	923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300027424	Ga0209984_1012238	Ga0209984_10122382	94
2	3300025938	Ga0207704_10960816	Ga0207704_109608162	100
3	3300006353	Ga0075370_10250373	Ga0075370_102503732	101
4	3300031548	Ga0307408_100309956	Ga0307408_1003099562	101
5	3300031548	Ga0307408_100404391	Ga0307408_1004043911	101
6	3300031911	Ga0307412_11002547	Ga0307412_110025472	101
7	3300050496	nmdc:mga07m45_140404_c1	nmdc:mga07m45_140404_c1_561_869	101
8	iso_pu_bacteria	2979764755	2979769577	101
9	iso_pu_bacteria	2693429783	2694628849	104
10	iso_pu_bacteria	2693429784	2694637237	104
11	iso_pu_bacteria	2856349417	2856353854	104
12	iso_pu_bacteria	2869162929	2869168343	104
13	iso_pu_bacteria	2876377896	2876383309	104
14	iso_pu_bacteria	2881155292	2881156635	104
15	iso_pu_bacteria	2881853255	2881854837	104
16	iso_pu_bacteria	2885318864	2885325852	104
17	iso_pu_bacteria	2885342637	2885349255	104
18	iso_pu_bacteria	2885350715	2885354315	104
19	iso_pu_bacteria	2888337043	2888338396	104
20	iso_pu_bacteria	2938014810	2938015082	104
21	iso_pu_bacteria	2961127735	2961132311	104
22	iso_pu_bacteria	2965062239	2965069074	104
23	iso_pu_bacteria	2968091066	2968096248	104
24	iso_pu_bacteria	2968128360	2968129772	104
25	iso_pu_bacteria	3004289098	3004295464	104
26	3300045836	Ga0466958_0516060	Ga0466958_0516060_226_567	105
27	iso_pu_bacteria	2509276033	2509442721	105
28	iso_pu_bacteria	2510065019	2510132666	105
29	iso_pu_bacteria	2510461076	2510894013	105
30	iso_pu_bacteria	2510461076	2510899038	105
31	iso_pu_bacteria	2510917026	2511170310	105
32	iso_pu_bacteria	2510917028	2511185159	105
33	iso_pu_bacteria	2513237084	2513570186	105
34	iso_pu_bacteria	2513237085	2513575556	105
35	iso_pu_bacteria	2513237088	2513597109	105
36	iso_pu_bacteria	2513237093	2513632862	105
37	iso_pu_bacteria	2513237103	2513710410	105
38	iso_pu_bacteria	2513237138	2513870845	105
39	iso_pu_bacteria	2513237144	2513910759	105
40	iso_pu_bacteria	2513237146	2513927265	105
41	iso_pu_bacteria	2513237162	2514019714	105
42	iso_pu_bacteria	2515075009	2515111662	105
43	iso_pu_bacteria	2515154113	2515634845	105
44	iso_pu_bacteria	2515154114	2515641988	105
45	iso_pu_bacteria	2515154116	2515656059	105
46	iso_pu_bacteria	2515154134	2515739270	105
47	iso_pu_bacteria	2516653077	2517040352	105
48	iso_pu_bacteria	2516653085	2517075844	105
49	iso_pu_bacteria	2517093000	2517094424	105
50	iso_pu_bacteria	2519899620	2520379551	105
51	iso_pu_bacteria	2529292951	2530644965	105
52	iso_pu_bacteria	2582581294	2585202540	105
53	iso_pu_bacteria	2582581299	2585227743	105
54	iso_pu_bacteria	2582581304	2585255597	105
55	iso_pu_bacteria	2582581315	2585328898	105
56	iso_pu_bacteria	2582581867	2585402149	105
57	iso_pu_bacteria	2585427526	2585528903	105
58	iso_pu_bacteria	2585427590	2585822551	105
59	iso_pu_bacteria	2585427594	2585847674	105
60	iso_pu_bacteria	2585427608	2585899343	105
61	iso_pu_bacteria	2585427633	2585997439	105
62	iso_pu_bacteria	2585427634	2586002045	105
63	iso_pu_bacteria	2599185170	2599415294	105
64	iso_pu_bacteria	2643221626	2644147166	105
65	iso_pu_bacteria	2643221634	2644195814	105
66	iso_pu_bacteria	2643221637	2644208110	105
67	iso_pu_bacteria	2643221643	2644241023	105
68	iso_pu_bacteria	2643221718	2644651512	105
69	iso_pu_bacteria	2667528174	2671116747	105
70	iso_pu_bacteria	2667528174	2671117039	105
71	iso_pu_bacteria	2718217997	2719665056	105
72	iso_pu_bacteria	2718218199	2720491476	105
73	iso_pu_bacteria	2718218235	2720631061	105
74	iso_pu_bacteria	2718218269	2720774699	105
75	iso_pu_bacteria	2721755556	2723026425	105
76	iso_pu_bacteria	2721755684	2723559968	105
77	iso_pu_bacteria	2721755685	2723566587	105
78	iso_pu_bacteria	2721755819	2724089306	105
79	iso_pu_bacteria	2721755822	2724103852	105
80	iso_pu_bacteria	2721755823	2724109691	105
81	iso_pu_bacteria	2724679232	2725951679	105
82	iso_pu_bacteria	2728369352	2730107361	105
83	iso_pu_bacteria	2738541293	2738799932	105
84	iso_pu_bacteria	2738541317	2738945702	105
85	iso_pu_bacteria	2765235942	2766063596	105
86	iso_pu_bacteria	2775507049	2776910519	105
87	iso_pu_bacteria	2791355256	2793297002	105
88	iso_pu_bacteria	2791355259	2793315572	105
89	iso_pu_bacteria	2791355261	2793328792	105
90	iso_pu_bacteria	2791355262	2793335197	105
91	iso_pu_bacteria	2791355265	2793352109	105
92	iso_pu_bacteria	2791355267	2793366257	105
93	iso_pu_bacteria	2802429605	2805930084	105
94	iso_pu_bacteria	2802429606	2805934978	105
95	iso_pu_bacteria	2818991272	2819243337	105
96	iso_pu_bacteria	2818991448	2819610122	105
97	iso_pu_bacteria	2838016132	2838018554	105
98	iso_pu_bacteria	2838035591	2838038981	105
99	iso_pu_bacteria	2838048938	2838052334	105
100	iso_pu_bacteria	2838061910	2838066532	105
101	iso_pu_bacteria	2838068647	2838071188	105
102	iso_pu_bacteria	2838074704	2838077763	105
103	iso_pu_bacteria	2838661181	2838664427	105
104	iso_pu_bacteria	2838668709	2838669808	105
105	iso_pu_bacteria	2838686498	2838693440	105
106	iso_pu_bacteria	2838701080	2838702180	105
107	iso_pu_bacteria	2838729681	2838735132	105
108	iso_pu_bacteria	2838742623	2838748017	105
109	iso_pu_bacteria	2841851746	2841857584	105
110	iso_pu_bacteria	2842110456	2842111161	105
111	iso_pu_bacteria	2842146304	2842147275	105
112	iso_pu_bacteria	2842156927	2842162896	105
113	iso_pu_bacteria	2842163707	2842165200	105
114	iso_pu_bacteria	2842180545	2842186574	105
115	iso_pu_bacteria	2842192696	2842197204	105
116	iso_pu_bacteria	2842205361	2842206606	105
117	iso_pu_bacteria	2842217011	2842220417	105
118	iso_pu_bacteria	2842229732	2842235778	105
119	iso_pu_bacteria	2842243621	2842249106	105
120	iso_pu_bacteria	2842250916	2842252341	105
121	iso_pu_bacteria	2842257432	2842263061	105
122	iso_pu_bacteria	2842264693	2842268629	105
123	iso_pu_bacteria	2842271015	2842277953	105
124	iso_pu_bacteria	2842278818	2842280063	105
125	iso_pu_bacteria	2842285085	2842287785	105
126	iso_pu_bacteria	2842304105	2842309937	105
127	iso_pu_bacteria	2842311132	2842315156	105
128	iso_pu_bacteria	2842317721	2842322853	105
129	iso_pu_bacteria	2842395702	2842399687	105
130	iso_pu_bacteria	2842402390	2842404686	105
131	iso_pu_bacteria	2842409023	2842411269	105
132	iso_pu_bacteria	2842415677	2842418280	105
133	iso_pu_bacteria	2842422224	2842425156	105
134	iso_pu_bacteria	2842428310	2842432762	105
135	iso_pu_bacteria	2842434925	2842439067	105
136	iso_pu_bacteria	2842441272	2842445696	105
137	iso_pu_bacteria	2842447887	2842451459	105
138	iso_pu_bacteria	2842462802	2842466952	105
139	iso_pu_bacteria	2842469257	2842473681	105
140	iso_pu_bacteria	2842489311	2842494493	105
141	iso_pu_bacteria	2842495871	2842500574	105
142	iso_pu_bacteria	2844163670	2844165567	105
143	iso_pu_bacteria	2844454524	2844454671	105
144	iso_pu_bacteria	2857516855	2857523336	105
145	iso_pu_bacteria	2899803654	2899804367	105
146	iso_pu_bacteria	2913308742	2913310616	105
147	iso_pu_bacteria	2919171160	2919173735	105
148	iso_pu_bacteria	2919408235	2919413892	105
149	iso_pu_bacteria	2920822456	2920822962	105
150	iso_pu_bacteria	2923556063	2923558814	105
151	iso_pu_bacteria	2933016740	2933016749	105
152	iso_pu_bacteria	2933570622	2933576334	105
153	iso_pu_bacteria	2933586486	2933587186	105
154	iso_pu_bacteria	2933599457	2933601987	105
155	iso_pu_bacteria	2935901341	2935905145	105
156	iso_pu_bacteria	2936367885	2936373373	105
157	iso_pu_bacteria	2936375103	2936378642	105
158	iso_pu_bacteria	2989771324	2989775229	105
159	iso_pu_bacteria	2989776772	2989777484	105
160	iso_pu_bacteria	2996887358	2996890591	105
161	iso_pu_bacteria	3002141150	3002146237	105
162	iso_pu_bacteria	3003930520	3003933862	105
163	iso_pu_bacteria	3005409236	3005413519	105
164	iso_pu_bacteria	3005452660	3005457882	105
165	iso_pu_bacteria	8005258706	8005264290	105
166	iso_pu_bacteria	8005282627	8005284103	105
167	iso_pu_bacteria	8005289223	8005294603	105
168	iso_pu_bacteria	8005307578	8005314830	105
169	iso_pu_bacteria	8005321885	8005325118	105
170	iso_pu_bacteria	8005382845	8005384835	105
171	iso_pu_bacteria	8005395548	8005398284	105
172	iso_pu_bacteria	8005430974	8005436291	105
173	iso_pu_bacteria	8005460587	8005462313	105
174	iso_pu_bacteria	8005497431	8005499719	105
175	iso_pu_bacteria	8005556819	8005558317	105
176	iso_pu_bacteria	8005563573	8005569498	105
177	iso_pu_bacteria	8005619151	8005620900	105
178	iso_pu_bacteria	8005626139	8005627400	105
179	iso_pu_bacteria	8005645114	8005647895	105
180	iso_pu_bacteria	8005668836	8005671140	105
181	iso_pu_bacteria	8005682033	8005684255	105
182	iso_pu_bacteria	8005695170	8005696356	105
183	iso_pu_bacteria	8018163183	8018164805	105
