F490100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1103 | 385 | 1063 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10054794|Ga0075365_100547942 |
| Length | 344 |
| Sequence | MSLAAQAARVGAPPYFGRDAPAAKTMHGVGRVRQAVAMINVEGLTRRYGNFTAVDDVSFVCQPGRVTGFLGPNGAGKTTTMRVMVGLTPPTKGRVTIGGHVYQDIPNPGTHVGVLLDASAQHAGRTGREILTLGAQTMGLPMSRVDEMLELVSLDKTEAKRRLRNYSLGMKQRLGIAHALLGDPSVLILDEPANGLDPAGIRWMRGLLKGYADRGGTVCLSSHLLNEVEQIADEMILIGHGRIVAEGTKEELLAGAESHTALVTSLDNERLAQALRDKGVTVTTAGSGLRAETAPVQVGRVAAEHSIVLSDLRAAEGGLEELFLTLTADTQREQPVATTQGATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 2 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 3 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 4 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 5 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 6 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 7 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 8 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 9 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 10 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 11 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 12 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 13 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 14 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 15 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 16 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 17 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 18 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 19 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 20 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 21 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 22 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 23 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 24 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 25 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 26 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 27 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 28 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 29 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 30 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 31 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 34 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 37 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 38 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 219 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 249 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 322 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 374 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 376 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 379 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 385 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.56 |
| Metatranscriptomes | 0.82 |
| Isolates | 3.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 9.88 |
| Nodule | 0.18 |
| Rhizoplane | 9.43 |
| Rhizosphere | 75.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1009250 | 3300001915 | Bacteria | 1818 |
| 2 | JGI24752J21851_1003606 | 3300001976 | Bacteria | 2039 |
| 3 | JGI24740J21852_10016912 | 3300001979 | Bacteria | 2622 |
| 4 | JGI24739J22299_10024977 | 3300001989 | Bacteria | 2103 |
| 5 | JGI24737J22298_10002340 | 3300001990 | Bacteria | 6758 |
| 6 | JGI24735J21928_10012866 | 3300002067 | Bacteria | 2641 |
| 7 | JGI24738J21930_10012282 | 3300002075 | Bacteria | 1872 |
| 8 | JGI24738J21930_10013790 | 3300002075 | Bacteria | 1741 |
| 9 | JGI24751J29686_10009083 | 3300002459 | Bacteria | 2041 |
| 10 | Ga0006562J51391_1041093 | 3300003578 | Bacteria | 2360 |
| 11 | Ga0070658_10022845 | 3300005327 | Bacteria | 5020 |
| 12 | Ga0070658_10052400 | 3300005327 | Bacteria | 3309 |
| 13 | Ga0070658_10174949 | 3300005327 | Bacteria | 1805 |
| 14 | Ga0070676_10008718 | 3300005328 | Bacteria | 5471 |
| 15 | Ga0070683_100004272 | 3300005329 | Bacteria | 11729 |
| 16 | Ga0070683_100068068 | 3300005329 | Bacteria | 3317 |
| 17 | Ga0070683_100188442 | 3300005329 | Bacteria | 1958 |
| 18 | Ga0070683_100530843 | 3300005329 | Bacteria | 1125 |
| 19 | Ga0070670_100030720 | 3300005331 | Bacteria | 4626 |
| 20 | Ga0070670_100055693 | 3300005331 | Bacteria | 3394 |
| 21 | Ga0070670_100139943 | 3300005331 | Bacteria | 2093 |
| 22 | Ga0070670_100156954 | 3300005331 | Bacteria | 1971 |
| 23 | Ga0068869_100101416 | 3300005334 | Bacteria | 2177 |
| 24 | Ga0070666_10111673 | 3300005335 | Bacteria | 1890 |
| 25 | Ga0070680_100086487 | 3300005336 | Bacteria | 2591 |
| 26 | Ga0070682_100020935 | 3300005337 | Bacteria | 3853 |
| 27 | Ga0070682_100033181 | 3300005337 | Bacteria | 3135 |
| 28 | Ga0070682_100087180 | 3300005337 | Bacteria | 2035 |
| 29 | Ga0068868_100130078 | 3300005338 | Bacteria | 2059 |
| 30 | Ga0068868_100155424 | 3300005338 | Bacteria | 1886 |
| 31 | Ga0068868_100219377 | 3300005338 | Bacteria | 1592 |
| 32 | Ga0068868_100337182 | 3300005338 | Bacteria | 1288 |
| 33 | Ga0070660_100026821 | 3300005339 | Bacteria | 4292 |
| 34 | Ga0070691_10008438 | 3300005341 | Bacteria | 4714 |
| 35 | Ga0070691_10032720 | 3300005341 | Bacteria | 2444 |
| 36 | Ga0070687_100067500 | 3300005343 | Bacteria | 1909 |
| 37 | Ga0070687_100170331 | 3300005343 | Bacteria | 1295 |
| 38 | Ga0070661_100083997 | 3300005344 | Bacteria | 2352 |
| 39 | Ga0070661_100096484 | 3300005344 | Bacteria | 2194 |
| 40 | Ga0070692_10031200 | 3300005345 | Bacteria | 2670 |
| 41 | Ga0070692_10063357 | 3300005345 | Bacteria | 1953 |
| 42 | Ga0070669_100085049 | 3300005353 | Bacteria | 2362 |
| 43 | Ga0070669_100113295 | 3300005353 | Bacteria | 2060 |
| 44 | Ga0070675_100003729 | 3300005354 | Bacteria | 11583 |
| 45 | Ga0070675_100081721 | 3300005354 | Bacteria | 2695 |
| 46 | Ga0070675_100201298 | 3300005354 | Bacteria | 1728 |
| 47 | Ga0070671_100001796 | 3300005355 | Bacteria | 16283 |
| 48 | Ga0070671_100284606 | 3300005355 | Bacteria | 1406 |
| 49 | Ga0070674_100020561 | 3300005356 | Bacteria | 4221 |
| 50 | Ga0070674_100028612 | 3300005356 | Bacteria | 3661 |
| 51 | Ga0070674_100064123 | 3300005356 | Bacteria | 2573 |
| 52 | Ga0070673_100194741 | 3300005364 | Bacteria | 1743 |
| 53 | Ga0070659_100017443 | 3300005366 | Bacteria | 5405 |
| 54 | Ga0070659_100031226 | 3300005366 | Bacteria | 4125 |
| 55 | Ga0070659_100111701 | 3300005366 | Bacteria | 2207 |
| 56 | Ga0070667_100105794 | 3300005367 | Bacteria | 2435 |
| 57 | Ga0070709_10018818 | 3300005434 | Bacteria | 3985 |
| 58 | Ga0070709_10219397 | 3300005434 | Bacteria | 1355 |
| 59 | Ga0070709_10226601 | 3300005434 | Bacteria | 1335 |
| 60 | Ga0070709_10318096 | 3300005434 | Bacteria | 1141 |
| 61 | Ga0070714_100145978 | 3300005435 | Bacteria | 2128 |
| 62 | Ga0070714_100351591 | 3300005435 | Bacteria | 1384 |
| 63 | Ga0070713_100499694 | 3300005436 | Bacteria | 1147 |
| 64 | Ga0070710_10033092 | 3300005437 | Bacteria | 2805 |
| 65 | Ga0070710_10196074 | 3300005437 | Bacteria | 1272 |
| 66 | Ga0070701_10002525 | 3300005438 | Bacteria | 7071 |
| 67 | Ga0070701_10004513 | 3300005438 | Bacteria | 5650 |
| 68 | Ga0070701_10013161 | 3300005438 | Bacteria | 3755 |
| 69 | Ga0070711_100107191 | 3300005439 | Bacteria | 2044 |
| 70 | Ga0070711_100305484 | 3300005439 | Bacteria | 1266 |
| 71 | Ga0070711_100518832 | 3300005439 | Bacteria | 984 |
| 72 | Ga0070705_100173239 | 3300005440 | Bacteria | 1454 |
| 73 | Ga0070700_100011432 | 3300005441 | Bacteria | 4917 |
| 74 | Ga0070700_100016043 | 3300005441 | Bacteria | 4260 |
| 75 | Ga0070700_100033084 | 3300005441 | Bacteria | 3112 |
| 76 | Ga0070700_100074634 | 3300005441 | Bacteria | 2173 |
| 77 | Ga0070663_100026021 | 3300005455 | Bacteria | 3958 |
| 78 | Ga0070678_100073846 | 3300005456 | Bacteria | 2561 |
| 79 | Ga0070678_100152184 | 3300005456 | Bacteria | 1865 |
| 80 | Ga0070662_100023827 | 3300005457 | Bacteria | 4210 |
| 81 | Ga0070681_10216441 | 3300005458 | Bacteria | 1831 |
| 82 | Ga0068867_100019341 | 3300005459 | Bacteria | 4853 |
| 83 | Ga0068867_100060741 | 3300005459 | Bacteria | 2804 |
| 84 | Ga0070685_10066406 | 3300005466 | Bacteria | 2125 |
| 85 | Ga0070706_100417038 | 3300005467 | Bacteria | 1249 |
| 86 | Ga0070679_100079751 | 3300005530 | Bacteria | 3263 |
| 87 | Ga0070684_100005484 | 3300005535 | Bacteria | 9720 |
| 88 | Ga0070684_100007079 | 3300005535 | Bacteria | 8719 |
| 89 | Ga0070684_100069190 | 3300005535 | Bacteria | 3104 |
| 90 | Ga0070684_100084213 | 3300005535 | Bacteria | 2818 |
| 91 | Ga0070684_100093417 | 3300005535 | Bacteria | 2678 |
| 92 | Ga0070684_100104682 | 3300005535 | Bacteria | 2532 |
| 93 | Ga0070684_100366711 | 3300005535 | Bacteria | 1326 |
| 94 | Ga0068853_100190760 | 3300005539 | Bacteria | 1862 |
| 95 | Ga0068853_100332806 | 3300005539 | Bacteria | 1409 |
| 96 | Ga0068853_100332826 | 3300005539 | Bacteria | 1409 |
| 97 | Ga0070672_100058530 | 3300005543 | Bacteria | 3029 |
| 98 | Ga0070693_100021585 | 3300005547 | Bacteria | 3412 |
| 99 | Ga0070693_100140788 | 3300005547 | Bacteria | 1518 |
| 100 | Ga0070665_100000273 | 3300005548 | Bacteria | 84592 |
| 101 | Ga0070665_100000957 | 3300005548 | Bacteria | 36788 |
| 102 | Ga0070665_100001051 | 3300005548 | Bacteria | 34592 |
| 103 | Ga0070665_100006876 | 3300005548 | Bacteria | 11562 |
| 104 | Ga0070665_100019437 | 3300005548 | Bacteria | 6817 |
| 105 | Ga0068855_100051021 | 3300005563 | Bacteria | 4874 |
| 106 | Ga0068855_100148667 | 3300005563 | Bacteria | 2665 |
| 107 | Ga0068855_100250575 | 3300005563 | Bacteria | 1975 |
| 108 | Ga0068855_100672769 | 3300005563 | Bacteria | 1110 |
| 109 | Ga0068855_100833010 | 3300005563 | Bacteria | 979 |
| 110 | Ga0070664_100006966 | 3300005564 | Bacteria | 9112 |
| 111 | Ga0070664_100073978 | 3300005564 | Bacteria | 2924 |
| 112 | Ga0070664_100282178 | 3300005564 | Bacteria | 1498 |
| 113 | Ga0068857_100022586 | 3300005577 | Bacteria | 5533 |
| 114 | Ga0068857_100047898 | 3300005577 | Bacteria | 3796 |
| 115 | Ga0068857_100067847 | 3300005577 | Bacteria | 3175 |
| 116 | Ga0068857_100108497 | 3300005577 | Bacteria | 2494 |
| 117 | Ga0068857_100315139 | 3300005577 | Bacteria | 1444 |
| 118 | Ga0068854_100380884 | 3300005578 | Bacteria | 1162 |
| 119 | Ga0068854_100441639 | 3300005578 | Bacteria | 1085 |
| 120 | Ga0068854_100470469 | 3300005578 | Bacteria | 1053 |
| 121 | Ga0068856_100007197 | 3300005614 | Bacteria | 10853 |
| 122 | Ga0068856_100191745 | 3300005614 | Bacteria | 2057 |
| 123 | Ga0068856_100274287 | 3300005614 | Bacteria | 1703 |
| 124 | Ga0070702_100007278 | 3300005615 | Bacteria | 5292 |
| 125 | Ga0070702_100040366 | 3300005615 | Bacteria | 2610 |
| 126 | Ga0070702_100092910 | 3300005615 | Bacteria | 1833 |
| 127 | Ga0070702_100139491 | 3300005615 | Bacteria | 1542 |
| 128 | Ga0070702_100236934 | 3300005615 | Bacteria | 1229 |
| 129 | Ga0068852_100017197 | 3300005616 | Bacteria | 5668 |
| 130 | Ga0068852_100027017 | 3300005616 | Bacteria | 4672 |
| 131 | Ga0068852_100055241 | 3300005616 | Bacteria | 3426 |
| 132 | Ga0068852_100349429 | 3300005616 | Bacteria | 1443 |
| 133 | Ga0068859_100205012 | 3300005617 | Bacteria | 2057 |
| 134 | Ga0068859_100355058 | 3300005617 | Bacteria | 1561 |
| 135 | Ga0068859_100612565 | 3300005617 | Bacteria | 1181 |
| 136 | Ga0068864_100021818 | 3300005618 | Bacteria | 5366 |
| 137 | Ga0068864_100107890 | 3300005618 | Bacteria | 2477 |
| 138 | Ga0068861_100027454 | 3300005719 | Bacteria | 4145 |
| 139 | Ga0068861_100029179 | 3300005719 | Bacteria | 4033 |
| 140 | Ga0068861_100116466 | 3300005719 | Bacteria | 2149 |
| 141 | Ga0068861_100127864 | 3300005719 | Bacteria | 2058 |
| 142 | Ga0068861_100158172 | 3300005719 | Bacteria | 1866 |
| 143 | Ga0068870_10033509 | 3300005840 | Bacteria | 2621 |
| 144 | Ga0068863_100380823 | 3300005841 | Bacteria | 1377 |
| 145 | Ga0068858_100042801 | 3300005842 | Bacteria | 4199 |
| 146 | Ga0068858_100094287 | 3300005842 | Bacteria | 2788 |
| 147 | Ga0068858_100191147 | 3300005842 | Bacteria | 1934 |
| 148 | Ga0068860_100000467 | 3300005843 | Bacteria | 50515 |
| 149 | Ga0068860_100012237 | 3300005843 | Bacteria | 8456 |
| 150 | Ga0068862_100216380 | 3300005844 | Bacteria | 1733 |
| 151 | Ga0081455_10000030 | 3300005937 | Bacteria | 148346 |
| 152 | Ga0081455_10071377 | 3300005937 | Bacteria | 2879 |
| 153 | Ga0081455_10195177 | 3300005937 | Bacteria | 1521 |
| 154 | Ga0081455_10221912 | 3300005937 | Bacteria | 1400 |
| 155 | Ga0081538_10000065 | 3300005981 | Bacteria | 98948 |
| 156 | Ga0081540_1025012 | 3300005983 | Bacteria | 3450 |
| 157 | Ga0081539_10033921 | 3300005985 | Bacteria | 3098 |
| 158 | Ga0070717_10098364 | 3300006028 | Bacteria | 2480 |
| 159 | Ga0070717_10375462 | 3300006028 | Bacteria | 1274 |
| 160 | Ga0075365_10008147 | 3300006038 | Bacteria | 5923 |
| 161 | Ga0075365_10024606 | 3300006038 | Bacteria | 3801 |
| 162 | Ga0075365_10031885 | 3300006038 | Bacteria | 3384 |
| 163 | Ga0075365_10043984 | 3300006038 | Bacteria | 2924 |
| 164 | Ga0075365_10046940 | 3300006038 | Bacteria | 2838 |
| 165 | Ga0075365_10054794 | 3300006038 | Bacteria | 2645 |
| 166 | Ga0075365_10071600 | 3300006038 | Bacteria | 2334 |
| 167 | Ga0075365_10075681 | 3300006038 | Bacteria | 2272 |
| 168 | Ga0075365_10096041 | 3300006038 | Bacteria | 2025 |
| 169 | Ga0075365_10101048 | 3300006038 | Bacteria | 1974 |
| 170 | Ga0075365_10112732 | 3300006038 | Bacteria | 1870 |
| 171 | Ga0075365_10156839 | 3300006038 | Bacteria | 1584 |
| 172 | Ga0075365_10159500 | 3300006038 | Bacteria | 1571 |
| 173 | Ga0075365_10166502 | 3300006038 | Bacteria | 1538 |
| 174 | Ga0075368_10000363 | 3300006042 | Bacteria | 13338 |
| 175 | Ga0075368_10000952 | 3300006042 | Bacteria | 9008 |
| 176 | Ga0075368_10017449 | 3300006042 | Bacteria | 2687 |
| 177 | Ga0075368_10031645 | 3300006042 | Bacteria | 2052 |
| 178 | Ga0075363_100000170 | 3300006048 | Bacteria | 16868 |
| 179 | Ga0075363_100000416 | 3300006048 | Bacteria | 13204 |
| 180 | Ga0075363_100001116 | 3300006048 | Bacteria | 9747 |
| 181 | Ga0075363_100002522 | 3300006048 | Bacteria | 7508 |
| 182 | Ga0075363_100020550 | 3300006048 | Bacteria | 3313 |
| 183 | Ga0075363_100061961 | 3300006048 | Bacteria | 2017 |
| 184 | Ga0075363_100063141 | 3300006048 | Bacteria | 1998 |
| 185 | Ga0075363_100072134 | 3300006048 | Bacteria | 1877 |
| 186 | Ga0075363_100079254 | 3300006048 | Bacteria | 1794 |
| 187 | Ga0075364_10006272 | 3300006051 | Bacteria | 6978 |
| 188 | Ga0075364_10008594 | 3300006051 | Bacteria | 6108 |
| 189 | Ga0075364_10014601 | 3300006051 | Bacteria | 4855 |
| 190 | Ga0075364_10042989 | 3300006051 | Bacteria | 2937 |
| 191 | Ga0075364_10057116 | 3300006051 | Bacteria | 2556 |
| 192 | Ga0075364_10062326 | 3300006051 | Bacteria | 2447 |
| 193 | Ga0075364_10073802 | 3300006051 | Bacteria | 2249 |
| 194 | Ga0075364_10086073 | 3300006051 | Bacteria | 2082 |
| 195 | Ga0070715_10011892 | 3300006163 | Bacteria | 3148 |
| 196 | Ga0070716_100192595 | 3300006173 | Bacteria | 1348 |
| 197 | Ga0070712_100069159 | 3300006175 | Bacteria | 2518 |
| 198 | Ga0070712_100111253 | 3300006175 | Bacteria | 2044 |
| 199 | Ga0070712_100169574 | 3300006175 | Bacteria | 1692 |
| 200 | Ga0070712_100500521 | 3300006175 | Bacteria | 1018 |
| 201 | Ga0075362_10015327 | 3300006177 | Bacteria | 3115 |
| 202 | Ga0075367_10000401 | 3300006178 | Bacteria | 15899 |
| 203 | Ga0075367_10010955 | 3300006178 | Bacteria | 4778 |
| 204 | Ga0075367_10018148 | 3300006178 | Bacteria | 3876 |
| 205 | Ga0075367_10019136 | 3300006178 | Bacteria | 3792 |
| 206 | Ga0075367_10053572 | 3300006178 | Bacteria | 2391 |
| 207 | Ga0075367_10080839 | 3300006178 | Bacteria | 1966 |
| 208 | Ga0075367_10090433 | 3300006178 | Bacteria | 1862 |
| 209 | Ga0097621_100086442 | 3300006237 | Bacteria | 2617 |
| 210 | Ga0097621_100167876 | 3300006237 | Bacteria | 1890 |
| 211 | Ga0075370_10001511 | 3300006353 | Bacteria | 10168 |
| 212 | Ga0075370_10001569 | 3300006353 | Bacteria | 10038 |
| 213 | Ga0075370_10003287 | 3300006353 | Bacteria | 7669 |
| 214 | Ga0075370_10032220 | 3300006353 | Bacteria | 2929 |
| 215 | Ga0075370_10065800 | 3300006353 | Bacteria | 2067 |
| 216 | Ga0075428_100016372 | 3300006844 | Bacteria | 8192 |
| 217 | Ga0075428_100021526 | 3300006844 | Bacteria | 7137 |
| 218 | Ga0075428_100800667 | 3300006844 | Bacteria | 1002 |
| 219 | Ga0075430_100003986 | 3300006846 | Bacteria | 12447 |
| 220 | Ga0075431_100022766 | 3300006847 | Bacteria | 6404 |
| 221 | Ga0075431_100141258 | 3300006847 | Bacteria | 2482 |
| 222 | Ga0075433_10088568 | 3300006852 | Bacteria | 2735 |
| 223 | Ga0075429_100048371 | 3300006880 | Bacteria | 3698 |
| 224 | Ga0068865_100019619 | 3300006881 | Bacteria | 4376 |
| 225 | Ga0068865_100035311 | 3300006881 | Bacteria | 3360 |
| 226 | Ga0068865_100217837 | 3300006881 | Bacteria | 1491 |
| 227 | Ga0068865_100228041 | 3300006881 | Bacteria | 1460 |
| 228 | Ga0097620_100205006 | 3300006931 | Bacteria | 2057 |
| 229 | Ga0097620_100355027 | 3300006931 | Bacteria | 1561 |
| 230 | Ga0097620_100612567 | 3300006931 | Bacteria | 1181 |
| 231 | Ga0111539_10006328 | 3300009094 | Bacteria | 15264 |
| 232 | Ga0111539_10012179 | 3300009094 | Bacteria | 10790 |
| 233 | Ga0111539_10046610 | 3300009094 | Bacteria | 5184 |
| 234 | Ga0111539_10048292 | 3300009094 | Bacteria | 5083 |
| 235 | Ga0111539_10373232 | 3300009094 | Bacteria | 1660 |
| 236 | Ga0111539_10460281 | 3300009094 | Bacteria | 1481 |
| 237 | Ga0111539_10490536 | 3300009094 | Bacteria | 1431 |
| 238 | Ga0105245_10001389 | 3300009098 | Bacteria | 21921 |
| 239 | Ga0105245_10163601 | 3300009098 | Bacteria | 2113 |
| 240 | Ga0105245_10187166 | 3300009098 | Bacteria | 1981 |
| 241 | Ga0105245_10219360 | 3300009098 | Bacteria | 1834 |
| 242 | Ga0105245_10465027 | 3300009098 | Bacteria | 1276 |
| 243 | Ga0105245_10516366 | 3300009098 | Bacteria | 1212 |
| 244 | Ga0114129_10010931 | 3300009147 | Bacteria | 12935 |
| 245 | Ga0105243_10014099 | 3300009148 | Bacteria | 6047 |
| 246 | Ga0105243_10016322 | 3300009148 | Bacteria | 5618 |
| 247 | Ga0105243_10209072 | 3300009148 | Bacteria | 1717 |
| 248 | Ga0105243_10224463 | 3300009148 | Bacteria | 1662 |
| 249 | Ga0105242_10058334 | 3300009176 | Bacteria | 3164 |
| 250 | Ga0105242_10235375 | 3300009176 | Bacteria | 1643 |
| 251 | Ga0105242_10451169 | 3300009176 | Bacteria | 1212 |
| 252 | Ga0105248_10031669 | 3300009177 | Bacteria | 5908 |
| 253 | Ga0105248_10200240 | 3300009177 | Bacteria | 2250 |
| 254 | Ga0105248_10279932 | 3300009177 | Bacteria | 1878 |
| 255 | Ga0105237_10033781 | 3300009545 | Bacteria | 5182 |
| 256 | Ga0105237_10393879 | 3300009545 | Bacteria | 1390 |
| 257 | Ga0105238_10044672 | 3300009551 | Bacteria | 4478 |
| 258 | Ga0105238_10268573 | 3300009551 | Bacteria | 1686 |