184	iso_pu_bacteria	8023680758	8023680774	105
185	iso_pu_bacteria	8024479707	8024485554	105
186	iso_pu_bacteria	8024501048	8024505032	105
187	iso_pu_bacteria	8046767195	8046773109	105
188	iso_pu_bacteria	8054558443	8054563609	105
189	iso_pu_bacteria	8056375014	8056379948	105
190	iso_pu_bacteria	8056382006	8056387738	105
191	iso_pu_bacteria	8057575449	8057579674	105
192	iso_pu_bacteria	8057874678	8057875693	105
193	iso_pu_bacteria	2511231027	2511391401	106
194	iso_pu_bacteria	2765235802	2765468534	106
195	iso_pu_bacteria	2767802442	2770198256	106
196	iso_pu_bacteria	2775506902	2776272831	106
197	iso_pu_bacteria	2775506904	2776283277	106
198	iso_pu_bacteria	2839993093	2839993697	106
199	iso_pu_bacteria	2840764183	2840765592	106
200	iso_pu_bacteria	2842871566	2842875670	106
201	iso_pu_bacteria	2904578770	2904582405	106
202	iso_pu_bacteria	2919119836	2919123889	106
203	iso_pu_bacteria	2928521798	2928524944	106
204	iso_pu_bacteria	2954011201	2954011448	106
205	3300015690	Ga0183363_1108	Ga0183363_11082	107
206	iso_pu_bacteria	2510065057	2510302768	107
207	iso_pu_bacteria	2510461069	2510839694	107
208	iso_pu_bacteria	2510917022	2511133407	107
209	iso_pu_bacteria	2511231052	2511497827	107
210	iso_pu_bacteria	2512047086	2512528834	107
211	iso_pu_bacteria	2512875026	2512969544	107
212	iso_pu_bacteria	2513237086	2513584324	107
213	iso_pu_bacteria	2513237089	2513606232	107
214	iso_pu_bacteria	2513237091	2513616465	107
215	iso_pu_bacteria	2513237140	2513885325	107
216	iso_pu_bacteria	2513237143	2513901966	107
217	iso_pu_bacteria	2513237156	2513985059	107
218	iso_pu_bacteria	2513237159	2514002358	107
219	iso_pu_bacteria	2513237160	2514007947	107
220	iso_pu_bacteria	2515154107	2515612064	107
221	iso_pu_bacteria	2516653046	2516896529	107
222	iso_pu_bacteria	2517487022	2517565578	107
223	iso_pu_bacteria	2524023207	2524452048	107
224	iso_pu_bacteria	2524023209	2524459234	107
225	iso_pu_bacteria	2534681796	2535517246	107
226	iso_pu_bacteria	2537561587	2537873081	107
227	iso_pu_bacteria	2551306084	2551679733	107
228	iso_pu_bacteria	2551306085	2551684178	107
229	iso_pu_bacteria	2551306086	2551696360	107
230	iso_pu_bacteria	2551306087	2551699076	107
231	iso_pu_bacteria	2551306089	2551711715	107
232	iso_pu_bacteria	2551306090	2551716039	107
233	iso_pu_bacteria	2551306090	2551718409	107
234	iso_pu_bacteria	2551306091	2551726899	107
235	iso_pu_bacteria	2551306092	2551732575	107
236	iso_pu_bacteria	2551306093	2551741241	107
237	iso_pu_bacteria	2558860983	2561467417	107
238	iso_pu_bacteria	2582581306	2585266763	107
239	iso_pu_bacteria	2582581307	2585276179	107
240	iso_pu_bacteria	2582581307	2585276659	107
241	iso_pu_bacteria	2582581308	2585277725	107
242	iso_pu_bacteria	2582581865	2585387804	107
243	iso_pu_bacteria	2582581866	2585398047	107
244	iso_pu_bacteria	2585427527	2585533408	107
245	iso_pu_bacteria	2585427530	2585557242	107
246	iso_pu_bacteria	2585427531	2585562703	107
247	iso_pu_bacteria	2585427609	2585908740	107
248	iso_pu_bacteria	2585428125	2587984157	107
249	iso_pu_bacteria	2599185156	2599332904	107
250	iso_pu_bacteria	2599185210	2599604937	107
251	iso_pu_bacteria	2599185352	2600194951	107
252	iso_pu_bacteria	2600254933	2600376360	107
253	iso_pu_bacteria	2615840626	2616310596	107
254	iso_pu_bacteria	2643221557	2643804608	107
255	iso_pu_bacteria	2643221582	2643916739	107
256	iso_pu_bacteria	2643221599	2644006611	107
257	iso_pu_bacteria	2643221607	2644048162	107
258	iso_pu_bacteria	2643221610	2644065433	107
259	iso_pu_bacteria	2643221618	2644105869	107
260	iso_pu_bacteria	2643221636	2644201888	107
261	iso_pu_bacteria	2643221653	2644297575	107
262	iso_pu_bacteria	2643221655	2644310481	107
263	iso_pu_bacteria	2643221659	2644334735	107
264	iso_pu_bacteria	2643221668	2644375577	107
265	iso_pu_bacteria	2643221675	2644417035	107
266	iso_pu_bacteria	2643221680	2644448213	107
267	iso_pu_bacteria	2643221686	2644480955	107
268	iso_pu_bacteria	2643221688	2644491905	107
269	iso_pu_bacteria	2643221698	2644545072	107
270	iso_pu_bacteria	2643221712	2644612583	107
271	iso_pu_bacteria	2643221719	2644655828	107
272	iso_pu_bacteria	2643221723	2644671609	107
273	iso_pu_bacteria	2643221726	2644686634	107
274	iso_pu_bacteria	2757320392	2757572094	107
275	iso_pu_bacteria	2802428858	2802715974	107
276	iso_pu_bacteria	2802428859	2802723002	107
277	iso_pu_bacteria	2802428860	2802728865	107
278	iso_pu_bacteria	2802428861	2802735232	107
279	iso_pu_bacteria	2802428862	2802742164	107
280	iso_pu_bacteria	2802428863	2802748611	107
281	iso_pu_bacteria	2818991439	2819561183	107
282	iso_pu_bacteria	2818991453	2819643099	107
283	iso_pu_bacteria	2838675328	2838678446	107
284	iso_pu_bacteria	2838714209	2838716646	107
285	iso_pu_bacteria	2838719591	2838722742	107
286	iso_pu_bacteria	2838724970	2838727397	107
287	iso_pu_bacteria	2841846520	2841849015	107
288	iso_pu_bacteria	2841859092	2841861964	107
289	iso_pu_bacteria	2842124991	2842128236	107
290	iso_pu_bacteria	2842130223	2842133339	107
291	iso_pu_bacteria	2842152218	2842155332	107
292	iso_pu_bacteria	2842170452	2842173832	107
293	iso_pu_bacteria	2842175837	2842178953	107
294	iso_pu_bacteria	2842187318	2842189754	107
295	iso_pu_bacteria	2842211629	2842214068	107
296	iso_pu_bacteria	2842224351	2842226788	107
297	iso_pu_bacteria	2842298080	2842301022	107
298	iso_pu_bacteria	2842357229	2842359963	107
299	iso_pu_bacteria	2842509118	2842513795	107
300	iso_pu_bacteria	2842515876	2842517770	107
301	iso_pu_bacteria	2842521101	2842524334	107
302	iso_pu_bacteria	2852387548	2852394238	107
303	iso_pu_bacteria	2855825444	2855828643	107
304	iso_pu_bacteria	2855839649	2855843765	107
305	iso_pu_bacteria	2858800743	2858806990	107
306	iso_pu_bacteria	2896384573	2896391877	107
307	iso_pu_bacteria	2899792073	2899794747	107
308	iso_pu_bacteria	2915980308	2915983639	107
309	iso_pu_bacteria	2915986958	2915992491	107
310	iso_pu_bacteria	2915993759	2915996875	107
311	iso_pu_bacteria	2916000859	2916006563	107
312	iso_pu_bacteria	2916007675	2916008597	107
313	iso_pu_bacteria	2916014648	2916016349	107
314	iso_pu_bacteria	2916021584	2916026312	107
315	iso_pu_bacteria	2916028427	2916034869	107
316	iso_pu_bacteria	2916035215	2916036502	107
317	iso_pu_bacteria	2916041962	2916047031	107
318	iso_pu_bacteria	2916048683	2916054556	107
319	iso_pu_bacteria	2916055098	2916056186	107
320	iso_pu_bacteria	2916061851	2916065338	107
321	iso_pu_bacteria	2916068649	2916075508	107
322	iso_pu_bacteria	2916076590	2916078941	107
323	iso_pu_bacteria	2919114240	2919116863	107
324	iso_pu_bacteria	2921201388	2921206617	107
325	iso_pu_bacteria	2921208531	2921210094	107
326	iso_pu_bacteria	2921237296	2921242723	107
327	iso_pu_bacteria	2921244191	2921248592	107
328	iso_pu_bacteria	2921250672	2921256878	107
329	iso_pu_bacteria	2921257292	2921258992	107
330	iso_pu_bacteria	2921263974	2921264786	107
331	iso_pu_bacteria	2921282425	2921288333	107
332	iso_pu_bacteria	2921289301	2921290444	107
333	iso_pu_bacteria	2921296804	2921304034	107
334	iso_pu_bacteria	2924144063	2924148488	107
335	iso_pu_bacteria	2924150972	2924156716	107
336	iso_pu_bacteria	2924158325	2924165461	107
337	iso_pu_bacteria	2924165586	2924168370	107
338	iso_pu_bacteria	2924172951	2924173278	107
339	iso_pu_bacteria	2924179722	2924179924	107
340	iso_pu_bacteria	2924186466	2924192442	107
341	iso_pu_bacteria	2924193448	2924195831	107
342	iso_pu_bacteria	2924200457	2924203172	107
343	iso_pu_bacteria	2924207177	2924208980	107
344	iso_pu_bacteria	2924214083	2924219911	107
345	iso_pu_bacteria	2924221636	2924228867	107
346	iso_pu_bacteria	2924228884	2924231153	107
347	iso_pu_bacteria	2926754445	2926758376	107
348	iso_pu_bacteria	2933006813	2933009289	107
349	iso_pu_bacteria	2933011516	2933013399	107
350	iso_pu_bacteria	2936996657	2937001504	107
351	iso_pu_bacteria	2937002841	2937009594	107
352	iso_pu_bacteria	2937009748	2937014352	107
353	iso_pu_bacteria	2937016420	2937017728	107
354	iso_pu_bacteria	2937023124	2937024011	107
355	iso_pu_bacteria	2937029754	2937034991	107
356	iso_pu_bacteria	2937036028	2937039222	107
357	iso_pu_bacteria	2937042894	2937048711	107
358	iso_pu_bacteria	2937049772	2937054807	107
359	iso_pu_bacteria	2937056579	2937058301	107
360	iso_pu_bacteria	2937063883	2937069805	107
361	iso_pu_bacteria	2937071275	2937073460	107
362	iso_pu_bacteria	2937078374	2937084365	107
363	iso_pu_bacteria	2937084907	2937086010	107
364	iso_pu_bacteria	2937091812	2937093121	107
365	iso_pu_bacteria	2937098957	2937102599	107
366	iso_pu_bacteria	2937106411	2937113308	107
367	iso_pu_bacteria	2937113482	2937118784	107
368	iso_pu_bacteria	2937119839	2937125871	107