| 259 | Ga0105238_10384194 | 3300009551 | Bacteria | 1396 |
| 260 | Ga0105238_10392380 | 3300009551 | Bacteria | 1380 |
| 261 | Ga0105238_10522303 | 3300009551 | Bacteria | 1190 |
| 262 | Ga0105249_10004469 | 3300009553 | Bacteria | 12090 |
| 263 | Ga0105249_10031845 | 3300009553 | Bacteria | 4771 |
| 264 | Ga0105249_10198452 | 3300009553 | Bacteria | 1962 |
| 265 | Ga0105249_10347224 | 3300009553 | Bacteria | 1502 |
| 266 | Ga0105239_10003376 | 3300010375 | Bacteria | 19591 |
| 267 | Ga0105239_10010898 | 3300010375 | Bacteria | 10156 |
| 268 | Ga0105239_10097739 | 3300010375 | Bacteria | 3245 |
| 269 | Ga0105239_10156809 | 3300010375 | Bacteria | 2542 |
| 270 | Ga0105239_10503710 | 3300010375 | Bacteria | 1377 |
| 271 | Ga0105246_10010063 | 3300011119 | Bacteria | 5836 |
| 272 | Ga0105246_10090788 | 3300011119 | Bacteria | 2200 |
| 273 | Ga0157346_1000863 | 3300012480 | Bacteria | 1360 |
| 274 | Ga0157371_10089881 | 3300013102 | Bacteria | 2175 |
| 275 | Ga0157370_10195463 | 3300013104 | Bacteria | 1877 |
| 276 | Ga0157370_10441299 | 3300013104 | Bacteria | 1197 |
| 277 | Ga0157369_10010908 | 3300013105 | Bacteria | 10347 |
| 278 | Ga0157369_10040542 | 3300013105 | Bacteria | 5083 |
| 279 | Ga0157369_10215533 | 3300013105 | Bacteria | 2011 |
| 280 | Ga0157369_10338537 | 3300013105 | Bacteria | 1563 |
| 281 | Ga0157369_10387946 | 3300013105 | Bacteria | 1449 |
| 282 | Ga0157369_10838189 | 3300013105 | Bacteria | 944 |
| 283 | Ga0163162_10002716 | 3300013306 | Bacteria | 16784 |
| 284 | Ga0163162_10008332 | 3300013306 | Bacteria | 10112 |
| 285 | Ga0163162_10163280 | 3300013306 | Bacteria | 2350 |
| 286 | Ga0163162_10185897 | 3300013306 | Bacteria | 2205 |
| 287 | Ga0157372_10000025 | 3300013307 | Bacteria | 195491 |
| 288 | Ga0157372_10015861 | 3300013307 | Bacteria | 8082 |
| 289 | Ga0157372_10022009 | 3300013307 | Bacteria | 6892 |
| 290 | Ga0157372_10125591 | 3300013307 | Bacteria | 2950 |
| 291 | Ga0157372_10403120 | 3300013307 | Bacteria | 1594 |
| 292 | Ga0157372_10416507 | 3300013307 | Bacteria | 1566 |
| 293 | Ga0157372_10697150 | 3300013307 | Bacteria | 1182 |
| 294 | Ga0157375_10029705 | 3300013308 | Bacteria | 5144 |
| 295 | Ga0157375_10058354 | 3300013308 | Bacteria | 3817 |
| 296 | Ga0157375_10106735 | 3300013308 | Bacteria | 2892 |
| 297 | Ga0157375_10243685 | 3300013308 | Bacteria | 1957 |
| 298 | Ga0157375_10420163 | 3300013308 | Bacteria | 1503 |
| 299 | Ga0157375_10534980 | 3300013308 | Bacteria | 1334 |
| 300 | Ga0163163_10022365 | 3300014325 | Bacteria | 5985 |
| 301 | Ga0163163_10067546 | 3300014325 | Bacteria | 3555 |
| 302 | Ga0163163_10129195 | 3300014325 | Bacteria | 2566 |
| 303 | Ga0163163_10151041 | 3300014325 | Bacteria | 2366 |
| 304 | Ga0157380_10002258 | 3300014326 | Bacteria | 12956 |
| 305 | Ga0157380_10010387 | 3300014326 | Bacteria | 6697 |
| 306 | Ga0157380_10018962 | 3300014326 | Bacteria | 5119 |
| 307 | Ga0157380_10173312 | 3300014326 | Bacteria | 1887 |
| 308 | Ga0157380_10351377 | 3300014326 | Bacteria | 1380 |
| 309 | Ga0182008_10092587 | 3300014497 | Bacteria | 1491 |
| 310 | Ga0157377_10003131 | 3300014745 | Bacteria | 7447 |
| 311 | Ga0157377_10024322 | 3300014745 | Bacteria | 3218 |
| 312 | Ga0157377_10044772 | 3300014745 | Bacteria | 2469 |
| 313 | Ga0157377_10048662 | 3300014745 | Bacteria | 2380 |
| 314 | Ga0157377_10182038 | 3300014745 | Bacteria | 1322 |
| 315 | Ga0157376_10263359 | 3300014969 | Bacteria | 1616 |
| 316 | Ga0163161_10139886 | 3300017792 | Bacteria | 1832 |
| 317 | Ga0163161_10178144 | 3300017792 | Bacteria | 1628 |
| 318 | Ga0206354_10058287 | 3300020081 | Bacteria | 1028 |
| 319 | Ga0206353_10418635 | 3300020082 | Bacteria | 1175 |
| 320 | Ga0206353_10455544 | 3300020082 | Bacteria | 2500 |
| 321 | Ga0206353_11704839 | 3300020082 | Bacteria | 2123 |
| 322 | Ga0206353_11712015 | 3300020082 | Bacteria | 3838 |
| 323 | Ga0207692_10012583 | 3300025898 | Bacteria | 3638 |
| 324 | Ga0207692_10056314 | 3300025898 | Bacteria | 2016 |
| 325 | Ga0207692_10156153 | 3300025898 | Bacteria | 1311 |
| 326 | Ga0207642_10008017 | 3300025899 | Bacteria | 3600 |
| 327 | Ga0207642_10050616 | 3300025899 | Bacteria | 1875 |
| 328 | Ga0207688_10003017 | 3300025901 | Bacteria | 9171 |
| 329 | Ga0207688_10004230 | 3300025901 | Bacteria | 7826 |
| 330 | Ga0207688_10008819 | 3300025901 | Bacteria | 5488 |
| 331 | Ga0207688_10015048 | 3300025901 | Bacteria | 4197 |
| 332 | Ga0207688_10019250 | 3300025901 | Bacteria | 3717 |
| 333 | Ga0207688_10025699 | 3300025901 | Bacteria | 3236 |
| 334 | Ga0207688_10046663 | 3300025901 | Bacteria | 2419 |
| 335 | Ga0207647_10002481 | 3300025904 | Bacteria | 13967 |
| 336 | Ga0207647_10056181 | 3300025904 | Bacteria | 2416 |
| 337 | Ga0207699_10044113 | 3300025906 | Bacteria | 2594 |
| 338 | Ga0207699_10053763 | 3300025906 | Bacteria | 2389 |
| 339 | Ga0207699_10199098 | 3300025906 | Bacteria | 1356 |
| 340 | Ga0207645_10039887 | 3300025907 | Bacteria | 3008 |
| 341 | Ga0207643_10002197 | 3300025908 | Bacteria | 10637 |
| 342 | Ga0207643_10023134 | 3300025908 | Bacteria | 3426 |
| 343 | Ga0207643_10037108 | 3300025908 | Bacteria | 2734 |
| 344 | Ga0207643_10061829 | 3300025908 | Bacteria | 2139 |
| 345 | Ga0207705_10038483 | 3300025909 | Bacteria | 3425 |
| 346 | Ga0207684_10247373 | 3300025910 | Bacteria | 1538 |
| 347 | Ga0207707_10160407 | 3300025912 | Bacteria | 1966 |
| 348 | Ga0207671_10028511 | 3300025914 | Bacteria | 4171 |
| 349 | Ga0207693_10127068 | 3300025915 | Bacteria | 2004 |
| 350 | Ga0207693_10464635 | 3300025915 | Bacteria | 989 |
| 351 | Ga0207663_10009729 | 3300025916 | Bacteria | 5089 |
| 352 | Ga0207663_10035696 | 3300025916 | Bacteria | 2985 |
| 353 | Ga0207663_10140756 | 3300025916 | Bacteria | 1680 |
| 354 | Ga0207663_10259046 | 3300025916 | Bacteria | 1284 |
| 355 | Ga0207660_10482565 | 3300025917 | Bacteria | 1005 |
| 356 | Ga0207662_10009033 | 3300025918 | Bacteria | 5475 |
| 357 | Ga0207662_10059818 | 3300025918 | Bacteria | 2284 |
| 358 | Ga0207662_10182328 | 3300025918 | Bacteria | 1351 |
| 359 | Ga0207657_10017941 | 3300025919 | Bacteria | 6772 |
| 360 | Ga0207657_10030851 | 3300025919 | Bacteria | 4859 |
| 361 | Ga0207649_10166865 | 3300025920 | Bacteria | 1530 |
| 362 | Ga0207652_10036477 | 3300025921 | Bacteria | 4156 |
| 363 | Ga0207694_10231719 | 3300025924 | Bacteria | 1508 |
| 364 | Ga0207650_10001714 | 3300025925 | Bacteria | 15564 |
| 365 | Ga0207650_10057978 | 3300025925 | Bacteria | 2882 |
| 366 | Ga0207659_10065925 | 3300025926 | Bacteria | 2626 |
| 367 | Ga0207659_10125442 | 3300025926 | Bacteria | 1973 |
| 368 | Ga0207659_10174260 | 3300025926 | Bacteria | 1699 |
| 369 | Ga0207687_10005324 | 3300025927 | Bacteria | 8521 |
| 370 | Ga0207687_10009758 | 3300025927 | Bacteria | 6280 |
| 371 | Ga0207687_10048229 | 3300025927 | Bacteria | 2956 |
| 372 | Ga0207687_10283889 | 3300025927 | Bacteria | 1328 |
| 373 | Ga0207700_10011354 | 3300025928 | Bacteria | 5673 |
| 374 | Ga0207700_10022238 | 3300025928 | Bacteria | 4347 |
| 375 | Ga0207700_10146230 | 3300025928 | Bacteria | 1948 |
| 376 | Ga0207700_10192090 | 3300025928 | Bacteria | 1716 |
| 377 | Ga0207700_10586713 | 3300025928 | Bacteria | 991 |
| 378 | Ga0207664_10047751 | 3300025929 | Bacteria | 3364 |
| 379 | Ga0207664_10122731 | 3300025929 | Bacteria | 2176 |
| 380 | Ga0207664_10169166 | 3300025929 | Bacteria | 1869 |
| 381 | Ga0207664_10181658 | 3300025929 | Bacteria | 1806 |
| 382 | Ga0207664_10292201 | 3300025929 | Bacteria | 1432 |
| 383 | Ga0207644_10027379 | 3300025931 | Bacteria | 3937 |
| 384 | Ga0207644_10043005 | 3300025931 | Bacteria | 3204 |
| 385 | Ga0207690_10023754 | 3300025932 | Bacteria | 3831 |
| 386 | Ga0207690_10040833 | 3300025932 | Bacteria | 3036 |
| 387 | Ga0207690_10069857 | 3300025932 | Bacteria | 2417 |
| 388 | Ga0207690_10107677 | 3300025932 | Bacteria | 2002 |
| 389 | Ga0207706_10017268 | 3300025933 | Bacteria | 6503 |
| 390 | Ga0207706_10111560 | 3300025933 | Bacteria | 2406 |
| 391 | Ga0207686_10057573 | 3300025934 | Bacteria | 2447 |
| 392 | Ga0207709_10025235 | 3300025935 | Bacteria | 3402 |
| 393 | Ga0207709_10065834 | 3300025935 | Bacteria | 2280 |
| 394 | Ga0207709_10105337 | 3300025935 | Bacteria | 1874 |
| 395 | Ga0207669_10011553 | 3300025937 | Bacteria | 4302 |
| 396 | Ga0207669_10058131 | 3300025937 | Bacteria | 2358 |
| 397 | Ga0207704_10007814 | 3300025938 | Bacteria | 5074 |
| 398 | Ga0207704_10010985 | 3300025938 | Bacteria | 4441 |
| 399 | Ga0207704_10029538 | 3300025938 | Bacteria | 3059 |
| 400 | Ga0207704_10112401 | 3300025938 | Bacteria | 1845 |
| 401 | Ga0207665_10071309 | 3300025939 | Bacteria | 2372 |
| 402 | Ga0207691_10018659 | 3300025940 | Bacteria | 6571 |
| 403 | Ga0207691_10019738 | 3300025940 | Bacteria | 6373 |
| 404 | Ga0207691_10059202 | 3300025940 | Bacteria | 3483 |
| 405 | Ga0207691_10062688 | 3300025940 | Bacteria | 3373 |
| 406 | Ga0207711_10220691 | 3300025941 | Bacteria | 1734 |
| 407 | Ga0207689_10079973 | 3300025942 | Bacteria | 2686 |
| 408 | Ga0207689_10088140 | 3300025942 | Bacteria | 2549 |
| 409 | Ga0207689_10101864 | 3300025942 | Bacteria | 2359 |
| 410 | Ga0207689_10183994 | 3300025942 | Bacteria | 1723 |
| 411 | Ga0207661_10007007 | 3300025944 | Bacteria | 7998 |
| 412 | Ga0207661_10011604 | 3300025944 | Bacteria | 6392 |
| 413 | Ga0207661_10013156 | 3300025944 | Bacteria | 6040 |
| 414 | Ga0207661_10071722 | 3300025944 | Bacteria | 2832 |
| 415 | Ga0207661_10103460 | 3300025944 | Bacteria | 2396 |
| 416 | Ga0207661_10163734 | 3300025944 | Bacteria | 1931 |
| 417 | Ga0207661_10215718 | 3300025944 | Bacteria | 1693 |
| 418 | Ga0207661_10324600 | 3300025944 | Bacteria | 1384 |
| 419 | Ga0207661_10385443 | 3300025944 | Bacteria | 1269 |
| 420 | Ga0207661_10390562 | 3300025944 | Bacteria | 1261 |
| 421 | Ga0207679_10015370 | 3300025945 | Bacteria | 5056 |
| 422 | Ga0207679_10090932 | 3300025945 | Bacteria | 2361 |
| 423 | Ga0207667_10085130 | 3300025949 | Bacteria | 3273 |
| 424 | Ga0207712_10018068 | 3300025961 | Bacteria | 4587 |
| 425 | Ga0207712_10214647 | 3300025961 | Bacteria | 1534 |
| 426 | Ga0207668_10078002 | 3300025972 | Bacteria | 2391 |
| 427 | Ga0207640_10120662 | 3300025981 | Bacteria | 1877 |
| 428 | Ga0207677_10039878 | 3300026023 | Bacteria | 3091 |
| 429 | Ga0207677_10099542 | 3300026023 | Bacteria | 2135 |
| 430 | Ga0207677_10245429 | 3300026023 | Bacteria | 1451 |
| 431 | Ga0207677_10273173 | 3300026023 | Bacteria | 1384 |
| 432 | Ga0207677_10493475 | 3300026023 | Bacteria | 1057 |
| 433 | Ga0207703_10081187 | 3300026035 | Bacteria | 2702 |
| 434 | Ga0207703_10100639 | 3300026035 | Bacteria | 2449 |
| 435 | Ga0207639_10089865 | 3300026041 | Bacteria | 2455 |
| 436 | Ga0207678_10000105 | 3300026067 | Bacteria | 68804 |
| 437 | Ga0207678_10041186 | 3300026067 | Bacteria | 4005 |
| 438 | Ga0207678_10109934 | 3300026067 | Bacteria | 2351 |
| 439 | Ga0207708_10000436 | 3300026075 | Bacteria | 32496 |
| 440 | Ga0207708_10001046 | 3300026075 | Bacteria | 20715 |
| 441 | Ga0207708_10004147 | 3300026075 | Bacteria | 10661 |
| 442 | Ga0207708_10004999 | 3300026075 | Bacteria | 9768 |
| 443 | Ga0207708_10057384 | 3300026075 | Bacteria | 2970 |
| 444 | Ga0207702_10062949 | 3300026078 | Bacteria | 3170 |
| 445 | Ga0207702_10068760 | 3300026078 | Bacteria | 3043 |
| 446 | Ga0207702_10496611 | 3300026078 | Bacteria | 1189 |
| 447 | Ga0207641_10055170 | 3300026088 | Bacteria | 3373 |
| 448 | Ga0207641_10100877 | 3300026088 | Bacteria | 2543 |
| 449 | Ga0207641_10371400 | 3300026088 | Bacteria | 1368 |
| 450 | Ga0207648_10003947 | 3300026089 | Bacteria | 15429 |
| 451 | Ga0207648_10004176 | 3300026089 | Bacteria | 14929 |
| 452 | Ga0207648_10057841 | 3300026089 | Bacteria | 3382 |
| 453 | Ga0207676_10002083 | 3300026095 | Bacteria | 14516 |
| 454 | Ga0207676_10016306 | 3300026095 | Bacteria | 5380 |
| 455 | Ga0207676_10503258 | 3300026095 | Bacteria | 1151 |
| 456 | Ga0207674_10019540 | 3300026116 | Bacteria | 7337 |
| 457 | Ga0207674_10042528 | 3300026116 | Bacteria | 4692 |
| 458 | Ga0207674_10120916 | 3300026116 | Bacteria | 2586 |
| 459 | Ga0207674_10135832 | 3300026116 | Bacteria | 2421 |
| 460 | Ga0207674_10305772 | 3300026116 | Bacteria | 1539 |
| 461 | Ga0207675_100004206 | 3300026118 | Bacteria | 13928 |
| 462 | Ga0207675_100004892 | 3300026118 | Bacteria | 12913 |
| 463 | Ga0207675_100082762 | 3300026118 | Bacteria | 3010 |
| 464 | Ga0207675_100526758 | 3300026118 | Bacteria | 1179 |
| 465 | Ga0207683_10021359 | 3300026121 | Bacteria | 5541 |
| 466 | Ga0207683_10043229 | 3300026121 | Bacteria | 3937 |
| 467 | Ga0207683_10053839 | 3300026121 | Bacteria | 3529 |
| 468 | Ga0207683_10098365 | 3300026121 | Bacteria | 2610 |
| 469 | Ga0207683_10308097 | 3300026121 | Bacteria | 1449 |
| 470 | Ga0207698_10129947 | 3300026142 | Bacteria | 2150 |
| 471 | Ga0207698_10176518 | 3300026142 | Bacteria | 1887 |
| 472 | Ga0207698_10239967 | 3300026142 | Bacteria | 1651 |
| 473 | Ga0209813_10003987 | 3300027866 | Bacteria | 3499 |
| 474 | Ga0209813_10004119 | 3300027866 | Bacteria | 3451 |
| 475 | Ga0209813_10007277 | 3300027866 | Bacteria | 2754 |
| 476 | Ga0209813_10061192 | 3300027866 | Bacteria | 1202 |
| 477 | Ga0207428_10030127 | 3300027907 | Bacteria | 4489 |
| 478 | Ga0207428_10051545 | 3300027907 | Bacteria | 3289 |
| 479 | Ga0207428_10335457 | 3300027907 | Bacteria | 1114 |
| 480 | Ga0268266_10051556 | 3300028379 | Bacteria | 3532 |
| 481 | Ga0268266_10111075 | 3300028379 | Bacteria | 2428 |
| 482 | Ga0268266_10144612 | 3300028379 | Bacteria | 2136 |
| 483 | Ga0268265_10179938 | 3300028380 | Bacteria | 1816 |
| 484 | Ga0268264_10000242 | 3300028381 | Bacteria | 103492 |
| 485 | Ga0268264_10001967 | 3300028381 | Bacteria | 18458 |
| 486 | Ga0268264_10004760 | 3300028381 | Bacteria | 11523 |
| 487 | Ga0268264_10039308 | 3300028381 | Bacteria | 3908 |
| 488 | Ga0265340_10000537 | 3300031247 | Bacteria | 20931 |
| 489 | Ga0307513_10015532 | 3300031456 | Bacteria | 9229 |
| 490 | Ga0307513_10092563 | 3300031456 | Bacteria | 3077 |
| 491 | Ga0307408_100407527 | 3300031548 | Bacteria | 1169 |
| 492 | Ga0307408_100427210 | 3300031548 | Bacteria | 1144 |
| 493 | Ga0316578_10001825 | 3300031728 | Bacteria | 8960 |
| 494 | Ga0307405_10142180 | 3300031731 | Bacteria | 1675 |
| 495 | Ga0307405_10245022 | 3300031731 | Bacteria | 1330 |
| 496 | Ga0307405_10350770 | 3300031731 | Bacteria | 1138 |
| 497 | Ga0307405_10360050 | 3300031731 | Bacteria | 1125 |
| 498 | Ga0307413_10041923 | 3300031824 | Bacteria | 2685 |
| 499 | Ga0307413_10057435 | 3300031824 | Bacteria | 2380 |
| 500 | Ga0307413_10139104 | 3300031824 | Bacteria | 1675 |
| 501 | Ga0307413_10149749 | 3300031824 | Bacteria | 1624 |
| 502 | Ga0307413_10170290 | 3300031824 | Bacteria | 1541 |
| 503 | Ga0307410_10006651 | 3300031852 | Bacteria | 6259 |
| 504 | Ga0307410_10010750 | 3300031852 | Bacteria | 5204 |
| 505 | Ga0307410_10018682 | 3300031852 | Bacteria | 4194 |
| 506 | Ga0307410_10087383 | 3300031852 | Bacteria | 2205 |
| 507 | Ga0307410_10116988 | 3300031852 | Bacteria | 1938 |
| 508 | Ga0307410_10250395 | 3300031852 | Bacteria | 1377 |
| 509 | Ga0307410_10342705 | 3300031852 | Bacteria | 1192 |
| 510 | Ga0307410_10388316 | 3300031852 | Bacteria | 1125 |
| 511 | Ga0307406_10031477 | 3300031901 | Bacteria | 3231 |
| 512 | Ga0307406_10048409 | 3300031901 | Bacteria | 2685 |
| 513 | Ga0307406_10084938 | 3300031901 | Bacteria | 2115 |
| 514 | Ga0307406_10104163 | 3300031901 | Bacteria | 1939 |
| 515 | Ga0307406_10145445 | 3300031901 | Bacteria | 1684 |
| 516 | Ga0307406_10221153 | 3300031901 | Bacteria | 1407 |
| 517 | Ga0307406_10288210 | 3300031901 | Bacteria | 1256 |
| 518 | Ga0307407_10004673 | 3300031903 | Bacteria | 5847 |
| 519 | Ga0307407_10010415 | 3300031903 | Bacteria | 4384 |
| 520 | Ga0307407_10015197 | 3300031903 | Bacteria | 3795 |
| 521 | Ga0307407_10016371 | 3300031903 | Bacteria | 3692 |
| 522 | Ga0307407_10017500 | 3300031903 | Bacteria | 3598 |
| 523 | Ga0307407_10062237 | 3300031903 | Bacteria | 2185 |
| 524 | Ga0307407_10244465 | 3300031903 | Bacteria | 1226 |
| 525 | Ga0307412_10345772 | 3300031911 | Bacteria | 1192 |
| 526 | Ga0307412_10498430 | 3300031911 | Bacteria | 1013 |
| 527 | Ga0307409_100009889 | 3300031995 | Bacteria | 5887 |
| 528 | Ga0307409_100011357 | 3300031995 | Bacteria | 5608 |
| 529 | Ga0307409_100016694 | 3300031995 | Bacteria | 4868 |
| 530 | Ga0307409_100030018 | 3300031995 | Bacteria | 3900 |
| 531 | Ga0307409_100034975 | 3300031995 | Bacteria | 3677 |
| 532 | Ga0307409_100038144 | 3300031995 | Bacteria | 3550 |
| 533 | Ga0307409_100046156 | 3300031995 | Bacteria | 3296 |
| 534 | Ga0307409_100060483 | 3300031995 | Bacteria | 2954 |
| 535 | Ga0307409_100063299 | 3300031995 | Bacteria | 2900 |
| 536 | Ga0307409_100071625 | 3300031995 | Bacteria | 2757 |
| 537 | Ga0307409_100097167 | 3300031995 | Bacteria | 2432 |
| 538 | Ga0307409_100108515 | 3300031995 | Bacteria | 2322 |
| 539 | Ga0307409_100128992 | 3300031995 | Bacteria | 2157 |
| 540 | Ga0307409_100151443 | 3300031995 | Bacteria | 2014 |
| 541 | Ga0307409_100215701 | 3300031995 | Bacteria | 1728 |
| 542 | Ga0307409_100240713 | 3300031995 | Bacteria | 1647 |
| 543 | Ga0307409_100254681 | 3300031995 | Bacteria | 1607 |
| 544 | Ga0307409_100329291 | 3300031995 | Bacteria | 1433 |
| 545 | Ga0307409_100437613 | 3300031995 | Bacteria | 1259 |
| 546 | Ga0307409_100440840 | 3300031995 | Bacteria | 1254 |
| 547 | Ga0307409_100492582 | 3300031995 | Bacteria | 1192 |
| 548 | Ga0307416_100002883 | 3300032002 | Bacteria | 10017 |
| 549 | Ga0307416_100002929 | 3300032002 | Bacteria | 9946 |
| 550 | Ga0307416_100012921 | 3300032002 | Bacteria | 5651 |
| 551 | Ga0307416_100048729 | 3300032002 | Bacteria | 3363 |
| 552 | Ga0307416_100051207 | 3300032002 | Bacteria | 3297 |
| 553 | Ga0307416_100065621 | 3300032002 | Bacteria | 2984 |
| 554 | Ga0307416_100102938 | 3300032002 | Bacteria | 2491 |
| 555 | Ga0307416_100186307 | 3300032002 | Bacteria | 1951 |
| 556 | Ga0307416_100299986 | 3300032002 | Bacteria | 1596 |
| 557 | Ga0307416_100395067 | 3300032002 | Bacteria | 1418 |
| 558 | Ga0307411_10068352 | 3300032005 | Bacteria | 2394 |
| 559 | Ga0307411_10076823 | 3300032005 | Bacteria | 2284 |
| 560 | Ga0307411_10095665 | 3300032005 | Bacteria | 2086 |
| 561 | Ga0307411_10221500 | 3300032005 | Bacteria | 1468 |
| 562 | Ga0307415_100007652 | 3300032126 | Bacteria | 5927 |
| 563 | Ga0307415_100009492 | 3300032126 | Bacteria | 5459 |
| 564 | Ga0307415_100021802 | 3300032126 | Bacteria | 3945 |
| 565 | Ga0307415_100026466 | 3300032126 | Bacteria | 3660 |
| 566 | Ga0307415_100038392 | 3300032126 | Bacteria | 3155 |
| 567 | Ga0307415_100089813 | 3300032126 | Bacteria | 2220 |
| 568 | Ga0307415_100089941 | 3300032126 | Bacteria | 2219 |
| 569 | Ga0307415_100107507 | 3300032126 | Bacteria | 2061 |
| 570 | Ga0307415_100118290 | 3300032126 | Bacteria | 1981 |
| 571 | Ga0307415_100283300 | 3300032126 | Bacteria | 1364 |
| 572 | Ga0307415_100620128 | 3300032126 | Bacteria | 965 |
| 573 | Ga0316583_10029656 | 3300032133 | Bacteria | 1950 |
| 574 | Ga0373938_0031409 | 3300034957 | Bacteria | 1139 |
| 575 | Ga0373926_0027830 | 3300035083 | Bacteria | 1982 |
| 576 | Ga0373934_0002754 | 3300035086 | Bacteria | 6447 |
| 577 | Ga0373944_0011334 | 3300035089 | Bacteria | 2441 |
| 578 | Ga0373923_0023500 | 3300035111 | Bacteria | 2425 |
| 579 | Ga0373923_0055474 | 3300035111 | Bacteria | 1670 |
| 580 | Ga0373936_0026431 | 3300035113 | Bacteria | 2272 |
| 581 | Ga0373936_0055578 | 3300035113 | Bacteria | 1607 |
| 582 | Ga0373945_0039542 | 3300035116 | Bacteria | 1700 |
| 583 | Ga0373953_0000821 | 3300035117 | Bacteria | 8685 |
| 584 | Ga0373954_0001563 | 3300035118 | Bacteria | 9326 |
| 585 | Ga0373956_0003221 | 3300035119 | Bacteria | 6590 |
| 586 | Ga0373957_0001428 | 3300035120 | Bacteria | 6465 |
| 587 | Ga0373943_0048468 | 3300035170 | Bacteria | 2081 |
| 588 | Ga0373946_0013175 | 3300035171 | Bacteria | 3103 |
| 589 | Ga0373955_0082888 | 3300035172 | Bacteria | 1815 |
| 590 | Ga0373955_0108511 | 3300035172 | Bacteria | 1602 |
| 591 | Ga0316574_0007917 | 3300035398 | Bacteria | 5865 |
| 592 | Ga0373924_0016500 | 3300035410 | Bacteria | 2819 |
| 593 | Ga0373927_0040940 | 3300035695 | Bacteria | 3005 |
| 594 | Ga0373933_0005000 | 3300035724 | Bacteria | 7231 |
| 595 | Ga0373947_0023550 | 3300035725 | Bacteria | 3583 |
| 596 | Ga0373947_0056553 | 3300035725 | Bacteria | 2371 |
| 597 | Ga0373937_0010654 | 3300036401 | Bacteria | 8037 |
| 598 | Ga0373937_0208215 | 3300036401 | Bacteria | 1839 |
| 599 | Ga0316584_0003766 | 3300036712 | Bacteria | 9935 |
| 600 | Ga0373925_0031453 | 3300037068 | Bacteria | 3900 |
| 601 | Ga0373925_0093661 | 3300037068 | Bacteria | 2299 |
| 602 | Ga0395900_0026320 | 3300037418 | Bacteria | 5957 |
| 603 | Ga0395900_0058762 | 3300037418 | Bacteria | 3959 |
| 604 | Ga0395898_0169591 | 3300037466 | Bacteria | 2086 |
| 605 | Ga0395905_0054291 | 3300037471 | Bacteria | 3750 |
| 606 | Ga0395905_0190772 | 3300037471 | Bacteria | 1922 |
| 607 | Ga0436364_0849504 | 3300037853 | Bacteria | 2397 |
| 608 | Ga0436364_1495084 | 3300037853 | Bacteria | 3514 |
| 609 | Ga0395901_0011948 | 3300038443 | Bacteria | 8806 |
| 610 | Ga0395901_0139889 | 3300038443 | Bacteria | 2544 |
| 611 | Ga0395901_0148039 | 3300038443 | Bacteria | 2467 |
| 612 | Ga0395901_0213971 | 3300038443 | Bacteria | 2016 |
| 613 | Ga0400483_021589 | 3300039062 | Bacteria | 5824 |
| 614 | Ga0400483_095912 | 3300039062 | Bacteria | 3768 |
| 615 | Ga0400483_209527 | 3300039062 | Bacteria | 2526 |
| 616 | Ga0436365_1063556 | 3300039437 | Bacteria | 1138 |
| 617 | Ga0436365_1544034 | 3300039437 | Bacteria | 1161 |
| 618 | Ga0451843_0051158 | 3300041509 | Bacteria | 1602 |
| 619 | Ga0439459_0030276 | 3300042438 | Bacteria | 1097 |
| 620 | Ga0466972_0176165 | 3300044658 | Bacteria | 1003 |
| 621 | Ga0466965_0000459 | 3300044683 | Bacteria | 14372 |
| 622 | Ga0466965_0004751 | 3300044683 | Bacteria | 6056 |
| 623 | Ga0466965_0012067 | 3300044683 | Bacteria | 4057 |
| 624 | Ga0466965_0025243 | 3300044683 | Bacteria | 2877 |
| 625 | Ga0466965_0048241 | 3300044683 | Bacteria | 2110 |
| 626 | Ga0466965_0069717 | 3300044683 | Bacteria | 1767 |
| 627 | Ga0466965_0093393 | 3300044683 | Bacteria | 1532 |
| 628 | Ga0466961_0035163 | 3300044693 | Bacteria | 3217 |
| 629 | Ga0466961_0109053 | 3300044693 | Bacteria | 1742 |
| 630 | Ga0466963_0038739 | 3300044694 | Bacteria | 3119 |
| 631 | Ga0466963_0069680 | 3300044694 | Bacteria | 2364 |
| 632 | Ga0466964_0031608 | 3300044706 | Bacteria | 2100 |
| 633 | Ga0466964_0048533 | 3300044706 | Bacteria | 1736 |
| 634 | Ga0466964_0054265 | 3300044706 | Bacteria | 1652 |
| 635 | Ga0466970_0012324 | 3300044765 | Bacteria | 4369 |
| 636 | Ga0466970_0015359 | 3300044765 | Bacteria | 3936 |
| 637 | Ga0466970_0018226 | 3300044765 | Bacteria | 3632 |
| 638 | Ga0466970_0033313 | 3300044765 | Bacteria | 2723 |
| 639 | Ga0466970_0098294 | 3300044765 | Bacteria | 1593 |
| 640 | Ga0466957_0001115 | 3300044842 | Bacteria | 13906 |
| 641 | Ga0466957_0084176 | 3300044842 | Bacteria | 1985 |
| 642 | Ga0466957_0096568 | 3300044842 | Bacteria | 1857 |
| 643 | Ga0466960_0000350 | 3300044901 | Bacteria | 15766 |
| 644 | Ga0466960_0006974 | 3300044901 | Bacteria | 4563 |
| 645 | Ga0466960_0008191 | 3300044901 | Bacteria | 4272 |
| 646 | Ga0466960_0016237 | 3300044901 | Bacteria | 3225 |
| 647 | Ga0466960_0023651 | 3300044901 | Bacteria | 2761 |
| 648 | Ga0466960_0047414 | 3300044901 | Bacteria | 2061 |
| 649 | Ga0466960_0054466 | 3300044901 | Bacteria | 1942 |
| 650 | Ga0466960_0098125 | 3300044901 | Bacteria | 1504 |
| 651 | Ga0451576_0414424 | 3300045051 | Bacteria | 1413 |
| 652 | Ga0466958_0042983 | 3300045836 | Bacteria | 2721 |
| 653 | Ga0466958_0094123 | 3300045836 | Bacteria | 1856 |
| 654 | Ga0466967_0003975 | 3300045976 | Bacteria | 9844 |
| 655 | Ga0466967_0065708 | 3300045976 | Bacteria | 3229 |
| 656 | Ga0466967_0073531 | 3300045976 | Bacteria | 3067 |
| 657 | Ga0466967_0095098 | 3300045976 | Bacteria | 2715 |
| 658 | Ga0466967_0119523 | 3300045976 | Bacteria | 2432 |
| 659 | Ga0466967_0143725 | 3300045976 | Bacteria | 2224 |
| 660 | Ga0466967_0153107 | 3300045976 | Bacteria | 2157 |
| 661 | Ga0466967_0159795 | 3300045976 | Bacteria | 2114 |
| 662 | Ga0466967_0170963 | 3300045976 | Bacteria | 2044 |
| 663 | Ga0466967_0183525 | 3300045976 | Bacteria | 1974 |
| 664 | Ga0466967_0244570 | 3300045976 | Bacteria | 1712 |
| 665 | Ga0466967_0252036 | 3300045976 | Bacteria | 1686 |
| 666 | Ga0466967_0495608 | 3300045976 | Bacteria | 1198 |
| 667 | Ga0495592_0000397 | 3300046454 | Bacteria | 33962 |
| 668 | Ga0495592_0008095 | 3300046454 | Bacteria | 7893 |
| 669 | Ga0495603_0095528 | 3300046455 | Bacteria | 1737 |
| 670 | Ga0495629_0107549 | 3300046459 | Bacteria | 1945 |
| 671 | Ga0495629_0161015 | 3300046459 | Bacteria | 1559 |
| 672 | Ga0495641_0051291 | 3300046461 | Bacteria | 1884 |
| 673 | Ga0495641_0057979 | 3300046461 | Bacteria | 1753 |
| 674 | Ga0495641_0080767 | 3300046461 | Bacteria | 1457 |
| 675 | Ga0495651_0126575 | 3300046462 | Bacteria | 1870 |
| 676 | Ga0495651_0126576 | 3300046462 | Bacteria | 1870 |
| 677 | Ga0495653_0120545 | 3300046463 | Bacteria | 1870 |
| 678 | Ga0495653_0165079 | 3300046463 | Bacteria | 1534 |
| 679 | Ga0495582_0079567 | 3300046473 | Bacteria | 1819 |
| 680 | Ga0495664_0007931 | 3300046477 | Bacteria | 5911 |
| 681 | Ga0495664_0087709 | 3300046477 | Bacteria | 1869 |
| 682 | Ga0495608_0089230 | 3300046511 | Bacteria | 1995 |
| 683 | Ga0495608_0089231 | 3300046511 | Bacteria | 1995 |
| 684 | Ga0495608_0105594 | 3300046511 | Bacteria | 1813 |
| 685 | Ga0495618_0009751 | 3300046514 | Bacteria | 5802 |
| 686 | Ga0495628_0005043 | 3300046516 | Bacteria | 11605 |
| 687 | Ga0495628_0122322 | 3300046516 | Bacteria | 1995 |
| 688 | Ga0495630_0055169 | 3300046517 | Bacteria | 2977 |
| 689 | Ga0495630_0152328 | 3300046517 | Bacteria | 1759 |
| 690 | Ga0495652_0002110 | 3300046529 | Bacteria | 20949 |
| 691 | Ga0495652_0049416 | 3300046529 | Bacteria | 3601 |
| 692 | Ga0495652_0108948 | 3300046529 | Bacteria | 2231 |
| 693 | Ga0495665_0093433 | 3300046531 | Bacteria | 1580 |
| 694 | Ga0495640_0067173 | 3300046533 | Bacteria | 2415 |
| 695 | Ga0495586_0015106 | 3300046535 | Bacteria | 4108 |
| 696 | Ga0495587_0029133 | 3300046536 | Bacteria | 3353 |
| 697 | Ga0495587_0099998 | 3300046536 | Bacteria | 1671 |
| 698 | Ga0495645_0003234 | 3300046543 | Bacteria | 11048 |
| 699 | Ga0495645_0010242 | 3300046543 | Bacteria | 6569 |
| 700 | Ga0495667_0011880 | 3300046559 | Bacteria | 5898 |
| 701 | Ga0495667_0114499 | 3300046559 | Bacteria | 1742 |
| 702 | Ga0495634_0021736 | 3300046642 | Bacteria | 4529 |
| 703 | Ga0495635_0074934 | 3300046663 | Bacteria | 2318 |
| 704 | Ga0495635_0111827 | 3300046663 | Bacteria | 1865 |
| 705 | Ga0495657_0192128 | 3300046675 | Bacteria | 1247 |
| 706 | Ga0495599_0017017 | 3300046678 | Bacteria | 4516 |
| 707 | Ga0495599_0084661 | 3300046678 | Bacteria | 1980 |
| 708 | Ga0495623_0019997 | 3300046679 | Bacteria | 4328 |
| 709 | Ga0495623_0100901 | 3300046679 | Bacteria | 1758 |
| 710 | Ga0495646_0002659 | 3300046680 | Bacteria | 11047 |
| 711 | Ga0495646_0004480 | 3300046680 | Bacteria | 8799 |
| 712 | Ga0495658_0086658 | 3300046683 | Bacteria | 1848 |
| 713 | Ga0495613_0039703 | 3300046689 | Bacteria | 3489 |
| 714 | Ga0495624_0137472 | 3300046690 | Bacteria | 1497 |
| 715 | Ga0495600_0009608 | 3300046809 | Bacteria | 5979 |
| 716 | Ga0495600_0056669 | 3300046809 | Bacteria | 2560 |
| 717 | Ga0495604_0004132 | 3300047317 | Bacteria | 11524 |
| 718 | Ga0495604_0042757 | 3300047317 | Bacteria | 3549 |
| 719 | Ga0495674_0088829 | 3300047319 | Bacteria | 2642 |
| 720 | Ga0495676_0085788 | 3300047321 | Bacteria | 2371 |
| 721 | Ga0495676_0124145 | 3300047321 | Bacteria | 1873 |
| 722 | Ga0495680_0001602 | 3300047322 | Bacteria | 24122 |
| 723 | Ga0495680_0096739 | 3300047322 | Bacteria | 2204 |
| 724 | Ga0495680_0120073 | 3300047322 | Bacteria | 1941 |
| 725 | Ga0495675_0034575 | 3300047444 | Bacteria | 3226 |
| 726 | Ga0495675_0225124 | 3300047444 | Bacteria | 1133 |
| 727 | Ga0495684_0000603 | 3300047471 | Bacteria | 28888 |
| 728 | Ga0495684_0138994 | 3300047471 | Bacteria | 1821 |
| 729 | Ga0495602_0017251 | 3300048088 | Bacteria | 7239 |
| 730 | Ga0495602_0018432 | 3300048088 | Bacteria | 6970 |
| 731 | Ga0496100_0003839 | 3300048903 | Bacteria | 7879 |
| 732 | Ga0496100_0032129 | 3300048903 | Bacteria | 3269 |
| 733 | Ga0496100_0252908 | 3300048903 | Bacteria | 1304 |
| 734 | Ga0496101_0013820 | 3300048904 | Bacteria | 5419 |
| 735 | Ga0496101_0134755 | 3300048904 | Bacteria | 1878 |
| 736 | Ga0496102_0002619 | 3300048905 | Bacteria | 15298 |
| 737 | Ga0496102_0008782 | 3300048905 | Bacteria | 8665 |
| 738 | Ga0496102_0013364 | 3300048905 | Bacteria | 7111 |
| 739 | Ga0496102_0015121 | 3300048905 | Bacteria | 6719 |
| 740 | Ga0496102_0033772 | 3300048905 | Bacteria | 4600 |
| 741 | Ga0496102_0051165 | 3300048905 | Bacteria | 3763 |
| 742 | Ga0496102_0079766 | 3300048905 | Bacteria | 3014 |
| 743 | Ga0496102_0136298 | 3300048905 | Bacteria | 2300 |
| 744 | Ga0496102_0154518 | 3300048905 | Bacteria | 2157 |
| 745 | Ga0496102_0177590 | 3300048905 | Bacteria | 2005 |
| 746 | Ga0496102_0601730 | 3300048905 | Bacteria | 1022 |
| 747 | Ga0496103_0009545 | 3300048906 | Bacteria | 5745 |
| 748 | Ga0496103_0018415 | 3300048906 | Bacteria | 4189 |
| 749 | Ga0496103_0048923 | 3300048906 | Bacteria | 2613 |
| 750 | Ga0496103_0085930 | 3300048906 | Bacteria | 1982 |
| 751 | Ga0496103_0160825 | 3300048906 | Bacteria | 1440 |
| 752 | Ga0496103_0246457 | 3300048906 | Bacteria | 1150 |
| 753 | Ga0496104_0030323 | 3300048907 | Bacteria | 5024 |
| 754 | Ga0496104_0072786 | 3300048907 | Bacteria | 3268 |
| 755 | Ga0496104_0103668 | 3300048907 | Bacteria | 2725 |
| 756 | Ga0496104_0222010 | 3300048907 | Bacteria | 1802 |
| 757 | Ga0496104_0234198 | 3300048907 | Bacteria | 1748 |
| 758 | Ga0496104_0260922 | 3300048907 | Bacteria | 1645 |
| 759 | Ga0496105_0004639 | 3300048908 | Bacteria | 10358 |
| 760 | Ga0496105_0010601 | 3300048908 | Bacteria | 7251 |
| 761 | Ga0496105_0013044 | 3300048908 | Bacteria | 6586 |
| 762 | Ga0496105_0046910 | 3300048908 | Bacteria | 3566 |
| 763 | Ga0496105_0071322 | 3300048908 | Bacteria | 2871 |
| 764 | Ga0496105_0112375 | 3300048908 | Bacteria | 2248 |
| 765 | Ga0496105_0134554 | 3300048908 | Bacteria | 2037 |
| 766 | Ga0496105_0151400 | 3300048908 | Bacteria | 1906 |
| 767 | Ga0496105_0163927 | 3300048908 | Bacteria | 1824 |
| 768 | Ga0496105_0233606 | 3300048908 | Bacteria | 1494 |
| 769 | Ga0496105_0465742 | 3300048908 | Bacteria | 996 |
| 770 | Ga0496106_0055833 | 3300048909 | Bacteria | 2985 |
| 771 | Ga0496107_0028957 | 3300048910 | Bacteria | 3938 |
| 772 | Ga0496107_0038148 | 3300048910 | Bacteria | 3447 |
| 773 | Ga0496107_0071877 | 3300048910 | Bacteria | 2514 |
| 774 | Ga0496107_0130879 | 3300048910 | Bacteria | 1852 |
| 775 | Ga0496107_0144379 | 3300048910 | Bacteria | 1759 |
| 776 | Ga0496107_0264463 | 3300048910 | Bacteria | 1280 |
| 777 | Ga0496107_0317528 | 3300048910 | Bacteria | 1159 |
| 778 | Ga0496107_0438783 | 3300048910 | Bacteria | 970 |
| 779 | Ga0496107_0487344 | 3300048910 | Bacteria | 915 |
| 780 | Ga0496108_0008499 | 3300048911 | Bacteria | 8329 |
| 781 | Ga0496108_0019824 | 3300048911 | Bacteria | 5526 |
| 782 | Ga0496108_0055934 | 3300048911 | Bacteria | 3314 |
| 783 | Ga0496108_0057158 | 3300048911 | Bacteria | 3278 |
| 784 | Ga0496108_0170747 | 3300048911 | Bacteria | 1881 |
| 785 | Ga0496108_0251142 | 3300048911 | Bacteria | 1539 |
| 786 | Ga0496108_0279324 | 3300048911 | Bacteria | 1454 |
| 787 | Ga0496108_0327330 | 3300048911 | Bacteria | 1336 |
| 788 | Ga0496109_0014295 | 3300048912 | Bacteria | 6907 |
| 789 | Ga0496109_0015913 | 3300048912 | Bacteria | 6569 |
| 790 | Ga0496109_0058785 | 3300048912 | Bacteria | 3512 |
| 791 | Ga0496109_0061158 | 3300048912 | Bacteria | 3442 |
| 792 | Ga0496109_0088079 | 3300048912 | Bacteria | 2868 |
| 793 | Ga0496109_0095372 | 3300048912 | Bacteria | 2754 |
| 794 | Ga0496109_0195072 | 3300048912 | Bacteria | 1903 |
| 795 | Ga0496109_0195396 | 3300048912 | Bacteria | 1901 |
| 796 | Ga0496109_0214230 | 3300048912 | Bacteria | 1811 |
| 797 | Ga0496109_0224563 | 3300048912 | Bacteria | 1767 |
| 798 | Ga0496109_0242584 | 3300048912 | Bacteria | 1696 |
| 799 | Ga0496109_0550688 | 3300048912 | Bacteria | 1088 |
| 800 | Ga0496109_0583580 | 3300048912 | Bacteria | 1053 |
| 801 | Ga0496110_0006612 | 3300048913 | Bacteria | 9209 |
| 802 | Ga0496110_0012958 | 3300048913 | Bacteria | 6875 |
| 803 | Ga0496110_0022918 | 3300048913 | Bacteria | 5306 |
| 804 | Ga0496110_0079099 | 3300048913 | Bacteria | 2927 |
| 805 | Ga0496110_0082241 | 3300048913 | Bacteria | 2872 |
| 806 | Ga0496110_0083440 | 3300048913 | Bacteria | 2851 |
| 807 | Ga0496110_0088856 | 3300048913 | Bacteria | 2760 |
| 808 | Ga0496110_0138698 | 3300048913 | Bacteria | 2198 |
| 809 | Ga0496110_0296797 | 3300048913 | Bacteria | 1472 |
| 810 | Ga0496110_0310798 | 3300048913 | Bacteria | 1435 |
| 811 | Ga0496110_0369646 | 3300048913 | Bacteria | 1307 |
| 812 | Ga0496111_0000863 | 3300048914 | Bacteria | 16436 |
| 813 | Ga0496111_0012659 | 3300048914 | Bacteria | 5717 |
| 814 | Ga0496112_0154324 | 3300048915 | Bacteria | 2263 |
| 815 | Ga0496112_0206213 | 3300048915 | Bacteria | 1924 |
| 816 | Ga0496112_0639119 | 3300048915 | Bacteria | 994 |
| 817 | Ga0496113_0036543 | 3300048916 | Bacteria | 3599 |
| 818 | Ga0496113_0038091 | 3300048916 | Bacteria | 3533 |
| 819 | Ga0496113_0358369 | 3300048916 | Bacteria | 1170 |
| 820 | Ga0496114_0002152 | 3300048917 | Bacteria | 14991 |
| 821 | Ga0496114_0003522 | 3300048917 | Bacteria | 12014 |
| 822 | Ga0496114_0005765 | 3300048917 | Bacteria | 9725 |
| 823 | Ga0496114_0008014 | 3300048917 | Bacteria | 8359 |
| 824 | Ga0496114_0033141 | 3300048917 | Bacteria | 4255 |
| 825 | Ga0496114_0074275 | 3300048917 | Bacteria | 2862 |
| 826 | Ga0496114_0090983 | 3300048917 | Bacteria | 2590 |
| 827 | Ga0496114_0107067 | 3300048917 | Bacteria | 2392 |
| 828 | Ga0496114_0160447 | 3300048917 | Bacteria | 1954 |
| 829 | Ga0496114_0216338 | 3300048917 | Bacteria | 1681 |
| 830 | Ga0496114_0303922 | 3300048917 | Bacteria | 1408 |
| 831 | Ga0496114_0353064 | 3300048917 | Bacteria | 1301 |
| 832 | Ga0496114_0463582 | 3300048917 | Bacteria | 1121 |
| 833 | Ga0496115_0029443 | 3300048918 | Bacteria | 4312 |
| 834 | Ga0496115_0091212 | 3300048918 | Bacteria | 2490 |
| 835 | Ga0496118_0173804 | 3300048921 | Bacteria | 1312 |
| 836 | Ga0496119_0014608 | 3300048922 | Bacteria | 6124 |
| 837 | Ga0496120_0006161 | 3300048923 | Bacteria | 9285 |
| 838 | Ga0496121_0035843 | 3300048924 | Bacteria | 4434 |
| 839 | Ga0496121_0169453 | 3300048924 | Bacteria | 1588 |
| 840 | Ga0496123_0078694 | 3300048926 | Bacteria | 2018 |
| 841 | Ga0496124_0228974 | 3300048927 | Bacteria | 1391 |
| 842 | Ga0496126_0000039 | 3300048929 | Bacteria | 347353 |
| 843 | Ga0501309_002015 | 3300049129 | Bacteria | 2123 |
| 844 | Ga0501291_020713 | 3300049514 | Bacteria | 1043 |
| 845 | Ga0501298_023437 | 3300049521 | Bacteria | 1170 |
| 846 | Ga0501031_0001569 | 3300049568 | Bacteria | 14236 |
| 847 | Ga0501031_0019479 | 3300049568 | Bacteria | 4421 |
| 848 | Ga0501031_0056192 | 3300049568 | Bacteria | 2564 |
| 849 | Ga0501031_0060482 | 3300049568 | Bacteria | 2468 |
| 850 | Ga0501031_0091406 | 3300049568 | Bacteria | 1985 |
| 851 | Ga0501031_0104827 | 3300049568 | Bacteria | 1845 |
| 852 | Ga0501032_0059829 | 3300049569 | Bacteria | 2556 |
| 853 | Ga0501032_0066357 | 3300049569 | Bacteria | 2411 |
| 854 | Ga0501032_0077745 | 3300049569 | Bacteria | 2209 |
| 855 | Ga0501033_0003386 | 3300049570 | Bacteria | 13153 |
| 856 | Ga0501034_0051347 | 3300049571 | Bacteria | 4158 |
| 857 | Ga0501034_0054748 | 3300049571 | Bacteria | 4016 |
| 858 | Ga0501034_0064361 | 3300049571 | Bacteria | 3681 |
| 859 | Ga0501036_0001694 | 3300049572 | Bacteria | 17122 |
| 860 | Ga0501036_0006122 | 3300049572 | Bacteria | 9765 |
| 861 | Ga0501036_0017266 | 3300049572 | Bacteria | 6031 |
| 862 | Ga0501036_0033743 | 3300049572 | Bacteria | 4328 |
| 863 | Ga0501036_0072369 | 3300049572 | Bacteria | 2914 |
| 864 | Ga0501036_0121489 | 3300049572 | Bacteria | 2206 |
| 865 | Ga0501036_0207628 | 3300049572 | Bacteria | 1646 |
| 866 | Ga0501037_0023454 | 3300049573 | Bacteria | 4562 |
| 867 | Ga0501037_0087179 | 3300049573 | Bacteria | 2259 |
| 868 | Ga0501037_0091380 | 3300049573 | Bacteria | 2201 |
| 869 | Ga0501037_0105898 | 3300049573 | Bacteria | 2027 |
| 870 | Ga0501037_0114203 | 3300049573 | Bacteria | 1944 |
| 871 | Ga0501038_0004008 | 3300049574 | Bacteria | 13683 |
| 872 | Ga0501038_0013769 | 3300049574 | Bacteria | 7371 |
| 873 | Ga0501039_0007037 | 3300049575 | Bacteria | 8560 |
| 874 | Ga0501040_0001709 | 3300049576 | Bacteria | 14063 |
| 875 | Ga0501040_0011354 | 3300049576 | Bacteria | 5830 |
| 876 | Ga0501040_0054839 | 3300049576 | Bacteria | 2733 |
| 877 | Ga0501040_0232480 | 3300049576 | Bacteria | 1313 |
| 878 | Ga0501040_0357141 | 3300049576 | Bacteria | 1047 |
| 879 | Ga0501041_0021998 | 3300049577 | Bacteria | 3818 |
| 880 | Ga0501041_0069015 | 3300049577 | Bacteria | 2167 |
| 881 | Ga0501041_0140093 | 3300049577 | Bacteria | 1508 |
| 882 | Ga0501042_0003027 | 3300049578 | Bacteria | 10455 |
| 883 | Ga0501042_0006792 | 3300049578 | Bacteria | 7460 |
| 884 | Ga0501042_0046751 | 3300049578 | Bacteria | 3085 |