369	iso_pu_bacteria	2937126314	2937131002	107
370	iso_pu_bacteria	2957375807	2957379093	107
371	iso_pu_bacteria	2957382221	2957383175	107
372	iso_pu_bacteria	2957388812	2957389690	107
373	iso_pu_bacteria	2957395598	2957401257	107
374	iso_pu_bacteria	2957402308	2957407449	107
375	iso_pu_bacteria	2957408893	2957410663	107
376	iso_pu_bacteria	2957415311	2957421005	107
377	iso_pu_bacteria	2957422303	2957427561	107
378	iso_pu_bacteria	2957430029	2957434716	107
379	iso_pu_bacteria	2957437181	2957443000	107
380	iso_pu_bacteria	2957443900	2957445264	107
381	iso_pu_bacteria	2957450854	2957451601	107
382	iso_pu_bacteria	2957457609	2957463998	107
383	iso_pu_bacteria	2957464669	2957464785	107
384	iso_pu_bacteria	2957471148	2957472249	107
385	iso_pu_bacteria	2957478035	2957478429	107
386	iso_pu_bacteria	2957484790	2957489964	107
387	iso_pu_bacteria	2957491536	2957491649	107
388	iso_pu_bacteria	2957498199	2957504609	107
389	iso_pu_bacteria	2957505466	2957507237	107
390	iso_pu_bacteria	2960584000	2960584244	107
391	iso_pu_bacteria	2960591022	2960595269	107
392	iso_pu_bacteria	2960597568	2960600186	107
393	iso_pu_bacteria	2960603979	2960607004	107
394	iso_pu_bacteria	2960610863	2960613477	107
395	iso_pu_bacteria	2960617483	2960621176	107
396	iso_pu_bacteria	2960624210	2960626905	107
397	iso_pu_bacteria	2960631154	2960634359	107
398	iso_pu_bacteria	2960637947	2960642360	107
399	iso_pu_bacteria	2960645483	2960645599	107
400	iso_pu_bacteria	2960652885	2960658657	107
401	iso_pu_bacteria	2960660292	2960661945	107
402	iso_pu_bacteria	2960667422	2960668204	107
403	iso_pu_bacteria	2960674078	2960678146	107
404	iso_pu_bacteria	2960680706	2960683413	107
405	iso_pu_bacteria	2960687367	2960692940	107
406	iso_pu_bacteria	2960693952	2960695264	107
407	iso_pu_bacteria	2964607997	2964610720	107
408	iso_pu_bacteria	2964615318	2964621697	107
409	iso_pu_bacteria	2964621998	2964623930	107
410	iso_pu_bacteria	2964628898	2964633681	107
411	iso_pu_bacteria	2964636051	2964639531	107
412	iso_pu_bacteria	2964643177	2964647918	107
413	iso_pu_bacteria	2964649959	2964653596	107
414	iso_pu_bacteria	2964656573	2964657963	107
415	iso_pu_bacteria	2964663802	2964665153	107
416	iso_pu_bacteria	2964670856	2964672795	107
417	iso_pu_bacteria	2964678106	2964684068	107
418	iso_pu_bacteria	2964685014	2964689123	107
419	iso_pu_bacteria	2964691889	2964697224	107
420	iso_pu_bacteria	2964698721	2964705368	107
421	iso_pu_bacteria	2964705432	2964711349	107
422	iso_pu_bacteria	2964712639	2964718379	107
423	iso_pu_bacteria	2964719344	2964723984	107
424	iso_pu_bacteria	2967664464	2967664758	107
425	iso_pu_bacteria	2967671571	2967676131	107
426	iso_pu_bacteria	2967678726	2967680296	107
427	iso_pu_bacteria	2967686174	2967687986	107
428	iso_pu_bacteria	2967693043	2967697874	107
429	iso_pu_bacteria	2967699805	2967701447	107
430	iso_pu_bacteria	2967706974	2967712963	107
431	iso_pu_bacteria	2967714385	2967720901	107
432	iso_pu_bacteria	2967721400	2967724935	107
433	iso_pu_bacteria	2967728569	2967732670	107
434	iso_pu_bacteria	2967735183	2967741835	107
435	iso_pu_bacteria	2967742019	2967743308	107
436	iso_pu_bacteria	2967748971	2967750901	107
437	iso_pu_bacteria	2967755722	2967761730	107
438	iso_pu_bacteria	2967762386	2967763037	107
439	iso_pu_bacteria	2967769361	2967772234	107
440	iso_pu_bacteria	2967775926	2967781704	107
441	iso_pu_bacteria	2970019648	2970023765	107
442	iso_pu_bacteria	2970026789	2970028907	107
443	iso_pu_bacteria	2970033650	2970034568	107
444	iso_pu_bacteria	2970040964	2970042894	107
445	iso_pu_bacteria	2970047711	2970052042	107
446	iso_pu_bacteria	2970054988	2970060783	107
447	iso_pu_bacteria	2970061556	2970062906	107
448	iso_pu_bacteria	2970068827	2970069174	107
449	iso_pu_bacteria	2970076120	2970077214	107
450	iso_pu_bacteria	2970082768	2970085756	107
451	iso_pu_bacteria	2970088815	2970094698	107
452	iso_pu_bacteria	2970095765	2970100966	107
453	iso_pu_bacteria	2970102677	2970105731	107
454	iso_pu_bacteria	2970109326	2970110566	107
455	iso_pu_bacteria	2970116247	2970122407	107
456	iso_pu_bacteria	2970122695	2970128629	107
457	iso_pu_bacteria	2970129317	2970134879	107
458	iso_pu_bacteria	2970136068	2970140732	107
459	iso_pu_bacteria	2970143518	2970147834	107
460	iso_pu_bacteria	2970149975	2970153136	107
461	iso_pu_bacteria	2970156795	2970158828	107
462	iso_pu_bacteria	2970164137	2970164696	107
463	iso_pu_bacteria	2970170962	2970174362	107
464	iso_pu_bacteria	2970177841	2970182172	107
465	iso_pu_bacteria	2970184632	2970190989	107
466	iso_pu_bacteria	2970191845	2970196733	107
467	iso_pu_bacteria	2977516862	2977520409	107
468	iso_pu_bacteria	2977523885	2977529720	107
469	iso_pu_bacteria	2977530762	2977533911	107
470	iso_pu_bacteria	2977537788	2977539118	107
471	iso_pu_bacteria	2977544691	2977547999	107
472	iso_pu_bacteria	2977551784	2977555317	107
473	iso_pu_bacteria	2977558990	2977559634	107
474	iso_pu_bacteria	2977565890	2977566903	107
475	iso_pu_bacteria	2977572785	2977574231	107
476	iso_pu_bacteria	2977579622	2977580712	107
477	iso_pu_bacteria	2979100975	2979101921	107
478	iso_pu_bacteria	2984509177	2984510141	107
479	iso_pu_bacteria	2984518228	2984519156	107
480	iso_pu_bacteria	2984537506	2984538482	107
481	iso_pu_bacteria	2984601300	2984605204	107
482	iso_pu_bacteria	2989349275	2989350195	107
483	iso_pu_bacteria	639633055	639647873	107
484	iso_pu_bacteria	648276728	648738988	107
485	iso_pu_bacteria	8003570095	8003573200	107
486	iso_pu_bacteria	8003992118	8003996325	107
487	iso_pu_bacteria	8003999396	8004004055	107
488	iso_pu_bacteria	8005246636	8005250052	107
489	iso_pu_bacteria	8005542996	8005546066	107
490	3300003775	Ga0055524_1000609	Ga0055524_100060925	108
491	3300003794	Ga0055531_10077444	Ga0055531_100774442	108
492	3300005327	Ga0070658_10348794	Ga0070658_103487942	108
493	3300005347	Ga0070668_100601849	Ga0070668_1006018492	108
494	3300006048	Ga0075363_100562963	Ga0075363_1005629632	108
495	3300006177	Ga0075362_10154742	Ga0075362_101547422	108
496	3300009551	Ga0105238_10188595	Ga0105238_101885952	108
497	3300010375	Ga0105239_10737860	Ga0105239_107378602	108
498	3300013249	Ga0171463_1001	Ga0171463_10011118	108
499	3300013297	Ga0157378_12999531	Ga0157378_129995312	108
500	3300025256	Ga0209759_1050701	Ga0209759_10507011	108
501	3300025292	Ga0209676_1044674	Ga0209676_10446742	108
502	3300025299	Ga0209256_1000948	Ga0209256_100094810	108
503	3300025304	Ga0209257_1006883	Ga0209257_10068832	108
504	3300025924	Ga0207694_10925660	Ga0207694_109256601	108
505	3300032126	Ga0307415_100438721	Ga0307415_1004387212	108
506	3300037466	Ga0395898_0331974	Ga0395898_0331974_1012_1341	108
507	3300037471	Ga0395905_0351773	Ga0395905_0351773_960_1289	108
508	3300046460	Ga0495638_0073459	Ga0495638_0073459_133_468	108
509	3300048922	Ga0496119_0574791	Ga0496119_0574791_111_440	108
510	3300048923	Ga0496120_0042072	Ga0496120_0042072_90_419	108
511	3300048929	Ga0496126_0462825	Ga0496126_0462825_286_615	108
512	3300050491	nmdc:mga00v17_587888_c1	nmdc:mga00v17_587888_c1_344_673	108
513	3300053153	Ga0500616_0231226	Ga0500616_0231226_365_694	108
514	iso_pu_bacteria	2509276021	2509387321	108
515	iso_pu_bacteria	2582581316	2585332858	108
516	iso_pu_bacteria	2585427528	2585540205	108
517	iso_pu_bacteria	2585427593	2585838403	108
518	iso_pu_bacteria	2615840624	2616292955	108
519	iso_pu_bacteria	2615840698	2616552208	108
520	iso_pu_bacteria	2617270742	2617386119	108
521	iso_pu_bacteria	2718217882	2719180624	108
522	iso_pu_bacteria	2718217927	2719385230	108
523	iso_pu_bacteria	2718218009	2719731373	108
524	iso_pu_bacteria	2718218232	2720612770	108
525	iso_pu_bacteria	2718218233	2720619623	108
526	iso_pu_bacteria	2718218363	2721146718	108
527	iso_pu_bacteria	2718218365	2721158241	108
528	iso_pu_bacteria	2718218366	2721163597	108
529	iso_pu_bacteria	2718218423	2721398949	108
530	iso_pu_bacteria	2721755514	2722839767	108
531	iso_pu_bacteria	2721755809	2724037762	108
532	iso_pu_bacteria	2721755810	2724044129	108
533	iso_pu_bacteria	2728369365	2730163861	108
534	iso_pu_bacteria	2728369397	2730297873	108
535	iso_pu_bacteria	2738541333	2739037844	108
536	iso_pu_bacteria	2775507266	2778178920	108
537	iso_pu_bacteria	2791355260	2793321394	108
538	iso_pu_bacteria	2791355263	2793342668	108
539	iso_pu_bacteria	2791355264	2793350373	108
540	iso_pu_bacteria	2791355266	2793360535	108
541	iso_pu_bacteria	2802429633	2806048509	108
542	iso_pu_bacteria	2802429634	2806053648	108
543	iso_pu_bacteria	2802429635	2806060848	108
544	iso_pu_bacteria	2802429636	2806067723	108
545	iso_pu_bacteria	2802429637	2806072925	108