| 885 | Ga0501043_0134861 | 3300049579 | Bacteria | 1934 |
| 886 | Ga0501046_0010342 | 3300049580 | Bacteria | 8021 |
| 887 | Ga0501046_0057893 | 3300049580 | Bacteria | 3039 |
| 888 | Ga0501046_0073585 | 3300049580 | Bacteria | 2651 |
| 889 | Ga0501047_0033893 | 3300049581 | Bacteria | 4928 |
| 890 | Ga0501048_0007035 | 3300049582 | Bacteria | 8544 |
| 891 | Ga0501048_0040541 | 3300049582 | Bacteria | 3336 |
| 892 | Ga0501067_0004112 | 3300049583 | Bacteria | 8022 |
| 893 | Ga0501067_0009441 | 3300049583 | Bacteria | 5406 |
| 894 | Ga0501067_0060698 | 3300049583 | Bacteria | 2093 |
| 895 | Ga0501067_0104913 | 3300049583 | Bacteria | 1570 |
| 896 | Ga0501067_0166254 | 3300049583 | Bacteria | 1228 |
| 897 | Ga0501068_0056147 | 3300049584 | Bacteria | 2387 |
| 898 | Ga0501068_0130005 | 3300049584 | Bacteria | 1574 |
| 899 | Ga0501069_0004130 | 3300049585 | Bacteria | 7498 |
| 900 | Ga0501069_0007837 | 3300049585 | Bacteria | 5607 |
| 901 | Ga0501069_0009384 | 3300049585 | Bacteria | 5165 |
| 902 | Ga0501069_0017089 | 3300049585 | Bacteria | 3901 |
| 903 | Ga0501069_0035271 | 3300049585 | Bacteria | 2755 |
| 904 | Ga0501069_0095019 | 3300049585 | Bacteria | 1688 |
| 905 | Ga0501069_0137160 | 3300049585 | Bacteria | 1402 |
| 906 | Ga0501070_0003855 | 3300049586 | Bacteria | 12939 |
| 907 | Ga0501070_0004279 | 3300049586 | Bacteria | 12279 |
| 908 | Ga0501070_0021270 | 3300049586 | Bacteria | 5444 |
| 909 | Ga0501070_0032937 | 3300049586 | Bacteria | 4335 |
| 910 | Ga0501070_0035442 | 3300049586 | Bacteria | 4169 |
| 911 | Ga0501070_0042917 | 3300049586 | Bacteria | 3765 |
| 912 | Ga0501070_0097933 | 3300049586 | Bacteria | 2426 |
| 913 | Ga0501070_0222332 | 3300049586 | Bacteria | 1548 |
| 914 | Ga0501070_0442156 | 3300049586 | Bacteria | 1049 |
| 915 | Ga0501071_0005666 | 3300049587 | Bacteria | 8054 |
| 916 | Ga0501071_0005962 | 3300049587 | Bacteria | 7890 |
| 917 | Ga0501071_0053300 | 3300049587 | Bacteria | 2917 |
| 918 | Ga0501071_0222462 | 3300049587 | Bacteria | 1421 |
| 919 | Ga0501072_0006084 | 3300049588 | Bacteria | 9211 |
| 920 | Ga0501072_0009890 | 3300049588 | Bacteria | 7253 |
| 921 | Ga0501072_0035834 | 3300049588 | Bacteria | 3888 |
| 922 | Ga0501072_0052339 | 3300049588 | Bacteria | 3215 |
| 923 | Ga0501072_0054608 | 3300049588 | Bacteria | 3147 |
| 924 | Ga0501072_0070974 | 3300049588 | Bacteria | 2751 |
| 925 | Ga0501072_0082701 | 3300049588 | Bacteria | 2545 |
| 926 | Ga0501072_0111824 | 3300049588 | Bacteria | 2174 |
| 927 | Ga0501073_0004693 | 3300049589 | Bacteria | 10261 |
| 928 | Ga0501073_0019457 | 3300049589 | Bacteria | 4901 |
| 929 | Ga0501073_0056459 | 3300049589 | Bacteria | 2746 |
| 930 | Ga0501073_0063282 | 3300049589 | Bacteria | 2581 |
| 931 | Ga0501073_0251170 | 3300049589 | Bacteria | 1221 |
| 932 | Ga0501073_0454919 | 3300049589 | Bacteria | 885 |
| 933 | Ga0501074_0007589 | 3300049590 | Bacteria | 7849 |
| 934 | Ga0501074_0008026 | 3300049590 | Bacteria | 7644 |
| 935 | Ga0501074_0016168 | 3300049590 | Bacteria | 5422 |
| 936 | Ga0501074_0035660 | 3300049590 | Bacteria | 3604 |
| 937 | Ga0501074_0049798 | 3300049590 | Bacteria | 3024 |
| 938 | Ga0501074_0093115 | 3300049590 | Bacteria | 2158 |
| 939 | Ga0501074_0106098 | 3300049590 | Bacteria | 2011 |
| 940 | Ga0501074_0108479 | 3300049590 | Bacteria | 1987 |
| 941 | Ga0501075_0009610 | 3300049591 | Bacteria | 6769 |
| 942 | Ga0501075_0067091 | 3300049591 | Bacteria | 2709 |
| 943 | Ga0501075_0138846 | 3300049591 | Bacteria | 1851 |
| 944 | Ga0501076_0011478 | 3300049592 | Bacteria | 6600 |
| 945 | Ga0501076_0049489 | 3300049592 | Bacteria | 3324 |
| 946 | Ga0501076_0086503 | 3300049592 | Bacteria | 2519 |
| 947 | Ga0501076_0086562 | 3300049592 | Bacteria | 2519 |
| 948 | Ga0501077_0007878 | 3300049593 | Bacteria | 6579 |
| 949 | Ga0501077_0009576 | 3300049593 | Bacteria | 6023 |
| 950 | Ga0501077_0011162 | 3300049593 | Bacteria | 5604 |
| 951 | Ga0501077_0022311 | 3300049593 | Bacteria | 4009 |
| 952 | Ga0501079_0058312 | 3300049741 | Bacteria | 2979 |
| 953 | Ga0501079_0079143 | 3300049741 | Bacteria | 2542 |
| 954 | Ga0501079_0093028 | 3300049741 | Bacteria | 2336 |
| 955 | Ga0501080_0000857 | 3300049742 | Bacteria | 24883 |
| 956 | Ga0501080_0013574 | 3300049742 | Bacteria | 7500 |
| 957 | Ga0501080_0029465 | 3300049742 | Bacteria | 5110 |
| 958 | Ga0501080_0039249 | 3300049742 | Bacteria | 4419 |
| 959 | Ga0501080_0157491 | 3300049742 | Bacteria | 2098 |
| 960 | Ga0501080_0292281 | 3300049742 | Bacteria | 1479 |
| 961 | Ga0501081_0017918 | 3300049743 | Bacteria | 4697 |
| 962 | Ga0501081_0329002 | 3300049743 | Bacteria | 1124 |
| 963 | Ga0501083_0020109 | 3300049744 | Bacteria | 4645 |
| 964 | Ga0501083_0112653 | 3300049744 | Bacteria | 1788 |
| 965 | Ga0501035_0021194 | 3300049822 | Bacteria | 5973 |
| 966 | Ga0501035_0032558 | 3300049822 | Bacteria | 4742 |
| 967 | Ga0501044_0040033 | 3300049823 | Bacteria | 4886 |
| 968 | Ga0501045_0002747 | 3300049824 | Bacteria | 12022 |
| 969 | Ga0501045_0019867 | 3300049824 | Bacteria | 4795 |
| 970 | Ga0501045_0070494 | 3300049824 | Bacteria | 2572 |
| 971 | Ga0501045_0074104 | 3300049824 | Bacteria | 2507 |
| 972 | Ga0501045_0114517 | 3300049824 | Bacteria | 2000 |
| 973 | Ga0501045_0134072 | 3300049824 | Bacteria | 1841 |
| 974 | Ga0501045_0380013 | 3300049824 | Bacteria | 1051 |
| 975 | nmdc:mga03683_108033_c1 | 3300050489 | Bacteria | 1228 |
| 976 | nmdc:mga03n38_131271_c1 | 3300050490 | Bacteria | 1242 |
| 977 | nmdc:mga03n38_15364_c1 | 3300050490 | Bacteria | 2955 |
| 978 | nmdc:mga03n38_1536_c1 | 3300050490 | Bacteria | 6688 |
| 979 | nmdc:mga03n38_16936_c1 | 3300050490 | Bacteria | 2845 |
| 980 | nmdc:mga03n38_31013_c1 | 3300050490 | Bacteria | 2252 |
| 981 | nmdc:mga03n38_51853_c1 | 3300050490 | Bacteria | 1834 |
| 982 | nmdc:mga03n38_87017_c1 | 3300050490 | Bacteria | 1480 |
| 983 | nmdc:mga03n38_92194_c1 | 3300050490 | Bacteria | 1445 |
| 984 | nmdc:mga03n38_92387_c1 | 3300050490 | Bacteria | 1443 |
| 985 | nmdc:mga03n38_9497_c1 | 3300050490 | Bacteria | 3543 |
| 986 | nmdc:mga00v17_101428_c1 | 3300050491 | Bacteria | 1817 |
| 987 | nmdc:mga00v17_12728_c1 | 3300050491 | Bacteria | 4647 |
| 988 | nmdc:mga00v17_13995_c1 | 3300050491 | Bacteria | 4468 |
| 989 | nmdc:mga00v17_167026_c1 | 3300050491 | Bacteria | 1418 |
| 990 | nmdc:mga00v17_18892_c1 | 3300050491 | Bacteria | 3924 |
| 991 | nmdc:mga00v17_199295_c1 | 3300050491 | Bacteria | 1294 |
| 992 | nmdc:mga00v17_22363_c1 | 3300050491 | Bacteria | 3648 |
| 993 | nmdc:mga00v17_30291_c1 | 3300050491 | Bacteria | 3183 |
| 994 | nmdc:mga00v17_32669_c1 | 3300050491 | Bacteria | 3078 |
| 995 | nmdc:mga00v17_49842_c1 | 3300050491 | Bacteria | 2542 |
| 996 | nmdc:mga00v17_89878_c1 | 3300050491 | Bacteria | 1927 |
| 997 | nmdc:mga0yw44_100306_c1 | 3300050492 | Bacteria | 1843 |
| 998 | nmdc:mga0yw44_105970_c1 | 3300050492 | Bacteria | 1796 |
| 999 | nmdc:mga0yw44_119425_c1 | 3300050492 | Bacteria | 1697 |
| 1000 | nmdc:mga0yw44_146689_c1 | 3300050492 | Bacteria | 1537 |
| 1001 | nmdc:mga0yw44_18098_c1 | 3300050492 | Bacteria | 3852 |
| 1002 | nmdc:mga0yw44_18114_c1 | 3300050492 | Bacteria | 3850 |
| 1003 | nmdc:mga0yw44_36814_c1 | 3300050492 | Bacteria | 2886 |
| 1004 | nmdc:mga0yw44_38807_c1 | 3300050492 | Bacteria | 2820 |
| 1005 | nmdc:mga0yw44_51998_c1 | 3300050492 | Bacteria | 2483 |
| 1006 | nmdc:mga0yw44_56569_c1 | 3300050492 | Bacteria | 2390 |
| 1007 | nmdc:mga0yw44_7733_c1 | 3300050492 | Bacteria | 5309 |
| 1008 | nmdc:mga0yw44_98052_c1 | 3300050492 | Bacteria | 1863 |
| 1009 | nmdc:mga06z11_26368_c1 | 3300050494 | Bacteria | 2765 |
| 1010 | nmdc:mga06z11_56530_c1 | 3300050494 | Bacteria | 2030 |
| 1011 | nmdc:mga06z11_69554_c1 | 3300050494 | Bacteria | 1859 |
| 1012 | nmdc:mga06z11_8413_c1 | 3300050494 | Bacteria | 4301 |
| 1013 | nmdc:mga04h51_102509_c1 | 3300050495 | Bacteria | 1045 |
| 1014 | nmdc:mga04h51_23893_c1 | 3300050495 | Bacteria | 1866 |
| 1015 | nmdc:mga07m45_101514_c1 | 3300050496 | Bacteria | 1652 |
| 1016 | nmdc:mga07m45_2647_c1 | 3300050496 | Bacteria | 8434 |
| 1017 | nmdc:mga07m45_44396_c1 | 3300050496 | Bacteria | 2495 |
| 1018 | nmdc:mga07m45_80186_c1 | 3300050496 | Bacteria | 1864 |
| 1019 | nmdc:mga07m45_9130_c1 | 3300050496 | Bacteria | 5123 |
| 1020 | nmdc:mga07m45_97695_c1 | 3300050496 | Bacteria | 1685 |
| 1021 | nmdc:mga05p37_147426_c1 | 3300050507 | Bacteria | 2880 |
| 1022 | nmdc:mga09592_291569_c1 | 3300050508 | Bacteria | 1415 |
| 1023 | nmdc:mga06r32_15209_c1 | 3300050510 | Bacteria | 6991 |
| 1024 | nmdc:mga06r32_191537_c1 | 3300050510 | Bacteria | 2032 |
| 1025 | nmdc:mga08y16_101083_c1 | 3300050511 | Bacteria | 3002 |
| 1026 | nmdc:mga08y16_201480_c1 | 3300050511 | Bacteria | 2063 |
| 1027 | nmdc:mga08y16_426063_c1 | 3300050511 | Bacteria | 1356 |
| 1028 | nmdc:mga08y16_4414_c1 | 3300050511 | Bacteria | 14702 |
| 1029 | nmdc:mga08y16_62979_c1 | 3300050511 | Bacteria | 3874 |
| 1030 | nmdc:mga08y16_692626_c1 | 3300050511 | Bacteria | 1020 |
| 1031 | nmdc:mga0rr50_403682_c1 | 3300050513 | Bacteria | 1155 |
| 1032 | nmdc:mga0a205_124922_c1 | 3300050515 | Bacteria | 2473 |
| 1033 | Ga0495601_0209487 | 3300053077 | Bacteria | 1273 |
| 1034 | Ga0495612_0013400 | 3300053078 | Bacteria | 3302 |
| 1035 | Ga0495595_0123021 | 3300053084 | Bacteria | 1264 |
| 1036 | Ga0495619_0023815 | 3300053085 | Bacteria | 3924 |
| 1037 | Ga0495619_0340286 | 3300053085 | Bacteria | 1038 |
| 1038 | Ga0500643_000239 | 3300053087 | Bacteria | 51005 |
| 1039 | Ga0500644_0000050 | 3300053088 | Bacteria | 71907 |
| 1040 | Ga0500644_0000104 | 3300053088 | Bacteria | 53398 |
| 1041 | Ga0500644_0081935 | 3300053088 | Bacteria | 1188 |
| 1042 | Ga0500554_008044 | 3300053102 | Bacteria | 2458 |
| 1043 | Ga0500554_078163 | 3300053102 | Bacteria | 1086 |
| 1044 | Ga0500556_0001058 | 3300053104 | Bacteria | 14153 |
| 1045 | Ga0500593_000179 | 3300053117 | Bacteria | 25713 |
| 1046 | Ga0500573_0018977 | 3300053140 | Bacteria | 3931 |
| 1047 | Ga0500616_0000060 | 3300053153 | Bacteria | 252252 |
| 1048 | Ga0500616_0000792 | 3300053153 | Bacteria | 36236 |
| 1049 | Ga0501084_0021438 | 3300054114 | Bacteria | 5384 |
| 1050 | Ga0501084_0158009 | 3300054114 | Bacteria | 1912 |
| 1051 | Ga0501084_0331367 | 3300054114 | Bacteria | 1285 |
| 1052 | Ga0501084_0350322 | 3300054114 | Bacteria | 1248 |
| 1053 | Ga0587073_0015132 | 3300059492 | Bacteria | 1385 |
| 1054 | Ga0587111_0020289 | 3300060346 | Bacteria | 1270 |
| 1055 | Ga0501082_0019122 | 3300060353 | Bacteria | 5902 |
| 1056 | Ga0501082_0046676 | 3300060353 | Bacteria | 3733 |
| 1057 | Ga0501082_0083012 | 3300060353 | Bacteria | 2764 |
| 1058 | Ga0501082_0134419 | 3300060353 | Bacteria | 2146 |
| 1059 | Ga0501082_0160522 | 3300060353 | Bacteria | 1953 |
| 1060 | Ga0501082_0237345 | 3300060353 | Bacteria | 1587 |
| 1061 | Ga0501082_0392189 | 3300060353 | Bacteria | 1211 |
| 1062 | Ga0530510_0029698 | 3300061734 | Bacteria | 3925 |
| 1063 | Ga0530510_0030715 | 3300061734 | Bacteria | 3860 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_100128992 | Ga0307409_1001289922 | 230 |
| 2 | 3300026088 | Ga0207641_10371400 | Ga0207641_103714002 | 234 |
| 3 | 3300013105 | Ga0157369_10215533 | Ga0157369_102155332 | 261 |
| 4 | 3300048908 | Ga0496105_0134554 | Ga0496105_0134554_604_1596 | 261 |
| 5 | 3300038443 | Ga0395901_0011948 | Ga0395901_0011948_5904_6839 | 264 |
| 6 | 3300048908 | Ga0496105_0046910 | Ga0496105_0046910_2487_3398 | 269 |
| 7 | 3300049586 | Ga0501070_0442156 | Ga0501070_0442156_71_997 | 269 |
| 8 | 3300049591 | Ga0501075_0138846 | Ga0501075_0138846_365_1261 | 269 |
| 9 | 3300048910 | Ga0496107_0487344 | Ga0496107_0487344_14_826 | 270 |
| 10 | 3300049573 | Ga0501037_0087179 | Ga0501037_0087179_568_1494 | 271 |
| 11 | 3300049586 | Ga0501070_0097933 | Ga0501070_0097933_598_1524 | 271 |
| 12 | 3300049589 | Ga0501073_0454919 | Ga0501073_0454919_20_835 | 271 |
| 13 | 3300049592 | Ga0501076_0049489 | Ga0501076_0049489_1564_2490 | 271 |
| 14 | 3300049824 | Ga0501045_0134072 | Ga0501045_0134072_67_993 | 271 |
| 15 | 3300049741 | Ga0501079_0058312 | Ga0501079_0058312_1871_2791 | 272 |
| 16 | 3300005937 | Ga0081455_10195177 | Ga0081455_101951772 | 275 |
| 17 | 3300049571 | Ga0501034_0064361 | Ga0501034_0064361_191_1111 | 275 |
| 18 | 3300049588 | Ga0501072_0082701 | Ga0501072_0082701_389_1309 | 275 |
| 19 | 3300045976 | Ga0466967_0073531 | Ga0466967_0073531_1815_2744 | 276 |
| 20 | 3300049592 | Ga0501076_0086562 | Ga0501076_0086562_157_1077 | 276 |
| 21 | 3300054114 | Ga0501084_0331367 | Ga0501084_0331367_192_1112 | 276 |
| 22 | 3300060353 | Ga0501082_0392189 | Ga0501082_0392189_15_935 | 276 |
| 23 | 3300044694 | Ga0466963_0069680 | Ga0466963_0069680_726_1685 | 277 |
| 24 | 3300031995 | Ga0307409_100071625 | Ga0307409_1000716252 | 280 |
| 25 | 3300005614 | Ga0068856_100274287 | Ga0068856_1002742872 | 281 |
| 26 | 3300026078 | Ga0207702_10496611 | Ga0207702_104966111 | 281 |
| 27 | 3300048908 | Ga0496105_0233606 | Ga0496105_0233606_299_1195 | 281 |
| 28 | 3300048912 | Ga0496109_0095372 | Ga0496109_0095372_308_1204 | 281 |
| 29 | 3300053117 | Ga0500593_000179 | Ga0500593_000179_19796_20710 | 281 |
| 30 | 3300060353 | Ga0501082_0134419 | Ga0501082_0134419_14_931 | 281 |
| 31 | 3300013308 | Ga0157375_10534980 | Ga0157375_105349802 | 282 |
| 32 | 3300044901 | Ga0466960_0023651 | Ga0466960_0023651_1042_1959 | 282 |
| 33 | 3300053104 | Ga0500556_0001058 | Ga0500556_0001058_2038_2952 | 283 |
| 34 | 3300006048 | Ga0075363_100001116 | Ga0075363_1000011164 | 286 |
| 35 | 3300006353 | Ga0075370_10001569 | Ga0075370_100015694 | 286 |
| 36 | 3300048911 | Ga0496108_0055934 | Ga0496108_0055934_1656_2552 | 286 |
| 37 | 3300049589 | Ga0501073_0056459 | Ga0501073_0056459_949_1848 | 286 |
| 38 | 3300049742 | Ga0501080_0157491 | Ga0501080_0157491_1003_1902 | 286 |
| 39 | 3300050490 | nmdc:mga03n38_15364_c1 | nmdc:mga03n38_15364_c1_1350_2249 | 286 |
| 40 | 3300050491 | nmdc:mga00v17_18892_c1 | nmdc:mga00v17_18892_c1_2809_3708 | 286 |
| 41 | 3300050496 | nmdc:mga07m45_80186_c1 | nmdc:mga07m45_80186_c1_948_1847 | 286 |
| 42 | 3300039062 | Ga0400483_021589 | Ga0400483_021589_2789_3769 | 287 |
| 43 | iso_pu_bacteria | 2643221615 | 2644091769 | 288 |
| 44 | iso_pu_bacteria | 2643221657 | 2644321572 | 288 |
| 45 | 3300032002 | Ga0307416_100102938 | Ga0307416_1001029382 | 289 |
| 46 | 3300042438 | Ga0439459_0030276 | Ga0439459_0030276_57_950 | 289 |
| 47 | 3300053087 | Ga0500643_000239 | Ga0500643_000239_27616_28524 | 289 |
| 48 | 3300005355 | Ga0070671_100001796 | Ga0070671_1000017965 | 290 |
| 49 | 3300005548 | Ga0070665_100006876 | Ga0070665_1000068765 | 290 |
| 50 | 3300005843 | Ga0068860_100012237 | Ga0068860_1000122376 | 290 |
| 51 | 3300025931 | Ga0207644_10027379 | Ga0207644_100273795 | 290 |
| 52 | 3300028379 | Ga0268266_10051556 | Ga0268266_100515562 | 290 |
| 53 | 3300028381 | Ga0268264_10004760 | Ga0268264_100047607 | 290 |
| 54 | 3300048907 | Ga0496104_0103668 | Ga0496104_0103668_381_1265 | 290 |
| 55 | 3300048908 | Ga0496105_0071322 | Ga0496105_0071322_1320_2204 | 290 |
| 56 | 3300048922 | Ga0496119_0014608 | Ga0496119_0014608_1962_2846 | 290 |
| 57 | 3300048923 | Ga0496120_0006161 | Ga0496120_0006161_6428_7312 | 290 |
| 58 | 3300048924 | Ga0496121_0169453 | Ga0496121_0169453_79_963 | 290 |
| 59 | 3300049572 | Ga0501036_0207628 | Ga0501036_0207628_456_1373 | 290 |
| 60 | 3300049587 | Ga0501071_0053300 | Ga0501071_0053300_1331_2248 | 290 |
| 61 | 3300049824 | Ga0501045_0074104 | Ga0501045_0074104_91_1008 | 290 |
| 62 | 3300009148 | Ga0105243_10209072 | Ga0105243_102090722 | 291 |
| 63 | 3300048910 | Ga0496107_0130879 | Ga0496107_0130879_796_1710 | 291 |
| 64 | iso_pu_bacteria | 2784132109 | 2784470931 | 291 |
| 65 | 3300013308 | Ga0157375_10029705 | Ga0157375_100297052 | 292 |
| 66 | 3300017792 | Ga0163161_10178144 | Ga0163161_101781442 | 292 |
| 67 | 3300032126 | Ga0307415_100283300 | Ga0307415_1002833001 | 292 |
| 68 | 3300044683 | Ga0466965_0004751 | Ga0466965_0004751_3670_4575 | 292 |
| 69 | 3300044683 | Ga0466965_0025243 | Ga0466965_0025243_1838_2740 | 292 |
| 70 | 3300044683 | Ga0466965_0048241 | Ga0466965_0048241_902_1804 | 292 |
| 71 | 3300044693 | Ga0466961_0109053 | Ga0466961_0109053_481_1383 | 292 |
| 72 | 3300044694 | Ga0466963_0038739 | Ga0466963_0038739_800_1702 | 292 |
| 73 | 3300044706 | Ga0466964_0031608 | Ga0466964_0031608_765_1667 | 292 |
| 74 | 3300044842 | Ga0466957_0001115 | Ga0466957_0001115_9433_10335 | 292 |
| 75 | 3300044901 | Ga0466960_0000350 | Ga0466960_0000350_9977_10885 | 292 |
| 76 | 3300044901 | Ga0466960_0006974 | Ga0466960_0006974_1162_2064 | 292 |
| 77 | 3300045836 | Ga0466958_0042983 | Ga0466958_0042983_889_1791 | 292 |
| 78 | 3300045976 | Ga0466967_0170963 | Ga0466967_0170963_728_1630 | 292 |
| 79 | 3300049586 | Ga0501070_0042917 | Ga0501070_0042917_565_1509 | 292 |
| 80 | iso_pu_bacteria | 2643221567 | 2643853500 | 292 |
| 81 | iso_pu_bacteria | 2643221576 | 2643889890 | 292 |
| 82 | iso_pu_bacteria | 2643221590 | 2643958946 | 292 |
| 83 | iso_pu_bacteria | 2643221604 | 2644033896 | 292 |
| 84 | iso_pu_bacteria | 2643221617 | 2644102586 | 292 |
| 85 | iso_pu_bacteria | 2643221620 | 2644118248 | 292 |
| 86 | iso_pu_bacteria | 2643221624 | 2644137461 | 292 |
| 87 | iso_pu_bacteria | 2643221711 | 2644609995 | 292 |
| 88 | iso_pu_bacteria | 2811994874 | 2812331744 | 292 |
| 89 | iso_pu_bacteria | 2811994878 | 2812350174 | 292 |
| 90 | iso_pu_bacteria | 2818991318 | 2819425474 | 292 |
| 91 | iso_pu_bacteria | 2818991458 | 2819667844 | 292 |
| 92 | iso_pu_bacteria | 2818991462 | 2819690251 | 292 |
| 93 | iso_pu_bacteria | 2818991469 | 2819726201 | 292 |
| 94 | iso_pu_bacteria | 2855386786 | 2855388905 | 292 |
| 95 | iso_pu_bacteria | 2857481737 | 2857483235 | 292 |
| 96 | 3300005327 | Ga0070658_10022845 | Ga0070658_100228452 | 293 |
| 97 | 3300005331 | Ga0070670_100156954 | Ga0070670_1001569541 | 293 |
| 98 | 3300005548 | Ga0070665_100000957 | Ga0070665_10000095748 | 293 |
| 99 | 3300006048 | Ga0075363_100061961 | Ga0075363_1000619612 | 293 |
| 100 | 3300006178 | Ga0075367_10018148 | Ga0075367_100181484 | 293 |
| 101 | 3300013104 | Ga0157370_10441299 | Ga0157370_104412991 | 293 |
| 102 | 3300013307 | Ga0157372_10416507 | Ga0157372_104165072 | 293 |
| 103 | 3300013308 | Ga0157375_10106735 | Ga0157375_101067353 | 293 |
| 104 | 3300014497 | Ga0182008_10092587 | Ga0182008_100925872 | 293 |
| 105 | 3300025944 | Ga0207661_10390562 | Ga0207661_103905621 | 293 |
| 106 | 3300031995 | Ga0307409_100329291 | Ga0307409_1003292911 | 293 |
| 107 | 3300045976 | Ga0466967_0183525 | Ga0466967_0183525_801_1724 | 293 |
| 108 | 3300048903 | Ga0496100_0032129 | Ga0496100_0032129_372_1295 | 293 |
| 109 | 3300048904 | Ga0496101_0134755 | Ga0496101_0134755_158_1081 | 293 |