546	iso_pu_bacteria	2838022645	2838022733	108
547	iso_pu_bacteria	2838029111	2838030638	108
548	iso_pu_bacteria	2838042994	2838047720	108
549	iso_pu_bacteria	2838680041	2838682802	108
550	iso_pu_bacteria	2838694306	2838697435	108
551	iso_pu_bacteria	2838707686	2838709387	108
552	iso_pu_bacteria	2841864319	2841865102	108
553	iso_pu_bacteria	2842077413	2842077498	108
554	iso_pu_bacteria	2842118031	2842119993	108
555	iso_pu_bacteria	2842198810	2842201440	108
556	iso_pu_bacteria	2842237096	2842238799	108
557	iso_pu_bacteria	2842291075	2842291160	108
558	iso_pu_bacteria	2842341865	2842347093	108
559	iso_pu_bacteria	2842363717	2842366928	108
560	iso_pu_bacteria	2842370503	2842373431	108
561	iso_pu_bacteria	2842377471	2842377556	108
562	iso_pu_bacteria	2842384541	2842386503	108
563	iso_pu_bacteria	2842475841	2842477081	108
564	iso_pu_bacteria	2842482326	2842485686	108
565	iso_pu_bacteria	2842502639	2842503878	108
566	iso_pu_bacteria	2935894831	2935900431	108
567	iso_pu_bacteria	2936381700	2936384733	108
568	iso_pu_bacteria	2941499720	2941506464	108
569	iso_pu_bacteria	2996893221	2996893938	108
570	iso_pu_bacteria	3005416602	3005417229	108
571	iso_pu_bacteria	8005275841	8005280006	108
572	iso_pu_bacteria	8005301065	8005307211	108
573	iso_pu_bacteria	8005314921	8005320522	108
574	iso_pu_bacteria	8005484373	8005487491	108
575	iso_pu_bacteria	8005570704	8005575230	108
576	iso_pu_bacteria	8005688590	8005695121	108
577	iso_pu_bacteria	8018127388	8018128313	108
578	iso_pu_bacteria	8018176218	8018177792	108
579	3300001979	JGI24740J21852_10030734	JGI24740J21852_100307342	109
580	3300002704	JGI25155J39150_1000046	JGI25155J39150_100004656	109
581	3300002705	JGI25156J39149_1000070	JGI25156J39149_100007022	109
582	3300002737	JGI25162J39368_1001472	JGI25162J39368_10014727	109
583	3300002737	JGI25162J39368_1002141	JGI25162J39368_10021418	109
584	3300002738	JGI25154J39366_1000092	JGI25154J39366_100009256	109
585	3300002739	JGI25158J39367_1005879	JGI25158J39367_10058792	109
586	3300002741	JGI25157J39369_1000087	JGI25157J39369_100008757	109
587	3300002773	JGI25152J39213_1000256	JGI25152J39213_10002566	109
588	3300002773	JGI25152J39213_1001609	JGI25152J39213_100160911	109
589	3300002773	JGI25152J39213_1010989	JGI25152J39213_10109892	109
590	3300002773	JGI25152J39213_1014694	JGI25152J39213_10146942	109
591	3300002774	JGI25150J39212_1000501	JGI25150J39212_10005016	109
592	3300002774	JGI25150J39212_1009161	JGI25150J39212_10091612	109
593	3300002987	JGI25159J45721_1000171	JGI25159J45721_100017111	109
594	3300002987	JGI25159J45721_1001786	JGI25159J45721_10017868	109
595	3300003187	JGI25151J46595_10000007	JGI25151J46595_1000000752	109
596	3300003187	JGI25151J46595_10000326	JGI25151J46595_100003267	109
597	3300003187	JGI25151J46595_10001095	JGI25151J46595_1000109517	109
598	3300003187	JGI25151J46595_10028501	JGI25151J46595_100285012	109
599	3300003187	JGI25151J46595_10071192	JGI25151J46595_100711922	109
600	3300003187	JGI25151J46595_10138869	JGI25151J46595_101388691	109
601	3300003187	JGI25151J46595_10142763	JGI25151J46595_101427631	109
602	3300003214	JGI25165J46597_1001164	JGI25165J46597_10011649	109
603	3300003214	JGI25165J46597_1001468	JGI25165J46597_10014683	109
604	3300003214	JGI25165J46597_1008606	JGI25165J46597_10086062	109
605	3300003215	JGI25153J46596_10000313	JGI25153J46596_1000031313	109
606	3300003215	JGI25153J46596_10004044	JGI25153J46596_100040442	109
607	3300003320	rootH2_10004653	rootH2_100046532	109
608	3300003322	rootL2_10007576	rootL2_100075766	109
609	3300003354	JGI25160J50197_1000032	JGI25160J50197_100003270	109
610	3300003354	JGI25160J50197_1000355	JGI25160J50197_100035511	109
611	3300003354	JGI25160J50197_1000444	JGI25160J50197_10004447	109
612	3300003354	JGI25160J50197_1014251	JGI25160J50197_10142512	109
613	3300003374	JGI25161J50226_1000017	JGI25161J50226_100001770	109
614	3300003374	JGI25161J50226_1000398	JGI25161J50226_10003985	109
615	3300003752	Ga0055539_1004625	Ga0055539_10046252	109
616	3300003771	Ga0055526_1000613	Ga0055526_100061322	109
617	3300003771	Ga0055526_1001408	Ga0055526_10014082	109
618	3300003771	Ga0055526_1014425	Ga0055526_10144252	109
619	3300003771	Ga0055526_1018247	Ga0055526_10182471	109
620	3300003771	Ga0055526_1018453	Ga0055526_10184532	109
621	3300003771	Ga0055526_1037737	Ga0055526_10377371	109
622	3300003775	Ga0055524_1004562	Ga0055524_10045628	109
623	3300003775	Ga0055524_1005279	Ga0055524_10052793	109
624	3300003775	Ga0055524_1006471	Ga0055524_10064712	109
625	3300003775	Ga0055524_1030456	Ga0055524_10304562	109
626	3300003775	Ga0055524_1033762	Ga0055524_10337622	109
627	3300003775	Ga0055524_1052009	Ga0055524_10520092	109
628	3300003781	Ga0055536_1016298	Ga0055536_10162982	109
629	3300003790	Ga0055528_1000067	Ga0055528_100006717	109
630	3300003790	Ga0055528_1000515	Ga0055528_100051520	109
631	3300003790	Ga0055528_1002522	Ga0055528_100252210	109
632	3300003790	Ga0055528_1007333	Ga0055528_10073332	109
633	3300003790	Ga0055528_1008809	Ga0055528_10088093	109
634	3300003790	Ga0055528_1020714	Ga0055528_10207142	109
635	3300003790	Ga0055528_1042170	Ga0055528_10421702	109
636	3300003792	Ga0055540_1000313	Ga0055540_100031330	109
637	3300003792	Ga0055540_1006328	Ga0055540_10063282	109
638	3300003794	Ga0055531_10019248	Ga0055531_100192482	109
639	3300003794	Ga0055531_10058386	Ga0055531_100583862	109
640	3300003794	Ga0055531_10073172	Ga0055531_100731721	109
641	3300003794	Ga0055531_10086020	Ga0055531_100860202	109
642	3300003856	Ga0058692_1016544	Ga0058692_10165442	109
643	3300003856	Ga0058692_1043951	Ga0058692_10439512	109
644	3300003856	Ga0058692_1074842	Ga0058692_10748422	109
645	3300004625	Ga0055543_1000039	Ga0055543_100003953	109
646	3300004625	Ga0055543_1000148	Ga0055543_100014829	109
647	3300004625	Ga0055543_1000362	Ga0055543_100036212	109
648	3300005262	Ga0065165_1000179	Ga0065165_100017970	109
649	3300005262	Ga0065165_1001187	Ga0065165_100118721	109
650	3300005262	Ga0065165_1009714	Ga0065165_10097142	109
651	3300005262	Ga0065165_1145841	Ga0065165_11458411	109
652	3300005327	Ga0070658_10580195	Ga0070658_105801951	109
653	3300005335	Ga0070666_10374203	Ga0070666_103742032	109
654	3300005347	Ga0070668_100041024	Ga0070668_1000410242	109
655	3300005347	Ga0070668_100928853	Ga0070668_1009288531	109
656	3300005355	Ga0070671_100030311	Ga0070671_1000303113	109
657	3300005456	Ga0070678_101880424	Ga0070678_1018804242	109
658	3300005548	Ga0070665_100069298	Ga0070665_1000692983	109
659	3300005548	Ga0070665_101122167	Ga0070665_1011221671	109
660	3300005563	Ga0068855_100995341	Ga0068855_1009953412	109
661	3300005614	Ga0068856_100058142	Ga0068856_1000581422	109
662	3300005614	Ga0068856_100451827	Ga0068856_1004518272	109
663	3300005616	Ga0068852_100448518	Ga0068852_1004485182	109
664	3300005719	Ga0068861_100648235	Ga0068861_1006482352	109
665	3300005834	Ga0068851_10149718	Ga0068851_101497183	109
666	3300006038	Ga0075365_10001066	Ga0075365_1000106612	109
667	3300006038	Ga0075365_10001685	Ga0075365_100016852	109
668	3300006038	Ga0075365_10034040	Ga0075365_100340402	109
669	3300006038	Ga0075365_10258476	Ga0075365_102584762	109
670	3300006038	Ga0075365_10729961	Ga0075365_107299612	109
671	3300006048	Ga0075363_100026827	Ga0075363_1000268272	109
672	3300006048	Ga0075363_100196537	Ga0075363_1001965372	109
673	3300006051	Ga0075364_10025538	Ga0075364_100255382	109
674	3300006051	Ga0075364_10286879	Ga0075364_102868793	109
675	3300006177	Ga0075362_10003089	Ga0075362_100030894	109
676	3300006178	Ga0075367_10001422	Ga0075367_100014222	109
677	3300006178	Ga0075367_10041457	Ga0075367_100414572	109
678	3300006178	Ga0075367_10245288	Ga0075367_102452882	109
679	3300006186	Ga0075369_10029934	Ga0075369_100299342	109
680	3300006186	Ga0075369_10047699	Ga0075369_100476991	109
681	3300006186	Ga0075369_10117527	Ga0075369_101175272	109
682	3300006186	Ga0075369_10159368	Ga0075369_101593682	109
683	3300006186	Ga0075369_10278620	Ga0075369_102786201	109
684	3300006186	Ga0075369_10497015	Ga0075369_104970151	109
685	3300006195	Ga0075366_10804396	Ga0075366_108043962	109
686	3300006353	Ga0075370_10044436	Ga0075370_100444362	109
687	3300006353	Ga0075370_10151421	Ga0075370_101514212	109
688	3300006353	Ga0075370_10300406	Ga0075370_103004062	109
689	3300006353	Ga0075370_10349835	Ga0075370_103498352	109
690	3300006353	Ga0075370_10972759	Ga0075370_109727591	109
691	3300006881	Ga0068865_101115934	Ga0068865_1011159342	109
692	3300006946	Ga0079104_1007475	Ga0079104_10074752	109
693	3300006948	Ga0099826_10000297	Ga0099826_100002979	109
694	3300006948	Ga0099826_10501872	Ga0099826_105018722	109