| 110 | 3300048905 | Ga0496102_0013364 | Ga0496102_0013364_4764_5687 | 293 |
| 111 | 3300048909 | Ga0496106_0055833 | Ga0496106_0055833_535_1458 | 293 |
| 112 | 3300048911 | Ga0496108_0251142 | Ga0496108_0251142_269_1192 | 293 |
| 113 | 3300048912 | Ga0496109_0015913 | Ga0496109_0015913_3885_4808 | 293 |
| 114 | 3300048912 | Ga0496109_0214230 | Ga0496109_0214230_197_1120 | 293 |
| 115 | 3300048917 | Ga0496114_0005765 | Ga0496114_0005765_7236_8159 | 293 |
| 116 | 3300048917 | Ga0496114_0008014 | Ga0496114_0008014_1106_2029 | 293 |
| 117 | 3300048918 | Ga0496115_0091212 | Ga0496115_0091212_1441_2364 | 293 |
| 118 | 3300048927 | Ga0496124_0228974 | Ga0496124_0228974_339_1310 | 293 |
| 119 | 3300050494 | nmdc:mga06z11_56530_c1 | nmdc:mga06z11_56530_c1_1061_1957 | 293 |
| 120 | 3300053088 | Ga0500644_0000104 | Ga0500644_0000104_33945_34841 | 293 |
| 121 | iso_pu_bacteria | 2643221641 | 2644228333 | 294 |
| 122 | iso_pu_bacteria | 2739367653 | 2739603387 | 294 |
| 123 | iso_pu_bacteria | 2739367898 | 2740165843 | 294 |
| 124 | iso_pu_bacteria | 2857481737 | 2857483533 | 294 |
| 125 | iso_pu_bacteria | 2857727296 | 2857727350 | 294 |
| 126 | 3300005843 | Ga0068860_100000467 | Ga0068860_10000046735 | 295 |
| 127 | 3300006844 | Ga0075428_100021526 | Ga0075428_1000215264 | 295 |
| 128 | 3300009094 | Ga0111539_10012179 | Ga0111539_1001217913 | 295 |
| 129 | 3300028381 | Ga0268264_10001967 | Ga0268264_100019679 | 295 |
| 130 | 3300039062 | Ga0400483_095912 | Ga0400483_095912_1796_2731 | 295 |
| 131 | 3300039062 | Ga0400483_209527 | Ga0400483_209527_890_1825 | 295 |
| 132 | 3300049588 | Ga0501072_0070974 | Ga0501072_0070974_867_1796 | 295 |
| 133 | 3300050511 | nmdc:mga08y16_4414_c1 | nmdc:mga08y16_4414_c1_4065_4955 | 295 |
| 134 | iso_pu_bacteria | 2643221576 | 2643893244 | 295 |
| 135 | iso_pu_bacteria | 2643221590 | 2643961697 | 295 |
| 136 | iso_pu_bacteria | 2643221604 | 2644034027 | 295 |
| 137 | iso_pu_bacteria | 2643221961 | 2645720479 | 295 |
| 138 | iso_pu_bacteria | 2643221962 | 2645723438 | 295 |
| 139 | iso_pu_bacteria | 2738541305 | 2738871640 | 295 |
| 140 | iso_pu_bacteria | 2773857762 | 2774393828 | 295 |
| 141 | iso_pu_bacteria | 2811994874 | 2812333915 | 295 |
| 142 | iso_pu_bacteria | 2984576629 | 2984579189 | 295 |
| 143 | iso_pu_bacteria | 2990256926 | 2990259918 | 295 |
| 144 | iso_pu_bacteria | 8054609563 | 8054609651 | 295 |
| 145 | iso_pu_bacteria | 8054609563 | 8054611362 | 295 |
| 146 | 3300003578 | Ga0006562J51391_1041093 | Ga0006562J51391_10410931 | 296 |
| 147 | 3300005615 | Ga0070702_100092910 | Ga0070702_1000929102 | 296 |
| 148 | 3300006038 | Ga0075365_10008147 | Ga0075365_100081475 | 296 |
| 149 | 3300006038 | Ga0075365_10024606 | Ga0075365_100246062 | 296 |
| 150 | 3300006038 | Ga0075365_10031885 | Ga0075365_100318853 | 296 |
| 151 | 3300006038 | Ga0075365_10046940 | Ga0075365_100469403 | 296 |
| 152 | 3300006038 | Ga0075365_10054794 | Ga0075365_100547942 | 296 |
| 153 | 3300006038 | Ga0075365_10071600 | Ga0075365_100716002 | 296 |
| 154 | 3300006038 | Ga0075365_10075681 | Ga0075365_100756813 | 296 |
| 155 | 3300006038 | Ga0075365_10096041 | Ga0075365_100960412 | 296 |
| 156 | 3300006038 | Ga0075365_10101048 | Ga0075365_101010482 | 296 |
| 157 | 3300006038 | Ga0075365_10156839 | Ga0075365_101568391 | 296 |
| 158 | 3300006038 | Ga0075365_10159500 | Ga0075365_101595002 | 296 |
| 159 | 3300006038 | Ga0075365_10166502 | Ga0075365_101665022 | 296 |
| 160 | 3300006042 | Ga0075368_10000363 | Ga0075368_100003635 | 296 |
| 161 | 3300006042 | Ga0075368_10000952 | Ga0075368_100009523 | 296 |
| 162 | 3300006042 | Ga0075368_10017449 | Ga0075368_100174492 | 296 |
| 163 | 3300006048 | Ga0075363_100000170 | Ga0075363_10000017023 | 296 |
| 164 | 3300006048 | Ga0075363_100002522 | Ga0075363_1000025222 | 296 |
| 165 | 3300006048 | Ga0075363_100020550 | Ga0075363_1000205502 | 296 |
| 166 | 3300006048 | Ga0075363_100063141 | Ga0075363_1000631412 | 296 |
| 167 | 3300006048 | Ga0075363_100072134 | Ga0075363_1000721342 | 296 |
| 168 | 3300006051 | Ga0075364_10006272 | Ga0075364_100062727 | 296 |
| 169 | 3300006051 | Ga0075364_10014601 | Ga0075364_100146016 | 296 |
| 170 | 3300006051 | Ga0075364_10042989 | Ga0075364_100429892 | 296 |
| 171 | 3300006051 | Ga0075364_10057116 | Ga0075364_100571163 | 296 |
| 172 | 3300006051 | Ga0075364_10062326 | Ga0075364_100623262 | 296 |
| 173 | 3300006051 | Ga0075364_10086073 | Ga0075364_100860733 | 296 |
| 174 | 3300006177 | Ga0075362_10015327 | Ga0075362_100153272 | 296 |
| 175 | 3300006178 | Ga0075367_10000401 | Ga0075367_1000040117 | 296 |
| 176 | 3300006178 | Ga0075367_10019136 | Ga0075367_100191361 | 296 |
| 177 | 3300006178 | Ga0075367_10053572 | Ga0075367_100535722 | 296 |
| 178 | 3300006353 | Ga0075370_10001511 | Ga0075370_100015113 | 296 |
| 179 | 3300006353 | Ga0075370_10003287 | Ga0075370_100032877 | 296 |
| 180 | 3300006353 | Ga0075370_10065800 | Ga0075370_100658002 | 296 |
| 181 | 3300009553 | Ga0105249_10198452 | Ga0105249_101984523 | 296 |
| 182 | 3300013308 | Ga0157375_10243685 | Ga0157375_102436852 | 296 |
| 183 | 3300013308 | Ga0157375_10420163 | Ga0157375_104201632 | 296 |
| 184 | 3300014745 | Ga0157377_10182038 | Ga0157377_101820382 | 296 |
| 185 | 3300017792 | Ga0163161_10139886 | Ga0163161_101398862 | 296 |
| 186 | 3300020082 | Ga0206353_10455544 | Ga0206353_104555443 | 296 |
| 187 | 3300025940 | Ga0207691_10062688 | Ga0207691_100626883 | 296 |
| 188 | 3300026067 | Ga0207678_10109934 | Ga0207678_101099342 | 296 |
| 189 | 3300027866 | Ga0209813_10004119 | Ga0209813_100041194 | 296 |
| 190 | 3300027866 | Ga0209813_10007277 | Ga0209813_100072772 | 296 |
| 191 | 3300031728 | Ga0316578_10001825 | Ga0316578_100018256 | 296 |
| 192 | 3300031824 | Ga0307413_10149749 | Ga0307413_101497492 | 296 |
| 193 | 3300031901 | Ga0307406_10145445 | Ga0307406_101454452 | 296 |
| 194 | 3300031901 | Ga0307406_10221153 | Ga0307406_102211532 | 296 |
| 195 | 3300031995 | Ga0307409_100011357 | Ga0307409_1000113572 | 296 |
| 196 | 3300031995 | Ga0307409_100034975 | Ga0307409_1000349752 | 296 |
| 197 | 3300031995 | Ga0307409_100046156 | Ga0307409_1000461563 | 296 |
| 198 | 3300031995 | Ga0307409_100151443 | Ga0307409_1001514432 | 296 |
| 199 | 3300032002 | Ga0307416_100002929 | Ga0307416_1000029293 | 296 |
| 200 | 3300032002 | Ga0307416_100299986 | Ga0307416_1002999861 | 296 |
| 201 | 3300032002 | Ga0307416_100395067 | Ga0307416_1003950672 | 296 |
| 202 | 3300032126 | Ga0307415_100038392 | Ga0307415_1000383922 | 296 |
| 203 | 3300032133 | Ga0316583_10029656 | Ga0316583_100296562 | 296 |
| 204 | 3300035398 | Ga0316574_0007917 | Ga0316574_0007917_4323_5222 | 296 |
| 205 | 3300036712 | Ga0316584_0003766 | Ga0316584_0003766_4480_5379 | 296 |
| 206 | 3300037418 | Ga0395900_0058762 | Ga0395900_0058762_1994_2896 | 296 |
| 207 | 3300038443 | Ga0395901_0213971 | Ga0395901_0213971_897_1814 | 296 |
| 208 | 3300044658 | Ga0466972_0176165 | Ga0466972_0176165_58_993 | 296 |
| 209 | 3300044683 | Ga0466965_0012067 | Ga0466965_0012067_969_1904 | 296 |
| 210 | 3300044765 | Ga0466970_0012324 | Ga0466970_0012324_2641_3576 | 296 |
| 211 | 3300044765 | Ga0466970_0018226 | Ga0466970_0018226_83_1018 | 296 |
| 212 | 3300044765 | Ga0466970_0033313 | Ga0466970_0033313_1708_2619 | 296 |
| 213 | 3300044765 | Ga0466970_0098294 | Ga0466970_0098294_181_1104 | 296 |
| 214 | 3300044842 | Ga0466957_0096568 | Ga0466957_0096568_356_1309 | 296 |
| 215 | 3300044901 | Ga0466960_0008191 | Ga0466960_0008191_1018_1914 | 296 |
| 216 | 3300044901 | Ga0466960_0016237 | Ga0466960_0016237_25_960 | 296 |
| 217 | 3300045836 | Ga0466958_0094123 | Ga0466958_0094123_230_1141 | 296 |
| 218 | 3300045976 | Ga0466967_0119523 | Ga0466967_0119523_597_1532 | 296 |
| 219 | 3300045976 | Ga0466967_0159795 | Ga0466967_0159795_58_969 | 296 |
| 220 | 3300048903 | Ga0496100_0003839 | Ga0496100_0003839_3582_4481 | 296 |
| 221 | 3300048905 | Ga0496102_0015121 | Ga0496102_0015121_157_1056 | 296 |
| 222 | 3300048906 | Ga0496103_0009545 | Ga0496103_0009545_1058_1957 | 296 |
| 223 | 3300048906 | Ga0496103_0246457 | Ga0496103_0246457_170_1096 | 296 |
| 224 | 3300048907 | Ga0496104_0260922 | Ga0496104_0260922_67_966 | 296 |
| 225 | 3300048908 | Ga0496105_0004639 | Ga0496105_0004639_9392_10291 | 296 |
| 226 | 3300048908 | Ga0496105_0465742 | Ga0496105_0465742_12_911 | 296 |
| 227 | 3300048910 | Ga0496107_0264463 | Ga0496107_0264463_330_1229 | 296 |
| 228 | 3300048911 | Ga0496108_0327330 | Ga0496108_0327330_25_924 | 296 |
| 229 | 3300048912 | Ga0496109_0195072 | Ga0496109_0195072_624_1523 | 296 |
| 230 | 3300048913 | Ga0496110_0138698 | Ga0496110_0138698_635_1534 | 296 |
| 231 | 3300048915 | Ga0496112_0639119 | Ga0496112_0639119_54_953 | 296 |
| 232 | 3300048916 | Ga0496113_0038091 | Ga0496113_0038091_904_1803 | 296 |
| 233 | 3300048917 | Ga0496114_0090983 | Ga0496114_0090983_1584_2483 | 296 |
| 234 | 3300048917 | Ga0496114_0353064 | Ga0496114_0353064_207_1103 | 296 |
| 235 | 3300048921 | Ga0496118_0173804 | Ga0496118_0173804_187_1101 | 296 |
| 236 | 3300049129 | Ga0501309_002015 | Ga0501309_002015_1185_2099 | 296 |
| 237 | 3300049568 | Ga0501031_0001569 | Ga0501031_0001569_1784_2719 | 296 |
| 238 | 3300049568 | Ga0501031_0104827 | Ga0501031_0104827_356_1279 | 296 |
| 239 | 3300049569 | Ga0501032_0066357 | Ga0501032_0066357_556_1479 | 296 |
| 240 | 3300049569 | Ga0501032_0077745 | Ga0501032_0077745_96_1031 | 296 |
| 241 | 3300049570 | Ga0501033_0003386 | Ga0501033_0003386_4753_5676 | 296 |
| 242 | 3300049572 | Ga0501036_0001694 | Ga0501036_0001694_11434_12369 | 296 |
| 243 | 3300049572 | Ga0501036_0006122 | Ga0501036_0006122_8177_9100 | 296 |
| 244 | 3300049572 | Ga0501036_0121489 | Ga0501036_0121489_981_1895 | 296 |
| 245 | 3300049573 | Ga0501037_0023454 | Ga0501037_0023454_2887_3810 | 296 |
| 246 | 3300049574 | Ga0501038_0004008 | Ga0501038_0004008_6139_7074 | 296 |
| 247 | 3300049574 | Ga0501038_0013769 | Ga0501038_0013769_1793_2716 | 296 |
| 248 | 3300049575 | Ga0501039_0007037 | Ga0501039_0007037_2756_3691 | 296 |
| 249 | 3300049576 | Ga0501040_0001709 | Ga0501040_0001709_11068_12003 | 296 |
| 250 | 3300049576 | Ga0501040_0054839 | Ga0501040_0054839_99_1013 | 296 |
| 251 | 3300049576 | Ga0501040_0357141 | Ga0501040_0357141_44_955 | 296 |
| 252 | 3300049577 | Ga0501041_0021998 | Ga0501041_0021998_1840_2775 | 296 |
| 253 | 3300049578 | Ga0501042_0003027 | Ga0501042_0003027_8701_9624 | 296 |
| 254 | 3300049578 | Ga0501042_0006792 | Ga0501042_0006792_2620_3555 | 296 |
| 255 | 3300049579 | Ga0501043_0134861 | Ga0501043_0134861_666_1589 | 296 |
| 256 | 3300049580 | Ga0501046_0057893 | Ga0501046_0057893_920_1843 | 296 |
| 257 | 3300049580 | Ga0501046_0073585 | Ga0501046_0073585_809_1732 | 296 |
| 258 | 3300049581 | Ga0501047_0033893 | Ga0501047_0033893_1203_2126 | 296 |
| 259 | 3300049582 | Ga0501048_0007035 | Ga0501048_0007035_2869_3804 | 296 |
| 260 | 3300049582 | Ga0501048_0040541 | Ga0501048_0040541_53_976 | 296 |
| 261 | 3300049585 | Ga0501069_0007837 | Ga0501069_0007837_767_1702 | 296 |
| 262 | 3300049586 | Ga0501070_0032937 | Ga0501070_0032937_832_1764 | 296 |
| 263 | 3300049588 | Ga0501072_0006084 | Ga0501072_0006084_2359_3294 | 296 |
| 264 | 3300049589 | Ga0501073_0063282 | Ga0501073_0063282_697_1620 | 296 |
| 265 | 3300049589 | Ga0501073_0251170 | Ga0501073_0251170_56_970 | 296 |
| 266 | 3300049590 | Ga0501074_0049798 | Ga0501074_0049798_334_1269 | 296 |
| 267 | 3300049590 | Ga0501074_0108479 | Ga0501074_0108479_451_1374 | 296 |
| 268 | 3300049591 | Ga0501075_0067091 | Ga0501075_0067091_834_1769 | 296 |
| 269 | 3300049592 | Ga0501076_0011478 | Ga0501076_0011478_2602_3537 | 296 |
| 270 | 3300049742 | Ga0501080_0039249 | Ga0501080_0039249_3080_4015 | 296 |
| 271 | 3300049822 | Ga0501035_0021194 | Ga0501035_0021194_2973_3896 | 296 |
| 272 | 3300049823 | Ga0501044_0040033 | Ga0501044_0040033_3230_4153 | 296 |
| 273 | 3300049824 | Ga0501045_0019867 | Ga0501045_0019867_2521_3456 | 296 |
| 274 | 3300049824 | Ga0501045_0070494 | Ga0501045_0070494_1445_2371 | 296 |
| 275 | 3300049824 | Ga0501045_0380013 | Ga0501045_0380013_73_996 | 296 |
| 276 | 3300050489 | nmdc:mga03683_108033_c1 | nmdc:mga03683_108033_c1_226_1152 | 296 |
| 277 | 3300050490 | nmdc:mga03n38_131271_c1 | nmdc:mga03n38_131271_c1_150_1067 | 296 |
| 278 | 3300050490 | nmdc:mga03n38_1536_c1 | nmdc:mga03n38_1536_c1_3764_4690 | 296 |
| 279 | 3300050490 | nmdc:mga03n38_16936_c1 | nmdc:mga03n38_16936_c1_1628_2572 | 296 |
| 280 | 3300050490 | nmdc:mga03n38_31013_c1 | nmdc:mga03n38_31013_c1_923_1855 | 296 |
| 281 | 3300050490 | nmdc:mga03n38_51853_c1 | nmdc:mga03n38_51853_c1_249_1163 | 296 |
| 282 | 3300050490 | nmdc:mga03n38_87017_c1 | nmdc:mga03n38_87017_c1_512_1438 | 296 |
| 283 | 3300050490 | nmdc:mga03n38_92387_c1 | nmdc:mga03n38_92387_c1_436_1374 | 296 |
| 284 | 3300050491 | nmdc:mga00v17_101428_c1 | nmdc:mga00v17_101428_c1_830_1744 | 296 |
| 285 | 3300050491 | nmdc:mga00v17_12728_c1 | nmdc:mga00v17_12728_c1_949_1863 | 296 |
| 286 | 3300050491 | nmdc:mga00v17_13995_c1 | nmdc:mga00v17_13995_c1_2954_3892 | 296 |
| 287 | 3300050491 | nmdc:mga00v17_167026_c1 | nmdc:mga00v17_167026_c1_266_1186 | 296 |
| 288 | 3300050491 | nmdc:mga00v17_22363_c1 | nmdc:mga00v17_22363_c1_1665_2603 | 296 |
| 289 | 3300050491 | nmdc:mga00v17_32669_c1 | nmdc:mga00v17_32669_c1_1113_2030 | 296 |
| 290 | 3300050491 | nmdc:mga00v17_49842_c1 | nmdc:mga00v17_49842_c1_255_1181 | 296 |
| 291 | 3300050492 | nmdc:mga0yw44_100306_c1 | nmdc:mga0yw44_100306_c1_27_941 | 296 |
| 292 | 3300050492 | nmdc:mga0yw44_105970_c1 | nmdc:mga0yw44_105970_c1_193_1107 | 296 |
| 293 | 3300050492 | nmdc:mga0yw44_146689_c1 | nmdc:mga0yw44_146689_c1_427_1368 | 296 |
| 294 | 3300050492 | nmdc:mga0yw44_18098_c1 | nmdc:mga0yw44_18098_c1_2555_3469 | 296 |
| 295 | 3300050492 | nmdc:mga0yw44_18114_c1 | nmdc:mga0yw44_18114_c1_1471_2388 | 296 |
| 296 | 3300050492 | nmdc:mga0yw44_36814_c1 | nmdc:mga0yw44_36814_c1_1345_2286 | 296 |
| 297 | 3300050492 | nmdc:mga0yw44_38807_c1 | nmdc:mga0yw44_38807_c1_1369_2307 | 296 |
| 298 | 3300050492 | nmdc:mga0yw44_51998_c1 | nmdc:mga0yw44_51998_c1_51_1034 | 296 |
| 299 | 3300050492 | nmdc:mga0yw44_56569_c1 | nmdc:mga0yw44_56569_c1_430_1464 | 296 |
| 300 | 3300050492 | nmdc:mga0yw44_7733_c1 | nmdc:mga0yw44_7733_c1_3870_4811 | 296 |
| 301 | 3300050494 | nmdc:mga06z11_26368_c1 | nmdc:mga06z11_26368_c1_187_1101 | 296 |
| 302 | 3300050494 | nmdc:mga06z11_69554_c1 | nmdc:mga06z11_69554_c1_868_1785 | 296 |
| 303 | 3300050495 | nmdc:mga04h51_102509_c1 | nmdc:mga04h51_102509_c1_77_1003 | 296 |
| 304 | 3300050496 | nmdc:mga07m45_2647_c1 | nmdc:mga07m45_2647_c1_919_1845 | 296 |
| 305 | 3300050496 | nmdc:mga07m45_9130_c1 | nmdc:mga07m45_9130_c1_708_1622 | 296 |
| 306 | 3300050496 | nmdc:mga07m45_97695_c1 | nmdc:mga07m45_97695_c1_231_1145 | 296 |
| 307 | 3300053088 | Ga0500644_0000050 | Ga0500644_0000050_31976_32890 | 296 |
| 308 | 3300053088 | Ga0500644_0081935 | Ga0500644_0081935_11_952 | 296 |
| 309 | 3300053102 | Ga0500554_008044 | Ga0500554_008044_579_1505 | 296 |
| 310 | 3300054114 | Ga0501084_0350322 | Ga0501084_0350322_242_1165 | 296 |
| 311 | 3300060353 | Ga0501082_0019122 | Ga0501082_0019122_2273_3208 | 296 |
| 312 | 3300061734 | Ga0530510_0029698 | Ga0530510_0029698_1762_2688 | 296 |
| 313 | 3300005364 | Ga0070673_100194741 | Ga0070673_1001947412 | 297 |
| 314 | 3300005456 | Ga0070678_100073846 | Ga0070678_1000738463 | 297 |
| 315 | 3300005535 | Ga0070684_100005484 | Ga0070684_1000054849 | 297 |
| 316 | 3300005535 | Ga0070684_100093417 | Ga0070684_1000934172 | 297 |
| 317 | 3300005547 | Ga0070693_100021585 | Ga0070693_1000215853 | 297 |
| 318 | 3300005548 | Ga0070665_100019437 | Ga0070665_1000194378 | 297 |
| 319 | 3300005563 | Ga0068855_100051021 | Ga0068855_1000510214 | 297 |
| 320 | 3300005577 | Ga0068857_100047898 | Ga0068857_1000478982 | 297 |
| 321 | 3300005614 | Ga0068856_100007197 | Ga0068856_1000071972 | 297 |
| 322 | 3300005618 | Ga0068864_100021818 | Ga0068864_1000218183 | 297 |
| 323 | 3300005842 | Ga0068858_100042801 | Ga0068858_1000428012 | 297 |
| 324 | 3300005937 | Ga0081455_10000030 | Ga0081455_1000003052 | 297 |
| 325 | 3300005937 | Ga0081455_10221912 | Ga0081455_102219122 | 297 |
| 326 | 3300005981 | Ga0081538_10000065 | Ga0081538_1000006599 | 297 |
| 327 | 3300006881 | Ga0068865_100228041 | Ga0068865_1002280412 | 297 |
| 328 | 3300009098 | Ga0105245_10001389 | Ga0105245_1000138920 | 297 |
| 329 | 3300009098 | Ga0105245_10187166 | Ga0105245_101871662 | 297 |
| 330 | 3300009553 | Ga0105249_10031845 | Ga0105249_100318451 | 297 |
| 331 | 3300010375 | Ga0105239_10003376 | Ga0105239_1000337625 | 297 |
| 332 | 3300011119 | Ga0105246_10010063 | Ga0105246_100100634 | 297 |
| 333 | 3300013105 | Ga0157369_10010908 | Ga0157369_1001090812 | 297 |
| 334 | 3300013306 | Ga0163162_10002716 | Ga0163162_100027164 | 297 |
| 335 | 3300013307 | Ga0157372_10022009 | Ga0157372_1002200910 | 297 |
| 336 | 3300020082 | Ga0206353_11704839 | Ga0206353_117048392 | 297 |
| 337 | 3300025901 | Ga0207688_10019250 | Ga0207688_100192504 | 297 |
| 338 | 3300025904 | Ga0207647_10056181 | Ga0207647_100561811 | 297 |
| 339 | 3300025909 | Ga0207705_10038483 | Ga0207705_100384834 | 297 |
| 340 | 3300025927 | Ga0207687_10009758 | Ga0207687_100097583 | 297 |
| 341 | 3300025932 | Ga0207690_10040833 | Ga0207690_100408333 | 297 |
| 342 | 3300025938 | Ga0207704_10010985 | Ga0207704_100109851 | 297 |
| 343 | 3300025944 | Ga0207661_10011604 | Ga0207661_1001160410 | 297 |
| 344 | 3300025944 | Ga0207661_10103460 | Ga0207661_101034602 | 297 |
| 345 | 3300025944 | Ga0207661_10215718 | Ga0207661_102157182 | 297 |
| 346 | 3300025949 | Ga0207667_10085130 | Ga0207667_100851303 | 297 |
| 347 | 3300025961 | Ga0207712_10018068 | Ga0207712_100180682 | 297 |
| 348 | 3300026035 | Ga0207703_10100639 | Ga0207703_101006392 | 297 |
| 349 | 3300026078 | Ga0207702_10062949 | Ga0207702_100629492 | 297 |
| 350 | 3300026088 | Ga0207641_10100877 | Ga0207641_101008771 | 297 |
| 351 | 3300026095 | Ga0207676_10016306 | Ga0207676_100163063 | 297 |
| 352 | 3300026116 | Ga0207674_10042528 | Ga0207674_100425285 | 297 |
| 353 | 3300026121 | Ga0207683_10098365 | Ga0207683_100983653 | 297 |
| 354 | 3300041509 | Ga0451843_0051158 | Ga0451843_0051158_67_966 | 297 |
| 355 | 3300044706 | Ga0466964_0054265 | Ga0466964_0054265_181_1089 | 297 |
| 356 | 3300045051 | Ga0451576_0414424 | Ga0451576_0414424_104_1039 | 297 |
| 357 | 3300045976 | Ga0466967_0095098 | Ga0466967_0095098_1739_2674 | 297 |
| 358 | 3300045976 | Ga0466967_0244570 | Ga0466967_0244570_403_1341 | 297 |
| 359 | 3300045976 | Ga0466967_0252036 | Ga0466967_0252036_385_1335 | 297 |
| 360 | 3300048905 | Ga0496102_0033772 | Ga0496102_0033772_564_1499 | 297 |
| 361 | 3300048905 | Ga0496102_0051165 | Ga0496102_0051165_2739_3674 | 297 |
| 362 | 3300048906 | Ga0496103_0018415 | Ga0496103_0018415_375_1310 | 297 |
| 363 | 3300048908 | Ga0496105_0010601 | Ga0496105_0010601_2676_3611 | 297 |
| 364 | 3300048910 | Ga0496107_0028957 | Ga0496107_0028957_2907_3842 | 297 |
| 365 | 3300048911 | Ga0496108_0008499 | Ga0496108_0008499_5103_6038 | 297 |
| 366 | 3300048912 | Ga0496109_0014295 | Ga0496109_0014295_4367_5302 | 297 |
| 367 | 3300048912 | Ga0496109_0061158 | Ga0496109_0061158_519_1454 | 297 |
| 368 | 3300048913 | Ga0496110_0022918 | Ga0496110_0022918_4309_5244 | 297 |
| 369 | 3300048914 | Ga0496111_0000863 | Ga0496111_0000863_13668_14603 | 297 |
| 370 | 3300048917 | Ga0496114_0003522 | Ga0496114_0003522_2803_3738 | 297 |
| 371 | 3300048918 | Ga0496115_0029443 | Ga0496115_0029443_1833_2768 | 297 |
| 372 | 3300049571 | Ga0501034_0051347 | Ga0501034_0051347_288_1226 | 297 |
| 373 | 3300049572 | Ga0501036_0072369 | Ga0501036_0072369_1255_2193 | 297 |
| 374 | 3300049573 | Ga0501037_0114203 | Ga0501037_0114203_31_969 | 297 |
| 375 | 3300049583 | Ga0501067_0004112 | Ga0501067_0004112_4086_5024 | 297 |
| 376 | 3300049583 | Ga0501067_0009441 | Ga0501067_0009441_1479_2417 | 297 |
| 377 | 3300049584 | Ga0501068_0130005 | Ga0501068_0130005_340_1278 | 297 |
| 378 | 3300049585 | Ga0501069_0004130 | Ga0501069_0004130_3715_4653 | 297 |
| 379 | 3300049585 | Ga0501069_0009384 | Ga0501069_0009384_2576_3511 | 297 |
| 380 | 3300049585 | Ga0501069_0035271 | Ga0501069_0035271_315_1250 | 297 |
| 381 | 3300049586 | Ga0501070_0003855 | Ga0501070_0003855_11557_12492 | 297 |
| 382 | 3300049586 | Ga0501070_0021270 | Ga0501070_0021270_1505_2443 | 297 |
| 383 | 3300049586 | Ga0501070_0035442 | Ga0501070_0035442_3142_4080 | 297 |
| 384 | 3300049587 | Ga0501071_0005666 | Ga0501071_0005666_2896_3834 | 297 |
| 385 | 3300049588 | Ga0501072_0009890 | Ga0501072_0009890_1733_2671 | 297 |
| 386 | 3300049588 | Ga0501072_0035834 | Ga0501072_0035834_177_1115 | 297 |
| 387 | 3300049589 | Ga0501073_0004693 | Ga0501073_0004693_8501_9439 | 297 |
| 388 | 3300049589 | Ga0501073_0019457 | Ga0501073_0019457_47_985 | 297 |
| 389 | 3300049590 | Ga0501074_0007589 | Ga0501074_0007589_3002_3940 | 297 |
| 390 | 3300049590 | Ga0501074_0016168 | Ga0501074_0016168_1507_2445 | 297 |
| 391 | 3300049590 | Ga0501074_0035660 | Ga0501074_0035660_1097_2032 | 297 |
| 392 | 3300049593 | Ga0501077_0007878 | Ga0501077_0007878_4312_5250 | 297 |
| 393 | 3300049593 | Ga0501077_0022311 | Ga0501077_0022311_87_1025 | 297 |
| 394 | 3300049742 | Ga0501080_0000857 | Ga0501080_0000857_14216_15154 | 297 |
| 395 | 3300049742 | Ga0501080_0013574 | Ga0501080_0013574_3523_4461 | 297 |
| 396 | 3300049742 | Ga0501080_0292281 | Ga0501080_0292281_361_1296 | 297 |
| 397 | 3300049744 | Ga0501083_0020109 | Ga0501083_0020109_326_1264 | 297 |
| 398 | 3300054114 | Ga0501084_0021438 | Ga0501084_0021438_952_1890 | 297 |
| 399 | 3300060353 | Ga0501082_0083012 | Ga0501082_0083012_323_1261 | 297 |
| 400 | 3300060353 | Ga0501082_0160522 | Ga0501082_0160522_729_1667 | 297 |
| 401 | iso_pu_bacteria | 2984576629 | 2984577222 | 297 |
| 402 | iso_pu_bacteria | 2990256926 | 2990260633 | 297 |
| 403 | 3300001990 | JGI24737J22298_10002340 | JGI24737J22298_100023401 | 298 |
| 404 | 3300002067 | JGI24735J21928_10012866 | JGI24735J21928_100128662 | 298 |
| 405 | 3300002075 | JGI24738J21930_10013790 | JGI24738J21930_100137901 | 298 |
| 406 | 3300005327 | Ga0070658_10052400 | Ga0070658_100524002 | 298 |
| 407 | 3300005327 | Ga0070658_10174949 | Ga0070658_101749492 | 298 |
| 408 | 3300005328 | Ga0070676_10008718 | Ga0070676_100087182 | 298 |
| 409 | 3300005329 | Ga0070683_100004272 | Ga0070683_10000427212 | 298 |
| 410 | 3300005329 | Ga0070683_100068068 | Ga0070683_1000680682 | 298 |
| 411 | 3300005329 | Ga0070683_100188442 | Ga0070683_1001884422 | 298 |
| 412 | 3300005329 | Ga0070683_100530843 | Ga0070683_1005308431 | 298 |
| 413 | 3300005331 | Ga0070670_100055693 | Ga0070670_1000556933 | 298 |
| 414 | 3300005331 | Ga0070670_100139943 | Ga0070670_1001399431 | 298 |
| 415 | 3300005337 | Ga0070682_100020935 | Ga0070682_1000209351 | 298 |
| 416 | 3300005337 | Ga0070682_100033181 | Ga0070682_1000331813 | 298 |
| 417 | 3300005337 | Ga0070682_100087180 | Ga0070682_1000871802 | 298 |
| 418 | 3300005338 | Ga0068868_100130078 | Ga0068868_1001300782 | 298 |
| 419 | 3300005338 | Ga0068868_100219377 | Ga0068868_1002193772 | 298 |
| 420 | 3300005339 | Ga0070660_100026821 | Ga0070660_1000268214 | 298 |
| 421 | 3300005341 | Ga0070691_10032720 | Ga0070691_100327203 | 298 |
| 422 | 3300005343 | Ga0070687_100067500 | Ga0070687_1000675002 | 298 |
| 423 | 3300005344 | Ga0070661_100096484 | Ga0070661_1000964842 | 298 |
| 424 | 3300005345 | Ga0070692_10063357 | Ga0070692_100633572 | 298 |
| 425 | 3300005353 | Ga0070669_100085049 | Ga0070669_1000850493 | 298 |
| 426 | 3300005354 | Ga0070675_100003729 | Ga0070675_1000037294 | 298 |
| 427 | 3300005354 | Ga0070675_100081721 | Ga0070675_1000817212 | 298 |
| 428 | 3300005356 | Ga0070674_100020561 | Ga0070674_1000205613 | 298 |
| 429 | 3300005356 | Ga0070674_100028612 | Ga0070674_1000286123 | 298 |
| 430 | 3300005366 | Ga0070659_100017443 | Ga0070659_1000174434 | 298 |
| 431 | 3300005366 | Ga0070659_100031226 | Ga0070659_1000312262 | 298 |
| 432 | 3300005366 | Ga0070659_100111701 | Ga0070659_1001117012 | 298 |
| 433 | 3300005438 | Ga0070701_10002525 | Ga0070701_100025254 | 298 |
| 434 | 3300005438 | Ga0070701_10004513 | Ga0070701_100045133 | 298 |
| 435 | 3300005441 | Ga0070700_100011432 | Ga0070700_1000114323 | 298 |
| 436 | 3300005441 | Ga0070700_100016043 | Ga0070700_1000160433 | 298 |
| 437 | 3300005441 | Ga0070700_100033084 | Ga0070700_1000330843 | 298 |
| 438 | 3300005455 | Ga0070663_100026021 | Ga0070663_1000260214 | 298 |
| 439 | 3300005457 | Ga0070662_100023827 | Ga0070662_1000238273 | 298 |
| 440 | 3300005459 | Ga0068867_100019341 | Ga0068867_1000193412 | 298 |
| 441 | 3300005459 | Ga0068867_100060741 | Ga0068867_1000607413 | 298 |
| 442 | 3300005466 | Ga0070685_10066406 | Ga0070685_100664061 | 298 |
| 443 | 3300005535 | Ga0070684_100007079 | Ga0070684_1000070797 | 298 |
| 444 | 3300005535 | Ga0070684_100069190 | Ga0070684_1000691903 | 298 |
| 445 | 3300005535 | Ga0070684_100366711 | Ga0070684_1003667112 | 298 |
| 446 | 3300005539 | Ga0068853_100190760 | Ga0068853_1001907602 | 298 |
| 447 | 3300005543 | Ga0070672_100058530 | Ga0070672_1000585302 | 298 |
| 448 | 3300005548 | Ga0070665_100000273 | Ga0070665_10000027360 | 298 |
| 449 | 3300005563 | Ga0068855_100148667 | Ga0068855_1001486673 | 298 |
| 450 | 3300005564 | Ga0070664_100006966 | Ga0070664_1000069664 | 298 |
| 451 | 3300005564 | Ga0070664_100073978 | Ga0070664_1000739783 | 298 |
| 452 | 3300005564 | Ga0070664_100282178 | Ga0070664_1002821782 | 298 |
| 453 | 3300005577 | Ga0068857_100022586 | Ga0068857_1000225864 | 298 |
| 454 | 3300005577 | Ga0068857_100315139 | Ga0068857_1003151392 | 298 |
| 455 | 3300005578 | Ga0068854_100441639 | Ga0068854_1004416392 | 298 |
| 456 | 3300005614 | Ga0068856_100191745 | Ga0068856_1001917453 | 298 |
| 457 | 3300005615 | Ga0070702_100007278 | Ga0070702_1000072784 | 298 |
| 458 | 3300005615 | Ga0070702_100040366 | Ga0070702_1000403662 | 298 |
| 459 | 3300005615 | Ga0070702_100236934 | Ga0070702_1002369341 | 298 |
| 460 | 3300005616 | Ga0068852_100017197 | Ga0068852_1000171977 | 298 |
| 461 | 3300005616 | Ga0068852_100027017 | Ga0068852_1000270174 | 298 |
| 462 | 3300005616 | Ga0068852_100055241 | Ga0068852_1000552413 | 298 |
| 463 | 3300005617 | Ga0068859_100355058 | Ga0068859_1003550582 | 298 |
| 464 | 3300005719 | Ga0068861_100027454 | Ga0068861_1000274542 | 298 |
| 465 | 3300005719 | Ga0068861_100127864 | Ga0068861_1001278642 | 298 |
| 466 | 3300005840 | Ga0068870_10033509 | Ga0068870_100335093 | 298 |
| 467 | 3300005842 | Ga0068858_100191147 | Ga0068858_1001911472 | 298 |
| 468 | 3300005985 | Ga0081539_10033921 | Ga0081539_100339213 | 298 |
| 469 | 3300006038 | Ga0075365_10043984 | Ga0075365_100439841 | 298 |
| 470 | 3300006178 | Ga0075367_10090433 | Ga0075367_100904331 | 298 |
| 471 | 3300006237 | Ga0097621_100167876 | Ga0097621_1001678762 | 298 |
| 472 | 3300006844 | Ga0075428_100016372 | Ga0075428_1000163725 | 298 |
| 473 | 3300006846 | Ga0075430_100003986 | Ga0075430_10000398612 | 298 |
| 474 | 3300006847 | Ga0075431_100022766 | Ga0075431_1000227667 | 298 |
| 475 | 3300006880 | Ga0075429_100048371 | Ga0075429_1000483716 | 298 |
| 476 | 3300006881 | Ga0068865_100019619 | Ga0068865_1000196194 | 298 |
| 477 | 3300006881 | Ga0068865_100035311 | Ga0068865_1000353114 | 298 |
| 478 | 3300006881 | Ga0068865_100217837 | Ga0068865_1002178372 | 298 |
| 479 | 3300006931 | Ga0097620_100355027 | Ga0097620_1003550272 | 298 |
| 480 | 3300009094 | Ga0111539_10006328 | Ga0111539_100063284 | 298 |
| 481 | 3300009094 | Ga0111539_10046610 | Ga0111539_100466105 | 298 |
| 482 | 3300009098 | Ga0105245_10219360 | Ga0105245_102193601 | 298 |
| 483 | 3300009098 | Ga0105245_10465027 | Ga0105245_104650272 | 298 |
| 484 | 3300009098 | Ga0105245_10516366 | Ga0105245_105163662 | 298 |
| 485 | 3300009147 | Ga0114129_10010931 | Ga0114129_1001093114 | 298 |
| 486 | 3300009148 | Ga0105243_10014099 | Ga0105243_100140997 | 298 |
| 487 | 3300009148 | Ga0105243_10016322 | Ga0105243_100163224 | 298 |
| 488 | 3300009176 | Ga0105242_10058334 | Ga0105242_100583343 | 298 |
| 489 | 3300009176 | Ga0105242_10235375 | Ga0105242_102353752 | 298 |
| 490 | 3300009177 | Ga0105248_10031669 | Ga0105248_100316694 | 298 |
| 491 | 3300009551 | Ga0105238_10384194 | Ga0105238_103841942 | 298 |
| 492 | 3300009551 | Ga0105238_10392380 | Ga0105238_103923802 | 298 |
| 493 | 3300009551 | Ga0105238_10522303 | Ga0105238_105223032 | 298 |
| 494 | 3300009553 | Ga0105249_10004469 | Ga0105249_1000446912 | 298 |
| 495 | 3300010375 | Ga0105239_10010898 | Ga0105239_100108984 | 298 |
| 496 | 3300010375 | Ga0105239_10097739 | Ga0105239_100977394 | 298 |
| 497 | 3300013102 | Ga0157371_10089881 | Ga0157371_100898813 | 298 |
| 498 | 3300013104 | Ga0157370_10195463 | Ga0157370_101954631 | 298 |
| 499 | 3300013105 | Ga0157369_10040542 | Ga0157369_100405425 | 298 |
| 500 | 3300013306 | Ga0163162_10008332 | Ga0163162_100083324 | 298 |
| 501 | 3300013306 | Ga0163162_10163280 | Ga0163162_101632803 | 298 |
| 502 | 3300013307 | Ga0157372_10015861 | Ga0157372_100158613 | 298 |
| 503 | 3300013307 | Ga0157372_10125591 | Ga0157372_101255912 | 298 |
| 504 | 3300014325 | Ga0163163_10022365 | Ga0163163_100223653 | 298 |
| 505 | 3300014325 | Ga0163163_10151041 | Ga0163163_101510412 | 298 |
| 506 | 3300014326 | Ga0157380_10002258 | Ga0157380_100022585 | 298 |
| 507 | 3300014326 | Ga0157380_10010387 | Ga0157380_100103873 | 298 |
| 508 | 3300014326 | Ga0157380_10018962 | Ga0157380_100189623 | 298 |
| 509 | 3300014326 | Ga0157380_10173312 | Ga0157380_101733123 | 298 |
| 510 | 3300014745 | Ga0157377_10003131 | Ga0157377_100031314 | 298 |
| 511 | 3300014745 | Ga0157377_10024322 | Ga0157377_100243222 | 298 |
| 512 | 3300014745 | Ga0157377_10044772 | Ga0157377_100447722 | 298 |
| 513 | 3300014745 | Ga0157377_10048662 | Ga0157377_100486621 | 298 |
| 514 | 3300025899 | Ga0207642_10008017 | Ga0207642_100080171 | 298 |
| 515 | 3300025899 | Ga0207642_10050616 | Ga0207642_100506162 | 298 |
| 516 | 3300025901 | Ga0207688_10003017 | Ga0207688_100030175 | 298 |
| 517 | 3300025901 | Ga0207688_10004230 | Ga0207688_100042306 | 298 |
| 518 | 3300025901 | Ga0207688_10008819 | Ga0207688_100088192 | 298 |
| 519 | 3300025901 | Ga0207688_10025699 | Ga0207688_100256991 | 298 |
| 520 | 3300025901 | Ga0207688_10046663 | Ga0207688_100466632 | 298 |
| 521 | 3300025904 | Ga0207647_10002481 | Ga0207647_1000248115 | 298 |
| 522 | 3300025907 | Ga0207645_10039887 | Ga0207645_100398872 | 298 |
| 523 | 3300025908 | Ga0207643_10002197 | Ga0207643_100021977 | 298 |
| 524 | 3300025908 | Ga0207643_10037108 | Ga0207643_100371082 | 298 |
| 525 | 3300025908 | Ga0207643_10061829 | Ga0207643_100618292 | 298 |
| 526 | 3300025918 | Ga0207662_10059818 | Ga0207662_100598182 | 298 |
| 527 | 3300025918 | Ga0207662_10182328 | Ga0207662_101823281 | 298 |
| 528 | 3300025919 | Ga0207657_10017941 | Ga0207657_100179415 | 298 |
| 529 | 3300025920 | Ga0207649_10166865 | Ga0207649_101668652 | 298 |
| 530 | 3300025925 | Ga0207650_10057978 | Ga0207650_100579782 | 298 |
| 531 | 3300025926 | Ga0207659_10065925 | Ga0207659_100659251 | 298 |
| 532 | 3300025926 | Ga0207659_10125442 | Ga0207659_101254422 | 298 |
| 533 | 3300025926 | Ga0207659_10174260 | Ga0207659_101742603 | 298 |
| 534 | 3300025927 | Ga0207687_10005324 | Ga0207687_100053243 | 298 |
| 535 | 3300025927 | Ga0207687_10048229 | Ga0207687_100482293 | 298 |
| 536 | 3300025932 | Ga0207690_10023754 | Ga0207690_100237543 | 298 |
| 537 | 3300025932 | Ga0207690_10069857 | Ga0207690_100698572 | 298 |
| 538 | 3300025933 | Ga0207706_10017268 | Ga0207706_100172685 | 298 |
| 539 | 3300025933 | Ga0207706_10111560 | Ga0207706_101115602 | 298 |
| 540 | 3300025935 | Ga0207709_10025235 | Ga0207709_100252353 | 298 |
| 541 | 3300025935 | Ga0207709_10065834 | Ga0207709_100658341 | 298 |
| 542 | 3300025935 | Ga0207709_10105337 | Ga0207709_101053373 | 298 |
| 543 | 3300025937 | Ga0207669_10011553 | Ga0207669_100115535 | 298 |
| 544 | 3300025937 | Ga0207669_10058131 | Ga0207669_100581311 | 298 |
| 545 | 3300025938 | Ga0207704_10007814 | Ga0207704_100078142 | 298 |
| 546 | 3300025938 | Ga0207704_10029538 | Ga0207704_100295381 | 298 |
| 547 | 3300025938 | Ga0207704_10112401 | Ga0207704_101124012 | 298 |
| 548 | 3300025940 | Ga0207691_10018659 | Ga0207691_100186594 | 298 |
| 549 | 3300025940 | Ga0207691_10019738 | Ga0207691_100197385 | 298 |
| 550 | 3300025940 | Ga0207691_10059202 | Ga0207691_100592022 | 298 |
| 551 | 3300025941 | Ga0207711_10220691 | Ga0207711_102206912 | 298 |
| 552 | 3300025942 | Ga0207689_10079973 | Ga0207689_100799733 | 298 |
| 553 | 3300025942 | Ga0207689_10101864 | Ga0207689_101018643 | 298 |
| 554 | 3300025942 | Ga0207689_10183994 | Ga0207689_101839942 | 298 |
| 555 | 3300025944 | Ga0207661_10007007 | Ga0207661_100070075 | 298 |
| 556 | 3300025944 | Ga0207661_10324600 | Ga0207661_103246002 | 298 |
| 557 | 3300025944 | Ga0207661_10385443 | Ga0207661_103854432 | 298 |
| 558 | 3300025945 | Ga0207679_10090932 | Ga0207679_100909323 | 298 |
| 559 | 3300025972 | Ga0207668_10078002 | Ga0207668_100780022 | 298 |
| 560 | 3300025981 | Ga0207640_10120662 | Ga0207640_101206621 | 298 |
| 561 | 3300026023 | Ga0207677_10245429 | Ga0207677_102454292 | 298 |
| 562 | 3300026023 | Ga0207677_10273173 | Ga0207677_102731732 | 298 |
| 563 | 3300026023 | Ga0207677_10493475 | Ga0207677_104934751 | 298 |
| 564 | 3300026067 | Ga0207678_10041186 | Ga0207678_100411864 | 298 |
| 565 | 3300026075 | Ga0207708_10001046 | Ga0207708_1000104613 | 298 |
| 566 | 3300026075 | Ga0207708_10004147 | Ga0207708_100041478 | 298 |
| 567 | 3300026075 | Ga0207708_10004999 | Ga0207708_100049996 | 298 |
| 568 | 3300026075 | Ga0207708_10057384 | Ga0207708_100573842 | 298 |
| 569 | 3300026089 | Ga0207648_10003947 | Ga0207648_1000394712 | 298 |
| 570 | 3300026089 | Ga0207648_10004176 | Ga0207648_100041765 | 298 |
| 571 | 3300026089 | Ga0207648_10057841 | Ga0207648_100578413 | 298 |
| 572 | 3300026116 | Ga0207674_10120916 | Ga0207674_101209162 | 298 |
| 573 | 3300026116 | Ga0207674_10305772 | Ga0207674_103057722 | 298 |
| 574 | 3300026118 | Ga0207675_100004206 | Ga0207675_10000420610 | 298 |
| 575 | 3300026118 | Ga0207675_100004892 | Ga0207675_10000489212 | 298 |
| 576 | 3300026118 | Ga0207675_100082762 | Ga0207675_1000827621 | 298 |
| 577 | 3300026121 | Ga0207683_10053839 | Ga0207683_100538391 | 298 |
| 578 | 3300026121 | Ga0207683_10308097 | Ga0207683_103080972 | 298 |
| 579 | 3300026142 | Ga0207698_10176518 | Ga0207698_101765181 | 298 |
| 580 | 3300026142 | Ga0207698_10239967 | Ga0207698_102399671 | 298 |
| 581 | 3300027907 | Ga0207428_10051545 | Ga0207428_100515454 | 298 |
| 582 | 3300028379 | Ga0268266_10111075 | Ga0268266_101110752 | 298 |
| 583 | 3300031456 | Ga0307513_10015532 | Ga0307513_100155325 | 298 |
| 584 | 3300031548 | Ga0307408_100407527 | Ga0307408_1004075272 | 298 |
| 585 | 3300031731 | Ga0307405_10245022 | Ga0307405_102450221 | 298 |
| 586 | 3300031731 | Ga0307405_10350770 | Ga0307405_103507701 | 298 |
| 587 | 3300031731 | Ga0307405_10360050 | Ga0307405_103600501 | 298 |
| 588 | 3300031824 | Ga0307413_10057435 | Ga0307413_100574352 | 298 |
| 589 | 3300031852 | Ga0307410_10010750 | Ga0307410_100107506 | 298 |
| 590 | 3300031852 | Ga0307410_10116988 | Ga0307410_101169883 | 298 |
| 591 | 3300031852 | Ga0307410_10250395 | Ga0307410_102503951 | 298 |
| 592 | 3300031901 | Ga0307406_10048409 | Ga0307406_100484093 | 298 |
| 593 | 3300031901 | Ga0307406_10084938 | Ga0307406_100849382 | 298 |
| 594 | 3300031903 | Ga0307407_10017500 | Ga0307407_100175003 | 298 |
| 595 | 3300031903 | Ga0307407_10244465 | Ga0307407_102444651 | 298 |
| 596 | 3300031911 | Ga0307412_10345772 | Ga0307412_103457722 | 298 |
| 597 | 3300031911 | Ga0307412_10498430 | Ga0307412_104984301 | 298 |
| 598 | 3300031995 | Ga0307409_100009889 | Ga0307409_1000098896 | 298 |
| 599 | 3300031995 | Ga0307409_100108515 | Ga0307409_1001085153 | 298 |
| 600 | 3300031995 | Ga0307409_100215701 | Ga0307409_1002157012 | 298 |
| 601 | 3300031995 | Ga0307409_100254681 | Ga0307409_1002546812 | 298 |
| 602 | 3300031995 | Ga0307409_100437613 | Ga0307409_1004376132 | 298 |
| 603 | 3300031995 | Ga0307409_100492582 | Ga0307409_1004925822 | 298 |
| 604 | 3300032005 | Ga0307411_10221500 | Ga0307411_102215002 | 298 |
| 605 | 3300032126 | Ga0307415_100089941 | Ga0307415_1000899412 | 298 |
| 606 | 3300032126 | Ga0307415_100118290 | Ga0307415_1001182902 | 298 |
| 607 | 3300044683 | Ga0466965_0000459 | Ga0466965_0000459_1874_2791 | 298 |
| 608 | 3300044706 | Ga0466964_0048533 | Ga0466964_0048533_404_1300 | 298 |
| 609 | 3300045976 | Ga0466967_0003975 | Ga0466967_0003975_8037_8933 | 298 |
| 610 | 3300046459 | Ga0495629_0161015 | Ga0495629_0161015_139_1035 | 298 |
| 611 | 3300046461 | Ga0495641_0080767 | Ga0495641_0080767_416_1312 | 298 |
| 612 | 3300046463 | Ga0495653_0165079 | Ga0495653_0165079_51_947 | 298 |
| 613 | 3300048905 | Ga0496102_0002619 | Ga0496102_0002619_11791_12687 | 298 |
| 614 | 3300048907 | Ga0496104_0222010 | Ga0496104_0222010_881_1777 | 298 |
| 615 | 3300048908 | Ga0496105_0112375 | Ga0496105_0112375_908_1804 | 298 |
| 616 | 3300048908 | Ga0496105_0163927 | Ga0496105_0163927_285_1184 | 298 |
| 617 | 3300048911 | Ga0496108_0019824 | Ga0496108_0019824_1792_2691 | 298 |
| 618 | 3300048911 | Ga0496108_0057158 | Ga0496108_0057158_152_1048 | 298 |
| 619 | 3300048912 | Ga0496109_0058785 | Ga0496109_0058785_666_1562 | 298 |
| 620 | 3300048912 | Ga0496109_0242584 | Ga0496109_0242584_174_1070 | 298 |
| 621 | 3300048912 | Ga0496109_0583580 | Ga0496109_0583580_142_1038 | 298 |