695	3300009011	Ga0105251_10002612	Ga0105251_1000261211	109
696	3300009093	Ga0105240_10000376	Ga0105240_1000037674	109
697	3300009093	Ga0105240_12205097	Ga0105240_122050972	109
698	3300009148	Ga0105243_11234781	Ga0105243_112347812	109
699	3300009177	Ga0105248_10077619	Ga0105248_100776192	109
700	3300009177	Ga0105248_10432804	Ga0105248_104328043	109
701	3300009545	Ga0105237_10000038	Ga0105237_10000038133	109
702	3300009545	Ga0105237_10006761	Ga0105237_1000676112	109
703	3300009551	Ga0105238_11659514	Ga0105238_116595141	109
704	3300009553	Ga0105249_10866160	Ga0105249_108661602	109
705	3300009765	Ga0123341_1000001	Ga0123341_1000001294	109
706	3300009766	Ga0123342_1023820	Ga0123342_10238202	109
707	3300010375	Ga0105239_10005625	Ga0105239_100056254	109
708	3300010375	Ga0105239_10182049	Ga0105239_101820493	109
709	3300010375	Ga0105239_10502279	Ga0105239_105022792	109
710	3300012513	Ga0157326_1013347	Ga0157326_10133472	109
711	3300013100	Ga0157373_10063952	Ga0157373_100639523	109
712	3300013100	Ga0157373_10588352	Ga0157373_105883521	109
713	3300013102	Ga0157371_10972523	Ga0157371_109725231	109
714	3300013104	Ga0157370_10045900	Ga0157370_100459002	109
715	3300013104	Ga0157370_10610911	Ga0157370_106109112	109
716	3300013105	Ga0157369_10221045	Ga0157369_102210453	109
717	3300013105	Ga0157369_10604413	Ga0157369_106044131	109
718	3300014497	Ga0182008_10027407	Ga0182008_100274073	109
719	3300015262	Ga0182007_10002126	Ga0182007_100021264	109
720	3300015265	Ga0182005_1090210	Ga0182005_10902101	109
721	3300022739	Ga0228711_1018920	Ga0228711_10189202	109
722	3300022740	Ga0228710_1008176	Ga0228710_10081763	109
723	3300025206	Ga0209435_100059	Ga0209435_10005922	109
724	3300025207	Ga0209760_102686	Ga0209760_1026862	109
725	3300025208	Ga0209436_100102	Ga0209436_1001022	109
726	3300025208	Ga0209436_125777	Ga0209436_1257772	109
727	3300025231	Ga0207427_106451	Ga0207427_1064512	109
728	3300025233	Ga0209437_100023	Ga0209437_100023385	109
729	3300025233	Ga0209437_100341	Ga0209437_10034153	109
730	3300025233	Ga0209437_115546	Ga0209437_1155462	109
731	3300025245	Ga0207425_1000018	Ga0207425_1000018278	109
732	3300025245	Ga0207425_1004085	Ga0207425_10040852	109
733	3300025245	Ga0207425_1038773	Ga0207425_10387732	109
734	3300025245	Ga0207425_1042827	Ga0207425_10428272	109
735	3300025246	Ga0209646_1000179	Ga0209646_100017956	109
736	3300025246	Ga0209646_1010633	Ga0209646_10106331	109
737	3300025246	Ga0209646_1021194	Ga0209646_10211942	109
738	3300025250	Ga0209026_1000212	Ga0209026_100021256	109
739	3300025253	Ga0209677_100218	Ga0209677_1002188	109
740	3300025256	Ga0209759_1000246	Ga0209759_100024656	109
741	3300025258	Ga0209129_1000026	Ga0209129_100002651	109
742	3300025258	Ga0209129_1000045	Ga0209129_100004578	109
743	3300025258	Ga0209129_1001008	Ga0209129_10010083	109
744	3300025258	Ga0209129_1002750	Ga0209129_10027502	109
745	3300025258	Ga0209129_1015648	Ga0209129_10156482	109
746	3300025261	Ga0209233_1000062	Ga0209233_100006290	109
747	3300025261	Ga0209233_1000097	Ga0209233_1000097244	109
748	3300025261	Ga0209233_1000970	Ga0209233_10009707	109
749	3300025272	Ga0209455_1027488	Ga0209455_10274882	109
750	3300025273	Ga0209673_1000005	Ga0209673_1000005126	109
751	3300025273	Ga0209673_1000310	Ga0209673_100031030	109
752	3300025273	Ga0209673_1000852	Ga0209673_100085227	109
753	3300025273	Ga0209673_1000877	Ga0209673_100087735	109
754	3300025273	Ga0209673_1002482	Ga0209673_10024826	109
755	3300025273	Ga0209673_1007638	Ga0209673_10076383	109
756	3300025273	Ga0209673_1009627	Ga0209673_10096273	109
757	3300025284	Ga0209130_1000092	Ga0209130_100009272	109
758	3300025284	Ga0209130_1000670	Ga0209130_100067023	109
759	3300025284	Ga0209130_1026631	Ga0209130_10266312	109
760	3300025292	Ga0209676_1032246	Ga0209676_10322462	109
761	3300025292	Ga0209676_1098095	Ga0209676_10980952	109
762	3300025294	Ga0209025_1000035	Ga0209025_100003551	109
763	3300025294	Ga0209025_1000097	Ga0209025_1000097190	109
764	3300025294	Ga0209025_1000376	Ga0209025_100037673	109
765	3300025294	Ga0209025_1001368	Ga0209025_10013682	109
766	3300025294	Ga0209025_1007209	Ga0209025_10072095	109
767	3300025294	Ga0209025_1008586	Ga0209025_10085863	109
768	3300025294	Ga0209025_1011225	Ga0209025_10112252	109
769	3300025294	Ga0209025_1078177	Ga0209025_10781772	109
770	3300025294	Ga0209025_1108448	Ga0209025_11084481	109
771	3300025295	Ga0209564_1000137	Ga0209564_100013771	109
772	3300025295	Ga0209564_1000827	Ga0209564_100082737	109
773	3300025295	Ga0209564_1003453	Ga0209564_10034536	109
774	3300025295	Ga0209564_1009878	Ga0209564_10098784	109
775	3300025295	Ga0209564_1018644	Ga0209564_10186442	109
776	3300025295	Ga0209564_1027339	Ga0209564_10273392	109
777	3300025297	Ga0209758_1000040	Ga0209758_100004051	109
778	3300025297	Ga0209758_1000652	Ga0209758_100065221	109
779	3300025297	Ga0209758_1001596	Ga0209758_100159613	109
780	3300025297	Ga0209758_1006004	Ga0209758_10060042	109
781	3300025297	Ga0209758_1010387	Ga0209758_10103872	109
782	3300025297	Ga0209758_1065005	Ga0209758_10650052	109
783	3300025298	Ga0209050_1001525	Ga0209050_10015253	109
784	3300025298	Ga0209050_1016113	Ga0209050_10161132	109
785	3300025299	Ga0209256_1000397	Ga0209256_10003972	109
786	3300025299	Ga0209256_1003072	Ga0209256_10030723	109
787	3300025299	Ga0209256_1005174	Ga0209256_10051748	109
788	3300025299	Ga0209256_1005462	Ga0209256_10054623	109
789	3300025299	Ga0209256_1009630	Ga0209256_10096302	109
790	3300025299	Ga0209256_1018814	Ga0209256_10188142	109
791	3300025299	Ga0209256_1061014	Ga0209256_10610142	109
792	3300025302	Ga0207426_1000022	Ga0207426_1000022412	109
793	3300025302	Ga0207426_1000094	Ga0207426_1000094188	109
794	3300025302	Ga0207426_1000677	Ga0207426_100067723	109
795	3300025302	Ga0207426_1001886	Ga0207426_10018862	109
796	3300025303	Ga0209051_1000166	Ga0209051_100016617	109
797	3300025303	Ga0209051_1002823	Ga0209051_10028236	109
798	3300025303	Ga0209051_1027181	Ga0209051_10271813	109
799	3300025303	Ga0209051_1068095	Ga0209051_10680952	109
800	3300025303	Ga0209051_1143367	Ga0209051_11433672	109
801	3300025304	Ga0209257_1008917	Ga0209257_10089175	109
802	3300025304	Ga0209257_1009354	Ga0209257_10093542	109
803	3300025304	Ga0209257_1027351	Ga0209257_10273512	109
804	3300025304	Ga0209257_1050499	Ga0209257_10504992	109
805	3300025321	Ga0207656_10289125	Ga0207656_102891252	109
806	3300025903	Ga0207680_10949295	Ga0207680_109492952	109
807	3300025909	Ga0207705_10439529	Ga0207705_104395292	109
808	3300025913	Ga0207695_10000495	Ga0207695_100004956	109
809	3300025914	Ga0207671_10000045	Ga0207671_10000045186	109
810	3300025914	Ga0207671_10000568	Ga0207671_1000056836	109
811	3300025931	Ga0207644_10098968	Ga0207644_100989682	109
812	3300025941	Ga0207711_10437931	Ga0207711_104379312	109
813	3300025941	Ga0207711_10810849	Ga0207711_108108492	109
814	3300025949	Ga0207667_11020230	Ga0207667_110202302	109
815	3300025961	Ga0207712_10355471	Ga0207712_103554712	109
816	3300025972	Ga0207668_10145331	Ga0207668_101453312	109
817	3300025972	Ga0207668_10167054	Ga0207668_101670542	109
818	3300025986	Ga0207658_11238119	Ga0207658_112381192	109
819	3300026067	Ga0207678_10559568	Ga0207678_105595682	109
820	3300026078	Ga0207702_10241882	Ga0207702_102418822	109
821	3300026078	Ga0207702_10478169	Ga0207702_104781692	109
822	3300026121	Ga0207683_11393888	Ga0207683_113938882	109
823	3300026142	Ga0207698_10374821	Ga0207698_103748212	109
824	3300027111	Ga0209281_1000190	Ga0209281_100019082	109
825	3300027111	Ga0209281_1000314	Ga0209281_100031448	109
826	3300027312	Ga0209371_1000035	Ga0209371_1000035300	109
827	3300027312	Ga0209371_1005219	Ga0209371_10052192	109
828	3300027312	Ga0209371_1012102	Ga0209371_10121022	109
829	3300027666	Ga0209282_1000068	Ga0209282_100006848	109
830	3300027666	Ga0209282_1001209	Ga0209282_10012096	109
831	3300027866	Ga0209813_10115411	Ga0209813_101154112	109
832	3300028379	Ga0268266_10013382	Ga0268266_100133823	109
833	3300028379	Ga0268266_11188630	Ga0268266_111886302	109
834	3300028380	Ga0268265_12088718	Ga0268265_120887182	109
835	3300028794	Ga0307515_10001947	Ga0307515_1000194728	109
836	3300028794	Ga0307515_10002407	Ga0307515_1000240731	109
837	3300028794	Ga0307515_10025212	Ga0307515_100252123	109
838	3300028794	Ga0307515_10372802	Ga0307515_103728021	109
839	3300030500	Ga0268256_1003172	Ga0268256_10031726	109
840	3300030500	Ga0268256_1004450	Ga0268256_10044504	109
841	3300030500	Ga0268256_1046620	Ga0268256_10466202	109
842	3300030744	Ga0316181_1259793	Ga0316181_12597933	109
843	3300031456	Ga0307513_10118948	Ga0307513_101189482	109