| 622 | 3300048913 | Ga0496110_0006612 | Ga0496110_0006612_3348_4247 | 298 |
| 623 | 3300048913 | Ga0496110_0012958 | Ga0496110_0012958_5710_6606 | 298 |
| 624 | 3300048913 | Ga0496110_0310798 | Ga0496110_0310798_277_1173 | 298 |
| 625 | 3300048915 | Ga0496112_0206213 | Ga0496112_0206213_1006_1902 | 298 |
| 626 | 3300048917 | Ga0496114_0074275 | Ga0496114_0074275_804_1700 | 298 |
| 627 | 3300048917 | Ga0496114_0107067 | Ga0496114_0107067_397_1293 | 298 |
| 628 | 3300048917 | Ga0496114_0216338 | Ga0496114_0216338_276_1172 | 298 |
| 629 | 3300048917 | Ga0496114_0463582 | Ga0496114_0463582_95_1003 | 298 |
| 630 | 3300049568 | Ga0501031_0019479 | Ga0501031_0019479_2109_3014 | 298 |
| 631 | 3300049568 | Ga0501031_0056192 | Ga0501031_0056192_1467_2363 | 298 |
| 632 | 3300049568 | Ga0501031_0091406 | Ga0501031_0091406_519_1424 | 298 |
| 633 | 3300049571 | Ga0501034_0054748 | Ga0501034_0054748_554_1450 | 298 |
| 634 | 3300049573 | Ga0501037_0105898 | Ga0501037_0105898_568_1473 | 298 |
| 635 | 3300049576 | Ga0501040_0232480 | Ga0501040_0232480_105_1010 | 298 |
| 636 | 3300049583 | Ga0501067_0060698 | Ga0501067_0060698_1036_1932 | 298 |
| 637 | 3300049585 | Ga0501069_0017089 | Ga0501069_0017089_1895_2791 | 298 |
| 638 | 3300049585 | Ga0501069_0095019 | Ga0501069_0095019_47_943 | 298 |
| 639 | 3300049585 | Ga0501069_0137160 | Ga0501069_0137160_46_954 | 298 |
| 640 | 3300049586 | Ga0501070_0004279 | Ga0501070_0004279_2545_3453 | 298 |
| 641 | 3300049586 | Ga0501070_0222332 | Ga0501070_0222332_532_1428 | 298 |
| 642 | 3300049587 | Ga0501071_0005962 | Ga0501071_0005962_529_1425 | 298 |
| 643 | 3300049587 | Ga0501071_0222462 | Ga0501071_0222462_430_1386 | 298 |
| 644 | 3300049588 | Ga0501072_0111824 | Ga0501072_0111824_811_1707 | 298 |
| 645 | 3300049590 | Ga0501074_0008026 | Ga0501074_0008026_6359_7267 | 298 |
| 646 | 3300049593 | Ga0501077_0009576 | Ga0501077_0009576_2678_3574 | 298 |
| 647 | 3300049741 | Ga0501079_0093028 | Ga0501079_0093028_854_1762 | 298 |
| 648 | 3300049742 | Ga0501080_0029465 | Ga0501080_0029465_604_1500 | 298 |
| 649 | 3300049824 | Ga0501045_0114517 | Ga0501045_0114517_135_1040 | 298 |
| 650 | 3300050507 | nmdc:mga05p37_147426_c1 | nmdc:mga05p37_147426_c1_371_1267 | 298 |
| 651 | 3300050508 | nmdc:mga09592_291569_c1 | nmdc:mga09592_291569_c1_210_1106 | 298 |
| 652 | 3300050510 | nmdc:mga06r32_15209_c1 | nmdc:mga06r32_15209_c1_5881_6777 | 298 |
| 653 | 3300050511 | nmdc:mga08y16_101083_c1 | nmdc:mga08y16_101083_c1_889_1785 | 298 |
| 654 | 3300050511 | nmdc:mga08y16_426063_c1 | nmdc:mga08y16_426063_c1_168_1100 | 298 |
| 655 | 3300053085 | Ga0495619_0340286 | Ga0495619_0340286_74_970 | 298 |
| 656 | 3300060353 | Ga0501082_0046676 | Ga0501082_0046676_2288_3184 | 298 |
| 657 | iso_pu_bacteria | 2643221567 | 2643850090 | 298 |
| 658 | iso_pu_bacteria | 2643221624 | 2644136092 | 298 |
| 659 | 3300001915 | JGI24741J21665_1009250 | JGI24741J21665_10092501 | 299 |
| 660 | 3300001976 | JGI24752J21851_1003606 | JGI24752J21851_10036061 | 299 |
| 661 | 3300001979 | JGI24740J21852_10016912 | JGI24740J21852_100169123 | 299 |
| 662 | 3300001989 | JGI24739J22299_10024977 | JGI24739J22299_100249773 | 299 |
| 663 | 3300002075 | JGI24738J21930_10012282 | JGI24738J21930_100122821 | 299 |
| 664 | 3300002459 | JGI24751J29686_10009083 | JGI24751J29686_100090832 | 299 |
| 665 | 3300005331 | Ga0070670_100030720 | Ga0070670_1000307202 | 299 |
| 666 | 3300005334 | Ga0068869_100101416 | Ga0068869_1001014162 | 299 |
| 667 | 3300005335 | Ga0070666_10111673 | Ga0070666_101116731 | 299 |
| 668 | 3300005336 | Ga0070680_100086487 | Ga0070680_1000864873 | 299 |
| 669 | 3300005338 | Ga0068868_100155424 | Ga0068868_1001554242 | 299 |
| 670 | 3300005338 | Ga0068868_100337182 | Ga0068868_1003371821 | 299 |
| 671 | 3300005341 | Ga0070691_10008438 | Ga0070691_100084382 | 299 |
| 672 | 3300005343 | Ga0070687_100170331 | Ga0070687_1001703312 | 299 |
| 673 | 3300005344 | Ga0070661_100083997 | Ga0070661_1000839972 | 299 |
| 674 | 3300005345 | Ga0070692_10031200 | Ga0070692_100312003 | 299 |
| 675 | 3300005353 | Ga0070669_100113295 | Ga0070669_1001132953 | 299 |
| 676 | 3300005354 | Ga0070675_100201298 | Ga0070675_1002012982 | 299 |
| 677 | 3300005355 | Ga0070671_100284606 | Ga0070671_1002846062 | 299 |
| 678 | 3300005356 | Ga0070674_100064123 | Ga0070674_1000641231 | 299 |
| 679 | 3300005367 | Ga0070667_100105794 | Ga0070667_1001057943 | 299 |
| 680 | 3300005434 | Ga0070709_10018818 | Ga0070709_100188181 | 299 |
| 681 | 3300005434 | Ga0070709_10219397 | Ga0070709_102193972 | 299 |
| 682 | 3300005434 | Ga0070709_10226601 | Ga0070709_102266011 | 299 |
| 683 | 3300005434 | Ga0070709_10318096 | Ga0070709_103180961 | 299 |
| 684 | 3300005435 | Ga0070714_100145978 | Ga0070714_1001459781 | 299 |
| 685 | 3300005435 | Ga0070714_100351591 | Ga0070714_1003515912 | 299 |
| 686 | 3300005436 | Ga0070713_100499694 | Ga0070713_1004996941 | 299 |
| 687 | 3300005437 | Ga0070710_10033092 | Ga0070710_100330923 | 299 |
| 688 | 3300005437 | Ga0070710_10196074 | Ga0070710_101960741 | 299 |
| 689 | 3300005438 | Ga0070701_10013161 | Ga0070701_100131614 | 299 |
| 690 | 3300005439 | Ga0070711_100107191 | Ga0070711_1001071911 | 299 |
| 691 | 3300005439 | Ga0070711_100305484 | Ga0070711_1003054841 | 299 |
| 692 | 3300005439 | Ga0070711_100518832 | Ga0070711_1005188321 | 299 |
| 693 | 3300005440 | Ga0070705_100173239 | Ga0070705_1001732392 | 299 |
| 694 | 3300005441 | Ga0070700_100074634 | Ga0070700_1000746342 | 299 |
| 695 | 3300005456 | Ga0070678_100152184 | Ga0070678_1001521841 | 299 |
| 696 | 3300005458 | Ga0070681_10216441 | Ga0070681_102164412 | 299 |
| 697 | 3300005467 | Ga0070706_100417038 | Ga0070706_1004170381 | 299 |
| 698 | 3300005530 | Ga0070679_100079751 | Ga0070679_1000797512 | 299 |
| 699 | 3300005535 | Ga0070684_100084213 | Ga0070684_1000842133 | 299 |
| 700 | 3300005535 | Ga0070684_100104682 | Ga0070684_1001046823 | 299 |
| 701 | 3300005539 | Ga0068853_100332806 | Ga0068853_1003328062 | 299 |
| 702 | 3300005539 | Ga0068853_100332826 | Ga0068853_1003328262 | 299 |
| 703 | 3300005547 | Ga0070693_100140788 | Ga0070693_1001407881 | 299 |
| 704 | 3300005548 | Ga0070665_100001051 | Ga0070665_1000010512 | 299 |
| 705 | 3300005563 | Ga0068855_100250575 | Ga0068855_1002505752 | 299 |
| 706 | 3300005563 | Ga0068855_100672769 | Ga0068855_1006727691 | 299 |
| 707 | 3300005563 | Ga0068855_100833010 | Ga0068855_1008330101 | 299 |
| 708 | 3300005577 | Ga0068857_100067847 | Ga0068857_1000678472 | 299 |
| 709 | 3300005577 | Ga0068857_100108497 | Ga0068857_1001084972 | 299 |
| 710 | 3300005578 | Ga0068854_100380884 | Ga0068854_1003808842 | 299 |
| 711 | 3300005578 | Ga0068854_100470469 | Ga0068854_1004704691 | 299 |
| 712 | 3300005615 | Ga0070702_100139491 | Ga0070702_1001394912 | 299 |
| 713 | 3300005616 | Ga0068852_100349429 | Ga0068852_1003494292 | 299 |
| 714 | 3300005617 | Ga0068859_100205012 | Ga0068859_1002050123 | 299 |
| 715 | 3300005617 | Ga0068859_100612565 | Ga0068859_1006125651 | 299 |
| 716 | 3300005618 | Ga0068864_100107890 | Ga0068864_1001078902 | 299 |
| 717 | 3300005719 | Ga0068861_100029179 | Ga0068861_1000291793 | 299 |
| 718 | 3300005719 | Ga0068861_100116466 | Ga0068861_1001164662 | 299 |
| 719 | 3300005719 | Ga0068861_100158172 | Ga0068861_1001581722 | 299 |
| 720 | 3300005841 | Ga0068863_100380823 | Ga0068863_1003808231 | 299 |
| 721 | 3300005842 | Ga0068858_100094287 | Ga0068858_1000942872 | 299 |
| 722 | 3300005844 | Ga0068862_100216380 | Ga0068862_1002163802 | 299 |
| 723 | 3300005937 | Ga0081455_10071377 | Ga0081455_100713773 | 299 |
| 724 | 3300005983 | Ga0081540_1025012 | Ga0081540_10250121 | 299 |
| 725 | 3300006028 | Ga0070717_10098364 | Ga0070717_100983643 | 299 |
| 726 | 3300006028 | Ga0070717_10375462 | Ga0070717_103754622 | 299 |
| 727 | 3300006038 | Ga0075365_10112732 | Ga0075365_101127322 | 299 |
| 728 | 3300006042 | Ga0075368_10031645 | Ga0075368_100316452 | 299 |
| 729 | 3300006048 | Ga0075363_100000416 | Ga0075363_1000004169 | 299 |
| 730 | 3300006048 | Ga0075363_100079254 | Ga0075363_1000792541 | 299 |
| 731 | 3300006051 | Ga0075364_10008594 | Ga0075364_100085942 | 299 |
| 732 | 3300006051 | Ga0075364_10073802 | Ga0075364_100738022 | 299 |
| 733 | 3300006163 | Ga0070715_10011892 | Ga0070715_100118922 | 299 |
| 734 | 3300006173 | Ga0070716_100192595 | Ga0070716_1001925952 | 299 |
| 735 | 3300006175 | Ga0070712_100069159 | Ga0070712_1000691592 | 299 |
| 736 | 3300006175 | Ga0070712_100111253 | Ga0070712_1001112531 | 299 |
| 737 | 3300006175 | Ga0070712_100169574 | Ga0070712_1001695742 | 299 |
| 738 | 3300006175 | Ga0070712_100500521 | Ga0070712_1005005211 | 299 |
| 739 | 3300006178 | Ga0075367_10010955 | Ga0075367_100109555 | 299 |
| 740 | 3300006178 | Ga0075367_10080839 | Ga0075367_100808392 | 299 |
| 741 | 3300006237 | Ga0097621_100086442 | Ga0097621_1000864423 | 299 |
| 742 | 3300006353 | Ga0075370_10032220 | Ga0075370_100322203 | 299 |
| 743 | 3300006844 | Ga0075428_100800667 | Ga0075428_1008006671 | 299 |
| 744 | 3300006847 | Ga0075431_100141258 | Ga0075431_1001412583 | 299 |
| 745 | 3300006852 | Ga0075433_10088568 | Ga0075433_100885682 | 299 |
| 746 | 3300006931 | Ga0097620_100205006 | Ga0097620_1002050061 | 299 |
| 747 | 3300006931 | Ga0097620_100612567 | Ga0097620_1006125671 | 299 |
| 748 | 3300009094 | Ga0111539_10048292 | Ga0111539_100482924 | 299 |
| 749 | 3300009094 | Ga0111539_10373232 | Ga0111539_103732322 | 299 |
| 750 | 3300009094 | Ga0111539_10460281 | Ga0111539_104602812 | 299 |
| 751 | 3300009094 | Ga0111539_10490536 | Ga0111539_104905362 | 299 |
| 752 | 3300009098 | Ga0105245_10163601 | Ga0105245_101636012 | 299 |
| 753 | 3300009148 | Ga0105243_10224463 | Ga0105243_102244632 | 299 |
| 754 | 3300009176 | Ga0105242_10451169 | Ga0105242_104511692 | 299 |
| 755 | 3300009177 | Ga0105248_10200240 | Ga0105248_102002402 | 299 |
| 756 | 3300009177 | Ga0105248_10279932 | Ga0105248_102799322 | 299 |
| 757 | 3300009545 | Ga0105237_10033781 | Ga0105237_100337812 | 299 |
| 758 | 3300009545 | Ga0105237_10393879 | Ga0105237_103938792 | 299 |
| 759 | 3300009551 | Ga0105238_10044672 | Ga0105238_100446723 | 299 |
| 760 | 3300009551 | Ga0105238_10268573 | Ga0105238_102685731 | 299 |
| 761 | 3300009553 | Ga0105249_10347224 | Ga0105249_103472242 | 299 |
| 762 | 3300010375 | Ga0105239_10156809 | Ga0105239_101568094 | 299 |
| 763 | 3300010375 | Ga0105239_10503710 | Ga0105239_105037102 | 299 |
| 764 | 3300011119 | Ga0105246_10090788 | Ga0105246_100907882 | 299 |
| 765 | 3300012480 | Ga0157346_1000863 | Ga0157346_10008632 | 299 |
| 766 | 3300013105 | Ga0157369_10338537 | Ga0157369_103385372 | 299 |
| 767 | 3300013105 | Ga0157369_10387946 | Ga0157369_103879461 | 299 |
| 768 | 3300013105 | Ga0157369_10838189 | Ga0157369_108381891 | 299 |
| 769 | 3300013306 | Ga0163162_10185897 | Ga0163162_101858972 | 299 |
| 770 | 3300013307 | Ga0157372_10000025 | Ga0157372_10000025182 | 299 |
| 771 | 3300013307 | Ga0157372_10403120 | Ga0157372_104031201 | 299 |
| 772 | 3300013307 | Ga0157372_10697150 | Ga0157372_106971502 | 299 |
| 773 | 3300013308 | Ga0157375_10058354 | Ga0157375_100583541 | 299 |
| 774 | 3300014325 | Ga0163163_10067546 | Ga0163163_100675463 | 299 |
| 775 | 3300014325 | Ga0163163_10129195 | Ga0163163_101291952 | 299 |
| 776 | 3300014326 | Ga0157380_10351377 | Ga0157380_103513772 | 299 |
| 777 | 3300014969 | Ga0157376_10263359 | Ga0157376_102633592 | 299 |
| 778 | 3300020081 | Ga0206354_10058287 | Ga0206354_100582871 | 299 |
| 779 | 3300020082 | Ga0206353_10418635 | Ga0206353_104186352 | 299 |
| 780 | 3300020082 | Ga0206353_11712015 | Ga0206353_117120153 | 299 |
| 781 | 3300025898 | Ga0207692_10012583 | Ga0207692_100125834 | 299 |
| 782 | 3300025898 | Ga0207692_10056314 | Ga0207692_100563141 | 299 |
| 783 | 3300025898 | Ga0207692_10156153 | Ga0207692_101561531 | 299 |
| 784 | 3300025901 | Ga0207688_10015048 | Ga0207688_100150482 | 299 |
| 785 | 3300025906 | Ga0207699_10044113 | Ga0207699_100441132 | 299 |
| 786 | 3300025906 | Ga0207699_10053763 | Ga0207699_100537632 | 299 |
| 787 | 3300025906 | Ga0207699_10199098 | Ga0207699_101990982 | 299 |
| 788 | 3300025908 | Ga0207643_10023134 | Ga0207643_100231344 | 299 |
| 789 | 3300025910 | Ga0207684_10247373 | Ga0207684_102473732 | 299 |
| 790 | 3300025912 | Ga0207707_10160407 | Ga0207707_101604071 | 299 |
| 791 | 3300025914 | Ga0207671_10028511 | Ga0207671_100285112 | 299 |
| 792 | 3300025915 | Ga0207693_10127068 | Ga0207693_101270681 | 299 |
| 793 | 3300025915 | Ga0207693_10464635 | Ga0207693_104646351 | 299 |
| 794 | 3300025916 | Ga0207663_10009729 | Ga0207663_100097293 | 299 |
| 795 | 3300025916 | Ga0207663_10035696 | Ga0207663_100356962 | 299 |
| 796 | 3300025916 | Ga0207663_10140756 | Ga0207663_101407562 | 299 |
| 797 | 3300025916 | Ga0207663_10259046 | Ga0207663_102590461 | 299 |
| 798 | 3300025917 | Ga0207660_10482565 | Ga0207660_104825651 | 299 |
| 799 | 3300025918 | Ga0207662_10009033 | Ga0207662_100090334 | 299 |
| 800 | 3300025919 | Ga0207657_10030851 | Ga0207657_100308512 | 299 |
| 801 | 3300025921 | Ga0207652_10036477 | Ga0207652_100364773 | 299 |
| 802 | 3300025924 | Ga0207694_10231719 | Ga0207694_102317192 | 299 |
| 803 | 3300025925 | Ga0207650_10001714 | Ga0207650_1000171412 | 299 |
| 804 | 3300025927 | Ga0207687_10283889 | Ga0207687_102838891 | 299 |
| 805 | 3300025928 | Ga0207700_10011354 | Ga0207700_100113544 | 299 |
| 806 | 3300025928 | Ga0207700_10022238 | Ga0207700_100222382 | 299 |
| 807 | 3300025928 | Ga0207700_10146230 | Ga0207700_101462301 | 299 |
| 808 | 3300025928 | Ga0207700_10192090 | Ga0207700_101920901 | 299 |
| 809 | 3300025928 | Ga0207700_10586713 | Ga0207700_105867131 | 299 |
| 810 | 3300025929 | Ga0207664_10047751 | Ga0207664_100477511 | 299 |
| 811 | 3300025929 | Ga0207664_10122731 | Ga0207664_101227312 | 299 |
| 812 | 3300025929 | Ga0207664_10169166 | Ga0207664_101691662 | 299 |
| 813 | 3300025929 | Ga0207664_10181658 | Ga0207664_101816582 | 299 |
| 814 | 3300025929 | Ga0207664_10292201 | Ga0207664_102922012 | 299 |
| 815 | 3300025931 | Ga0207644_10043005 | Ga0207644_100430053 | 299 |
| 816 | 3300025932 | Ga0207690_10107677 | Ga0207690_101076771 | 299 |
| 817 | 3300025934 | Ga0207686_10057573 | Ga0207686_100575733 | 299 |
| 818 | 3300025939 | Ga0207665_10071309 | Ga0207665_100713092 | 299 |
| 819 | 3300025942 | Ga0207689_10088140 | Ga0207689_100881402 | 299 |
| 820 | 3300025944 | Ga0207661_10013156 | Ga0207661_100131562 | 299 |
| 821 | 3300025944 | Ga0207661_10071722 | Ga0207661_100717222 | 299 |
| 822 | 3300025944 | Ga0207661_10163734 | Ga0207661_101637342 | 299 |
| 823 | 3300025945 | Ga0207679_10015370 | Ga0207679_100153701 | 299 |
| 824 | 3300025961 | Ga0207712_10214647 | Ga0207712_102146472 | 299 |
| 825 | 3300026023 | Ga0207677_10039878 | Ga0207677_100398782 | 299 |
| 826 | 3300026023 | Ga0207677_10099542 | Ga0207677_100995423 | 299 |
| 827 | 3300026035 | Ga0207703_10081187 | Ga0207703_100811872 | 299 |
| 828 | 3300026041 | Ga0207639_10089865 | Ga0207639_100898652 | 299 |
| 829 | 3300026067 | Ga0207678_10000105 | Ga0207678_1000010567 | 299 |
| 830 | 3300026075 | Ga0207708_10000436 | Ga0207708_100004365 | 299 |
| 831 | 3300026078 | Ga0207702_10068760 | Ga0207702_100687603 | 299 |
| 832 | 3300026088 | Ga0207641_10055170 | Ga0207641_100551702 | 299 |
| 833 | 3300026095 | Ga0207676_10002083 | Ga0207676_100020833 | 299 |
| 834 | 3300026095 | Ga0207676_10503258 | Ga0207676_105032581 | 299 |
| 835 | 3300026116 | Ga0207674_10019540 | Ga0207674_100195402 | 299 |
| 836 | 3300026116 | Ga0207674_10135832 | Ga0207674_101358322 | 299 |
| 837 | 3300026118 | Ga0207675_100526758 | Ga0207675_1005267581 | 299 |
| 838 | 3300026121 | Ga0207683_10021359 | Ga0207683_100213594 | 299 |
| 839 | 3300026121 | Ga0207683_10043229 | Ga0207683_100432292 | 299 |
| 840 | 3300026142 | Ga0207698_10129947 | Ga0207698_101299472 | 299 |
| 841 | 3300027866 | Ga0209813_10003987 | Ga0209813_100039872 | 299 |
| 842 | 3300027866 | Ga0209813_10061192 | Ga0209813_100611921 | 299 |
| 843 | 3300027907 | Ga0207428_10030127 | Ga0207428_100301271 | 299 |
| 844 | 3300027907 | Ga0207428_10335457 | Ga0207428_103354571 | 299 |
| 845 | 3300028379 | Ga0268266_10144612 | Ga0268266_101446122 | 299 |
| 846 | 3300028380 | Ga0268265_10179938 | Ga0268265_101799381 | 299 |
| 847 | 3300028381 | Ga0268264_10000242 | Ga0268264_1000024288 | 299 |
| 848 | 3300028381 | Ga0268264_10039308 | Ga0268264_100393085 | 299 |
| 849 | 3300031247 | Ga0265340_10000537 | Ga0265340_1000053713 | 299 |
| 850 | 3300031456 | Ga0307513_10092563 | Ga0307513_100925632 | 299 |
| 851 | 3300031548 | Ga0307408_100427210 | Ga0307408_1004272101 | 299 |
| 852 | 3300031731 | Ga0307405_10142180 | Ga0307405_101421802 | 299 |
| 853 | 3300031824 | Ga0307413_10041923 | Ga0307413_100419233 | 299 |
| 854 | 3300031824 | Ga0307413_10139104 | Ga0307413_101391042 | 299 |
| 855 | 3300031824 | Ga0307413_10170290 | Ga0307413_101702902 | 299 |
| 856 | 3300031852 | Ga0307410_10006651 | Ga0307410_100066513 | 299 |
| 857 | 3300031852 | Ga0307410_10018682 | Ga0307410_100186822 | 299 |
| 858 | 3300031852 | Ga0307410_10087383 | Ga0307410_100873832 | 299 |
| 859 | 3300031852 | Ga0307410_10342705 | Ga0307410_103427052 | 299 |
| 860 | 3300031852 | Ga0307410_10388316 | Ga0307410_103883162 | 299 |
| 861 | 3300031901 | Ga0307406_10031477 | Ga0307406_100314772 | 299 |
| 862 | 3300031901 | Ga0307406_10104163 | Ga0307406_101041632 | 299 |
| 863 | 3300031901 | Ga0307406_10288210 | Ga0307406_102882102 | 299 |
| 864 | 3300031903 | Ga0307407_10004673 | Ga0307407_100046734 | 299 |
| 865 | 3300031903 | Ga0307407_10010415 | Ga0307407_100104152 | 299 |
| 866 | 3300031903 | Ga0307407_10015197 | Ga0307407_100151972 | 299 |
| 867 | 3300031903 | Ga0307407_10016371 | Ga0307407_100163715 | 299 |
| 868 | 3300031903 | Ga0307407_10062237 | Ga0307407_100622372 | 299 |
| 869 | 3300031995 | Ga0307409_100016694 | Ga0307409_1000166944 | 299 |
| 870 | 3300031995 | Ga0307409_100030018 | Ga0307409_1000300182 | 299 |
| 871 | 3300031995 | Ga0307409_100038144 | Ga0307409_1000381442 | 299 |
| 872 | 3300031995 | Ga0307409_100060483 | Ga0307409_1000604834 | 299 |
| 873 | 3300031995 | Ga0307409_100063299 | Ga0307409_1000632992 | 299 |
| 874 | 3300031995 | Ga0307409_100097167 | Ga0307409_1000971672 | 299 |
| 875 | 3300031995 | Ga0307409_100240713 | Ga0307409_1002407132 | 299 |
| 876 | 3300031995 | Ga0307409_100440840 | Ga0307409_1004408402 | 299 |
| 877 | 3300032002 | Ga0307416_100002883 | Ga0307416_1000028838 | 299 |
| 878 | 3300032002 | Ga0307416_100012921 | Ga0307416_1000129213 | 299 |
| 879 | 3300032002 | Ga0307416_100048729 | Ga0307416_1000487294 | 299 |
| 880 | 3300032002 | Ga0307416_100051207 | Ga0307416_1000512073 | 299 |
| 881 | 3300032002 | Ga0307416_100065621 | Ga0307416_1000656212 | 299 |