844	3300031456	Ga0307513_10462287	Ga0307513_104622872	109
845	3300031456	Ga0307513_10975862	Ga0307513_109758622	109
846	3300031548	Ga0307408_100172175	Ga0307408_1001721751	109
847	3300031548	Ga0307408_100413440	Ga0307408_1004134402	109
848	3300031548	Ga0307408_100931271	Ga0307408_1009312712	109
849	3300031548	Ga0307408_101122751	Ga0307408_1011227512	109
850	3300031730	Ga0307516_10190246	Ga0307516_101902462	109
851	3300031731	Ga0307405_10002301	Ga0307405_100023012	109
852	3300031731	Ga0307405_10577080	Ga0307405_105770801	109
853	3300031731	Ga0307405_11036814	Ga0307405_110368142	109
854	3300031824	Ga0307413_10843083	Ga0307413_108430832	109
855	3300031852	Ga0307410_10180013	Ga0307410_101800132	109
856	3300031901	Ga0307406_10016639	Ga0307406_100166393	109
857	3300031901	Ga0307406_11179929	Ga0307406_111799291	109
858	3300031911	Ga0307412_10006984	Ga0307412_100069842	109
859	3300031911	Ga0307412_10102704	Ga0307412_101027042	109
860	3300031911	Ga0307412_10600413	Ga0307412_106004131	109
861	3300031911	Ga0307412_10801290	Ga0307412_108012902	109
862	3300031967	Ga0315914_1008613	Ga0315914_10086132	109
863	3300031995	Ga0307409_100452653	Ga0307409_1004526532	109
864	3300032002	Ga0307416_100197955	Ga0307416_1001979552	109
865	3300032002	Ga0307416_101266807	Ga0307416_1012668072	109
866	3300032002	Ga0307416_103781014	Ga0307416_1037810141	109
867	3300032004	Ga0307414_11161982	Ga0307414_111619822	109
868	3300032004	Ga0307414_11352620	Ga0307414_113526201	109
869	3300032005	Ga0307411_10714633	Ga0307411_107146332	109
870	3300033430	Ga0315913_1000094	Ga0315913_100009446	109
871	3300033464	Ga0315915_1000007	Ga0315915_1000007289	109
872	3300037471	Ga0395905_0000790	Ga0395905_0000790_24099_24449	109
873	3300037471	Ga0395905_0243894	Ga0395905_0243894_744_1076	109
874	3300038705	Ga0237819_20481	Ga0237819_20481_189_524	109
875	3300041404	Ga0439436_0179364	Ga0439436_0179364_98_433	109
876	3300041406	Ga0439439_0139883	Ga0439439_0139883_66_401	109
877	3300041413	Ga0439465_0014825	Ga0439465_0014825_1899_2228	109
878	3300041443	Ga0451789_1365962	Ga0451789_1365962_28_363	109
879	3300041452	Ga0451793_0716888	Ga0451793_0716888_118_453	109
880	3300041458	Ga0451798_0577066	Ga0451798_0577066_672_1007	109
881	3300041486	Ga0451807_0647986	Ga0451807_0647986_71_406	109
882	3300041492	Ga0451835_0899831	Ga0451835_0899831_822_1151	109
883	3300041494	Ga0451837_1776210	Ga0451837_1776210_135_464	109
884	3300041496	Ga0451839_1650530	Ga0451839_1650530_1320_1655	109
885	3300041498	Ga0451841_1233672	Ga0451841_1233672_327_662	109
886	3300041505	Ga0451849_1417950	Ga0451849_1417950_974_1309	109
887	3300041507	Ga0451851_1328210	Ga0451851_1328210_1292_1621	109
888	3300041511	Ga0451855_0935236	Ga0451855_0935236_537_872	109
889	3300041512	Ga0451853_0089417	Ga0451853_0089417_73_408	109
890	3300041512	Ga0451853_2883727	Ga0451853_2883727_328_663	109
891	3300041997	Ga0439431_0122488	Ga0439431_0122488_16_351	109
892	3300042007	Ga0439449_0017835	Ga0439449_0017835_2097_2435	109
893	3300042015	Ga0439462_0144938	Ga0439462_0144938_233_568	109
894	3300042015	Ga0439462_0165970	Ga0439462_0165970_143_478	109
895	3300042122	Ga0450920_071195	Ga0450920_071195_20_355	109
896	3300042146	Ga0450907_081790	Ga0450907_081790_89_424	109
897	3300042156	Ga0439446_0211616	Ga0439446_0211616_112_447	109
898	3300042185	Ga0450909_006353	Ga0450909_006353_1316_1651	109
899	3300042435	Ga0439434_0293844	Ga0439434_0293844_152_487	109
900	3300042531	Ga0450918_042427	Ga0450918_042427_44_379	109
901	3300044684	Ga0466966_0053469	Ga0466966_0053469_156_506	109
902	3300044719	Ga0466971_0636161	Ga0466971_0636161_127_477	109
903	3300044765	Ga0466970_0000129	Ga0466970_0000129_27465_27815	109
904	3300044842	Ga0466957_0083919	Ga0466957_0083919_1216_1566	109
905	3300045976	Ga0466967_0602672	Ga0466967_0602672_392_742	109
906	3300046454	Ga0495592_0019844	Ga0495592_0019844_1410_1751	109
907	3300046455	Ga0495603_0780304	Ga0495603_0780304_49_378	109
908	3300046457	Ga0495590_0075995	Ga0495590_0075995_45_389	109
909	3300046460	Ga0495638_0001230	Ga0495638_0001230_23597_23941	109
910	3300046460	Ga0495638_0170164	Ga0495638_0170164_416_751	109
911	3300046460	Ga0495638_0311523	Ga0495638_0311523_23_358	109
912	3300046460	Ga0495638_0531424	Ga0495638_0531424_208_561	109
913	3300046462	Ga0495651_0783423	Ga0495651_0783423_135_476	109
914	3300046471	Ga0495650_0045946	Ga0495650_0045946_900_1244	109
915	3300046474	Ga0495605_0058837	Ga0495605_0058837_1134_1478	109
916	3300046474	Ga0495605_0103857	Ga0495605_0103857_328_663	109
917	3300046474	Ga0495605_0232663	Ga0495605_0232663_47_376	109
918	3300046492	Ga0495585_0059552	Ga0495585_0059552_1200_1529	109
919	3300046492	Ga0495585_0195591	Ga0495585_0195591_555_899	109
920	3300046492	Ga0495585_0266857	Ga0495585_0266857_31_366	109
921	3300046492	Ga0495585_0313644	Ga0495585_0313644_249_578	109
922	3300046500	Ga0495596_0300718	Ga0495596_0300718_23_364	109
923	3300046501	Ga0495607_0087649	Ga0495607_0087649_280_609	109
924	3300046501	Ga0495607_0333614	Ga0495607_0333614_187_531	109
925	3300046506	Ga0495583_0052748	Ga0495583_0052748_1276_1605	109
926	3300046506	Ga0495583_0068228	Ga0495583_0068228_260_604	109
927	3300046506	Ga0495583_0381845	Ga0495583_0381845_147_476	109
928	3300046507	Ga0495606_0019140	Ga0495606_0019140_1088_1423	109
929	3300046507	Ga0495606_0031736	Ga0495606_0031736_1135_1485	109
930	3300046507	Ga0495606_0188484	Ga0495606_0188484_480_824	109
931	3300046507	Ga0495606_0418085	Ga0495606_0418085_125_475	109
932	3300046512	Ga0495610_0005376	Ga0495610_0005376_6470_6805	109
933	3300046512	Ga0495610_0121862	Ga0495610_0121862_738_1067	109
934	3300046513	Ga0495616_0045124	Ga0495616_0045124_1862_2197	109
935	3300046513	Ga0495616_0267457	Ga0495616_0267457_241_585	109
936	3300046515	Ga0495620_0097545	Ga0495620_0097545_715_1050	109
937	3300046515	Ga0495620_0098516	Ga0495620_0098516_505_834	109
938	3300046515	Ga0495620_0155095	Ga0495620_0155095_97_441	109
939	3300046516	Ga0495628_0479976	Ga0495628_0479976_348_689	109
940	3300046518	Ga0495631_0097082	Ga0495631_0097082_361_705	109
941	3300046518	Ga0495631_0211170	Ga0495631_0211170_334_663	109
942	3300046519	Ga0495632_0006764	Ga0495632_0006764_533_868	109
943	3300046519	Ga0495632_0351858	Ga0495632_0351858_140_484	109
944	3300046522	Ga0495643_0009372	Ga0495643_0009372_1464_1799	109
945	3300046523	Ga0495644_0286955	Ga0495644_0286955_64_393	109
946	3300046524	Ga0495648_0309159	Ga0495648_0309159_339_674	109
947	3300046524	Ga0495648_0349181	Ga0495648_0349181_173_511	109
948	3300046524	Ga0495648_0519496	Ga0495648_0519496_34_369	109
949	3300046530	Ga0495654_0180508	Ga0495654_0180508_148_492	109
950	3300046530	Ga0495654_0358620	Ga0495654_0358620_227_556	109
951	3300046536	Ga0495587_0375863	Ga0495587_0375863_203_544	109
952	3300046538	Ga0495609_0075478	Ga0495609_0075478_886_1230	109
953	3300046538	Ga0495609_0309780	Ga0495609_0309780_300_629	109
954	3300046557	Ga0495622_0005933	Ga0495622_0005933_2338_2679	109
955	3300046557	Ga0495622_0356302	Ga0495622_0356302_85_414	109
956	3300046558	Ga0495633_0014979	Ga0495633_0014979_460_795	109
957	3300046558	Ga0495633_0084709	Ga0495633_0084709_1093_1428	109
958	3300046558	Ga0495633_0102963	Ga0495633_0102963_741_1070	109
959	3300046558	Ga0495633_0433189	Ga0495633_0433189_142_477	109
960	3300046616	Ga0495668_0037979	Ga0495668_0037979_26_361	109
961	3300046616	Ga0495668_0094148	Ga0495668_0094148_285_629	109
962	3300046642	Ga0495634_0021463	Ga0495634_0021463_2344_2685	109
963	3300046648	Ga0495611_0031622	Ga0495611_0031622_26_370	109
964	3300046648	Ga0495611_0390517	Ga0495611_0390517_243_578	109
965	3300046660	Ga0495625_0042561	Ga0495625_0042561_1908_2243	109
966	3300046660	Ga0495625_0050483	Ga0495625_0050483_358_702	109
967	3300046660	Ga0495625_0066953	Ga0495625_0066953_261_590	109
968	3300046660	Ga0495625_0077857	Ga0495625_0077857_420_752	109
969	3300046660	Ga0495625_0717822	Ga0495625_0717822_122_457	109
970	3300046660	Ga0495625_0884962	Ga0495625_0884962_116_445	109
971	3300046674	Ga0495588_0021138	Ga0495588_0021138_1711_2046	109
972	3300046674	Ga0495588_0220850	Ga0495588_0220850_609_950	109
973	3300046674	Ga0495588_0319710	Ga0495588_0319710_347_676	109
974	3300046691	Ga0495670_0512502	Ga0495670_0512502_233_577	109
975	3300046691	Ga0495670_0528523	Ga0495670_0528523_197_526	109
976	3300046692	Ga0495671_0086501	Ga0495671_0086501_47_376	109
977	3300046692	Ga0495671_0158736	Ga0495671_0158736_83_418	109
978	3300046810	Ga0495660_0032637	Ga0495660_0032637_571_906	109
979	3300046810	Ga0495660_0152858	Ga0495660_0152858_517_861	109
980	3300047318	Ga0495636_0113933	Ga0495636_0113933_220_555	109
981	3300047318	Ga0495636_0250282	Ga0495636_0250282_395_739	109
982	3300047443	Ga0495687_071738	Ga0495687_071738_802_1137	109
983	3300047469	Ga0495673_0296938	Ga0495673_0296938_159_497	109
984	3300047470	Ga0495681_0071015	Ga0495681_0071015_851_1180	109
985	3300047472	Ga0495686_0001114	Ga0495686_0001114_30578_30934	109
986	3300047472	Ga0495686_0205720	Ga0495686_0205720_179_514	109
987	3300048090	Ga0495615_0062967	Ga0495615_0062967_21_356	109
988	3300048903	Ga0496100_0013991	Ga0496100_0013991_4101_4451	109
989	3300048904	Ga0496101_0006718	Ga0496101_0006718_1158_1493	109
990	3300048904	Ga0496101_0055225	Ga0496101_0055225_176_526	109
991	3300048905	Ga0496102_0001638	Ga0496102_0001638_311_661	109
992	3300048906	Ga0496103_0438971	Ga0496103_0438971_348_698	109
993	3300048907	Ga0496104_0109413	Ga0496104_0109413_538_873	109
994	3300048909	Ga0496106_0503839	Ga0496106_0503839_456_791	109
995	3300048909	Ga0496106_0824100	Ga0496106_0824100_104_433	109
996	3300048913	Ga0496110_1821442	Ga0496110_1821442_149_484	109
997	3300048919	Ga0496116_0003895	Ga0496116_0003895_1179_1514	109
998	3300048919	Ga0496116_0012692	Ga0496116_0012692_4600_4935	109
999	3300048919	Ga0496116_0041415	Ga0496116_0041415_602_937	109
1000	3300048919	Ga0496116_0059934	Ga0496116_0059934_1749_2099	109
1001	3300048920	Ga0496117_0002435	Ga0496117_0002435_22692_23042	109
1002	3300048920	Ga0496117_0003618	Ga0496117_0003618_92_427	109
1003	3300048920	Ga0496117_0009706	Ga0496117_0009706_4852_5187	109
1004	3300048920	Ga0496117_0295041	Ga0496117_0295041_19_354	109
1005	3300048921	Ga0496118_0002792	Ga0496118_0002792_444_794	109
1006	3300048921	Ga0496118_0016898	Ga0496118_0016898_6136_6471	109
1007	3300048921	Ga0496118_0022582	Ga0496118_0022582_204_539	109
1008	3300048921	Ga0496118_0271328	Ga0496118_0271328_119_454	109
1009	3300048921	Ga0496118_0384681	Ga0496118_0384681_306_656	109
1010	3300048922	Ga0496119_0002764	Ga0496119_0002764_18163_18513	109
1011	3300048922	Ga0496119_0006926	Ga0496119_0006926_6914_7249	109
1012	3300048922	Ga0496119_0017586	Ga0496119_0017586_5008_5343	109
1013	3300048922	Ga0496119_0079220	Ga0496119_0079220_682_1017	109
1014	3300048922	Ga0496119_0168670	Ga0496119_0168670_741_1070	109
1015	3300048922	Ga0496119_0189462	Ga0496119_0189462_354_695	109
1016	3300048922	Ga0496119_0434168	Ga0496119_0434168_175_510	109
1017	3300048923	Ga0496120_0001857	Ga0496120_0001857_524_874	109
1018	3300048923	Ga0496120_0187369	Ga0496120_0187369_524_859	109
1019	3300048924	Ga0496121_0006830	Ga0496121_0006830_438_788	109
1020	3300048924	Ga0496121_0050736	Ga0496121_0050736_1112_1447	109
1021	3300048924	Ga0496121_0092209	Ga0496121_0092209_1933_2268	109
1022	3300048924	Ga0496121_0115035	Ga0496121_0115035_1343_1678	109
1023	3300048924	Ga0496121_0137549	Ga0496121_0137549_423_758	109
1024	3300048924	Ga0496121_0260379	Ga0496121_0260379_549_884	109
1025	3300048924	Ga0496121_0314384	Ga0496121_0314384_20_355	109
1026	3300048924	Ga0496121_0469386	Ga0496121_0469386_87_437	109
1027	3300048924	Ga0496121_0553679	Ga0496121_0553679_42_386	109
1028	3300048925	Ga0496122_0000505	Ga0496122_0000505_4027_4356	109
1029	3300048925	Ga0496122_0003439	Ga0496122_0003439_17477_17809	109
1030	3300048925	Ga0496122_0010316	Ga0496122_0010316_71_406	109
1031	3300048925	Ga0496122_0015265	Ga0496122_0015265_207_557	109
1032	3300048925	Ga0496122_0039778	Ga0496122_0039778_138_473	109
1033	3300048926	Ga0496123_0000400	Ga0496123_0000400_76216_76545	109
1034	3300048926	Ga0496123_0002783	Ga0496123_0002783_3010_3342	109
1035	3300048926	Ga0496123_0006886	Ga0496123_0006886_166_516	109
1036	3300048926	Ga0496123_0033433	Ga0496123_0033433_885_1220	109
1037	3300048926	Ga0496123_0129784	Ga0496123_0129784_919_1254	109
1038	3300048926	Ga0496123_0330709	Ga0496123_0330709_346_681	109
1039	3300048927	Ga0496124_0000610	Ga0496124_0000610_56352_56687	109
1040	3300048927	Ga0496124_0017255	Ga0496124_0017255_379_729	109
1041	3300048927	Ga0496124_0042301	Ga0496124_0042301_191_526	109
1042	3300048927	Ga0496124_0543274	Ga0496124_0543274_283_621	109
1043	3300048928	Ga0496125_0000765	Ga0496125_0000765_17812_18141	109
1044	3300048928	Ga0496125_0029958	Ga0496125_0029958_2967_3302	109
1045	3300048928	Ga0496125_0048805	Ga0496125_0048805_107_457	109
1046	3300048928	Ga0496125_0050433	Ga0496125_0050433_823_1158	109
1047	3300048928	Ga0496125_0316121	Ga0496125_0316121_33_368	109
1048	3300048928	Ga0496125_0712954	Ga0496125_0712954_40_375	109
1049	3300048929	Ga0496126_0036607	Ga0496126_0036607_4211_4546	109
1050	3300048929	Ga0496126_0069300	Ga0496126_0069300_2093_2428	109
1051	3300048929	Ga0496126_0777120	Ga0496126_0777120_101_442	109
1052	3300049459	Ga0495678_015476	Ga0495678_015476_2834_3178	109
1053	3300049459	Ga0495678_034527	Ga0495678_034527_470_805	109
1054	3300049460	Ga0495682_0134631	Ga0495682_0134631_153_497	109
1055	3300049523	Ga0501300_029112	Ga0501300_029112_223_552	109
1056	3300049568	Ga0501031_0268152	Ga0501031_0268152_32_367	109
1057	3300049569	Ga0501032_0733058	Ga0501032_0733058_119_454	109
1058	3300049570	Ga0501033_0477695	Ga0501033_0477695_339_674	109
1059	3300049571	Ga0501034_1244442	Ga0501034_1244442_198_533	109
1060	3300049579	Ga0501043_0860195	Ga0501043_0860195_163_498	109
1061	3300049758	Ga0501241_042532	Ga0501241_042532_251_604	109
1062	3300049776	Ga0501280_001000	Ga0501280_001000_5497_5826	109
1063	3300049822	Ga0501035_0046976	Ga0501035_0046976_25_363	109
1064	3300049822	Ga0501035_1156397	Ga0501035_1156397_218_553	109
1065	3300050489	nmdc:mga03683_58945_c1	nmdc:mga03683_58945_c1_237_587	109
1066	3300050490	nmdc:mga03n38_91558_c1	nmdc:mga03n38_91558_c1_1065_1415	109
1067	3300050491	nmdc:mga00v17_326332_c1	nmdc:mga00v17_326332_c1_77_412	109
1068	3300050492	nmdc:mga0yw44_151479_c1	nmdc:mga0yw44_151479_c1_646_987	109
1069	3300050492	nmdc:mga0yw44_27050_c1	nmdc:mga0yw44_27050_c1_558_908	109
1070	3300050493	nmdc:mga0k408_177551_c1	nmdc:mga0k408_177551_c1_298_648	109
1071	3300050494	nmdc:mga06z11_105348_c1	nmdc:mga06z11_105348_c1_393_743	109
1072	3300050496	nmdc:mga07m45_407924_c1	nmdc:mga07m45_407924_c1_340_675	109
1073	3300050496	nmdc:mga07m45_680291_c1	nmdc:mga07m45_680291_c1_65_400	109
1074	3300050496	nmdc:mga07m45_7220_c1	nmdc:mga07m45_7220_c1_2247_2597	109
1075	3300050516	nmdc:mga0sz30_35367_c1	nmdc:mga0sz30_35367_c1_522_872	109
1076	3300050516	nmdc:mga0sz30_405535_c1	nmdc:mga0sz30_405535_c1_187_537	109
1077	3300050516	nmdc:mga0sz30_555189_c1	nmdc:mga0sz30_555189_c1_165_500	109
1078	3300050516	nmdc:mga0sz30_59031_c1	nmdc:mga0sz30_59031_c1_489_824	109
1079	3300053079	Ga0500610_0078108	Ga0500610_0078108_1240_1584	109
1080	3300053086	Ga0500578_0251829	Ga0500578_0251829_135_470	109
1081	3300053090	Ga0500646_0119194	Ga0500646_0119194_372_716	109
1082	3300053096	Ga0500641_0139054	Ga0500641_0139054_149_478	109
1083	3300053104	Ga0500556_0175371	Ga0500556_0175371_223_567	109
1084	3300053105	Ga0500557_033996	Ga0500557_033996_843_1187	109
1085	3300053107	Ga0500560_180544	Ga0500560_180544_294_629	109
1086	3300053118	Ga0500594_0077965	Ga0500594_0077965_113_457	109
1087	3300053134	Ga0500658_0000846	Ga0500658_0000846_408_743	109
1088	3300053139	Ga0500568_0000980	Ga0500568_0000980_160_504	109
1089	3300053140	Ga0500573_0552064	Ga0500573_0552064_10_339	109
1090	3300053148	Ga0500590_058655	Ga0500590_058655_1020_1361	109
1091	3300053153	Ga0500616_0000324	Ga0500616_0000324_205_558	109
1092	3300053153	Ga0500616_0004151	Ga0500616_0004151_300_644	109
1093	3300053153	Ga0500616_0090553	Ga0500616_0090553_576_917	109
1094	3300053153	Ga0500616_0163878	Ga0500616_0163878_647_982	109
1095	3300053156	Ga0500622_0206994	Ga0500622_0206994_165_500	109
1096	3300053157	Ga0500624_003062	Ga0500624_003062_573_908	109
1097	3300053158	Ga0500627_0110953	Ga0500627_0110953_16_351	109
1098	3300053158	Ga0500627_0129026	Ga0500627_0129026_661_1005	109
1099	3300059503	Ga0587080_016745	Ga0587080_016745_741_1091	109
1100	3300059503	Ga0587080_081725	Ga0587080_081725_123_452	109
1101	3300059505	Ga0587083_0006550	Ga0587083_0006550_747_1097	109
1102	3300059644	Ga0587075_122498	Ga0587075_122498_70_420	109
1103	3300061719	Ga0466962_0223361	Ga0466962_0223361_179_529	109
1104	iso_pu_bacteria	2517287029	2517406220	109
1105	iso_pu_bacteria	2600255279	2601611061	109
1106	iso_pu_bacteria	2600255308	2601747834	109
1107	iso_pu_bacteria	2643221689	2644497451	109
1108	iso_pu_bacteria	2842922631	2842923195	109
1109	iso_pu_bacteria	2933594066	2933598264	109
1110	iso_pu_bacteria	8005376324	8005378597	109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

3

101

0.96 PF00355

Rieske

Rieske [2Fe-2S] domain

3

90

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2yvj-assembly1.cif.gz_B	crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex	0.9141	2	100
4emj-assembly1.cif.gz_B	complex between the reductase and ferredoxin components of toluene dioxygenase	0.9064	2	103
5bok-assembly1.cif.gz_A	ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2	0.9043	1	102
3gce-assembly1.cif.gz_A	ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177	0.8994	1	100
7bui-assembly1.cif.gz_D	complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase	0.899	4	100

ID	Description	Score	Start	End	Superfamily
af_Q2FVL9_1_103_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.9669	1	100	2.102.10.10
af_Q2FVL9_1_103_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.9306	1	100	2.102.10.10
af_P0ABW0_1_105_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.9178	1	101	2.102.10.10
5bokA00	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.9043	1	102	2.102.10.10
af_Q6DHJ3_118_252_2.102.10.10	Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain	0.9041	3	101	2.102.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A526RW59-F1-model_v4	Nitrite reductase small subunit NirD	1.002	1	90	GO:0042128 GO:0046872 GO:0051537
AF-A0A7G6VQQ7-F1-model_v4	Nitrite reductase small subunit NirD	0.9992	2	104	GO:0042128 GO:0046872 GO:0051537
AF-A0A512DRF1-F1-model_v4	tRNA-(Guanine-N1)-methyltransferase	0.9986	2	101	GO:0008168 GO:0032259 GO:0042128 GO:0046872 GO:0051537
AF-A0A4R6R9V2-F1-model_v4	Assimilatory nitrite reductase (NAD(P)H) small subunit	0.9985	3	99	GO:0042128 GO:0046872 GO:0051537
AF-A0A1G3IEF5-F1-model_v4	Nitrite reductase	0.9979	2	101	GO:0042128 GO:0046872 GO:0051537

Feature Viewer

pLDDT	pTM	Quality
93.71	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F490214

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

3

101

0.96

PF00355

Rieske

Rieske [2Fe-2S] domain

3

90

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map