| 882 | 3300032002 | Ga0307416_100186307 | Ga0307416_1001863072 | 299 |
| 883 | 3300032005 | Ga0307411_10068352 | Ga0307411_100683522 | 299 |
| 884 | 3300032005 | Ga0307411_10076823 | Ga0307411_100768232 | 299 |
| 885 | 3300032005 | Ga0307411_10095665 | Ga0307411_100956652 | 299 |
| 886 | 3300032126 | Ga0307415_100007652 | Ga0307415_1000076522 | 299 |
| 887 | 3300032126 | Ga0307415_100009492 | Ga0307415_1000094925 | 299 |
| 888 | 3300032126 | Ga0307415_100021802 | Ga0307415_1000218021 | 299 |
| 889 | 3300032126 | Ga0307415_100026466 | Ga0307415_1000264662 | 299 |
| 890 | 3300032126 | Ga0307415_100089813 | Ga0307415_1000898132 | 299 |
| 891 | 3300032126 | Ga0307415_100107507 | Ga0307415_1001075073 | 299 |
| 892 | 3300032126 | Ga0307415_100620128 | Ga0307415_1006201281 | 299 |
| 893 | 3300034957 | Ga0373938_0031409 | Ga0373938_0031409_204_1103 | 299 |
| 894 | 3300035083 | Ga0373926_0027830 | Ga0373926_0027830_322_1257 | 299 |
| 895 | 3300035086 | Ga0373934_0002754 | Ga0373934_0002754_4855_5754 | 299 |
| 896 | 3300035089 | Ga0373944_0011334 | Ga0373944_0011334_1012_1947 | 299 |
| 897 | 3300035111 | Ga0373923_0023500 | Ga0373923_0023500_583_1482 | 299 |
| 898 | 3300035111 | Ga0373923_0055474 | Ga0373923_0055474_636_1571 | 299 |
| 899 | 3300035113 | Ga0373936_0026431 | Ga0373936_0026431_982_1917 | 299 |
| 900 | 3300035113 | Ga0373936_0055578 | Ga0373936_0055578_320_1219 | 299 |
| 901 | 3300035116 | Ga0373945_0039542 | Ga0373945_0039542_736_1671 | 299 |
| 902 | 3300035117 | Ga0373953_0000821 | Ga0373953_0000821_3046_3945 | 299 |
| 903 | 3300035118 | Ga0373954_0001563 | Ga0373954_0001563_2479_3378 | 299 |
| 904 | 3300035119 | Ga0373956_0003221 | Ga0373956_0003221_1063_1962 | 299 |
| 905 | 3300035120 | Ga0373957_0001428 | Ga0373957_0001428_81_1016 | 299 |
| 906 | 3300035170 | Ga0373943_0048468 | Ga0373943_0048468_973_1908 | 299 |
| 907 | 3300035171 | Ga0373946_0013175 | Ga0373946_0013175_2135_3034 | 299 |
| 908 | 3300035172 | Ga0373955_0082888 | Ga0373955_0082888_230_1165 | 299 |
| 909 | 3300035172 | Ga0373955_0108511 | Ga0373955_0108511_320_1219 | 299 |
| 910 | 3300035410 | Ga0373924_0016500 | Ga0373924_0016500_1907_2806 | 299 |
| 911 | 3300035695 | Ga0373927_0040940 | Ga0373927_0040940_1700_2599 | 299 |
| 912 | 3300035724 | Ga0373933_0005000 | Ga0373933_0005000_384_1283 | 299 |
| 913 | 3300035725 | Ga0373947_0023550 | Ga0373947_0023550_1298_2233 | 299 |
| 914 | 3300035725 | Ga0373947_0056553 | Ga0373947_0056553_1184_2083 | 299 |
| 915 | 3300036401 | Ga0373937_0010654 | Ga0373937_0010654_4169_5068 | 299 |
| 916 | 3300036401 | Ga0373937_0208215 | Ga0373937_0208215_202_1137 | 299 |
| 917 | 3300037068 | Ga0373925_0031453 | Ga0373925_0031453_36_935 | 299 |
| 918 | 3300037068 | Ga0373925_0093661 | Ga0373925_0093661_799_1734 | 299 |
| 919 | 3300037418 | Ga0395900_0026320 | Ga0395900_0026320_4996_5922 | 299 |
| 920 | 3300037466 | Ga0395898_0169591 | Ga0395898_0169591_265_1200 | 299 |
| 921 | 3300037471 | Ga0395905_0054291 | Ga0395905_0054291_136_1053 | 299 |
| 922 | 3300037471 | Ga0395905_0190772 | Ga0395905_0190772_929_1828 | 299 |
| 923 | 3300037853 | Ga0436364_0849504 | Ga0436364_0849504_43_942 | 299 |
| 924 | 3300037853 | Ga0436364_1495084 | Ga0436364_1495084_1378_2277 | 299 |
| 925 | 3300038443 | Ga0395901_0139889 | Ga0395901_0139889_1214_2113 | 299 |
| 926 | 3300038443 | Ga0395901_0148039 | Ga0395901_0148039_1176_2111 | 299 |
| 927 | 3300039437 | Ga0436365_1063556 | Ga0436365_1063556_100_999 | 299 |
| 928 | 3300039437 | Ga0436365_1544034 | Ga0436365_1544034_174_1073 | 299 |
| 929 | 3300044683 | Ga0466965_0069717 | Ga0466965_0069717_543_1442 | 299 |
| 930 | 3300044683 | Ga0466965_0093393 | Ga0466965_0093393_110_1033 | 299 |
| 931 | 3300044693 | Ga0466961_0035163 | Ga0466961_0035163_866_1789 | 299 |
| 932 | 3300044765 | Ga0466970_0015359 | Ga0466970_0015359_2177_3106 | 299 |
| 933 | 3300044842 | Ga0466957_0084176 | Ga0466957_0084176_698_1627 | 299 |
| 934 | 3300044901 | Ga0466960_0047414 | Ga0466960_0047414_373_1272 | 299 |
| 935 | 3300044901 | Ga0466960_0054466 | Ga0466960_0054466_435_1385 | 299 |
| 936 | 3300044901 | Ga0466960_0098125 | Ga0466960_0098125_487_1410 | 299 |
| 937 | 3300045976 | Ga0466967_0065708 | Ga0466967_0065708_738_1637 | 299 |
| 938 | 3300045976 | Ga0466967_0143725 | Ga0466967_0143725_901_1818 | 299 |
| 939 | 3300045976 | Ga0466967_0153107 | Ga0466967_0153107_410_1345 | 299 |
| 940 | 3300045976 | Ga0466967_0495608 | Ga0466967_0495608_15_914 | 299 |
| 941 | 3300046454 | Ga0495592_0000397 | Ga0495592_0000397_205_1104 | 299 |
| 942 | 3300046454 | Ga0495592_0008095 | Ga0495592_0008095_205_1104 | 299 |
| 943 | 3300046455 | Ga0495603_0095528 | Ga0495603_0095528_60_971 | 299 |
| 944 | 3300046459 | Ga0495629_0107549 | Ga0495629_0107549_330_1265 | 299 |
| 945 | 3300046461 | Ga0495641_0051291 | Ga0495641_0051291_293_1192 | 299 |
| 946 | 3300046461 | Ga0495641_0057979 | Ga0495641_0057979_150_1049 | 299 |
| 947 | 3300046462 | Ga0495651_0126575 | Ga0495651_0126575_767_1666 | 299 |
| 948 | 3300046462 | Ga0495651_0126576 | Ga0495651_0126576_205_1104 | 299 |
| 949 | 3300046463 | Ga0495653_0120545 | Ga0495653_0120545_205_1104 | 299 |
| 950 | 3300046473 | Ga0495582_0079567 | Ga0495582_0079567_830_1765 | 299 |
| 951 | 3300046477 | Ga0495664_0007931 | Ga0495664_0007931_205_1104 | 299 |
| 952 | 3300046477 | Ga0495664_0087709 | Ga0495664_0087709_205_1104 | 299 |
| 953 | 3300046511 | Ga0495608_0089230 | Ga0495608_0089230_330_1229 | 299 |
| 954 | 3300046511 | Ga0495608_0089231 | Ga0495608_0089231_767_1666 | 299 |
| 955 | 3300046511 | Ga0495608_0105594 | Ga0495608_0105594_872_1771 | 299 |
| 956 | 3300046514 | Ga0495618_0009751 | Ga0495618_0009751_197_1096 | 299 |
| 957 | 3300046516 | Ga0495628_0005043 | Ga0495628_0005043_330_1229 | 299 |
| 958 | 3300046516 | Ga0495628_0122322 | Ga0495628_0122322_330_1229 | 299 |
| 959 | 3300046517 | Ga0495630_0055169 | Ga0495630_0055169_1312_2247 | 299 |
| 960 | 3300046517 | Ga0495630_0152328 | Ga0495630_0152328_767_1666 | 299 |
| 961 | 3300046529 | Ga0495652_0002110 | Ga0495652_0002110_179_1078 | 299 |
| 962 | 3300046529 | Ga0495652_0049416 | Ga0495652_0049416_2104_3003 | 299 |
| 963 | 3300046529 | Ga0495652_0108948 | Ga0495652_0108948_1058_1957 | 299 |
| 964 | 3300046531 | Ga0495665_0093433 | Ga0495665_0093433_332_1267 | 299 |
| 965 | 3300046533 | Ga0495640_0067173 | Ga0495640_0067173_749_1648 | 299 |
| 966 | 3300046535 | Ga0495586_0015106 | Ga0495586_0015106_14_913 | 299 |
| 967 | 3300046536 | Ga0495587_0029133 | Ga0495587_0029133_202_1101 | 299 |
| 968 | 3300046536 | Ga0495587_0099998 | Ga0495587_0099998_188_1087 | 299 |
| 969 | 3300046543 | Ga0495645_0003234 | Ga0495645_0003234_251_1150 | 299 |
| 970 | 3300046543 | Ga0495645_0010242 | Ga0495645_0010242_3043_3942 | 299 |
| 971 | 3300046559 | Ga0495667_0011880 | Ga0495667_0011880_205_1104 | 299 |
| 972 | 3300046559 | Ga0495667_0114499 | Ga0495667_0114499_639_1538 | 299 |
| 973 | 3300046642 | Ga0495634_0021736 | Ga0495634_0021736_30_929 | 299 |
| 974 | 3300046663 | Ga0495635_0074934 | Ga0495635_0074934_205_1104 | 299 |
| 975 | 3300046663 | Ga0495635_0111827 | Ga0495635_0111827_762_1661 | 299 |
| 976 | 3300046675 | Ga0495657_0192128 | Ga0495657_0192128_200_1099 | 299 |
| 977 | 3300046678 | Ga0495599_0017017 | Ga0495599_0017017_330_1229 | 299 |
| 978 | 3300046678 | Ga0495599_0084661 | Ga0495599_0084661_330_1229 | 299 |
| 979 | 3300046679 | Ga0495623_0019997 | Ga0495623_0019997_3166_4065 | 299 |
| 980 | 3300046679 | Ga0495623_0100901 | Ga0495623_0100901_673_1572 | 299 |
| 981 | 3300046680 | Ga0495646_0002659 | Ga0495646_0002659_269_1168 | 299 |
| 982 | 3300046680 | Ga0495646_0004480 | Ga0495646_0004480_3046_3945 | 299 |
| 983 | 3300046683 | Ga0495658_0086658 | Ga0495658_0086658_330_1229 | 299 |
| 984 | 3300046689 | Ga0495613_0039703 | Ga0495613_0039703_2353_3288 | 299 |
| 985 | 3300046690 | Ga0495624_0137472 | Ga0495624_0137472_358_1293 | 299 |
| 986 | 3300046809 | Ga0495600_0009608 | Ga0495600_0009608_285_1184 | 299 |
| 987 | 3300046809 | Ga0495600_0056669 | Ga0495600_0056669_688_1623 | 299 |
| 988 | 3300047317 | Ga0495604_0004132 | Ga0495604_0004132_678_1613 | 299 |
| 989 | 3300047317 | Ga0495604_0042757 | Ga0495604_0042757_578_1477 | 299 |
| 990 | 3300047319 | Ga0495674_0088829 | Ga0495674_0088829_1539_2438 | 299 |
| 991 | 3300047321 | Ga0495676_0085788 | Ga0495676_0085788_737_1636 | 299 |
| 992 | 3300047321 | Ga0495676_0124145 | Ga0495676_0124145_736_1671 | 299 |
| 993 | 3300047322 | Ga0495680_0001602 | Ga0495680_0001602_20178_21077 | 299 |
| 994 | 3300047322 | Ga0495680_0096739 | Ga0495680_0096739_539_1438 | 299 |
| 995 | 3300047322 | Ga0495680_0120073 | Ga0495680_0120073_101_1000 | 299 |
| 996 | 3300047444 | Ga0495675_0034575 | Ga0495675_0034575_205_1104 | 299 |
| 997 | 3300047444 | Ga0495675_0225124 | Ga0495675_0225124_205_1104 | 299 |
| 998 | 3300047471 | Ga0495684_0000603 | Ga0495684_0000603_27785_28684 | 299 |
| 999 | 3300047471 | Ga0495684_0138994 | Ga0495684_0138994_721_1620 | 299 |
| 1000 | 3300048088 | Ga0495602_0017251 | Ga0495602_0017251_1030_1929 | 299 |
| 1001 | 3300048088 | Ga0495602_0018432 | Ga0495602_0018432_5799_6734 | 299 |
| 1002 | 3300048903 | Ga0496100_0252908 | Ga0496100_0252908_251_1150 | 299 |
| 1003 | 3300048904 | Ga0496101_0013820 | Ga0496101_0013820_3933_4862 | 299 |
| 1004 | 3300048905 | Ga0496102_0008782 | Ga0496102_0008782_7708_8637 | 299 |
| 1005 | 3300048905 | Ga0496102_0079766 | Ga0496102_0079766_1933_2868 | 299 |
| 1006 | 3300048905 | Ga0496102_0136298 | Ga0496102_0136298_624_1559 | 299 |
| 1007 | 3300048905 | Ga0496102_0154518 | Ga0496102_0154518_1083_1982 | 299 |
| 1008 | 3300048905 | Ga0496102_0177590 | Ga0496102_0177590_168_1067 | 299 |
| 1009 | 3300048905 | Ga0496102_0601730 | Ga0496102_0601730_53_952 | 299 |
| 1010 | 3300048906 | Ga0496103_0048923 | Ga0496103_0048923_98_997 | 299 |
| 1011 | 3300048906 | Ga0496103_0085930 | Ga0496103_0085930_459_1388 | 299 |
| 1012 | 3300048906 | Ga0496103_0160825 | Ga0496103_0160825_411_1394 | 299 |
| 1013 | 3300048907 | Ga0496104_0030323 | Ga0496104_0030323_1479_2414 | 299 |
| 1014 | 3300048907 | Ga0496104_0072786 | Ga0496104_0072786_2087_3070 | 299 |
| 1015 | 3300048907 | Ga0496104_0234198 | Ga0496104_0234198_789_1688 | 299 |
| 1016 | 3300048908 | Ga0496105_0013044 | Ga0496105_0013044_1597_2580 | 299 |
| 1017 | 3300048908 | Ga0496105_0151400 | Ga0496105_0151400_761_1660 | 299 |
| 1018 | 3300048910 | Ga0496107_0038148 | Ga0496107_0038148_542_1441 | 299 |
| 1019 | 3300048910 | Ga0496107_0071877 | Ga0496107_0071877_88_987 | 299 |
| 1020 | 3300048910 | Ga0496107_0144379 | Ga0496107_0144379_612_1595 | 299 |
| 1021 | 3300048910 | Ga0496107_0317528 | Ga0496107_0317528_229_1128 | 299 |
| 1022 | 3300048910 | Ga0496107_0438783 | Ga0496107_0438783_47_946 | 299 |
| 1023 | 3300048911 | Ga0496108_0170747 | Ga0496108_0170747_366_1349 | 299 |
| 1024 | 3300048911 | Ga0496108_0279324 | Ga0496108_0279324_363_1274 | 299 |
| 1025 | 3300048912 | Ga0496109_0088079 | Ga0496109_0088079_392_1291 | 299 |
| 1026 | 3300048912 | Ga0496109_0195396 | Ga0496109_0195396_819_1718 | 299 |
| 1027 | 3300048912 | Ga0496109_0224563 | Ga0496109_0224563_470_1372 | 299 |
| 1028 | 3300048912 | Ga0496109_0550688 | Ga0496109_0550688_167_1069 | 299 |
| 1029 | 3300048913 | Ga0496110_0079099 | Ga0496110_0079099_1709_2620 | 299 |
| 1030 | 3300048913 | Ga0496110_0082241 | Ga0496110_0082241_288_1271 | 299 |
| 1031 | 3300048913 | Ga0496110_0083440 | Ga0496110_0083440_1029_1928 | 299 |
| 1032 | 3300048913 | Ga0496110_0088856 | Ga0496110_0088856_899_1798 | 299 |
| 1033 | 3300048913 | Ga0496110_0296797 | Ga0496110_0296797_396_1295 | 299 |
| 1034 | 3300048913 | Ga0496110_0369646 | Ga0496110_0369646_12_923 | 299 |
| 1035 | 3300048914 | Ga0496111_0012659 | Ga0496111_0012659_1722_2633 | 299 |
| 1036 | 3300048915 | Ga0496112_0154324 | Ga0496112_0154324_689_1624 | 299 |
| 1037 | 3300048916 | Ga0496113_0036543 | Ga0496113_0036543_1221_2120 | 299 |
| 1038 | 3300048916 | Ga0496113_0358369 | Ga0496113_0358369_40_939 | 299 |
| 1039 | 3300048917 | Ga0496114_0002152 | Ga0496114_0002152_13591_14574 | 299 |
| 1040 | 3300048917 | Ga0496114_0033141 | Ga0496114_0033141_2863_3762 | 299 |
| 1041 | 3300048917 | Ga0496114_0160447 | Ga0496114_0160447_531_1430 | 299 |
| 1042 | 3300048917 | Ga0496114_0303922 | Ga0496114_0303922_252_1151 | 299 |
| 1043 | 3300048924 | Ga0496121_0035843 | Ga0496121_0035843_932_1867 | 299 |
| 1044 | 3300048926 | Ga0496123_0078694 | Ga0496123_0078694_183_1109 | 299 |
| 1045 | 3300048929 | Ga0496126_0000039 | Ga0496126_0000039_220751_221650 | 299 |
| 1046 | 3300049514 | Ga0501291_020713 | Ga0501291_020713_32_931 | 299 |
| 1047 | 3300049521 | Ga0501298_023437 | Ga0501298_023437_216_1115 | 299 |
| 1048 | 3300049568 | Ga0501031_0060482 | Ga0501031_0060482_950_1849 | 299 |
| 1049 | 3300049569 | Ga0501032_0059829 | Ga0501032_0059829_1168_2067 | 299 |
| 1050 | 3300049572 | Ga0501036_0017266 | Ga0501036_0017266_263_1162 | 299 |
| 1051 | 3300049572 | Ga0501036_0033743 | Ga0501036_0033743_738_1655 | 299 |
| 1052 | 3300049573 | Ga0501037_0091380 | Ga0501037_0091380_848_1747 | 299 |
| 1053 | 3300049576 | Ga0501040_0011354 | Ga0501040_0011354_815_1714 | 299 |
| 1054 | 3300049577 | Ga0501041_0069015 | Ga0501041_0069015_356_1255 | 299 |
| 1055 | 3300049577 | Ga0501041_0140093 | Ga0501041_0140093_108_1025 | 299 |
| 1056 | 3300049578 | Ga0501042_0046751 | Ga0501042_0046751_442_1341 | 299 |
| 1057 | 3300049580 | Ga0501046_0010342 | Ga0501046_0010342_2580_3479 | 299 |
| 1058 | 3300049583 | Ga0501067_0104913 | Ga0501067_0104913_110_1009 | 299 |
| 1059 | 3300049583 | Ga0501067_0166254 | Ga0501067_0166254_39_974 | 299 |
| 1060 | 3300049584 | Ga0501068_0056147 | Ga0501068_0056147_719_1618 | 299 |
| 1061 | 3300049588 | Ga0501072_0052339 | Ga0501072_0052339_1831_2730 | 299 |
| 1062 | 3300049588 | Ga0501072_0054608 | Ga0501072_0054608_1006_1905 | 299 |
| 1063 | 3300049590 | Ga0501074_0093115 | Ga0501074_0093115_433_1332 | 299 |
| 1064 | 3300049590 | Ga0501074_0106098 | Ga0501074_0106098_687_1604 | 299 |
| 1065 | 3300049591 | Ga0501075_0009610 | Ga0501075_0009610_5115_6014 | 299 |
| 1066 | 3300049592 | Ga0501076_0086503 | Ga0501076_0086503_582_1481 | 299 |
| 1067 | 3300049593 | Ga0501077_0011162 | Ga0501077_0011162_3065_3964 | 299 |
| 1068 | 3300049741 | Ga0501079_0079143 | Ga0501079_0079143_609_1508 | 299 |
| 1069 | 3300049743 | Ga0501081_0017918 | Ga0501081_0017918_671_1570 | 299 |
| 1070 | 3300049743 | Ga0501081_0329002 | Ga0501081_0329002_185_1084 | 299 |
| 1071 | 3300049744 | Ga0501083_0112653 | Ga0501083_0112653_555_1454 | 299 |
| 1072 | 3300049822 | Ga0501035_0032558 | Ga0501035_0032558_620_1519 | 299 |
| 1073 | 3300049824 | Ga0501045_0002747 | Ga0501045_0002747_6267_7166 | 299 |
| 1074 | 3300050490 | nmdc:mga03n38_92194_c1 | nmdc:mga03n38_92194_c1_175_1110 | 299 |
| 1075 | 3300050490 | nmdc:mga03n38_9497_c1 | nmdc:mga03n38_9497_c1_1900_2799 | 299 |
| 1076 | 3300050491 | nmdc:mga00v17_199295_c1 | nmdc:mga00v17_199295_c1_36_935 | 299 |
| 1077 | 3300050491 | nmdc:mga00v17_30291_c1 | nmdc:mga00v17_30291_c1_1458_2393 | 299 |
| 1078 | 3300050491 | nmdc:mga00v17_89878_c1 | nmdc:mga00v17_89878_c1_971_1870 | 299 |
| 1079 | 3300050492 | nmdc:mga0yw44_119425_c1 | nmdc:mga0yw44_119425_c1_759_1658 | 299 |
| 1080 | 3300050492 | nmdc:mga0yw44_98052_c1 | nmdc:mga0yw44_98052_c1_947_1846 | 299 |
| 1081 | 3300050494 | nmdc:mga06z11_8413_c1 | nmdc:mga06z11_8413_c1_2157_3056 | 299 |
| 1082 | 3300050495 | nmdc:mga04h51_23893_c1 | nmdc:mga04h51_23893_c1_586_1521 | 299 |
| 1083 | 3300050496 | nmdc:mga07m45_101514_c1 | nmdc:mga07m45_101514_c1_507_1442 | 299 |
| 1084 | 3300050496 | nmdc:mga07m45_44396_c1 | nmdc:mga07m45_44396_c1_852_1751 | 299 |
| 1085 | 3300050510 | nmdc:mga06r32_191537_c1 | nmdc:mga06r32_191537_c1_832_1731 | 299 |
| 1086 | 3300050511 | nmdc:mga08y16_201480_c1 | nmdc:mga08y16_201480_c1_667_1566 | 299 |
| 1087 | 3300050511 | nmdc:mga08y16_62979_c1 | nmdc:mga08y16_62979_c1_2608_3519 | 299 |
| 1088 | 3300050511 | nmdc:mga08y16_692626_c1 | nmdc:mga08y16_692626_c1_38_937 | 299 |
| 1089 | 3300050513 | nmdc:mga0rr50_403682_c1 | nmdc:mga0rr50_403682_c1_111_1010 | 299 |
| 1090 | 3300050515 | nmdc:mga0a205_124922_c1 | nmdc:mga0a205_124922_c1_640_1575 | 299 |
| 1091 | 3300053077 | Ga0495601_0209487 | Ga0495601_0209487_202_1137 | 299 |
| 1092 | 3300053078 | Ga0495612_0013400 | Ga0495612_0013400_15_950 | 299 |
| 1093 | 3300053084 | Ga0495595_0123021 | Ga0495595_0123021_248_1147 | 299 |
| 1094 | 3300053085 | Ga0495619_0023815 | Ga0495619_0023815_1661_2596 | 299 |
| 1095 | 3300053102 | Ga0500554_078163 | Ga0500554_078163_37_936 | 299 |
| 1096 | 3300053140 | Ga0500573_0018977 | Ga0500573_0018977_1368_2309 | 299 |
| 1097 | 3300053153 | Ga0500616_0000060 | Ga0500616_0000060_140436_141338 | 299 |
| 1098 | 3300053153 | Ga0500616_0000792 | Ga0500616_0000792_17976_18878 | 299 |
| 1099 | 3300054114 | Ga0501084_0158009 | Ga0501084_0158009_587_1486 | 299 |
| 1100 | 3300059492 | Ga0587073_0015132 | Ga0587073_0015132_64_963 | 299 |
| 1101 | 3300060346 | Ga0587111_0020289 | Ga0587111_0020289_22_957 | 299 |
| 1102 | 3300060353 | Ga0501082_0237345 | Ga0501082_0237345_189_1088 | 299 |
| 1103 | 3300061734 | Ga0530510_0030715 | Ga0530510_0030715_2116_3015 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l2t-assembly1.cif.gz_B | dimeric structure of mj0796, a bacterial abc transporter cassette | 0.9173 | 1 | 211 |
| 3tif-assembly1.cif.gz_B | dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi | 0.9074 | 1 | 211 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9036 | 2 | 216 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.9006 | 2 | 216 |
| 7v8i-assembly1.cif.gz_F | lolcd(e171q)e with bound amppnp in nanodiscs | 0.8993 | 1 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9471 | 2 | 219 | 3.40.50.300 |
| af_Q2FXB7_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9427 | 2 | 211 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9395 | 2 | 220 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.932 | 2 | 206 | 3.40.50.300 |
| af_P37624_268_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9288 | 2 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7J281-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9929 | 1 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A3N0DQ34-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9841 | 2 | 216 |
GO:0005524
GO:0016887 |
| AF-A0A0S9DLE0-F1-model_v4 | ABC transporter domain-containing protein | 0.947 | 2 | 216 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A6G8KU53-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9468 | 2 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A7H2BMT5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9461 | 2 | 216 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar