F490100

General Info

Members Datasets Scaffolds Average Seq Length
1103 385 1063 302

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10054794|Ga0075365_100547942
Length 344
Sequence MSLAAQAARVGAPPYFGRDAPAAKTMHGVGRVRQAVAMINVEGLTRRYGNFTAVDDVSFVCQPGRVTGFLGPNGAGKTTTMRVMVGLTPPTKGRVTIGGHVYQDIPNPGTHVGVLLDASAQHAGRTGREILTLGAQTMGLPMSRVDEMLELVSLDKTEAKRRLRNYSLGMKQRLGIAHALLGDPSVLILDEPANGLDPAGIRWMRGLLKGYADRGGTVCLSSHLLNEVEQIADEMILIGHGRIVAEGTKEELLAGAESHTALVTSLDNERLAQALRDKGVTVTTAGSGLRAETAPVQVGRVAAEHSIVLSDLRAAEGGLEELFLTLTADTQREQPVATTQGATA

Samples

Sample ID Description Type Environment
1 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221617 Nocardioides sp. Root79 Isolate Unclassified
7 2643221620 Nocardioides sp. Root240 Isolate Unclassified
8 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
9 2643221641 Nocardioides sp. Root122 Isolate Unclassified
10 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
11 2643221711 Terrabacter sp. Root85 Isolate Unclassified
12 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
13 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
14 2738541305 Nocardioides sp. CF167 Isolate Unclassified
15 2739367653 Kocuria sp. OV113 Isolate Unclassified
16 2739367898 Nocardioides sp. CF479 Isolate Unclassified
17 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
18 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
19 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
20 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
21 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
22 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
23 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
24 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
25 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
26 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
27 2857727296 Kocuria sp. R-72562 Isolate Unclassified
28 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
29 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
34 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
107 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
322 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
376 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
377 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
378 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.82
Isolates 3.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 9.88
Nodule 0.18
Rhizoplane 9.43
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009250 3300001915 Bacteria 1818
2 JGI24752J21851_1003606 3300001976 Bacteria 2039
3 JGI24740J21852_10016912 3300001979 Bacteria 2622
4 JGI24739J22299_10024977 3300001989 Bacteria 2103
5 JGI24737J22298_10002340 3300001990 Bacteria 6758
6 JGI24735J21928_10012866 3300002067 Bacteria 2641
7 JGI24738J21930_10012282 3300002075 Bacteria 1872
8 JGI24738J21930_10013790 3300002075 Bacteria 1741
9 JGI24751J29686_10009083 3300002459 Bacteria 2041
10 Ga0006562J51391_1041093 3300003578 Bacteria 2360
11 Ga0070658_10022845 3300005327 Bacteria 5020
12 Ga0070658_10052400 3300005327 Bacteria 3309
13 Ga0070658_10174949 3300005327 Bacteria 1805
14 Ga0070676_10008718 3300005328 Bacteria 5471
15 Ga0070683_100004272 3300005329 Bacteria 11729
16 Ga0070683_100068068 3300005329 Bacteria 3317
17 Ga0070683_100188442 3300005329 Bacteria 1958
18 Ga0070683_100530843 3300005329 Bacteria 1125
19 Ga0070670_100030720 3300005331 Bacteria 4626
20 Ga0070670_100055693 3300005331 Bacteria 3394
21 Ga0070670_100139943 3300005331 Bacteria 2093
22 Ga0070670_100156954 3300005331 Bacteria 1971
23 Ga0068869_100101416 3300005334 Bacteria 2177
24 Ga0070666_10111673 3300005335 Bacteria 1890
25 Ga0070680_100086487 3300005336 Bacteria 2591
26 Ga0070682_100020935 3300005337 Bacteria 3853
27 Ga0070682_100033181 3300005337 Bacteria 3135
28 Ga0070682_100087180 3300005337 Bacteria 2035
29 Ga0068868_100130078 3300005338 Bacteria 2059
30 Ga0068868_100155424 3300005338 Bacteria 1886
31 Ga0068868_100219377 3300005338 Bacteria 1592
32 Ga0068868_100337182 3300005338 Bacteria 1288
33 Ga0070660_100026821 3300005339 Bacteria 4292
34 Ga0070691_10008438 3300005341 Bacteria 4714
35 Ga0070691_10032720 3300005341 Bacteria 2444
36 Ga0070687_100067500 3300005343 Bacteria 1909
37 Ga0070687_100170331 3300005343 Bacteria 1295
38 Ga0070661_100083997 3300005344 Bacteria 2352
39 Ga0070661_100096484 3300005344 Bacteria 2194
40 Ga0070692_10031200 3300005345 Bacteria 2670
41 Ga0070692_10063357 3300005345 Bacteria 1953
42 Ga0070669_100085049 3300005353 Bacteria 2362
43 Ga0070669_100113295 3300005353 Bacteria 2060
44 Ga0070675_100003729 3300005354 Bacteria 11583
45 Ga0070675_100081721 3300005354 Bacteria 2695
46 Ga0070675_100201298 3300005354 Bacteria 1728
47 Ga0070671_100001796 3300005355 Bacteria 16283
48 Ga0070671_100284606 3300005355 Bacteria 1406
49 Ga0070674_100020561 3300005356 Bacteria 4221
50 Ga0070674_100028612 3300005356 Bacteria 3661
51 Ga0070674_100064123 3300005356 Bacteria 2573
52 Ga0070673_100194741 3300005364 Bacteria 1743
53 Ga0070659_100017443 3300005366 Bacteria 5405
54 Ga0070659_100031226 3300005366 Bacteria 4125
55 Ga0070659_100111701 3300005366 Bacteria 2207
56 Ga0070667_100105794 3300005367 Bacteria 2435
57 Ga0070709_10018818 3300005434 Bacteria 3985
58 Ga0070709_10219397 3300005434 Bacteria 1355
59 Ga0070709_10226601 3300005434 Bacteria 1335
60 Ga0070709_10318096 3300005434 Bacteria 1141
61 Ga0070714_100145978 3300005435 Bacteria 2128
62 Ga0070714_100351591 3300005435 Bacteria 1384
63 Ga0070713_100499694 3300005436 Bacteria 1147
64 Ga0070710_10033092 3300005437 Bacteria 2805
65 Ga0070710_10196074 3300005437 Bacteria 1272
66 Ga0070701_10002525 3300005438 Bacteria 7071
67 Ga0070701_10004513 3300005438 Bacteria 5650
68 Ga0070701_10013161 3300005438 Bacteria 3755
69 Ga0070711_100107191 3300005439 Bacteria 2044
70 Ga0070711_100305484 3300005439 Bacteria 1266
71 Ga0070711_100518832 3300005439 Bacteria 984
72 Ga0070705_100173239 3300005440 Bacteria 1454
73 Ga0070700_100011432 3300005441 Bacteria 4917
74 Ga0070700_100016043 3300005441 Bacteria 4260
75 Ga0070700_100033084 3300005441 Bacteria 3112
76 Ga0070700_100074634 3300005441 Bacteria 2173
77 Ga0070663_100026021 3300005455 Bacteria 3958
78 Ga0070678_100073846 3300005456 Bacteria 2561
79 Ga0070678_100152184 3300005456 Bacteria 1865
80 Ga0070662_100023827 3300005457 Bacteria 4210
81 Ga0070681_10216441 3300005458 Bacteria 1831
82 Ga0068867_100019341 3300005459 Bacteria 4853
83 Ga0068867_100060741 3300005459 Bacteria 2804
84 Ga0070685_10066406 3300005466 Bacteria 2125
85 Ga0070706_100417038 3300005467 Bacteria 1249
86 Ga0070679_100079751 3300005530 Bacteria 3263
87 Ga0070684_100005484 3300005535 Bacteria 9720
88 Ga0070684_100007079 3300005535 Bacteria 8719
89 Ga0070684_100069190 3300005535 Bacteria 3104
90 Ga0070684_100084213 3300005535 Bacteria 2818
91 Ga0070684_100093417 3300005535 Bacteria 2678
92 Ga0070684_100104682 3300005535 Bacteria 2532
93 Ga0070684_100366711 3300005535 Bacteria 1326
94 Ga0068853_100190760 3300005539 Bacteria 1862
95 Ga0068853_100332806 3300005539 Bacteria 1409
96 Ga0068853_100332826 3300005539 Bacteria 1409
97 Ga0070672_100058530 3300005543 Bacteria 3029
98 Ga0070693_100021585 3300005547 Bacteria 3412
99 Ga0070693_100140788 3300005547 Bacteria 1518
100 Ga0070665_100000273 3300005548 Bacteria 84592
101 Ga0070665_100000957 3300005548 Bacteria 36788
102 Ga0070665_100001051 3300005548 Bacteria 34592
103 Ga0070665_100006876 3300005548 Bacteria 11562
104 Ga0070665_100019437 3300005548 Bacteria 6817
105 Ga0068855_100051021 3300005563 Bacteria 4874
106 Ga0068855_100148667 3300005563 Bacteria 2665
107 Ga0068855_100250575 3300005563 Bacteria 1975
108 Ga0068855_100672769 3300005563 Bacteria 1110
109 Ga0068855_100833010 3300005563 Bacteria 979
110 Ga0070664_100006966 3300005564 Bacteria 9112
111 Ga0070664_100073978 3300005564 Bacteria 2924
112 Ga0070664_100282178 3300005564 Bacteria 1498
113 Ga0068857_100022586 3300005577 Bacteria 5533
114 Ga0068857_100047898 3300005577 Bacteria 3796
115 Ga0068857_100067847 3300005577 Bacteria 3175
116 Ga0068857_100108497 3300005577 Bacteria 2494
117 Ga0068857_100315139 3300005577 Bacteria 1444
118 Ga0068854_100380884 3300005578 Bacteria 1162
119 Ga0068854_100441639 3300005578 Bacteria 1085
120 Ga0068854_100470469 3300005578 Bacteria 1053
121 Ga0068856_100007197 3300005614 Bacteria 10853
122 Ga0068856_100191745 3300005614 Bacteria 2057
123 Ga0068856_100274287 3300005614 Bacteria 1703
124 Ga0070702_100007278 3300005615 Bacteria 5292
125 Ga0070702_100040366 3300005615 Bacteria 2610
126 Ga0070702_100092910 3300005615 Bacteria 1833
127 Ga0070702_100139491 3300005615 Bacteria 1542
128 Ga0070702_100236934 3300005615 Bacteria 1229
129 Ga0068852_100017197 3300005616 Bacteria 5668
130 Ga0068852_100027017 3300005616 Bacteria 4672
131 Ga0068852_100055241 3300005616 Bacteria 3426
132 Ga0068852_100349429 3300005616 Bacteria 1443
133 Ga0068859_100205012 3300005617 Bacteria 2057
134 Ga0068859_100355058 3300005617 Bacteria 1561
135 Ga0068859_100612565 3300005617 Bacteria 1181
136 Ga0068864_100021818 3300005618 Bacteria 5366
137 Ga0068864_100107890 3300005618 Bacteria 2477
138 Ga0068861_100027454 3300005719 Bacteria 4145
139 Ga0068861_100029179 3300005719 Bacteria 4033
140 Ga0068861_100116466 3300005719 Bacteria 2149
141 Ga0068861_100127864 3300005719 Bacteria 2058
142 Ga0068861_100158172 3300005719 Bacteria 1866
143 Ga0068870_10033509 3300005840 Bacteria 2621
144 Ga0068863_100380823 3300005841 Bacteria 1377
145 Ga0068858_100042801 3300005842 Bacteria 4199
146 Ga0068858_100094287 3300005842 Bacteria 2788
147 Ga0068858_100191147 3300005842 Bacteria 1934
148 Ga0068860_100000467 3300005843 Bacteria 50515
149 Ga0068860_100012237 3300005843 Bacteria 8456
150 Ga0068862_100216380 3300005844 Bacteria 1733
151 Ga0081455_10000030 3300005937 Bacteria 148346
152 Ga0081455_10071377 3300005937 Bacteria 2879
153 Ga0081455_10195177 3300005937 Bacteria 1521
154 Ga0081455_10221912 3300005937 Bacteria 1400
155 Ga0081538_10000065 3300005981 Bacteria 98948
156 Ga0081540_1025012 3300005983 Bacteria 3450
157 Ga0081539_10033921 3300005985 Bacteria 3098
158 Ga0070717_10098364 3300006028 Bacteria 2480
159 Ga0070717_10375462 3300006028 Bacteria 1274
160 Ga0075365_10008147 3300006038 Bacteria 5923
161 Ga0075365_10024606 3300006038 Bacteria 3801
162 Ga0075365_10031885 3300006038 Bacteria 3384
163 Ga0075365_10043984 3300006038 Bacteria 2924
164 Ga0075365_10046940 3300006038 Bacteria 2838
165 Ga0075365_10054794 3300006038 Bacteria 2645
166 Ga0075365_10071600 3300006038 Bacteria 2334
167 Ga0075365_10075681 3300006038 Bacteria 2272
168 Ga0075365_10096041 3300006038 Bacteria 2025
169 Ga0075365_10101048 3300006038 Bacteria 1974
170 Ga0075365_10112732 3300006038 Bacteria 1870
171 Ga0075365_10156839 3300006038 Bacteria 1584
172 Ga0075365_10159500 3300006038 Bacteria 1571
173 Ga0075365_10166502 3300006038 Bacteria 1538
174 Ga0075368_10000363 3300006042 Bacteria 13338
175 Ga0075368_10000952 3300006042 Bacteria 9008
176 Ga0075368_10017449 3300006042 Bacteria 2687
177 Ga0075368_10031645 3300006042 Bacteria 2052
178 Ga0075363_100000170 3300006048 Bacteria 16868
179 Ga0075363_100000416 3300006048 Bacteria 13204
180 Ga0075363_100001116 3300006048 Bacteria 9747
181 Ga0075363_100002522 3300006048 Bacteria 7508
182 Ga0075363_100020550 3300006048 Bacteria 3313
183 Ga0075363_100061961 3300006048 Bacteria 2017
184 Ga0075363_100063141 3300006048 Bacteria 1998
185 Ga0075363_100072134 3300006048 Bacteria 1877
186 Ga0075363_100079254 3300006048 Bacteria 1794
187 Ga0075364_10006272 3300006051 Bacteria 6978
188 Ga0075364_10008594 3300006051 Bacteria 6108
189 Ga0075364_10014601 3300006051 Bacteria 4855
190 Ga0075364_10042989 3300006051 Bacteria 2937
191 Ga0075364_10057116 3300006051 Bacteria 2556
192 Ga0075364_10062326 3300006051 Bacteria 2447
193 Ga0075364_10073802 3300006051 Bacteria 2249
194 Ga0075364_10086073 3300006051 Bacteria 2082
195 Ga0070715_10011892 3300006163 Bacteria 3148
196 Ga0070716_100192595 3300006173 Bacteria 1348
197 Ga0070712_100069159 3300006175 Bacteria 2518
198 Ga0070712_100111253 3300006175 Bacteria 2044
199 Ga0070712_100169574 3300006175 Bacteria 1692
200 Ga0070712_100500521 3300006175 Bacteria 1018
201 Ga0075362_10015327 3300006177 Bacteria 3115
202 Ga0075367_10000401 3300006178 Bacteria 15899
203 Ga0075367_10010955 3300006178 Bacteria 4778
204 Ga0075367_10018148 3300006178 Bacteria 3876
205 Ga0075367_10019136 3300006178 Bacteria 3792
206 Ga0075367_10053572 3300006178 Bacteria 2391
207 Ga0075367_10080839 3300006178 Bacteria 1966
208 Ga0075367_10090433 3300006178 Bacteria 1862
209 Ga0097621_100086442 3300006237 Bacteria 2617
210 Ga0097621_100167876 3300006237 Bacteria 1890
211 Ga0075370_10001511 3300006353 Bacteria 10168
212 Ga0075370_10001569 3300006353 Bacteria 10038
213 Ga0075370_10003287 3300006353 Bacteria 7669
214 Ga0075370_10032220 3300006353 Bacteria 2929
215 Ga0075370_10065800 3300006353 Bacteria 2067
216 Ga0075428_100016372 3300006844 Bacteria 8192
217 Ga0075428_100021526 3300006844 Bacteria 7137
218 Ga0075428_100800667 3300006844 Bacteria 1002
219 Ga0075430_100003986 3300006846 Bacteria 12447
220 Ga0075431_100022766 3300006847 Bacteria 6404
221 Ga0075431_100141258 3300006847 Bacteria 2482
222 Ga0075433_10088568 3300006852 Bacteria 2735
223 Ga0075429_100048371 3300006880 Bacteria 3698
224 Ga0068865_100019619 3300006881 Bacteria 4376
225 Ga0068865_100035311 3300006881 Bacteria 3360
226 Ga0068865_100217837 3300006881 Bacteria 1491
227 Ga0068865_100228041 3300006881 Bacteria 1460
228 Ga0097620_100205006 3300006931 Bacteria 2057
229 Ga0097620_100355027 3300006931 Bacteria 1561
230 Ga0097620_100612567 3300006931 Bacteria 1181
231 Ga0111539_10006328 3300009094 Bacteria 15264
232 Ga0111539_10012179 3300009094 Bacteria 10790
233 Ga0111539_10046610 3300009094 Bacteria 5184
234 Ga0111539_10048292 3300009094 Bacteria 5083
235 Ga0111539_10373232 3300009094 Bacteria 1660
236 Ga0111539_10460281 3300009094 Bacteria 1481
237 Ga0111539_10490536 3300009094 Bacteria 1431
238 Ga0105245_10001389 3300009098 Bacteria 21921
239 Ga0105245_10163601 3300009098 Bacteria 2113
240 Ga0105245_10187166 3300009098 Bacteria 1981
241 Ga0105245_10219360 3300009098 Bacteria 1834
242 Ga0105245_10465027 3300009098 Bacteria 1276
243 Ga0105245_10516366 3300009098 Bacteria 1212
244 Ga0114129_10010931 3300009147 Bacteria 12935
245 Ga0105243_10014099 3300009148 Bacteria 6047
246 Ga0105243_10016322 3300009148 Bacteria 5618
247 Ga0105243_10209072 3300009148 Bacteria 1717
248 Ga0105243_10224463 3300009148 Bacteria 1662
249 Ga0105242_10058334 3300009176 Bacteria 3164
250 Ga0105242_10235375 3300009176 Bacteria 1643
251 Ga0105242_10451169 3300009176 Bacteria 1212
252 Ga0105248_10031669 3300009177 Bacteria 5908
253 Ga0105248_10200240 3300009177 Bacteria 2250
254 Ga0105248_10279932 3300009177 Bacteria 1878
255 Ga0105237_10033781 3300009545 Bacteria 5182
256 Ga0105237_10393879 3300009545 Bacteria 1390
257 Ga0105238_10044672 3300009551 Bacteria 4478
258 Ga0105238_10268573 3300009551 Bacteria 1686
259 Ga0105238_10384194 3300009551 Bacteria 1396
260 Ga0105238_10392380 3300009551 Bacteria 1380
261 Ga0105238_10522303 3300009551 Bacteria 1190
262 Ga0105249_10004469 3300009553 Bacteria 12090
263 Ga0105249_10031845 3300009553 Bacteria 4771
264 Ga0105249_10198452 3300009553 Bacteria 1962
265 Ga0105249_10347224 3300009553 Bacteria 1502
266 Ga0105239_10003376 3300010375 Bacteria 19591
267 Ga0105239_10010898 3300010375 Bacteria 10156
268 Ga0105239_10097739 3300010375 Bacteria 3245
269 Ga0105239_10156809 3300010375 Bacteria 2542
270 Ga0105239_10503710 3300010375 Bacteria 1377
271 Ga0105246_10010063 3300011119 Bacteria 5836
272 Ga0105246_10090788 3300011119 Bacteria 2200
273 Ga0157346_1000863 3300012480 Bacteria 1360
274 Ga0157371_10089881 3300013102 Bacteria 2175
275 Ga0157370_10195463 3300013104 Bacteria 1877
276 Ga0157370_10441299 3300013104 Bacteria 1197
277 Ga0157369_10010908 3300013105 Bacteria 10347
278 Ga0157369_10040542 3300013105 Bacteria 5083
279 Ga0157369_10215533 3300013105 Bacteria 2011
280 Ga0157369_10338537 3300013105 Bacteria 1563
281 Ga0157369_10387946 3300013105 Bacteria 1449
282 Ga0157369_10838189 3300013105 Bacteria 944
283 Ga0163162_10002716 3300013306 Bacteria 16784
284 Ga0163162_10008332 3300013306 Bacteria 10112
285 Ga0163162_10163280 3300013306 Bacteria 2350
286 Ga0163162_10185897 3300013306 Bacteria 2205
287 Ga0157372_10000025 3300013307 Bacteria 195491
288 Ga0157372_10015861 3300013307 Bacteria 8082
289 Ga0157372_10022009 3300013307 Bacteria 6892
290 Ga0157372_10125591 3300013307 Bacteria 2950
291 Ga0157372_10403120 3300013307 Bacteria 1594
292 Ga0157372_10416507 3300013307 Bacteria 1566
293 Ga0157372_10697150 3300013307 Bacteria 1182
294 Ga0157375_10029705 3300013308 Bacteria 5144
295 Ga0157375_10058354 3300013308 Bacteria 3817
296 Ga0157375_10106735 3300013308 Bacteria 2892
297 Ga0157375_10243685 3300013308 Bacteria 1957
298 Ga0157375_10420163 3300013308 Bacteria 1503
299 Ga0157375_10534980 3300013308 Bacteria 1334
300 Ga0163163_10022365 3300014325 Bacteria 5985
301 Ga0163163_10067546 3300014325 Bacteria 3555
302 Ga0163163_10129195 3300014325 Bacteria 2566
303 Ga0163163_10151041 3300014325 Bacteria 2366
304 Ga0157380_10002258 3300014326 Bacteria 12956
305 Ga0157380_10010387 3300014326 Bacteria 6697
306 Ga0157380_10018962 3300014326 Bacteria 5119
307 Ga0157380_10173312 3300014326 Bacteria 1887
308 Ga0157380_10351377 3300014326 Bacteria 1380
309 Ga0182008_10092587 3300014497 Bacteria 1491
310 Ga0157377_10003131 3300014745 Bacteria 7447
311 Ga0157377_10024322 3300014745 Bacteria 3218
312 Ga0157377_10044772 3300014745 Bacteria 2469
313 Ga0157377_10048662 3300014745 Bacteria 2380
314 Ga0157377_10182038 3300014745 Bacteria 1322
315 Ga0157376_10263359 3300014969 Bacteria 1616
316 Ga0163161_10139886 3300017792 Bacteria 1832
317 Ga0163161_10178144 3300017792 Bacteria 1628
318 Ga0206354_10058287 3300020081 Bacteria 1028
319 Ga0206353_10418635 3300020082 Bacteria 1175
320 Ga0206353_10455544 3300020082 Bacteria 2500
321 Ga0206353_11704839 3300020082 Bacteria 2123
322 Ga0206353_11712015 3300020082 Bacteria 3838
323 Ga0207692_10012583 3300025898 Bacteria 3638
324 Ga0207692_10056314 3300025898 Bacteria 2016
325 Ga0207692_10156153 3300025898 Bacteria 1311
326 Ga0207642_10008017 3300025899 Bacteria 3600
327 Ga0207642_10050616 3300025899 Bacteria 1875
328 Ga0207688_10003017 3300025901 Bacteria 9171
329 Ga0207688_10004230 3300025901 Bacteria 7826
330 Ga0207688_10008819 3300025901 Bacteria 5488
331 Ga0207688_10015048 3300025901 Bacteria 4197
332 Ga0207688_10019250 3300025901 Bacteria 3717
333 Ga0207688_10025699 3300025901 Bacteria 3236
334 Ga0207688_10046663 3300025901 Bacteria 2419
335 Ga0207647_10002481 3300025904 Bacteria 13967
336 Ga0207647_10056181 3300025904 Bacteria 2416
337 Ga0207699_10044113 3300025906 Bacteria 2594
338 Ga0207699_10053763 3300025906 Bacteria 2389
339 Ga0207699_10199098 3300025906 Bacteria 1356
340 Ga0207645_10039887 3300025907 Bacteria 3008
341 Ga0207643_10002197 3300025908 Bacteria 10637
342 Ga0207643_10023134 3300025908 Bacteria 3426
343 Ga0207643_10037108 3300025908 Bacteria 2734
344 Ga0207643_10061829 3300025908 Bacteria 2139
345 Ga0207705_10038483 3300025909 Bacteria 3425
346 Ga0207684_10247373 3300025910 Bacteria 1538
347 Ga0207707_10160407 3300025912 Bacteria 1966
348 Ga0207671_10028511 3300025914 Bacteria 4171
349 Ga0207693_10127068 3300025915 Bacteria 2004
350 Ga0207693_10464635 3300025915 Bacteria 989
351 Ga0207663_10009729 3300025916 Bacteria 5089
352 Ga0207663_10035696 3300025916 Bacteria 2985
353 Ga0207663_10140756 3300025916 Bacteria 1680
354 Ga0207663_10259046 3300025916 Bacteria 1284
355 Ga0207660_10482565 3300025917 Bacteria 1005
356 Ga0207662_10009033 3300025918 Bacteria 5475
357 Ga0207662_10059818 3300025918 Bacteria 2284
358 Ga0207662_10182328 3300025918 Bacteria 1351
359 Ga0207657_10017941 3300025919 Bacteria 6772
360 Ga0207657_10030851 3300025919 Bacteria 4859
361 Ga0207649_10166865 3300025920 Bacteria 1530
362 Ga0207652_10036477 3300025921 Bacteria 4156
363 Ga0207694_10231719 3300025924 Bacteria 1508
364 Ga0207650_10001714 3300025925 Bacteria 15564
365 Ga0207650_10057978 3300025925 Bacteria 2882
366 Ga0207659_10065925 3300025926 Bacteria 2626
367 Ga0207659_10125442 3300025926 Bacteria 1973
368 Ga0207659_10174260 3300025926 Bacteria 1699
369 Ga0207687_10005324 3300025927 Bacteria 8521
370 Ga0207687_10009758 3300025927 Bacteria 6280
371 Ga0207687_10048229 3300025927 Bacteria 2956
372 Ga0207687_10283889 3300025927 Bacteria 1328
373 Ga0207700_10011354 3300025928 Bacteria 5673
374 Ga0207700_10022238 3300025928 Bacteria 4347
375 Ga0207700_10146230 3300025928 Bacteria 1948
376 Ga0207700_10192090 3300025928 Bacteria 1716
377 Ga0207700_10586713 3300025928 Bacteria 991
378 Ga0207664_10047751 3300025929 Bacteria 3364
379 Ga0207664_10122731 3300025929 Bacteria 2176
380 Ga0207664_10169166 3300025929 Bacteria 1869
381 Ga0207664_10181658 3300025929 Bacteria 1806
382 Ga0207664_10292201 3300025929 Bacteria 1432
383 Ga0207644_10027379 3300025931 Bacteria 3937
384 Ga0207644_10043005 3300025931 Bacteria 3204
385 Ga0207690_10023754 3300025932 Bacteria 3831
386 Ga0207690_10040833 3300025932 Bacteria 3036
387 Ga0207690_10069857 3300025932 Bacteria 2417
388 Ga0207690_10107677 3300025932 Bacteria 2002
389 Ga0207706_10017268 3300025933 Bacteria 6503
390 Ga0207706_10111560 3300025933 Bacteria 2406
391 Ga0207686_10057573 3300025934 Bacteria 2447
392 Ga0207709_10025235 3300025935 Bacteria 3402
393 Ga0207709_10065834 3300025935 Bacteria 2280
394 Ga0207709_10105337 3300025935 Bacteria 1874
395 Ga0207669_10011553 3300025937 Bacteria 4302
396 Ga0207669_10058131 3300025937 Bacteria 2358
397 Ga0207704_10007814 3300025938 Bacteria 5074
398 Ga0207704_10010985 3300025938 Bacteria 4441
399 Ga0207704_10029538 3300025938 Bacteria 3059
400 Ga0207704_10112401 3300025938 Bacteria 1845
401 Ga0207665_10071309 3300025939 Bacteria 2372
402 Ga0207691_10018659 3300025940 Bacteria 6571
403 Ga0207691_10019738 3300025940 Bacteria 6373
404 Ga0207691_10059202 3300025940 Bacteria 3483
405 Ga0207691_10062688 3300025940 Bacteria 3373
406 Ga0207711_10220691 3300025941 Bacteria 1734
407 Ga0207689_10079973 3300025942 Bacteria 2686
408 Ga0207689_10088140 3300025942 Bacteria 2549
409 Ga0207689_10101864 3300025942 Bacteria 2359
410 Ga0207689_10183994 3300025942 Bacteria 1723
411 Ga0207661_10007007 3300025944 Bacteria 7998
412 Ga0207661_10011604 3300025944 Bacteria 6392
413 Ga0207661_10013156 3300025944 Bacteria 6040
414 Ga0207661_10071722 3300025944 Bacteria 2832
415 Ga0207661_10103460 3300025944 Bacteria 2396
416 Ga0207661_10163734 3300025944 Bacteria 1931
417 Ga0207661_10215718 3300025944 Bacteria 1693
418 Ga0207661_10324600 3300025944 Bacteria 1384
419 Ga0207661_10385443 3300025944 Bacteria 1269
420 Ga0207661_10390562 3300025944 Bacteria 1261
421 Ga0207679_10015370 3300025945 Bacteria 5056
422 Ga0207679_10090932 3300025945 Bacteria 2361
423 Ga0207667_10085130 3300025949 Bacteria 3273
424 Ga0207712_10018068 3300025961 Bacteria 4587
425 Ga0207712_10214647 3300025961 Bacteria 1534
426 Ga0207668_10078002 3300025972 Bacteria 2391
427 Ga0207640_10120662 3300025981 Bacteria 1877
428 Ga0207677_10039878 3300026023 Bacteria 3091
429 Ga0207677_10099542 3300026023 Bacteria 2135
430 Ga0207677_10245429 3300026023 Bacteria 1451
431 Ga0207677_10273173 3300026023 Bacteria 1384
432 Ga0207677_10493475 3300026023 Bacteria 1057
433 Ga0207703_10081187 3300026035 Bacteria 2702
434 Ga0207703_10100639 3300026035 Bacteria 2449
435 Ga0207639_10089865 3300026041 Bacteria 2455
436 Ga0207678_10000105 3300026067 Bacteria 68804
437 Ga0207678_10041186 3300026067 Bacteria 4005
438 Ga0207678_10109934 3300026067 Bacteria 2351
439 Ga0207708_10000436 3300026075 Bacteria 32496
440 Ga0207708_10001046 3300026075 Bacteria 20715
441 Ga0207708_10004147 3300026075 Bacteria 10661
442 Ga0207708_10004999 3300026075 Bacteria 9768
443 Ga0207708_10057384 3300026075 Bacteria 2970
444 Ga0207702_10062949 3300026078 Bacteria 3170
445 Ga0207702_10068760 3300026078 Bacteria 3043
446 Ga0207702_10496611 3300026078 Bacteria 1189
447 Ga0207641_10055170 3300026088 Bacteria 3373
448 Ga0207641_10100877 3300026088 Bacteria 2543
449 Ga0207641_10371400 3300026088 Bacteria 1368
450 Ga0207648_10003947 3300026089 Bacteria 15429
451 Ga0207648_10004176 3300026089 Bacteria 14929
452 Ga0207648_10057841 3300026089 Bacteria 3382
453 Ga0207676_10002083 3300026095 Bacteria 14516
454 Ga0207676_10016306 3300026095 Bacteria 5380
455 Ga0207676_10503258 3300026095 Bacteria 1151
456 Ga0207674_10019540 3300026116 Bacteria 7337
457 Ga0207674_10042528 3300026116 Bacteria 4692
458 Ga0207674_10120916 3300026116 Bacteria 2586
459 Ga0207674_10135832 3300026116 Bacteria 2421
460 Ga0207674_10305772 3300026116 Bacteria 1539
461 Ga0207675_100004206 3300026118 Bacteria 13928
462 Ga0207675_100004892 3300026118 Bacteria 12913
463 Ga0207675_100082762 3300026118 Bacteria 3010
464 Ga0207675_100526758 3300026118 Bacteria 1179
465 Ga0207683_10021359 3300026121 Bacteria 5541
466 Ga0207683_10043229 3300026121 Bacteria 3937
467 Ga0207683_10053839 3300026121 Bacteria 3529
468 Ga0207683_10098365 3300026121 Bacteria 2610
469 Ga0207683_10308097 3300026121 Bacteria 1449
470 Ga0207698_10129947 3300026142 Bacteria 2150
471 Ga0207698_10176518 3300026142 Bacteria 1887
472 Ga0207698_10239967 3300026142 Bacteria 1651
473 Ga0209813_10003987 3300027866 Bacteria 3499
474 Ga0209813_10004119 3300027866 Bacteria 3451
475 Ga0209813_10007277 3300027866 Bacteria 2754
476 Ga0209813_10061192 3300027866 Bacteria 1202
477 Ga0207428_10030127 3300027907 Bacteria 4489
478 Ga0207428_10051545 3300027907 Bacteria 3289
479 Ga0207428_10335457 3300027907 Bacteria 1114
480 Ga0268266_10051556 3300028379 Bacteria 3532
481 Ga0268266_10111075 3300028379 Bacteria 2428
482 Ga0268266_10144612 3300028379 Bacteria 2136
483 Ga0268265_10179938 3300028380 Bacteria 1816
484 Ga0268264_10000242 3300028381 Bacteria 103492
485 Ga0268264_10001967 3300028381 Bacteria 18458
486 Ga0268264_10004760 3300028381 Bacteria 11523
487 Ga0268264_10039308 3300028381 Bacteria 3908
488 Ga0265340_10000537 3300031247 Bacteria 20931
489 Ga0307513_10015532 3300031456 Bacteria 9229
490 Ga0307513_10092563 3300031456 Bacteria 3077
491 Ga0307408_100407527 3300031548 Bacteria 1169
492 Ga0307408_100427210 3300031548 Bacteria 1144
493 Ga0316578_10001825 3300031728 Bacteria 8960
494 Ga0307405_10142180 3300031731 Bacteria 1675
495 Ga0307405_10245022 3300031731 Bacteria 1330
496 Ga0307405_10350770 3300031731 Bacteria 1138
497 Ga0307405_10360050 3300031731 Bacteria 1125
498 Ga0307413_10041923 3300031824 Bacteria 2685
499 Ga0307413_10057435 3300031824 Bacteria 2380
500 Ga0307413_10139104 3300031824 Bacteria 1675
501 Ga0307413_10149749 3300031824 Bacteria 1624
502 Ga0307413_10170290 3300031824 Bacteria 1541
503 Ga0307410_10006651 3300031852 Bacteria 6259
504 Ga0307410_10010750 3300031852 Bacteria 5204
505 Ga0307410_10018682 3300031852 Bacteria 4194
506 Ga0307410_10087383 3300031852 Bacteria 2205
507 Ga0307410_10116988 3300031852 Bacteria 1938
508 Ga0307410_10250395 3300031852 Bacteria 1377
509 Ga0307410_10342705 3300031852 Bacteria 1192
510 Ga0307410_10388316 3300031852 Bacteria 1125
511 Ga0307406_10031477 3300031901 Bacteria 3231
512 Ga0307406_10048409 3300031901 Bacteria 2685
513 Ga0307406_10084938 3300031901 Bacteria 2115
514 Ga0307406_10104163 3300031901 Bacteria 1939
515 Ga0307406_10145445 3300031901 Bacteria 1684
516 Ga0307406_10221153 3300031901 Bacteria 1407
517 Ga0307406_10288210 3300031901 Bacteria 1256
518 Ga0307407_10004673 3300031903 Bacteria 5847
519 Ga0307407_10010415 3300031903 Bacteria 4384
520 Ga0307407_10015197 3300031903 Bacteria 3795
521 Ga0307407_10016371 3300031903 Bacteria 3692
522 Ga0307407_10017500 3300031903 Bacteria 3598
523 Ga0307407_10062237 3300031903 Bacteria 2185
524 Ga0307407_10244465 3300031903 Bacteria 1226
525 Ga0307412_10345772 3300031911 Bacteria 1192
526 Ga0307412_10498430 3300031911 Bacteria 1013
527 Ga0307409_100009889 3300031995 Bacteria 5887
528 Ga0307409_100011357 3300031995 Bacteria 5608
529 Ga0307409_100016694 3300031995 Bacteria 4868
530 Ga0307409_100030018 3300031995 Bacteria 3900
531 Ga0307409_100034975 3300031995 Bacteria 3677
532 Ga0307409_100038144 3300031995 Bacteria 3550
533 Ga0307409_100046156 3300031995 Bacteria 3296
534 Ga0307409_100060483 3300031995 Bacteria 2954
535 Ga0307409_100063299 3300031995 Bacteria 2900
536 Ga0307409_100071625 3300031995 Bacteria 2757
537 Ga0307409_100097167 3300031995 Bacteria 2432
538 Ga0307409_100108515 3300031995 Bacteria 2322
539 Ga0307409_100128992 3300031995 Bacteria 2157
540 Ga0307409_100151443 3300031995 Bacteria 2014
541 Ga0307409_100215701 3300031995 Bacteria 1728
542 Ga0307409_100240713 3300031995 Bacteria 1647
543 Ga0307409_100254681 3300031995 Bacteria 1607
544 Ga0307409_100329291 3300031995 Bacteria 1433
545 Ga0307409_100437613 3300031995 Bacteria 1259
546 Ga0307409_100440840 3300031995 Bacteria 1254
547 Ga0307409_100492582 3300031995 Bacteria 1192
548 Ga0307416_100002883 3300032002 Bacteria 10017
549 Ga0307416_100002929 3300032002 Bacteria 9946
550 Ga0307416_100012921 3300032002 Bacteria 5651
551 Ga0307416_100048729 3300032002 Bacteria 3363
552 Ga0307416_100051207 3300032002 Bacteria 3297
553 Ga0307416_100065621 3300032002 Bacteria 2984
554 Ga0307416_100102938 3300032002 Bacteria 2491
555 Ga0307416_100186307 3300032002 Bacteria 1951
556 Ga0307416_100299986 3300032002 Bacteria 1596
557 Ga0307416_100395067 3300032002 Bacteria 1418
558 Ga0307411_10068352 3300032005 Bacteria 2394
559 Ga0307411_10076823 3300032005 Bacteria 2284
560 Ga0307411_10095665 3300032005 Bacteria 2086
561 Ga0307411_10221500 3300032005 Bacteria 1468
562 Ga0307415_100007652 3300032126 Bacteria 5927
563 Ga0307415_100009492 3300032126 Bacteria 5459
564 Ga0307415_100021802 3300032126 Bacteria 3945
565 Ga0307415_100026466 3300032126 Bacteria 3660
566 Ga0307415_100038392 3300032126 Bacteria 3155
567 Ga0307415_100089813 3300032126 Bacteria 2220
568 Ga0307415_100089941 3300032126 Bacteria 2219
569 Ga0307415_100107507 3300032126 Bacteria 2061
570 Ga0307415_100118290 3300032126 Bacteria 1981
571 Ga0307415_100283300 3300032126 Bacteria 1364
572 Ga0307415_100620128 3300032126 Bacteria 965
573 Ga0316583_10029656 3300032133 Bacteria 1950
574 Ga0373938_0031409 3300034957 Bacteria 1139
575 Ga0373926_0027830 3300035083 Bacteria 1982
576 Ga0373934_0002754 3300035086 Bacteria 6447
577 Ga0373944_0011334 3300035089 Bacteria 2441
578 Ga0373923_0023500 3300035111 Bacteria 2425
579 Ga0373923_0055474 3300035111 Bacteria 1670
580 Ga0373936_0026431 3300035113 Bacteria 2272
581 Ga0373936_0055578 3300035113 Bacteria 1607
582 Ga0373945_0039542 3300035116 Bacteria 1700
583 Ga0373953_0000821 3300035117 Bacteria 8685
584 Ga0373954_0001563 3300035118 Bacteria 9326
585 Ga0373956_0003221 3300035119 Bacteria 6590
586 Ga0373957_0001428 3300035120 Bacteria 6465
587 Ga0373943_0048468 3300035170 Bacteria 2081
588 Ga0373946_0013175 3300035171 Bacteria 3103
589 Ga0373955_0082888 3300035172 Bacteria 1815
590 Ga0373955_0108511 3300035172 Bacteria 1602
591 Ga0316574_0007917 3300035398 Bacteria 5865
592 Ga0373924_0016500 3300035410 Bacteria 2819
593 Ga0373927_0040940 3300035695 Bacteria 3005
594 Ga0373933_0005000 3300035724 Bacteria 7231
595 Ga0373947_0023550 3300035725 Bacteria 3583
596 Ga0373947_0056553 3300035725 Bacteria 2371
597 Ga0373937_0010654 3300036401 Bacteria 8037
598 Ga0373937_0208215 3300036401 Bacteria 1839
599 Ga0316584_0003766 3300036712 Bacteria 9935
600 Ga0373925_0031453 3300037068 Bacteria 3900
601 Ga0373925_0093661 3300037068 Bacteria 2299
602 Ga0395900_0026320 3300037418 Bacteria 5957
603 Ga0395900_0058762 3300037418 Bacteria 3959
604 Ga0395898_0169591 3300037466 Bacteria 2086
605 Ga0395905_0054291 3300037471 Bacteria 3750
606 Ga0395905_0190772 3300037471 Bacteria 1922
607 Ga0436364_0849504 3300037853 Bacteria 2397
608 Ga0436364_1495084 3300037853 Bacteria 3514
609 Ga0395901_0011948 3300038443 Bacteria 8806
610 Ga0395901_0139889 3300038443 Bacteria 2544
611 Ga0395901_0148039 3300038443 Bacteria 2467
612 Ga0395901_0213971 3300038443 Bacteria 2016
613 Ga0400483_021589 3300039062 Bacteria 5824
614 Ga0400483_095912 3300039062 Bacteria 3768
615 Ga0400483_209527 3300039062 Bacteria 2526
616 Ga0436365_1063556 3300039437 Bacteria 1138
617 Ga0436365_1544034 3300039437 Bacteria 1161
618 Ga0451843_0051158 3300041509 Bacteria 1602
619 Ga0439459_0030276 3300042438 Bacteria 1097
620 Ga0466972_0176165 3300044658 Bacteria 1003
621 Ga0466965_0000459 3300044683 Bacteria 14372
622 Ga0466965_0004751 3300044683 Bacteria 6056
623 Ga0466965_0012067 3300044683 Bacteria 4057
624 Ga0466965_0025243 3300044683 Bacteria 2877
625 Ga0466965_0048241 3300044683 Bacteria 2110
626 Ga0466965_0069717 3300044683 Bacteria 1767
627 Ga0466965_0093393 3300044683 Bacteria 1532
628 Ga0466961_0035163 3300044693 Bacteria 3217
629 Ga0466961_0109053 3300044693 Bacteria 1742
630 Ga0466963_0038739 3300044694 Bacteria 3119
631 Ga0466963_0069680 3300044694 Bacteria 2364
632 Ga0466964_0031608 3300044706 Bacteria 2100
633 Ga0466964_0048533 3300044706 Bacteria 1736
634 Ga0466964_0054265 3300044706 Bacteria 1652
635 Ga0466970_0012324 3300044765 Bacteria 4369
636 Ga0466970_0015359 3300044765 Bacteria 3936
637 Ga0466970_0018226 3300044765 Bacteria 3632
638 Ga0466970_0033313 3300044765 Bacteria 2723
639 Ga0466970_0098294 3300044765 Bacteria 1593
640 Ga0466957_0001115 3300044842 Bacteria 13906
641 Ga0466957_0084176 3300044842 Bacteria 1985
642 Ga0466957_0096568 3300044842 Bacteria 1857
643 Ga0466960_0000350 3300044901 Bacteria 15766
644 Ga0466960_0006974 3300044901 Bacteria 4563
645 Ga0466960_0008191 3300044901 Bacteria 4272
646 Ga0466960_0016237 3300044901 Bacteria 3225
647 Ga0466960_0023651 3300044901 Bacteria 2761
648 Ga0466960_0047414 3300044901 Bacteria 2061
649 Ga0466960_0054466 3300044901 Bacteria 1942
650 Ga0466960_0098125 3300044901 Bacteria 1504
651 Ga0451576_0414424 3300045051 Bacteria 1413
652 Ga0466958_0042983 3300045836 Bacteria 2721
653 Ga0466958_0094123 3300045836 Bacteria 1856
654 Ga0466967_0003975 3300045976 Bacteria 9844
655 Ga0466967_0065708 3300045976 Bacteria 3229
656 Ga0466967_0073531 3300045976 Bacteria 3067
657 Ga0466967_0095098 3300045976 Bacteria 2715
658 Ga0466967_0119523 3300045976 Bacteria 2432
659 Ga0466967_0143725 3300045976 Bacteria 2224
660 Ga0466967_0153107 3300045976 Bacteria 2157
661 Ga0466967_0159795 3300045976 Bacteria 2114
662 Ga0466967_0170963 3300045976 Bacteria 2044
663 Ga0466967_0183525 3300045976 Bacteria 1974
664 Ga0466967_0244570 3300045976 Bacteria 1712
665 Ga0466967_0252036 3300045976 Bacteria 1686
666 Ga0466967_0495608 3300045976 Bacteria 1198
667 Ga0495592_0000397 3300046454 Bacteria 33962
668 Ga0495592_0008095 3300046454 Bacteria 7893
669 Ga0495603_0095528 3300046455 Bacteria 1737
670 Ga0495629_0107549 3300046459 Bacteria 1945
671 Ga0495629_0161015 3300046459 Bacteria 1559
672 Ga0495641_0051291 3300046461 Bacteria 1884
673 Ga0495641_0057979 3300046461 Bacteria 1753
674 Ga0495641_0080767 3300046461 Bacteria 1457
675 Ga0495651_0126575 3300046462 Bacteria 1870
676 Ga0495651_0126576 3300046462 Bacteria 1870
677 Ga0495653_0120545 3300046463 Bacteria 1870
678 Ga0495653_0165079 3300046463 Bacteria 1534
679 Ga0495582_0079567 3300046473 Bacteria 1819
680 Ga0495664_0007931 3300046477 Bacteria 5911
681 Ga0495664_0087709 3300046477 Bacteria 1869
682 Ga0495608_0089230 3300046511 Bacteria 1995
683 Ga0495608_0089231 3300046511 Bacteria 1995
684 Ga0495608_0105594 3300046511 Bacteria 1813
685 Ga0495618_0009751 3300046514 Bacteria 5802
686 Ga0495628_0005043 3300046516 Bacteria 11605
687 Ga0495628_0122322 3300046516 Bacteria 1995
688 Ga0495630_0055169 3300046517 Bacteria 2977
689 Ga0495630_0152328 3300046517 Bacteria 1759
690 Ga0495652_0002110 3300046529 Bacteria 20949
691 Ga0495652_0049416 3300046529 Bacteria 3601
692 Ga0495652_0108948 3300046529 Bacteria 2231
693 Ga0495665_0093433 3300046531 Bacteria 1580
694 Ga0495640_0067173 3300046533 Bacteria 2415
695 Ga0495586_0015106 3300046535 Bacteria 4108
696 Ga0495587_0029133 3300046536 Bacteria 3353
697 Ga0495587_0099998 3300046536 Bacteria 1671
698 Ga0495645_0003234 3300046543 Bacteria 11048
699 Ga0495645_0010242 3300046543 Bacteria 6569
700 Ga0495667_0011880 3300046559 Bacteria 5898
701 Ga0495667_0114499 3300046559 Bacteria 1742
702 Ga0495634_0021736 3300046642 Bacteria 4529
703 Ga0495635_0074934 3300046663 Bacteria 2318
704 Ga0495635_0111827 3300046663 Bacteria 1865
705 Ga0495657_0192128 3300046675 Bacteria 1247
706 Ga0495599_0017017 3300046678 Bacteria 4516
707 Ga0495599_0084661 3300046678 Bacteria 1980
708 Ga0495623_0019997 3300046679 Bacteria 4328
709 Ga0495623_0100901 3300046679 Bacteria 1758
710 Ga0495646_0002659 3300046680 Bacteria 11047
711 Ga0495646_0004480 3300046680 Bacteria 8799
712 Ga0495658_0086658 3300046683 Bacteria 1848
713 Ga0495613_0039703 3300046689 Bacteria 3489
714 Ga0495624_0137472 3300046690 Bacteria 1497
715 Ga0495600_0009608 3300046809 Bacteria 5979
716 Ga0495600_0056669 3300046809 Bacteria 2560
717 Ga0495604_0004132 3300047317 Bacteria 11524
718 Ga0495604_0042757 3300047317 Bacteria 3549
719 Ga0495674_0088829 3300047319 Bacteria 2642
720 Ga0495676_0085788 3300047321 Bacteria 2371
721 Ga0495676_0124145 3300047321 Bacteria 1873
722 Ga0495680_0001602 3300047322 Bacteria 24122
723 Ga0495680_0096739 3300047322 Bacteria 2204
724 Ga0495680_0120073 3300047322 Bacteria 1941
725 Ga0495675_0034575 3300047444 Bacteria 3226
726 Ga0495675_0225124 3300047444 Bacteria 1133
727 Ga0495684_0000603 3300047471 Bacteria 28888
728 Ga0495684_0138994 3300047471 Bacteria 1821
729 Ga0495602_0017251 3300048088 Bacteria 7239
730 Ga0495602_0018432 3300048088 Bacteria 6970
731 Ga0496100_0003839 3300048903 Bacteria 7879
732 Ga0496100_0032129 3300048903 Bacteria 3269
733 Ga0496100_0252908 3300048903 Bacteria 1304
734 Ga0496101_0013820 3300048904 Bacteria 5419
735 Ga0496101_0134755 3300048904 Bacteria 1878
736 Ga0496102_0002619 3300048905 Bacteria 15298
737 Ga0496102_0008782 3300048905 Bacteria 8665
738 Ga0496102_0013364 3300048905 Bacteria 7111
739 Ga0496102_0015121 3300048905 Bacteria 6719
740 Ga0496102_0033772 3300048905 Bacteria 4600
741 Ga0496102_0051165 3300048905 Bacteria 3763
742 Ga0496102_0079766 3300048905 Bacteria 3014
743 Ga0496102_0136298 3300048905 Bacteria 2300
744 Ga0496102_0154518 3300048905 Bacteria 2157
745 Ga0496102_0177590 3300048905 Bacteria 2005
746 Ga0496102_0601730 3300048905 Bacteria 1022
747 Ga0496103_0009545 3300048906 Bacteria 5745
748 Ga0496103_0018415 3300048906 Bacteria 4189
749 Ga0496103_0048923 3300048906 Bacteria 2613
750 Ga0496103_0085930 3300048906 Bacteria 1982
751 Ga0496103_0160825 3300048906 Bacteria 1440
752 Ga0496103_0246457 3300048906 Bacteria 1150
753 Ga0496104_0030323 3300048907 Bacteria 5024
754 Ga0496104_0072786 3300048907 Bacteria 3268
755 Ga0496104_0103668 3300048907 Bacteria 2725
756 Ga0496104_0222010 3300048907 Bacteria 1802
757 Ga0496104_0234198 3300048907 Bacteria 1748
758 Ga0496104_0260922 3300048907 Bacteria 1645
759 Ga0496105_0004639 3300048908 Bacteria 10358
760 Ga0496105_0010601 3300048908 Bacteria 7251
761 Ga0496105_0013044 3300048908 Bacteria 6586
762 Ga0496105_0046910 3300048908 Bacteria 3566
763 Ga0496105_0071322 3300048908 Bacteria 2871
764 Ga0496105_0112375 3300048908 Bacteria 2248
765 Ga0496105_0134554 3300048908 Bacteria 2037
766 Ga0496105_0151400 3300048908 Bacteria 1906
767 Ga0496105_0163927 3300048908 Bacteria 1824
768 Ga0496105_0233606 3300048908 Bacteria 1494
769 Ga0496105_0465742 3300048908 Bacteria 996
770 Ga0496106_0055833 3300048909 Bacteria 2985
771 Ga0496107_0028957 3300048910 Bacteria 3938
772 Ga0496107_0038148 3300048910 Bacteria 3447
773 Ga0496107_0071877 3300048910 Bacteria 2514
774 Ga0496107_0130879 3300048910 Bacteria 1852
775 Ga0496107_0144379 3300048910 Bacteria 1759
776 Ga0496107_0264463 3300048910 Bacteria 1280
777 Ga0496107_0317528 3300048910 Bacteria 1159
778 Ga0496107_0438783 3300048910 Bacteria 970
779 Ga0496107_0487344 3300048910 Bacteria 915
780 Ga0496108_0008499 3300048911 Bacteria 8329
781 Ga0496108_0019824 3300048911 Bacteria 5526
782 Ga0496108_0055934 3300048911 Bacteria 3314
783 Ga0496108_0057158 3300048911 Bacteria 3278
784 Ga0496108_0170747 3300048911 Bacteria 1881
785 Ga0496108_0251142 3300048911 Bacteria 1539
786 Ga0496108_0279324 3300048911 Bacteria 1454
787 Ga0496108_0327330 3300048911 Bacteria 1336
788 Ga0496109_0014295 3300048912 Bacteria 6907
789 Ga0496109_0015913 3300048912 Bacteria 6569
790 Ga0496109_0058785 3300048912 Bacteria 3512
791 Ga0496109_0061158 3300048912 Bacteria 3442
792 Ga0496109_0088079 3300048912 Bacteria 2868
793 Ga0496109_0095372 3300048912 Bacteria 2754
794 Ga0496109_0195072 3300048912 Bacteria 1903
795 Ga0496109_0195396 3300048912 Bacteria 1901
796 Ga0496109_0214230 3300048912 Bacteria 1811
797 Ga0496109_0224563 3300048912 Bacteria 1767
798 Ga0496109_0242584 3300048912 Bacteria 1696
799 Ga0496109_0550688 3300048912 Bacteria 1088
800 Ga0496109_0583580 3300048912 Bacteria 1053
801 Ga0496110_0006612 3300048913 Bacteria 9209
802 Ga0496110_0012958 3300048913 Bacteria 6875
803 Ga0496110_0022918 3300048913 Bacteria 5306
804 Ga0496110_0079099 3300048913 Bacteria 2927
805 Ga0496110_0082241 3300048913 Bacteria 2872
806 Ga0496110_0083440 3300048913 Bacteria 2851
807 Ga0496110_0088856 3300048913 Bacteria 2760
808 Ga0496110_0138698 3300048913 Bacteria 2198
809 Ga0496110_0296797 3300048913 Bacteria 1472
810 Ga0496110_0310798 3300048913 Bacteria 1435
811 Ga0496110_0369646 3300048913 Bacteria 1307
812 Ga0496111_0000863 3300048914 Bacteria 16436
813 Ga0496111_0012659 3300048914 Bacteria 5717
814 Ga0496112_0154324 3300048915 Bacteria 2263
815 Ga0496112_0206213 3300048915 Bacteria 1924
816 Ga0496112_0639119 3300048915 Bacteria 994
817 Ga0496113_0036543 3300048916 Bacteria 3599
818 Ga0496113_0038091 3300048916 Bacteria 3533
819 Ga0496113_0358369 3300048916 Bacteria 1170
820 Ga0496114_0002152 3300048917 Bacteria 14991
821 Ga0496114_0003522 3300048917 Bacteria 12014
822 Ga0496114_0005765 3300048917 Bacteria 9725
823 Ga0496114_0008014 3300048917 Bacteria 8359
824 Ga0496114_0033141 3300048917 Bacteria 4255
825 Ga0496114_0074275 3300048917 Bacteria 2862
826 Ga0496114_0090983 3300048917 Bacteria 2590
827 Ga0496114_0107067 3300048917 Bacteria 2392
828 Ga0496114_0160447 3300048917 Bacteria 1954
829 Ga0496114_0216338 3300048917 Bacteria 1681
830 Ga0496114_0303922 3300048917 Bacteria 1408
831 Ga0496114_0353064 3300048917 Bacteria 1301
832 Ga0496114_0463582 3300048917 Bacteria 1121
833 Ga0496115_0029443 3300048918 Bacteria 4312
834 Ga0496115_0091212 3300048918 Bacteria 2490
835 Ga0496118_0173804 3300048921 Bacteria 1312
836 Ga0496119_0014608 3300048922 Bacteria 6124
837 Ga0496120_0006161 3300048923 Bacteria 9285
838 Ga0496121_0035843 3300048924 Bacteria 4434
839 Ga0496121_0169453 3300048924 Bacteria 1588
840 Ga0496123_0078694 3300048926 Bacteria 2018
841 Ga0496124_0228974 3300048927 Bacteria 1391
842 Ga0496126_0000039 3300048929 Bacteria 347353
843 Ga0501309_002015 3300049129 Bacteria 2123
844 Ga0501291_020713 3300049514 Bacteria 1043
845 Ga0501298_023437 3300049521 Bacteria 1170
846 Ga0501031_0001569 3300049568 Bacteria 14236
847 Ga0501031_0019479 3300049568 Bacteria 4421
848 Ga0501031_0056192 3300049568 Bacteria 2564
849 Ga0501031_0060482 3300049568 Bacteria 2468
850 Ga0501031_0091406 3300049568 Bacteria 1985
851 Ga0501031_0104827 3300049568 Bacteria 1845
852 Ga0501032_0059829 3300049569 Bacteria 2556
853 Ga0501032_0066357 3300049569 Bacteria 2411
854 Ga0501032_0077745 3300049569 Bacteria 2209
855 Ga0501033_0003386 3300049570 Bacteria 13153
856 Ga0501034_0051347 3300049571 Bacteria 4158
857 Ga0501034_0054748 3300049571 Bacteria 4016
858 Ga0501034_0064361 3300049571 Bacteria 3681
859 Ga0501036_0001694 3300049572 Bacteria 17122
860 Ga0501036_0006122 3300049572 Bacteria 9765
861 Ga0501036_0017266 3300049572 Bacteria 6031
862 Ga0501036_0033743 3300049572 Bacteria 4328
863 Ga0501036_0072369 3300049572 Bacteria 2914
864 Ga0501036_0121489 3300049572 Bacteria 2206
865 Ga0501036_0207628 3300049572 Bacteria 1646
866 Ga0501037_0023454 3300049573 Bacteria 4562
867 Ga0501037_0087179 3300049573 Bacteria 2259
868 Ga0501037_0091380 3300049573 Bacteria 2201
869 Ga0501037_0105898 3300049573 Bacteria 2027
870 Ga0501037_0114203 3300049573 Bacteria 1944
871 Ga0501038_0004008 3300049574 Bacteria 13683
872 Ga0501038_0013769 3300049574 Bacteria 7371
873 Ga0501039_0007037 3300049575 Bacteria 8560
874 Ga0501040_0001709 3300049576 Bacteria 14063
875 Ga0501040_0011354 3300049576 Bacteria 5830
876 Ga0501040_0054839 3300049576 Bacteria 2733
877 Ga0501040_0232480 3300049576 Bacteria 1313
878 Ga0501040_0357141 3300049576 Bacteria 1047
879 Ga0501041_0021998 3300049577 Bacteria 3818
880 Ga0501041_0069015 3300049577 Bacteria 2167
881 Ga0501041_0140093 3300049577 Bacteria 1508
882 Ga0501042_0003027 3300049578 Bacteria 10455
883 Ga0501042_0006792 3300049578 Bacteria 7460
884 Ga0501042_0046751 3300049578 Bacteria 3085
885 Ga0501043_0134861 3300049579 Bacteria 1934
886 Ga0501046_0010342 3300049580 Bacteria 8021
887 Ga0501046_0057893 3300049580 Bacteria 3039
888 Ga0501046_0073585 3300049580 Bacteria 2651
889 Ga0501047_0033893 3300049581 Bacteria 4928
890 Ga0501048_0007035 3300049582 Bacteria 8544
891 Ga0501048_0040541 3300049582 Bacteria 3336
892 Ga0501067_0004112 3300049583 Bacteria 8022
893 Ga0501067_0009441 3300049583 Bacteria 5406
894 Ga0501067_0060698 3300049583 Bacteria 2093
895 Ga0501067_0104913 3300049583 Bacteria 1570
896 Ga0501067_0166254 3300049583 Bacteria 1228
897 Ga0501068_0056147 3300049584 Bacteria 2387
898 Ga0501068_0130005 3300049584 Bacteria 1574
899 Ga0501069_0004130 3300049585 Bacteria 7498
900 Ga0501069_0007837 3300049585 Bacteria 5607
901 Ga0501069_0009384 3300049585 Bacteria 5165
902 Ga0501069_0017089 3300049585 Bacteria 3901
903 Ga0501069_0035271 3300049585 Bacteria 2755
904 Ga0501069_0095019 3300049585 Bacteria 1688
905 Ga0501069_0137160 3300049585 Bacteria 1402
906 Ga0501070_0003855 3300049586 Bacteria 12939
907 Ga0501070_0004279 3300049586 Bacteria 12279
908 Ga0501070_0021270 3300049586 Bacteria 5444
909 Ga0501070_0032937 3300049586 Bacteria 4335
910 Ga0501070_0035442 3300049586 Bacteria 4169
911 Ga0501070_0042917 3300049586 Bacteria 3765
912 Ga0501070_0097933 3300049586 Bacteria 2426
913 Ga0501070_0222332 3300049586 Bacteria 1548
914 Ga0501070_0442156 3300049586 Bacteria 1049
915 Ga0501071_0005666 3300049587 Bacteria 8054
916 Ga0501071_0005962 3300049587 Bacteria 7890
917 Ga0501071_0053300 3300049587 Bacteria 2917
918 Ga0501071_0222462 3300049587 Bacteria 1421
919 Ga0501072_0006084 3300049588 Bacteria 9211
920 Ga0501072_0009890 3300049588 Bacteria 7253
921 Ga0501072_0035834 3300049588 Bacteria 3888
922 Ga0501072_0052339 3300049588 Bacteria 3215
923 Ga0501072_0054608 3300049588 Bacteria 3147
924 Ga0501072_0070974 3300049588 Bacteria 2751
925 Ga0501072_0082701 3300049588 Bacteria 2545
926 Ga0501072_0111824 3300049588 Bacteria 2174
927 Ga0501073_0004693 3300049589 Bacteria 10261
928 Ga0501073_0019457 3300049589 Bacteria 4901
929 Ga0501073_0056459 3300049589 Bacteria 2746
930 Ga0501073_0063282 3300049589 Bacteria 2581
931 Ga0501073_0251170 3300049589 Bacteria 1221
932 Ga0501073_0454919 3300049589 Bacteria 885
933 Ga0501074_0007589 3300049590 Bacteria 7849
934 Ga0501074_0008026 3300049590 Bacteria 7644
935 Ga0501074_0016168 3300049590 Bacteria 5422
936 Ga0501074_0035660 3300049590 Bacteria 3604
937 Ga0501074_0049798 3300049590 Bacteria 3024
938 Ga0501074_0093115 3300049590 Bacteria 2158
939 Ga0501074_0106098 3300049590 Bacteria 2011
940 Ga0501074_0108479 3300049590 Bacteria 1987
941 Ga0501075_0009610 3300049591 Bacteria 6769
942 Ga0501075_0067091 3300049591 Bacteria 2709
943 Ga0501075_0138846 3300049591 Bacteria 1851
944 Ga0501076_0011478 3300049592 Bacteria 6600
945 Ga0501076_0049489 3300049592 Bacteria 3324
946 Ga0501076_0086503 3300049592 Bacteria 2519
947 Ga0501076_0086562 3300049592 Bacteria 2519
948 Ga0501077_0007878 3300049593 Bacteria 6579
949 Ga0501077_0009576 3300049593 Bacteria 6023
950 Ga0501077_0011162 3300049593 Bacteria 5604
951 Ga0501077_0022311 3300049593 Bacteria 4009
952 Ga0501079_0058312 3300049741 Bacteria 2979
953 Ga0501079_0079143 3300049741 Bacteria 2542
954 Ga0501079_0093028 3300049741 Bacteria 2336
955 Ga0501080_0000857 3300049742 Bacteria 24883
956 Ga0501080_0013574 3300049742 Bacteria 7500
957 Ga0501080_0029465 3300049742 Bacteria 5110
958 Ga0501080_0039249 3300049742 Bacteria 4419
959 Ga0501080_0157491 3300049742 Bacteria 2098
960 Ga0501080_0292281 3300049742 Bacteria 1479
961 Ga0501081_0017918 3300049743 Bacteria 4697
962 Ga0501081_0329002 3300049743 Bacteria 1124
963 Ga0501083_0020109 3300049744 Bacteria 4645
964 Ga0501083_0112653 3300049744 Bacteria 1788
965 Ga0501035_0021194 3300049822 Bacteria 5973
966 Ga0501035_0032558 3300049822 Bacteria 4742
967 Ga0501044_0040033 3300049823 Bacteria 4886
968 Ga0501045_0002747 3300049824 Bacteria 12022
969 Ga0501045_0019867 3300049824 Bacteria 4795
970 Ga0501045_0070494 3300049824 Bacteria 2572
971 Ga0501045_0074104 3300049824 Bacteria 2507
972 Ga0501045_0114517 3300049824 Bacteria 2000
973 Ga0501045_0134072 3300049824 Bacteria 1841
974 Ga0501045_0380013 3300049824 Bacteria 1051
975 nmdc:mga03683_108033_c1 3300050489 Bacteria 1228
976 nmdc:mga03n38_131271_c1 3300050490 Bacteria 1242
977 nmdc:mga03n38_15364_c1 3300050490 Bacteria 2955
978 nmdc:mga03n38_1536_c1 3300050490 Bacteria 6688
979 nmdc:mga03n38_16936_c1 3300050490 Bacteria 2845
980 nmdc:mga03n38_31013_c1 3300050490 Bacteria 2252
981 nmdc:mga03n38_51853_c1 3300050490 Bacteria 1834
982 nmdc:mga03n38_87017_c1 3300050490 Bacteria 1480
983 nmdc:mga03n38_92194_c1 3300050490 Bacteria 1445
984 nmdc:mga03n38_92387_c1 3300050490 Bacteria 1443
985 nmdc:mga03n38_9497_c1 3300050490 Bacteria 3543
986 nmdc:mga00v17_101428_c1 3300050491 Bacteria 1817
987 nmdc:mga00v17_12728_c1 3300050491 Bacteria 4647
988 nmdc:mga00v17_13995_c1 3300050491 Bacteria 4468
989 nmdc:mga00v17_167026_c1 3300050491 Bacteria 1418
990 nmdc:mga00v17_18892_c1 3300050491 Bacteria 3924
991 nmdc:mga00v17_199295_c1 3300050491 Bacteria 1294
992 nmdc:mga00v17_22363_c1 3300050491 Bacteria 3648
993 nmdc:mga00v17_30291_c1 3300050491 Bacteria 3183
994 nmdc:mga00v17_32669_c1 3300050491 Bacteria 3078
995 nmdc:mga00v17_49842_c1 3300050491 Bacteria 2542
996 nmdc:mga00v17_89878_c1 3300050491 Bacteria 1927
997 nmdc:mga0yw44_100306_c1 3300050492 Bacteria 1843
998 nmdc:mga0yw44_105970_c1 3300050492 Bacteria 1796
999 nmdc:mga0yw44_119425_c1 3300050492 Bacteria 1697
1000 nmdc:mga0yw44_146689_c1 3300050492 Bacteria 1537
1001 nmdc:mga0yw44_18098_c1 3300050492 Bacteria 3852
1002 nmdc:mga0yw44_18114_c1 3300050492 Bacteria 3850
1003 nmdc:mga0yw44_36814_c1 3300050492 Bacteria 2886
1004 nmdc:mga0yw44_38807_c1 3300050492 Bacteria 2820
1005 nmdc:mga0yw44_51998_c1 3300050492 Bacteria 2483
1006 nmdc:mga0yw44_56569_c1 3300050492 Bacteria 2390
1007 nmdc:mga0yw44_7733_c1 3300050492 Bacteria 5309
1008 nmdc:mga0yw44_98052_c1 3300050492 Bacteria 1863
1009 nmdc:mga06z11_26368_c1 3300050494 Bacteria 2765
1010 nmdc:mga06z11_56530_c1 3300050494 Bacteria 2030
1011 nmdc:mga06z11_69554_c1 3300050494 Bacteria 1859
1012 nmdc:mga06z11_8413_c1 3300050494 Bacteria 4301
1013 nmdc:mga04h51_102509_c1 3300050495 Bacteria 1045
1014 nmdc:mga04h51_23893_c1 3300050495 Bacteria 1866
1015 nmdc:mga07m45_101514_c1 3300050496 Bacteria 1652
1016 nmdc:mga07m45_2647_c1 3300050496 Bacteria 8434
1017 nmdc:mga07m45_44396_c1 3300050496 Bacteria 2495
1018 nmdc:mga07m45_80186_c1 3300050496 Bacteria 1864
1019 nmdc:mga07m45_9130_c1 3300050496 Bacteria 5123
1020 nmdc:mga07m45_97695_c1 3300050496 Bacteria 1685
1021 nmdc:mga05p37_147426_c1 3300050507 Bacteria 2880
1022 nmdc:mga09592_291569_c1 3300050508 Bacteria 1415
1023 nmdc:mga06r32_15209_c1 3300050510 Bacteria 6991
1024 nmdc:mga06r32_191537_c1 3300050510 Bacteria 2032
1025 nmdc:mga08y16_101083_c1 3300050511 Bacteria 3002
1026 nmdc:mga08y16_201480_c1 3300050511 Bacteria 2063
1027 nmdc:mga08y16_426063_c1 3300050511 Bacteria 1356
1028 nmdc:mga08y16_4414_c1 3300050511 Bacteria 14702
1029 nmdc:mga08y16_62979_c1 3300050511 Bacteria 3874
1030 nmdc:mga08y16_692626_c1 3300050511 Bacteria 1020
1031 nmdc:mga0rr50_403682_c1 3300050513 Bacteria 1155
1032 nmdc:mga0a205_124922_c1 3300050515 Bacteria 2473
1033 Ga0495601_0209487 3300053077 Bacteria 1273
1034 Ga0495612_0013400 3300053078 Bacteria 3302
1035 Ga0495595_0123021 3300053084 Bacteria 1264
1036 Ga0495619_0023815 3300053085 Bacteria 3924
1037 Ga0495619_0340286 3300053085 Bacteria 1038
1038 Ga0500643_000239 3300053087 Bacteria 51005
1039 Ga0500644_0000050 3300053088 Bacteria 71907
1040 Ga0500644_0000104 3300053088 Bacteria 53398
1041 Ga0500644_0081935 3300053088 Bacteria 1188
1042 Ga0500554_008044 3300053102 Bacteria 2458
1043 Ga0500554_078163 3300053102 Bacteria 1086
1044 Ga0500556_0001058 3300053104 Bacteria 14153
1045 Ga0500593_000179 3300053117 Bacteria 25713
1046 Ga0500573_0018977 3300053140 Bacteria 3931
1047 Ga0500616_0000060 3300053153 Bacteria 252252
1048 Ga0500616_0000792 3300053153 Bacteria 36236
1049 Ga0501084_0021438 3300054114 Bacteria 5384
1050 Ga0501084_0158009 3300054114 Bacteria 1912
1051 Ga0501084_0331367 3300054114 Bacteria 1285
1052 Ga0501084_0350322 3300054114 Bacteria 1248
1053 Ga0587073_0015132 3300059492 Bacteria 1385
1054 Ga0587111_0020289 3300060346 Bacteria 1270
1055 Ga0501082_0019122 3300060353 Bacteria 5902
1056 Ga0501082_0046676 3300060353 Bacteria 3733
1057 Ga0501082_0083012 3300060353 Bacteria 2764
1058 Ga0501082_0134419 3300060353 Bacteria 2146
1059 Ga0501082_0160522 3300060353 Bacteria 1953
1060 Ga0501082_0237345 3300060353 Bacteria 1587
1061 Ga0501082_0392189 3300060353 Bacteria 1211
1062 Ga0530510_0029698 3300061734 Bacteria 3925
1063 Ga0530510_0030715 3300061734 Bacteria 3860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100128992 Ga0307409_1001289922 230
2 3300026088 Ga0207641_10371400 Ga0207641_103714002 234
3 3300013105 Ga0157369_10215533 Ga0157369_102155332 261
4 3300048908 Ga0496105_0134554 Ga0496105_0134554_604_1596 261
5 3300038443 Ga0395901_0011948 Ga0395901_0011948_5904_6839 264
6 3300048908 Ga0496105_0046910 Ga0496105_0046910_2487_3398 269
7 3300049586 Ga0501070_0442156 Ga0501070_0442156_71_997 269
8 3300049591 Ga0501075_0138846 Ga0501075_0138846_365_1261 269
9 3300048910 Ga0496107_0487344 Ga0496107_0487344_14_826 270
10 3300049573 Ga0501037_0087179 Ga0501037_0087179_568_1494 271
11 3300049586 Ga0501070_0097933 Ga0501070_0097933_598_1524 271
12 3300049589 Ga0501073_0454919 Ga0501073_0454919_20_835 271
13 3300049592 Ga0501076_0049489 Ga0501076_0049489_1564_2490 271
14 3300049824 Ga0501045_0134072 Ga0501045_0134072_67_993 271
15 3300049741 Ga0501079_0058312 Ga0501079_0058312_1871_2791 272
16 3300005937 Ga0081455_10195177 Ga0081455_101951772 275
17 3300049571 Ga0501034_0064361 Ga0501034_0064361_191_1111 275
18 3300049588 Ga0501072_0082701 Ga0501072_0082701_389_1309 275
19 3300045976 Ga0466967_0073531 Ga0466967_0073531_1815_2744 276
20 3300049592 Ga0501076_0086562 Ga0501076_0086562_157_1077 276
21 3300054114 Ga0501084_0331367 Ga0501084_0331367_192_1112 276
22 3300060353 Ga0501082_0392189 Ga0501082_0392189_15_935 276
23 3300044694 Ga0466963_0069680 Ga0466963_0069680_726_1685 277
24 3300031995 Ga0307409_100071625 Ga0307409_1000716252 280
25 3300005614 Ga0068856_100274287 Ga0068856_1002742872 281
26 3300026078 Ga0207702_10496611 Ga0207702_104966111 281
27 3300048908 Ga0496105_0233606 Ga0496105_0233606_299_1195 281
28 3300048912 Ga0496109_0095372 Ga0496109_0095372_308_1204 281
29 3300053117 Ga0500593_000179 Ga0500593_000179_19796_20710 281
30 3300060353 Ga0501082_0134419 Ga0501082_0134419_14_931 281
31 3300013308 Ga0157375_10534980 Ga0157375_105349802 282
32 3300044901 Ga0466960_0023651 Ga0466960_0023651_1042_1959 282
33 3300053104 Ga0500556_0001058 Ga0500556_0001058_2038_2952 283
34 3300006048 Ga0075363_100001116 Ga0075363_1000011164 286
35 3300006353 Ga0075370_10001569 Ga0075370_100015694 286
36 3300048911 Ga0496108_0055934 Ga0496108_0055934_1656_2552 286
37 3300049589 Ga0501073_0056459 Ga0501073_0056459_949_1848 286
38 3300049742 Ga0501080_0157491 Ga0501080_0157491_1003_1902 286
39 3300050490 nmdc:mga03n38_15364_c1 nmdc:mga03n38_15364_c1_1350_2249 286
40 3300050491 nmdc:mga00v17_18892_c1 nmdc:mga00v17_18892_c1_2809_3708 286
41 3300050496 nmdc:mga07m45_80186_c1 nmdc:mga07m45_80186_c1_948_1847 286
42 3300039062 Ga0400483_021589 Ga0400483_021589_2789_3769 287
43 iso_pu_bacteria 2643221615 2644091769 288
44 iso_pu_bacteria 2643221657 2644321572 288
45 3300032002 Ga0307416_100102938 Ga0307416_1001029382 289
46 3300042438 Ga0439459_0030276 Ga0439459_0030276_57_950 289
47 3300053087 Ga0500643_000239 Ga0500643_000239_27616_28524 289
48 3300005355 Ga0070671_100001796 Ga0070671_1000017965 290
49 3300005548 Ga0070665_100006876 Ga0070665_1000068765 290
50 3300005843 Ga0068860_100012237 Ga0068860_1000122376 290
51 3300025931 Ga0207644_10027379 Ga0207644_100273795 290
52 3300028379 Ga0268266_10051556 Ga0268266_100515562 290
53 3300028381 Ga0268264_10004760 Ga0268264_100047607 290
54 3300048907 Ga0496104_0103668 Ga0496104_0103668_381_1265 290
55 3300048908 Ga0496105_0071322 Ga0496105_0071322_1320_2204 290
56 3300048922 Ga0496119_0014608 Ga0496119_0014608_1962_2846 290
57 3300048923 Ga0496120_0006161 Ga0496120_0006161_6428_7312 290
58 3300048924 Ga0496121_0169453 Ga0496121_0169453_79_963 290
59 3300049572 Ga0501036_0207628 Ga0501036_0207628_456_1373 290
60 3300049587 Ga0501071_0053300 Ga0501071_0053300_1331_2248 290
61 3300049824 Ga0501045_0074104 Ga0501045_0074104_91_1008 290
62 3300009148 Ga0105243_10209072 Ga0105243_102090722 291
63 3300048910 Ga0496107_0130879 Ga0496107_0130879_796_1710 291
64 iso_pu_bacteria 2784132109 2784470931 291
65 3300013308 Ga0157375_10029705 Ga0157375_100297052 292
66 3300017792 Ga0163161_10178144 Ga0163161_101781442 292
67 3300032126 Ga0307415_100283300 Ga0307415_1002833001 292
68 3300044683 Ga0466965_0004751 Ga0466965_0004751_3670_4575 292
69 3300044683 Ga0466965_0025243 Ga0466965_0025243_1838_2740 292
70 3300044683 Ga0466965_0048241 Ga0466965_0048241_902_1804 292
71 3300044693 Ga0466961_0109053 Ga0466961_0109053_481_1383 292
72 3300044694 Ga0466963_0038739 Ga0466963_0038739_800_1702 292
73 3300044706 Ga0466964_0031608 Ga0466964_0031608_765_1667 292
74 3300044842 Ga0466957_0001115 Ga0466957_0001115_9433_10335 292
75 3300044901 Ga0466960_0000350 Ga0466960_0000350_9977_10885 292
76 3300044901 Ga0466960_0006974 Ga0466960_0006974_1162_2064 292
77 3300045836 Ga0466958_0042983 Ga0466958_0042983_889_1791 292
78 3300045976 Ga0466967_0170963 Ga0466967_0170963_728_1630 292
79 3300049586 Ga0501070_0042917 Ga0501070_0042917_565_1509 292
80 iso_pu_bacteria 2643221567 2643853500 292
81 iso_pu_bacteria 2643221576 2643889890 292
82 iso_pu_bacteria 2643221590 2643958946 292
83 iso_pu_bacteria 2643221604 2644033896 292
84 iso_pu_bacteria 2643221617 2644102586 292
85 iso_pu_bacteria 2643221620 2644118248 292
86 iso_pu_bacteria 2643221624 2644137461 292
87 iso_pu_bacteria 2643221711 2644609995 292
88 iso_pu_bacteria 2811994874 2812331744 292
89 iso_pu_bacteria 2811994878 2812350174 292
90 iso_pu_bacteria 2818991318 2819425474 292
91 iso_pu_bacteria 2818991458 2819667844 292
92 iso_pu_bacteria 2818991462 2819690251 292
93 iso_pu_bacteria 2818991469 2819726201 292
94 iso_pu_bacteria 2855386786 2855388905 292
95 iso_pu_bacteria 2857481737 2857483235 292
96 3300005327 Ga0070658_10022845 Ga0070658_100228452 293
97 3300005331 Ga0070670_100156954 Ga0070670_1001569541 293
98 3300005548 Ga0070665_100000957 Ga0070665_10000095748 293
99 3300006048 Ga0075363_100061961 Ga0075363_1000619612 293
100 3300006178 Ga0075367_10018148 Ga0075367_100181484 293
101 3300013104 Ga0157370_10441299 Ga0157370_104412991 293
102 3300013307 Ga0157372_10416507 Ga0157372_104165072 293
103 3300013308 Ga0157375_10106735 Ga0157375_101067353 293
104 3300014497 Ga0182008_10092587 Ga0182008_100925872 293
105 3300025944 Ga0207661_10390562 Ga0207661_103905621 293
106 3300031995 Ga0307409_100329291 Ga0307409_1003292911 293
107 3300045976 Ga0466967_0183525 Ga0466967_0183525_801_1724 293
108 3300048903 Ga0496100_0032129 Ga0496100_0032129_372_1295 293
109 3300048904 Ga0496101_0134755 Ga0496101_0134755_158_1081 293
110 3300048905 Ga0496102_0013364 Ga0496102_0013364_4764_5687 293
111 3300048909 Ga0496106_0055833 Ga0496106_0055833_535_1458 293
112 3300048911 Ga0496108_0251142 Ga0496108_0251142_269_1192 293
113 3300048912 Ga0496109_0015913 Ga0496109_0015913_3885_4808 293
114 3300048912 Ga0496109_0214230 Ga0496109_0214230_197_1120 293
115 3300048917 Ga0496114_0005765 Ga0496114_0005765_7236_8159 293
116 3300048917 Ga0496114_0008014 Ga0496114_0008014_1106_2029 293
117 3300048918 Ga0496115_0091212 Ga0496115_0091212_1441_2364 293
118 3300048927 Ga0496124_0228974 Ga0496124_0228974_339_1310 293
119 3300050494 nmdc:mga06z11_56530_c1 nmdc:mga06z11_56530_c1_1061_1957 293
120 3300053088 Ga0500644_0000104 Ga0500644_0000104_33945_34841 293
121 iso_pu_bacteria 2643221641 2644228333 294
122 iso_pu_bacteria 2739367653 2739603387 294
123 iso_pu_bacteria 2739367898 2740165843 294
124 iso_pu_bacteria 2857481737 2857483533 294
125 iso_pu_bacteria 2857727296 2857727350 294
126 3300005843 Ga0068860_100000467 Ga0068860_10000046735 295
127 3300006844 Ga0075428_100021526 Ga0075428_1000215264 295
128 3300009094 Ga0111539_10012179 Ga0111539_1001217913 295
129 3300028381 Ga0268264_10001967 Ga0268264_100019679 295
130 3300039062 Ga0400483_095912 Ga0400483_095912_1796_2731 295
131 3300039062 Ga0400483_209527 Ga0400483_209527_890_1825 295
132 3300049588 Ga0501072_0070974 Ga0501072_0070974_867_1796 295
133 3300050511 nmdc:mga08y16_4414_c1 nmdc:mga08y16_4414_c1_4065_4955 295
134 iso_pu_bacteria 2643221576 2643893244 295
135 iso_pu_bacteria 2643221590 2643961697 295
136 iso_pu_bacteria 2643221604 2644034027 295
137 iso_pu_bacteria 2643221961 2645720479 295
138 iso_pu_bacteria 2643221962 2645723438 295
139 iso_pu_bacteria 2738541305 2738871640 295
140 iso_pu_bacteria 2773857762 2774393828 295
141 iso_pu_bacteria 2811994874 2812333915 295
142 iso_pu_bacteria 2984576629 2984579189 295
143 iso_pu_bacteria 2990256926 2990259918 295
144 iso_pu_bacteria 8054609563 8054609651 295
145 iso_pu_bacteria 8054609563 8054611362 295
146 3300003578 Ga0006562J51391_1041093 Ga0006562J51391_10410931 296
147 3300005615 Ga0070702_100092910 Ga0070702_1000929102 296
148 3300006038 Ga0075365_10008147 Ga0075365_100081475 296
149 3300006038 Ga0075365_10024606 Ga0075365_100246062 296
150 3300006038 Ga0075365_10031885 Ga0075365_100318853 296
151 3300006038 Ga0075365_10046940 Ga0075365_100469403 296
152 3300006038 Ga0075365_10054794 Ga0075365_100547942 296
153 3300006038 Ga0075365_10071600 Ga0075365_100716002 296
154 3300006038 Ga0075365_10075681 Ga0075365_100756813 296
155 3300006038 Ga0075365_10096041 Ga0075365_100960412 296
156 3300006038 Ga0075365_10101048 Ga0075365_101010482 296
157 3300006038 Ga0075365_10156839 Ga0075365_101568391 296
158 3300006038 Ga0075365_10159500 Ga0075365_101595002 296
159 3300006038 Ga0075365_10166502 Ga0075365_101665022 296
160 3300006042 Ga0075368_10000363 Ga0075368_100003635 296
161 3300006042 Ga0075368_10000952 Ga0075368_100009523 296
162 3300006042 Ga0075368_10017449 Ga0075368_100174492 296
163 3300006048 Ga0075363_100000170 Ga0075363_10000017023 296
164 3300006048 Ga0075363_100002522 Ga0075363_1000025222 296
165 3300006048 Ga0075363_100020550 Ga0075363_1000205502 296
166 3300006048 Ga0075363_100063141 Ga0075363_1000631412 296
167 3300006048 Ga0075363_100072134 Ga0075363_1000721342 296
168 3300006051 Ga0075364_10006272 Ga0075364_100062727 296
169 3300006051 Ga0075364_10014601 Ga0075364_100146016 296
170 3300006051 Ga0075364_10042989 Ga0075364_100429892 296
171 3300006051 Ga0075364_10057116 Ga0075364_100571163 296
172 3300006051 Ga0075364_10062326 Ga0075364_100623262 296
173 3300006051 Ga0075364_10086073 Ga0075364_100860733 296
174 3300006177 Ga0075362_10015327 Ga0075362_100153272 296
175 3300006178 Ga0075367_10000401 Ga0075367_1000040117 296
176 3300006178 Ga0075367_10019136 Ga0075367_100191361 296
177 3300006178 Ga0075367_10053572 Ga0075367_100535722 296
178 3300006353 Ga0075370_10001511 Ga0075370_100015113 296
179 3300006353 Ga0075370_10003287 Ga0075370_100032877 296
180 3300006353 Ga0075370_10065800 Ga0075370_100658002 296
181 3300009553 Ga0105249_10198452 Ga0105249_101984523 296
182 3300013308 Ga0157375_10243685 Ga0157375_102436852 296
183 3300013308 Ga0157375_10420163 Ga0157375_104201632 296
184 3300014745 Ga0157377_10182038 Ga0157377_101820382 296
185 3300017792 Ga0163161_10139886 Ga0163161_101398862 296
186 3300020082 Ga0206353_10455544 Ga0206353_104555443 296
187 3300025940 Ga0207691_10062688 Ga0207691_100626883 296
188 3300026067 Ga0207678_10109934 Ga0207678_101099342 296
189 3300027866 Ga0209813_10004119 Ga0209813_100041194 296
190 3300027866 Ga0209813_10007277 Ga0209813_100072772 296
191 3300031728 Ga0316578_10001825 Ga0316578_100018256 296
192 3300031824 Ga0307413_10149749 Ga0307413_101497492 296
193 3300031901 Ga0307406_10145445 Ga0307406_101454452 296
194 3300031901 Ga0307406_10221153 Ga0307406_102211532 296
195 3300031995 Ga0307409_100011357 Ga0307409_1000113572 296
196 3300031995 Ga0307409_100034975 Ga0307409_1000349752 296
197 3300031995 Ga0307409_100046156 Ga0307409_1000461563 296
198 3300031995 Ga0307409_100151443 Ga0307409_1001514432 296
199 3300032002 Ga0307416_100002929 Ga0307416_1000029293 296
200 3300032002 Ga0307416_100299986 Ga0307416_1002999861 296
201 3300032002 Ga0307416_100395067 Ga0307416_1003950672 296
202 3300032126 Ga0307415_100038392 Ga0307415_1000383922 296
203 3300032133 Ga0316583_10029656 Ga0316583_100296562 296
204 3300035398 Ga0316574_0007917 Ga0316574_0007917_4323_5222 296
205 3300036712 Ga0316584_0003766 Ga0316584_0003766_4480_5379 296
206 3300037418 Ga0395900_0058762 Ga0395900_0058762_1994_2896 296
207 3300038443 Ga0395901_0213971 Ga0395901_0213971_897_1814 296
208 3300044658 Ga0466972_0176165 Ga0466972_0176165_58_993 296
209 3300044683 Ga0466965_0012067 Ga0466965_0012067_969_1904 296
210 3300044765 Ga0466970_0012324 Ga0466970_0012324_2641_3576 296
211 3300044765 Ga0466970_0018226 Ga0466970_0018226_83_1018 296
212 3300044765 Ga0466970_0033313 Ga0466970_0033313_1708_2619 296
213 3300044765 Ga0466970_0098294 Ga0466970_0098294_181_1104 296
214 3300044842 Ga0466957_0096568 Ga0466957_0096568_356_1309 296
215 3300044901 Ga0466960_0008191 Ga0466960_0008191_1018_1914 296
216 3300044901 Ga0466960_0016237 Ga0466960_0016237_25_960 296
217 3300045836 Ga0466958_0094123 Ga0466958_0094123_230_1141 296
218 3300045976 Ga0466967_0119523 Ga0466967_0119523_597_1532 296
219 3300045976 Ga0466967_0159795 Ga0466967_0159795_58_969 296
220 3300048903 Ga0496100_0003839 Ga0496100_0003839_3582_4481 296
221 3300048905 Ga0496102_0015121 Ga0496102_0015121_157_1056 296
222 3300048906 Ga0496103_0009545 Ga0496103_0009545_1058_1957 296
223 3300048906 Ga0496103_0246457 Ga0496103_0246457_170_1096 296
224 3300048907 Ga0496104_0260922 Ga0496104_0260922_67_966 296
225 3300048908 Ga0496105_0004639 Ga0496105_0004639_9392_10291 296
226 3300048908 Ga0496105_0465742 Ga0496105_0465742_12_911 296
227 3300048910 Ga0496107_0264463 Ga0496107_0264463_330_1229 296
228 3300048911 Ga0496108_0327330 Ga0496108_0327330_25_924 296
229 3300048912 Ga0496109_0195072 Ga0496109_0195072_624_1523 296
230 3300048913 Ga0496110_0138698 Ga0496110_0138698_635_1534 296
231 3300048915 Ga0496112_0639119 Ga0496112_0639119_54_953 296
232 3300048916 Ga0496113_0038091 Ga0496113_0038091_904_1803 296
233 3300048917 Ga0496114_0090983 Ga0496114_0090983_1584_2483 296
234 3300048917 Ga0496114_0353064 Ga0496114_0353064_207_1103 296
235 3300048921 Ga0496118_0173804 Ga0496118_0173804_187_1101 296
236 3300049129 Ga0501309_002015 Ga0501309_002015_1185_2099 296
237 3300049568 Ga0501031_0001569 Ga0501031_0001569_1784_2719 296
238 3300049568 Ga0501031_0104827 Ga0501031_0104827_356_1279 296
239 3300049569 Ga0501032_0066357 Ga0501032_0066357_556_1479 296
240 3300049569 Ga0501032_0077745 Ga0501032_0077745_96_1031 296
241 3300049570 Ga0501033_0003386 Ga0501033_0003386_4753_5676 296
242 3300049572 Ga0501036_0001694 Ga0501036_0001694_11434_12369 296
243 3300049572 Ga0501036_0006122 Ga0501036_0006122_8177_9100 296
244 3300049572 Ga0501036_0121489 Ga0501036_0121489_981_1895 296
245 3300049573 Ga0501037_0023454 Ga0501037_0023454_2887_3810 296
246 3300049574 Ga0501038_0004008 Ga0501038_0004008_6139_7074 296
247 3300049574 Ga0501038_0013769 Ga0501038_0013769_1793_2716 296
248 3300049575 Ga0501039_0007037 Ga0501039_0007037_2756_3691 296
249 3300049576 Ga0501040_0001709 Ga0501040_0001709_11068_12003 296
250 3300049576 Ga0501040_0054839 Ga0501040_0054839_99_1013 296
251 3300049576 Ga0501040_0357141 Ga0501040_0357141_44_955 296
252 3300049577 Ga0501041_0021998 Ga0501041_0021998_1840_2775 296
253 3300049578 Ga0501042_0003027 Ga0501042_0003027_8701_9624 296
254 3300049578 Ga0501042_0006792 Ga0501042_0006792_2620_3555 296
255 3300049579 Ga0501043_0134861 Ga0501043_0134861_666_1589 296
256 3300049580 Ga0501046_0057893 Ga0501046_0057893_920_1843 296
257 3300049580 Ga0501046_0073585 Ga0501046_0073585_809_1732 296
258 3300049581 Ga0501047_0033893 Ga0501047_0033893_1203_2126 296
259 3300049582 Ga0501048_0007035 Ga0501048_0007035_2869_3804 296
260 3300049582 Ga0501048_0040541 Ga0501048_0040541_53_976 296
261 3300049585 Ga0501069_0007837 Ga0501069_0007837_767_1702 296
262 3300049586 Ga0501070_0032937 Ga0501070_0032937_832_1764 296
263 3300049588 Ga0501072_0006084 Ga0501072_0006084_2359_3294 296
264 3300049589 Ga0501073_0063282 Ga0501073_0063282_697_1620 296
265 3300049589 Ga0501073_0251170 Ga0501073_0251170_56_970 296
266 3300049590 Ga0501074_0049798 Ga0501074_0049798_334_1269 296
267 3300049590 Ga0501074_0108479 Ga0501074_0108479_451_1374 296
268 3300049591 Ga0501075_0067091 Ga0501075_0067091_834_1769 296
269 3300049592 Ga0501076_0011478 Ga0501076_0011478_2602_3537 296
270 3300049742 Ga0501080_0039249 Ga0501080_0039249_3080_4015 296
271 3300049822 Ga0501035_0021194 Ga0501035_0021194_2973_3896 296
272 3300049823 Ga0501044_0040033 Ga0501044_0040033_3230_4153 296
273 3300049824 Ga0501045_0019867 Ga0501045_0019867_2521_3456 296
274 3300049824 Ga0501045_0070494 Ga0501045_0070494_1445_2371 296
275 3300049824 Ga0501045_0380013 Ga0501045_0380013_73_996 296
276 3300050489 nmdc:mga03683_108033_c1 nmdc:mga03683_108033_c1_226_1152 296
277 3300050490 nmdc:mga03n38_131271_c1 nmdc:mga03n38_131271_c1_150_1067 296
278 3300050490 nmdc:mga03n38_1536_c1 nmdc:mga03n38_1536_c1_3764_4690 296
279 3300050490 nmdc:mga03n38_16936_c1 nmdc:mga03n38_16936_c1_1628_2572 296
280 3300050490 nmdc:mga03n38_31013_c1 nmdc:mga03n38_31013_c1_923_1855 296
281 3300050490 nmdc:mga03n38_51853_c1 nmdc:mga03n38_51853_c1_249_1163 296
282 3300050490 nmdc:mga03n38_87017_c1 nmdc:mga03n38_87017_c1_512_1438 296
283 3300050490 nmdc:mga03n38_92387_c1 nmdc:mga03n38_92387_c1_436_1374 296
284 3300050491 nmdc:mga00v17_101428_c1 nmdc:mga00v17_101428_c1_830_1744 296
285 3300050491 nmdc:mga00v17_12728_c1 nmdc:mga00v17_12728_c1_949_1863 296
286 3300050491 nmdc:mga00v17_13995_c1 nmdc:mga00v17_13995_c1_2954_3892 296
287 3300050491 nmdc:mga00v17_167026_c1 nmdc:mga00v17_167026_c1_266_1186 296
288 3300050491 nmdc:mga00v17_22363_c1 nmdc:mga00v17_22363_c1_1665_2603 296
289 3300050491 nmdc:mga00v17_32669_c1 nmdc:mga00v17_32669_c1_1113_2030 296
290 3300050491 nmdc:mga00v17_49842_c1 nmdc:mga00v17_49842_c1_255_1181 296
291 3300050492 nmdc:mga0yw44_100306_c1 nmdc:mga0yw44_100306_c1_27_941 296
292 3300050492 nmdc:mga0yw44_105970_c1 nmdc:mga0yw44_105970_c1_193_1107 296
293 3300050492 nmdc:mga0yw44_146689_c1 nmdc:mga0yw44_146689_c1_427_1368 296
294 3300050492 nmdc:mga0yw44_18098_c1 nmdc:mga0yw44_18098_c1_2555_3469 296
295 3300050492 nmdc:mga0yw44_18114_c1 nmdc:mga0yw44_18114_c1_1471_2388 296
296 3300050492 nmdc:mga0yw44_36814_c1 nmdc:mga0yw44_36814_c1_1345_2286 296
297 3300050492 nmdc:mga0yw44_38807_c1 nmdc:mga0yw44_38807_c1_1369_2307 296
298 3300050492 nmdc:mga0yw44_51998_c1 nmdc:mga0yw44_51998_c1_51_1034 296
299 3300050492 nmdc:mga0yw44_56569_c1 nmdc:mga0yw44_56569_c1_430_1464 296
300 3300050492 nmdc:mga0yw44_7733_c1 nmdc:mga0yw44_7733_c1_3870_4811 296
301 3300050494 nmdc:mga06z11_26368_c1 nmdc:mga06z11_26368_c1_187_1101 296
302 3300050494 nmdc:mga06z11_69554_c1 nmdc:mga06z11_69554_c1_868_1785 296
303 3300050495 nmdc:mga04h51_102509_c1 nmdc:mga04h51_102509_c1_77_1003 296
304 3300050496 nmdc:mga07m45_2647_c1 nmdc:mga07m45_2647_c1_919_1845 296
305 3300050496 nmdc:mga07m45_9130_c1 nmdc:mga07m45_9130_c1_708_1622 296
306 3300050496 nmdc:mga07m45_97695_c1 nmdc:mga07m45_97695_c1_231_1145 296
307 3300053088 Ga0500644_0000050 Ga0500644_0000050_31976_32890 296
308 3300053088 Ga0500644_0081935 Ga0500644_0081935_11_952 296
309 3300053102 Ga0500554_008044 Ga0500554_008044_579_1505 296
310 3300054114 Ga0501084_0350322 Ga0501084_0350322_242_1165 296
311 3300060353 Ga0501082_0019122 Ga0501082_0019122_2273_3208 296
312 3300061734 Ga0530510_0029698 Ga0530510_0029698_1762_2688 296
313 3300005364 Ga0070673_100194741 Ga0070673_1001947412 297
314 3300005456 Ga0070678_100073846 Ga0070678_1000738463 297
315 3300005535 Ga0070684_100005484 Ga0070684_1000054849 297
316 3300005535 Ga0070684_100093417 Ga0070684_1000934172 297
317 3300005547 Ga0070693_100021585 Ga0070693_1000215853 297
318 3300005548 Ga0070665_100019437 Ga0070665_1000194378 297
319 3300005563 Ga0068855_100051021 Ga0068855_1000510214 297
320 3300005577 Ga0068857_100047898 Ga0068857_1000478982 297
321 3300005614 Ga0068856_100007197 Ga0068856_1000071972 297
322 3300005618 Ga0068864_100021818 Ga0068864_1000218183 297
323 3300005842 Ga0068858_100042801 Ga0068858_1000428012 297
324 3300005937 Ga0081455_10000030 Ga0081455_1000003052 297
325 3300005937 Ga0081455_10221912 Ga0081455_102219122 297
326 3300005981 Ga0081538_10000065 Ga0081538_1000006599 297
327 3300006881 Ga0068865_100228041 Ga0068865_1002280412 297
328 3300009098 Ga0105245_10001389 Ga0105245_1000138920 297
329 3300009098 Ga0105245_10187166 Ga0105245_101871662 297
330 3300009553 Ga0105249_10031845 Ga0105249_100318451 297
331 3300010375 Ga0105239_10003376 Ga0105239_1000337625 297
332 3300011119 Ga0105246_10010063 Ga0105246_100100634 297
333 3300013105 Ga0157369_10010908 Ga0157369_1001090812 297
334 3300013306 Ga0163162_10002716 Ga0163162_100027164 297
335 3300013307 Ga0157372_10022009 Ga0157372_1002200910 297
336 3300020082 Ga0206353_11704839 Ga0206353_117048392 297
337 3300025901 Ga0207688_10019250 Ga0207688_100192504 297
338 3300025904 Ga0207647_10056181 Ga0207647_100561811 297
339 3300025909 Ga0207705_10038483 Ga0207705_100384834 297
340 3300025927 Ga0207687_10009758 Ga0207687_100097583 297
341 3300025932 Ga0207690_10040833 Ga0207690_100408333 297
342 3300025938 Ga0207704_10010985 Ga0207704_100109851 297
343 3300025944 Ga0207661_10011604 Ga0207661_1001160410 297
344 3300025944 Ga0207661_10103460 Ga0207661_101034602 297
345 3300025944 Ga0207661_10215718 Ga0207661_102157182 297
346 3300025949 Ga0207667_10085130 Ga0207667_100851303 297
347 3300025961 Ga0207712_10018068 Ga0207712_100180682 297
348 3300026035 Ga0207703_10100639 Ga0207703_101006392 297
349 3300026078 Ga0207702_10062949 Ga0207702_100629492 297
350 3300026088 Ga0207641_10100877 Ga0207641_101008771 297
351 3300026095 Ga0207676_10016306 Ga0207676_100163063 297
352 3300026116 Ga0207674_10042528 Ga0207674_100425285 297
353 3300026121 Ga0207683_10098365 Ga0207683_100983653 297
354 3300041509 Ga0451843_0051158 Ga0451843_0051158_67_966 297
355 3300044706 Ga0466964_0054265 Ga0466964_0054265_181_1089 297
356 3300045051 Ga0451576_0414424 Ga0451576_0414424_104_1039 297
357 3300045976 Ga0466967_0095098 Ga0466967_0095098_1739_2674 297
358 3300045976 Ga0466967_0244570 Ga0466967_0244570_403_1341 297
359 3300045976 Ga0466967_0252036 Ga0466967_0252036_385_1335 297
360 3300048905 Ga0496102_0033772 Ga0496102_0033772_564_1499 297
361 3300048905 Ga0496102_0051165 Ga0496102_0051165_2739_3674 297
362 3300048906 Ga0496103_0018415 Ga0496103_0018415_375_1310 297
363 3300048908 Ga0496105_0010601 Ga0496105_0010601_2676_3611 297
364 3300048910 Ga0496107_0028957 Ga0496107_0028957_2907_3842 297
365 3300048911 Ga0496108_0008499 Ga0496108_0008499_5103_6038 297
366 3300048912 Ga0496109_0014295 Ga0496109_0014295_4367_5302 297
367 3300048912 Ga0496109_0061158 Ga0496109_0061158_519_1454 297
368 3300048913 Ga0496110_0022918 Ga0496110_0022918_4309_5244 297
369 3300048914 Ga0496111_0000863 Ga0496111_0000863_13668_14603 297
370 3300048917 Ga0496114_0003522 Ga0496114_0003522_2803_3738 297
371 3300048918 Ga0496115_0029443 Ga0496115_0029443_1833_2768 297
372 3300049571 Ga0501034_0051347 Ga0501034_0051347_288_1226 297
373 3300049572 Ga0501036_0072369 Ga0501036_0072369_1255_2193 297
374 3300049573 Ga0501037_0114203 Ga0501037_0114203_31_969 297
375 3300049583 Ga0501067_0004112 Ga0501067_0004112_4086_5024 297
376 3300049583 Ga0501067_0009441 Ga0501067_0009441_1479_2417 297
377 3300049584 Ga0501068_0130005 Ga0501068_0130005_340_1278 297
378 3300049585 Ga0501069_0004130 Ga0501069_0004130_3715_4653 297
379 3300049585 Ga0501069_0009384 Ga0501069_0009384_2576_3511 297
380 3300049585 Ga0501069_0035271 Ga0501069_0035271_315_1250 297
381 3300049586 Ga0501070_0003855 Ga0501070_0003855_11557_12492 297
382 3300049586 Ga0501070_0021270 Ga0501070_0021270_1505_2443 297
383 3300049586 Ga0501070_0035442 Ga0501070_0035442_3142_4080 297
384 3300049587 Ga0501071_0005666 Ga0501071_0005666_2896_3834 297
385 3300049588 Ga0501072_0009890 Ga0501072_0009890_1733_2671 297
386 3300049588 Ga0501072_0035834 Ga0501072_0035834_177_1115 297
387 3300049589 Ga0501073_0004693 Ga0501073_0004693_8501_9439 297
388 3300049589 Ga0501073_0019457 Ga0501073_0019457_47_985 297
389 3300049590 Ga0501074_0007589 Ga0501074_0007589_3002_3940 297
390 3300049590 Ga0501074_0016168 Ga0501074_0016168_1507_2445 297
391 3300049590 Ga0501074_0035660 Ga0501074_0035660_1097_2032 297
392 3300049593 Ga0501077_0007878 Ga0501077_0007878_4312_5250 297
393 3300049593 Ga0501077_0022311 Ga0501077_0022311_87_1025 297
394 3300049742 Ga0501080_0000857 Ga0501080_0000857_14216_15154 297
395 3300049742 Ga0501080_0013574 Ga0501080_0013574_3523_4461 297
396 3300049742 Ga0501080_0292281 Ga0501080_0292281_361_1296 297
397 3300049744 Ga0501083_0020109 Ga0501083_0020109_326_1264 297
398 3300054114 Ga0501084_0021438 Ga0501084_0021438_952_1890 297
399 3300060353 Ga0501082_0083012 Ga0501082_0083012_323_1261 297
400 3300060353 Ga0501082_0160522 Ga0501082_0160522_729_1667 297
401 iso_pu_bacteria 2984576629 2984577222 297
402 iso_pu_bacteria 2990256926 2990260633 297
403 3300001990 JGI24737J22298_10002340 JGI24737J22298_100023401 298
404 3300002067 JGI24735J21928_10012866 JGI24735J21928_100128662 298
405 3300002075 JGI24738J21930_10013790 JGI24738J21930_100137901 298
406 3300005327 Ga0070658_10052400 Ga0070658_100524002 298
407 3300005327 Ga0070658_10174949 Ga0070658_101749492 298
408 3300005328 Ga0070676_10008718 Ga0070676_100087182 298
409 3300005329 Ga0070683_100004272 Ga0070683_10000427212 298
410 3300005329 Ga0070683_100068068 Ga0070683_1000680682 298
411 3300005329 Ga0070683_100188442 Ga0070683_1001884422 298
412 3300005329 Ga0070683_100530843 Ga0070683_1005308431 298
413 3300005331 Ga0070670_100055693 Ga0070670_1000556933 298
414 3300005331 Ga0070670_100139943 Ga0070670_1001399431 298
415 3300005337 Ga0070682_100020935 Ga0070682_1000209351 298
416 3300005337 Ga0070682_100033181 Ga0070682_1000331813 298
417 3300005337 Ga0070682_100087180 Ga0070682_1000871802 298
418 3300005338 Ga0068868_100130078 Ga0068868_1001300782 298
419 3300005338 Ga0068868_100219377 Ga0068868_1002193772 298
420 3300005339 Ga0070660_100026821 Ga0070660_1000268214 298
421 3300005341 Ga0070691_10032720 Ga0070691_100327203 298
422 3300005343 Ga0070687_100067500 Ga0070687_1000675002 298
423 3300005344 Ga0070661_100096484 Ga0070661_1000964842 298
424 3300005345 Ga0070692_10063357 Ga0070692_100633572 298
425 3300005353 Ga0070669_100085049 Ga0070669_1000850493 298
426 3300005354 Ga0070675_100003729 Ga0070675_1000037294 298
427 3300005354 Ga0070675_100081721 Ga0070675_1000817212 298
428 3300005356 Ga0070674_100020561 Ga0070674_1000205613 298
429 3300005356 Ga0070674_100028612 Ga0070674_1000286123 298
430 3300005366 Ga0070659_100017443 Ga0070659_1000174434 298
431 3300005366 Ga0070659_100031226 Ga0070659_1000312262 298
432 3300005366 Ga0070659_100111701 Ga0070659_1001117012 298
433 3300005438 Ga0070701_10002525 Ga0070701_100025254 298
434 3300005438 Ga0070701_10004513 Ga0070701_100045133 298
435 3300005441 Ga0070700_100011432 Ga0070700_1000114323 298
436 3300005441 Ga0070700_100016043 Ga0070700_1000160433 298
437 3300005441 Ga0070700_100033084 Ga0070700_1000330843 298
438 3300005455 Ga0070663_100026021 Ga0070663_1000260214 298
439 3300005457 Ga0070662_100023827 Ga0070662_1000238273 298
440 3300005459 Ga0068867_100019341 Ga0068867_1000193412 298
441 3300005459 Ga0068867_100060741 Ga0068867_1000607413 298
442 3300005466 Ga0070685_10066406 Ga0070685_100664061 298
443 3300005535 Ga0070684_100007079 Ga0070684_1000070797 298
444 3300005535 Ga0070684_100069190 Ga0070684_1000691903 298
445 3300005535 Ga0070684_100366711 Ga0070684_1003667112 298
446 3300005539 Ga0068853_100190760 Ga0068853_1001907602 298
447 3300005543 Ga0070672_100058530 Ga0070672_1000585302 298
448 3300005548 Ga0070665_100000273 Ga0070665_10000027360 298
449 3300005563 Ga0068855_100148667 Ga0068855_1001486673 298
450 3300005564 Ga0070664_100006966 Ga0070664_1000069664 298
451 3300005564 Ga0070664_100073978 Ga0070664_1000739783 298
452 3300005564 Ga0070664_100282178 Ga0070664_1002821782 298
453 3300005577 Ga0068857_100022586 Ga0068857_1000225864 298
454 3300005577 Ga0068857_100315139 Ga0068857_1003151392 298
455 3300005578 Ga0068854_100441639 Ga0068854_1004416392 298
456 3300005614 Ga0068856_100191745 Ga0068856_1001917453 298
457 3300005615 Ga0070702_100007278 Ga0070702_1000072784 298
458 3300005615 Ga0070702_100040366 Ga0070702_1000403662 298
459 3300005615 Ga0070702_100236934 Ga0070702_1002369341 298
460 3300005616 Ga0068852_100017197 Ga0068852_1000171977 298
461 3300005616 Ga0068852_100027017 Ga0068852_1000270174 298
462 3300005616 Ga0068852_100055241 Ga0068852_1000552413 298
463 3300005617 Ga0068859_100355058 Ga0068859_1003550582 298
464 3300005719 Ga0068861_100027454 Ga0068861_1000274542 298
465 3300005719 Ga0068861_100127864 Ga0068861_1001278642 298
466 3300005840 Ga0068870_10033509 Ga0068870_100335093 298
467 3300005842 Ga0068858_100191147 Ga0068858_1001911472 298
468 3300005985 Ga0081539_10033921 Ga0081539_100339213 298
469 3300006038 Ga0075365_10043984 Ga0075365_100439841 298
470 3300006178 Ga0075367_10090433 Ga0075367_100904331 298
471 3300006237 Ga0097621_100167876 Ga0097621_1001678762 298
472 3300006844 Ga0075428_100016372 Ga0075428_1000163725 298
473 3300006846 Ga0075430_100003986 Ga0075430_10000398612 298
474 3300006847 Ga0075431_100022766 Ga0075431_1000227667 298
475 3300006880 Ga0075429_100048371 Ga0075429_1000483716 298
476 3300006881 Ga0068865_100019619 Ga0068865_1000196194 298
477 3300006881 Ga0068865_100035311 Ga0068865_1000353114 298
478 3300006881 Ga0068865_100217837 Ga0068865_1002178372 298
479 3300006931 Ga0097620_100355027 Ga0097620_1003550272 298
480 3300009094 Ga0111539_10006328 Ga0111539_100063284 298
481 3300009094 Ga0111539_10046610 Ga0111539_100466105 298
482 3300009098 Ga0105245_10219360 Ga0105245_102193601 298
483 3300009098 Ga0105245_10465027 Ga0105245_104650272 298
484 3300009098 Ga0105245_10516366 Ga0105245_105163662 298
485 3300009147 Ga0114129_10010931 Ga0114129_1001093114 298
486 3300009148 Ga0105243_10014099 Ga0105243_100140997 298
487 3300009148 Ga0105243_10016322 Ga0105243_100163224 298
488 3300009176 Ga0105242_10058334 Ga0105242_100583343 298
489 3300009176 Ga0105242_10235375 Ga0105242_102353752 298
490 3300009177 Ga0105248_10031669 Ga0105248_100316694 298
491 3300009551 Ga0105238_10384194 Ga0105238_103841942 298
492 3300009551 Ga0105238_10392380 Ga0105238_103923802 298
493 3300009551 Ga0105238_10522303 Ga0105238_105223032 298
494 3300009553 Ga0105249_10004469 Ga0105249_1000446912 298
495 3300010375 Ga0105239_10010898 Ga0105239_100108984 298
496 3300010375 Ga0105239_10097739 Ga0105239_100977394 298
497 3300013102 Ga0157371_10089881 Ga0157371_100898813 298
498 3300013104 Ga0157370_10195463 Ga0157370_101954631 298
499 3300013105 Ga0157369_10040542 Ga0157369_100405425 298
500 3300013306 Ga0163162_10008332 Ga0163162_100083324 298
501 3300013306 Ga0163162_10163280 Ga0163162_101632803 298
502 3300013307 Ga0157372_10015861 Ga0157372_100158613 298
503 3300013307 Ga0157372_10125591 Ga0157372_101255912 298
504 3300014325 Ga0163163_10022365 Ga0163163_100223653 298
505 3300014325 Ga0163163_10151041 Ga0163163_101510412 298
506 3300014326 Ga0157380_10002258 Ga0157380_100022585 298
507 3300014326 Ga0157380_10010387 Ga0157380_100103873 298
508 3300014326 Ga0157380_10018962 Ga0157380_100189623 298
509 3300014326 Ga0157380_10173312 Ga0157380_101733123 298
510 3300014745 Ga0157377_10003131 Ga0157377_100031314 298
511 3300014745 Ga0157377_10024322 Ga0157377_100243222 298
512 3300014745 Ga0157377_10044772 Ga0157377_100447722 298
513 3300014745 Ga0157377_10048662 Ga0157377_100486621 298
514 3300025899 Ga0207642_10008017 Ga0207642_100080171 298
515 3300025899 Ga0207642_10050616 Ga0207642_100506162 298
516 3300025901 Ga0207688_10003017 Ga0207688_100030175 298
517 3300025901 Ga0207688_10004230 Ga0207688_100042306 298
518 3300025901 Ga0207688_10008819 Ga0207688_100088192 298
519 3300025901 Ga0207688_10025699 Ga0207688_100256991 298
520 3300025901 Ga0207688_10046663 Ga0207688_100466632 298
521 3300025904 Ga0207647_10002481 Ga0207647_1000248115 298
522 3300025907 Ga0207645_10039887 Ga0207645_100398872 298
523 3300025908 Ga0207643_10002197 Ga0207643_100021977 298
524 3300025908 Ga0207643_10037108 Ga0207643_100371082 298
525 3300025908 Ga0207643_10061829 Ga0207643_100618292 298
526 3300025918 Ga0207662_10059818 Ga0207662_100598182 298
527 3300025918 Ga0207662_10182328 Ga0207662_101823281 298
528 3300025919 Ga0207657_10017941 Ga0207657_100179415 298
529 3300025920 Ga0207649_10166865 Ga0207649_101668652 298
530 3300025925 Ga0207650_10057978 Ga0207650_100579782 298
531 3300025926 Ga0207659_10065925 Ga0207659_100659251 298
532 3300025926 Ga0207659_10125442 Ga0207659_101254422 298
533 3300025926 Ga0207659_10174260 Ga0207659_101742603 298
534 3300025927 Ga0207687_10005324 Ga0207687_100053243 298
535 3300025927 Ga0207687_10048229 Ga0207687_100482293 298
536 3300025932 Ga0207690_10023754 Ga0207690_100237543 298
537 3300025932 Ga0207690_10069857 Ga0207690_100698572 298
538 3300025933 Ga0207706_10017268 Ga0207706_100172685 298
539 3300025933 Ga0207706_10111560 Ga0207706_101115602 298
540 3300025935 Ga0207709_10025235 Ga0207709_100252353 298
541 3300025935 Ga0207709_10065834 Ga0207709_100658341 298
542 3300025935 Ga0207709_10105337 Ga0207709_101053373 298
543 3300025937 Ga0207669_10011553 Ga0207669_100115535 298
544 3300025937 Ga0207669_10058131 Ga0207669_100581311 298
545 3300025938 Ga0207704_10007814 Ga0207704_100078142 298
546 3300025938 Ga0207704_10029538 Ga0207704_100295381 298
547 3300025938 Ga0207704_10112401 Ga0207704_101124012 298
548 3300025940 Ga0207691_10018659 Ga0207691_100186594 298
549 3300025940 Ga0207691_10019738 Ga0207691_100197385 298
550 3300025940 Ga0207691_10059202 Ga0207691_100592022 298
551 3300025941 Ga0207711_10220691 Ga0207711_102206912 298
552 3300025942 Ga0207689_10079973 Ga0207689_100799733 298
553 3300025942 Ga0207689_10101864 Ga0207689_101018643 298
554 3300025942 Ga0207689_10183994 Ga0207689_101839942 298
555 3300025944 Ga0207661_10007007 Ga0207661_100070075 298
556 3300025944 Ga0207661_10324600 Ga0207661_103246002 298
557 3300025944 Ga0207661_10385443 Ga0207661_103854432 298
558 3300025945 Ga0207679_10090932 Ga0207679_100909323 298
559 3300025972 Ga0207668_10078002 Ga0207668_100780022 298
560 3300025981 Ga0207640_10120662 Ga0207640_101206621 298
561 3300026023 Ga0207677_10245429 Ga0207677_102454292 298
562 3300026023 Ga0207677_10273173 Ga0207677_102731732 298
563 3300026023 Ga0207677_10493475 Ga0207677_104934751 298
564 3300026067 Ga0207678_10041186 Ga0207678_100411864 298
565 3300026075 Ga0207708_10001046 Ga0207708_1000104613 298
566 3300026075 Ga0207708_10004147 Ga0207708_100041478 298
567 3300026075 Ga0207708_10004999 Ga0207708_100049996 298
568 3300026075 Ga0207708_10057384 Ga0207708_100573842 298
569 3300026089 Ga0207648_10003947 Ga0207648_1000394712 298
570 3300026089 Ga0207648_10004176 Ga0207648_100041765 298
571 3300026089 Ga0207648_10057841 Ga0207648_100578413 298
572 3300026116 Ga0207674_10120916 Ga0207674_101209162 298
573 3300026116 Ga0207674_10305772 Ga0207674_103057722 298
574 3300026118 Ga0207675_100004206 Ga0207675_10000420610 298
575 3300026118 Ga0207675_100004892 Ga0207675_10000489212 298
576 3300026118 Ga0207675_100082762 Ga0207675_1000827621 298
577 3300026121 Ga0207683_10053839 Ga0207683_100538391 298
578 3300026121 Ga0207683_10308097 Ga0207683_103080972 298
579 3300026142 Ga0207698_10176518 Ga0207698_101765181 298
580 3300026142 Ga0207698_10239967 Ga0207698_102399671 298
581 3300027907 Ga0207428_10051545 Ga0207428_100515454 298
582 3300028379 Ga0268266_10111075 Ga0268266_101110752 298
583 3300031456 Ga0307513_10015532 Ga0307513_100155325 298
584 3300031548 Ga0307408_100407527 Ga0307408_1004075272 298
585 3300031731 Ga0307405_10245022 Ga0307405_102450221 298
586 3300031731 Ga0307405_10350770 Ga0307405_103507701 298
587 3300031731 Ga0307405_10360050 Ga0307405_103600501 298
588 3300031824 Ga0307413_10057435 Ga0307413_100574352 298
589 3300031852 Ga0307410_10010750 Ga0307410_100107506 298
590 3300031852 Ga0307410_10116988 Ga0307410_101169883 298
591 3300031852 Ga0307410_10250395 Ga0307410_102503951 298
592 3300031901 Ga0307406_10048409 Ga0307406_100484093 298
593 3300031901 Ga0307406_10084938 Ga0307406_100849382 298
594 3300031903 Ga0307407_10017500 Ga0307407_100175003 298
595 3300031903 Ga0307407_10244465 Ga0307407_102444651 298
596 3300031911 Ga0307412_10345772 Ga0307412_103457722 298
597 3300031911 Ga0307412_10498430 Ga0307412_104984301 298
598 3300031995 Ga0307409_100009889 Ga0307409_1000098896 298
599 3300031995 Ga0307409_100108515 Ga0307409_1001085153 298
600 3300031995 Ga0307409_100215701 Ga0307409_1002157012 298
601 3300031995 Ga0307409_100254681 Ga0307409_1002546812 298
602 3300031995 Ga0307409_100437613 Ga0307409_1004376132 298
603 3300031995 Ga0307409_100492582 Ga0307409_1004925822 298
604 3300032005 Ga0307411_10221500 Ga0307411_102215002 298
605 3300032126 Ga0307415_100089941 Ga0307415_1000899412 298
606 3300032126 Ga0307415_100118290 Ga0307415_1001182902 298
607 3300044683 Ga0466965_0000459 Ga0466965_0000459_1874_2791 298
608 3300044706 Ga0466964_0048533 Ga0466964_0048533_404_1300 298
609 3300045976 Ga0466967_0003975 Ga0466967_0003975_8037_8933 298
610 3300046459 Ga0495629_0161015 Ga0495629_0161015_139_1035 298
611 3300046461 Ga0495641_0080767 Ga0495641_0080767_416_1312 298
612 3300046463 Ga0495653_0165079 Ga0495653_0165079_51_947 298
613 3300048905 Ga0496102_0002619 Ga0496102_0002619_11791_12687 298
614 3300048907 Ga0496104_0222010 Ga0496104_0222010_881_1777 298
615 3300048908 Ga0496105_0112375 Ga0496105_0112375_908_1804 298
616 3300048908 Ga0496105_0163927 Ga0496105_0163927_285_1184 298
617 3300048911 Ga0496108_0019824 Ga0496108_0019824_1792_2691 298
618 3300048911 Ga0496108_0057158 Ga0496108_0057158_152_1048 298
619 3300048912 Ga0496109_0058785 Ga0496109_0058785_666_1562 298
620 3300048912 Ga0496109_0242584 Ga0496109_0242584_174_1070 298
621 3300048912 Ga0496109_0583580 Ga0496109_0583580_142_1038 298
622 3300048913 Ga0496110_0006612 Ga0496110_0006612_3348_4247 298
623 3300048913 Ga0496110_0012958 Ga0496110_0012958_5710_6606 298
624 3300048913 Ga0496110_0310798 Ga0496110_0310798_277_1173 298
625 3300048915 Ga0496112_0206213 Ga0496112_0206213_1006_1902 298
626 3300048917 Ga0496114_0074275 Ga0496114_0074275_804_1700 298
627 3300048917 Ga0496114_0107067 Ga0496114_0107067_397_1293 298
628 3300048917 Ga0496114_0216338 Ga0496114_0216338_276_1172 298
629 3300048917 Ga0496114_0463582 Ga0496114_0463582_95_1003 298
630 3300049568 Ga0501031_0019479 Ga0501031_0019479_2109_3014 298
631 3300049568 Ga0501031_0056192 Ga0501031_0056192_1467_2363 298
632 3300049568 Ga0501031_0091406 Ga0501031_0091406_519_1424 298
633 3300049571 Ga0501034_0054748 Ga0501034_0054748_554_1450 298
634 3300049573 Ga0501037_0105898 Ga0501037_0105898_568_1473 298
635 3300049576 Ga0501040_0232480 Ga0501040_0232480_105_1010 298
636 3300049583 Ga0501067_0060698 Ga0501067_0060698_1036_1932 298
637 3300049585 Ga0501069_0017089 Ga0501069_0017089_1895_2791 298
638 3300049585 Ga0501069_0095019 Ga0501069_0095019_47_943 298
639 3300049585 Ga0501069_0137160 Ga0501069_0137160_46_954 298
640 3300049586 Ga0501070_0004279 Ga0501070_0004279_2545_3453 298
641 3300049586 Ga0501070_0222332 Ga0501070_0222332_532_1428 298
642 3300049587 Ga0501071_0005962 Ga0501071_0005962_529_1425 298
643 3300049587 Ga0501071_0222462 Ga0501071_0222462_430_1386 298
644 3300049588 Ga0501072_0111824 Ga0501072_0111824_811_1707 298
645 3300049590 Ga0501074_0008026 Ga0501074_0008026_6359_7267 298
646 3300049593 Ga0501077_0009576 Ga0501077_0009576_2678_3574 298
647 3300049741 Ga0501079_0093028 Ga0501079_0093028_854_1762 298
648 3300049742 Ga0501080_0029465 Ga0501080_0029465_604_1500 298
649 3300049824 Ga0501045_0114517 Ga0501045_0114517_135_1040 298
650 3300050507 nmdc:mga05p37_147426_c1 nmdc:mga05p37_147426_c1_371_1267 298
651 3300050508 nmdc:mga09592_291569_c1 nmdc:mga09592_291569_c1_210_1106 298
652 3300050510 nmdc:mga06r32_15209_c1 nmdc:mga06r32_15209_c1_5881_6777 298
653 3300050511 nmdc:mga08y16_101083_c1 nmdc:mga08y16_101083_c1_889_1785 298
654 3300050511 nmdc:mga08y16_426063_c1 nmdc:mga08y16_426063_c1_168_1100 298
655 3300053085 Ga0495619_0340286 Ga0495619_0340286_74_970 298
656 3300060353 Ga0501082_0046676 Ga0501082_0046676_2288_3184 298
657 iso_pu_bacteria 2643221567 2643850090 298
658 iso_pu_bacteria 2643221624 2644136092 298
659 3300001915 JGI24741J21665_1009250 JGI24741J21665_10092501 299
660 3300001976 JGI24752J21851_1003606 JGI24752J21851_10036061 299
661 3300001979 JGI24740J21852_10016912 JGI24740J21852_100169123 299
662 3300001989 JGI24739J22299_10024977 JGI24739J22299_100249773 299
663 3300002075 JGI24738J21930_10012282 JGI24738J21930_100122821 299
664 3300002459 JGI24751J29686_10009083 JGI24751J29686_100090832 299
665 3300005331 Ga0070670_100030720 Ga0070670_1000307202 299
666 3300005334 Ga0068869_100101416 Ga0068869_1001014162 299
667 3300005335 Ga0070666_10111673 Ga0070666_101116731 299
668 3300005336 Ga0070680_100086487 Ga0070680_1000864873 299
669 3300005338 Ga0068868_100155424 Ga0068868_1001554242 299
670 3300005338 Ga0068868_100337182 Ga0068868_1003371821 299
671 3300005341 Ga0070691_10008438 Ga0070691_100084382 299
672 3300005343 Ga0070687_100170331 Ga0070687_1001703312 299
673 3300005344 Ga0070661_100083997 Ga0070661_1000839972 299
674 3300005345 Ga0070692_10031200 Ga0070692_100312003 299
675 3300005353 Ga0070669_100113295 Ga0070669_1001132953 299
676 3300005354 Ga0070675_100201298 Ga0070675_1002012982 299
677 3300005355 Ga0070671_100284606 Ga0070671_1002846062 299
678 3300005356 Ga0070674_100064123 Ga0070674_1000641231 299
679 3300005367 Ga0070667_100105794 Ga0070667_1001057943 299
680 3300005434 Ga0070709_10018818 Ga0070709_100188181 299
681 3300005434 Ga0070709_10219397 Ga0070709_102193972 299
682 3300005434 Ga0070709_10226601 Ga0070709_102266011 299
683 3300005434 Ga0070709_10318096 Ga0070709_103180961 299
684 3300005435 Ga0070714_100145978 Ga0070714_1001459781 299
685 3300005435 Ga0070714_100351591 Ga0070714_1003515912 299
686 3300005436 Ga0070713_100499694 Ga0070713_1004996941 299
687 3300005437 Ga0070710_10033092 Ga0070710_100330923 299
688 3300005437 Ga0070710_10196074 Ga0070710_101960741 299
689 3300005438 Ga0070701_10013161 Ga0070701_100131614 299
690 3300005439 Ga0070711_100107191 Ga0070711_1001071911 299
691 3300005439 Ga0070711_100305484 Ga0070711_1003054841 299
692 3300005439 Ga0070711_100518832 Ga0070711_1005188321 299
693 3300005440 Ga0070705_100173239 Ga0070705_1001732392 299
694 3300005441 Ga0070700_100074634 Ga0070700_1000746342 299
695 3300005456 Ga0070678_100152184 Ga0070678_1001521841 299
696 3300005458 Ga0070681_10216441 Ga0070681_102164412 299
697 3300005467 Ga0070706_100417038 Ga0070706_1004170381 299
698 3300005530 Ga0070679_100079751 Ga0070679_1000797512 299
699 3300005535 Ga0070684_100084213 Ga0070684_1000842133 299
700 3300005535 Ga0070684_100104682 Ga0070684_1001046823 299
701 3300005539 Ga0068853_100332806 Ga0068853_1003328062 299
702 3300005539 Ga0068853_100332826 Ga0068853_1003328262 299
703 3300005547 Ga0070693_100140788 Ga0070693_1001407881 299
704 3300005548 Ga0070665_100001051 Ga0070665_1000010512 299
705 3300005563 Ga0068855_100250575 Ga0068855_1002505752 299
706 3300005563 Ga0068855_100672769 Ga0068855_1006727691 299
707 3300005563 Ga0068855_100833010 Ga0068855_1008330101 299
708 3300005577 Ga0068857_100067847 Ga0068857_1000678472 299
709 3300005577 Ga0068857_100108497 Ga0068857_1001084972 299
710 3300005578 Ga0068854_100380884 Ga0068854_1003808842 299
711 3300005578 Ga0068854_100470469 Ga0068854_1004704691 299
712 3300005615 Ga0070702_100139491 Ga0070702_1001394912 299
713 3300005616 Ga0068852_100349429 Ga0068852_1003494292 299
714 3300005617 Ga0068859_100205012 Ga0068859_1002050123 299
715 3300005617 Ga0068859_100612565 Ga0068859_1006125651 299
716 3300005618 Ga0068864_100107890 Ga0068864_1001078902 299
717 3300005719 Ga0068861_100029179 Ga0068861_1000291793 299
718 3300005719 Ga0068861_100116466 Ga0068861_1001164662 299
719 3300005719 Ga0068861_100158172 Ga0068861_1001581722 299
720 3300005841 Ga0068863_100380823 Ga0068863_1003808231 299
721 3300005842 Ga0068858_100094287 Ga0068858_1000942872 299
722 3300005844 Ga0068862_100216380 Ga0068862_1002163802 299
723 3300005937 Ga0081455_10071377 Ga0081455_100713773 299
724 3300005983 Ga0081540_1025012 Ga0081540_10250121 299
725 3300006028 Ga0070717_10098364 Ga0070717_100983643 299
726 3300006028 Ga0070717_10375462 Ga0070717_103754622 299
727 3300006038 Ga0075365_10112732 Ga0075365_101127322 299
728 3300006042 Ga0075368_10031645 Ga0075368_100316452 299
729 3300006048 Ga0075363_100000416 Ga0075363_1000004169 299
730 3300006048 Ga0075363_100079254 Ga0075363_1000792541 299
731 3300006051 Ga0075364_10008594 Ga0075364_100085942 299
732 3300006051 Ga0075364_10073802 Ga0075364_100738022 299
733 3300006163 Ga0070715_10011892 Ga0070715_100118922 299
734 3300006173 Ga0070716_100192595 Ga0070716_1001925952 299
735 3300006175 Ga0070712_100069159 Ga0070712_1000691592 299
736 3300006175 Ga0070712_100111253 Ga0070712_1001112531 299
737 3300006175 Ga0070712_100169574 Ga0070712_1001695742 299
738 3300006175 Ga0070712_100500521 Ga0070712_1005005211 299
739 3300006178 Ga0075367_10010955 Ga0075367_100109555 299
740 3300006178 Ga0075367_10080839 Ga0075367_100808392 299
741 3300006237 Ga0097621_100086442 Ga0097621_1000864423 299
742 3300006353 Ga0075370_10032220 Ga0075370_100322203 299
743 3300006844 Ga0075428_100800667 Ga0075428_1008006671 299
744 3300006847 Ga0075431_100141258 Ga0075431_1001412583 299
745 3300006852 Ga0075433_10088568 Ga0075433_100885682 299
746 3300006931 Ga0097620_100205006 Ga0097620_1002050061 299
747 3300006931 Ga0097620_100612567 Ga0097620_1006125671 299
748 3300009094 Ga0111539_10048292 Ga0111539_100482924 299
749 3300009094 Ga0111539_10373232 Ga0111539_103732322 299
750 3300009094 Ga0111539_10460281 Ga0111539_104602812 299
751 3300009094 Ga0111539_10490536 Ga0111539_104905362 299
752 3300009098 Ga0105245_10163601 Ga0105245_101636012 299
753 3300009148 Ga0105243_10224463 Ga0105243_102244632 299
754 3300009176 Ga0105242_10451169 Ga0105242_104511692 299
755 3300009177 Ga0105248_10200240 Ga0105248_102002402 299
756 3300009177 Ga0105248_10279932 Ga0105248_102799322 299
757 3300009545 Ga0105237_10033781 Ga0105237_100337812 299
758 3300009545 Ga0105237_10393879 Ga0105237_103938792 299
759 3300009551 Ga0105238_10044672 Ga0105238_100446723 299
760 3300009551 Ga0105238_10268573 Ga0105238_102685731 299
761 3300009553 Ga0105249_10347224 Ga0105249_103472242 299
762 3300010375 Ga0105239_10156809 Ga0105239_101568094 299
763 3300010375 Ga0105239_10503710 Ga0105239_105037102 299
764 3300011119 Ga0105246_10090788 Ga0105246_100907882 299
765 3300012480 Ga0157346_1000863 Ga0157346_10008632 299
766 3300013105 Ga0157369_10338537 Ga0157369_103385372 299
767 3300013105 Ga0157369_10387946 Ga0157369_103879461 299
768 3300013105 Ga0157369_10838189 Ga0157369_108381891 299
769 3300013306 Ga0163162_10185897 Ga0163162_101858972 299
770 3300013307 Ga0157372_10000025 Ga0157372_10000025182 299
771 3300013307 Ga0157372_10403120 Ga0157372_104031201 299
772 3300013307 Ga0157372_10697150 Ga0157372_106971502 299
773 3300013308 Ga0157375_10058354 Ga0157375_100583541 299
774 3300014325 Ga0163163_10067546 Ga0163163_100675463 299
775 3300014325 Ga0163163_10129195 Ga0163163_101291952 299
776 3300014326 Ga0157380_10351377 Ga0157380_103513772 299
777 3300014969 Ga0157376_10263359 Ga0157376_102633592 299
778 3300020081 Ga0206354_10058287 Ga0206354_100582871 299
779 3300020082 Ga0206353_10418635 Ga0206353_104186352 299
780 3300020082 Ga0206353_11712015 Ga0206353_117120153 299
781 3300025898 Ga0207692_10012583 Ga0207692_100125834 299
782 3300025898 Ga0207692_10056314 Ga0207692_100563141 299
783 3300025898 Ga0207692_10156153 Ga0207692_101561531 299
784 3300025901 Ga0207688_10015048 Ga0207688_100150482 299
785 3300025906 Ga0207699_10044113 Ga0207699_100441132 299
786 3300025906 Ga0207699_10053763 Ga0207699_100537632 299
787 3300025906 Ga0207699_10199098 Ga0207699_101990982 299
788 3300025908 Ga0207643_10023134 Ga0207643_100231344 299
789 3300025910 Ga0207684_10247373 Ga0207684_102473732 299
790 3300025912 Ga0207707_10160407 Ga0207707_101604071 299
791 3300025914 Ga0207671_10028511 Ga0207671_100285112 299
792 3300025915 Ga0207693_10127068 Ga0207693_101270681 299
793 3300025915 Ga0207693_10464635 Ga0207693_104646351 299
794 3300025916 Ga0207663_10009729 Ga0207663_100097293 299
795 3300025916 Ga0207663_10035696 Ga0207663_100356962 299
796 3300025916 Ga0207663_10140756 Ga0207663_101407562 299
797 3300025916 Ga0207663_10259046 Ga0207663_102590461 299
798 3300025917 Ga0207660_10482565 Ga0207660_104825651 299
799 3300025918 Ga0207662_10009033 Ga0207662_100090334 299
800 3300025919 Ga0207657_10030851 Ga0207657_100308512 299
801 3300025921 Ga0207652_10036477 Ga0207652_100364773 299
802 3300025924 Ga0207694_10231719 Ga0207694_102317192 299
803 3300025925 Ga0207650_10001714 Ga0207650_1000171412 299
804 3300025927 Ga0207687_10283889 Ga0207687_102838891 299
805 3300025928 Ga0207700_10011354 Ga0207700_100113544 299
806 3300025928 Ga0207700_10022238 Ga0207700_100222382 299
807 3300025928 Ga0207700_10146230 Ga0207700_101462301 299
808 3300025928 Ga0207700_10192090 Ga0207700_101920901 299
809 3300025928 Ga0207700_10586713 Ga0207700_105867131 299
810 3300025929 Ga0207664_10047751 Ga0207664_100477511 299
811 3300025929 Ga0207664_10122731 Ga0207664_101227312 299
812 3300025929 Ga0207664_10169166 Ga0207664_101691662 299
813 3300025929 Ga0207664_10181658 Ga0207664_101816582 299
814 3300025929 Ga0207664_10292201 Ga0207664_102922012 299
815 3300025931 Ga0207644_10043005 Ga0207644_100430053 299
816 3300025932 Ga0207690_10107677 Ga0207690_101076771 299
817 3300025934 Ga0207686_10057573 Ga0207686_100575733 299
818 3300025939 Ga0207665_10071309 Ga0207665_100713092 299
819 3300025942 Ga0207689_10088140 Ga0207689_100881402 299
820 3300025944 Ga0207661_10013156 Ga0207661_100131562 299
821 3300025944 Ga0207661_10071722 Ga0207661_100717222 299
822 3300025944 Ga0207661_10163734 Ga0207661_101637342 299
823 3300025945 Ga0207679_10015370 Ga0207679_100153701 299
824 3300025961 Ga0207712_10214647 Ga0207712_102146472 299
825 3300026023 Ga0207677_10039878 Ga0207677_100398782 299
826 3300026023 Ga0207677_10099542 Ga0207677_100995423 299
827 3300026035 Ga0207703_10081187 Ga0207703_100811872 299
828 3300026041 Ga0207639_10089865 Ga0207639_100898652 299
829 3300026067 Ga0207678_10000105 Ga0207678_1000010567 299
830 3300026075 Ga0207708_10000436 Ga0207708_100004365 299
831 3300026078 Ga0207702_10068760 Ga0207702_100687603 299
832 3300026088 Ga0207641_10055170 Ga0207641_100551702 299
833 3300026095 Ga0207676_10002083 Ga0207676_100020833 299
834 3300026095 Ga0207676_10503258 Ga0207676_105032581 299
835 3300026116 Ga0207674_10019540 Ga0207674_100195402 299
836 3300026116 Ga0207674_10135832 Ga0207674_101358322 299
837 3300026118 Ga0207675_100526758 Ga0207675_1005267581 299
838 3300026121 Ga0207683_10021359 Ga0207683_100213594 299
839 3300026121 Ga0207683_10043229 Ga0207683_100432292 299
840 3300026142 Ga0207698_10129947 Ga0207698_101299472 299
841 3300027866 Ga0209813_10003987 Ga0209813_100039872 299
842 3300027866 Ga0209813_10061192 Ga0209813_100611921 299
843 3300027907 Ga0207428_10030127 Ga0207428_100301271 299
844 3300027907 Ga0207428_10335457 Ga0207428_103354571 299
845 3300028379 Ga0268266_10144612 Ga0268266_101446122 299
846 3300028380 Ga0268265_10179938 Ga0268265_101799381 299
847 3300028381 Ga0268264_10000242 Ga0268264_1000024288 299
848 3300028381 Ga0268264_10039308 Ga0268264_100393085 299
849 3300031247 Ga0265340_10000537 Ga0265340_1000053713 299
850 3300031456 Ga0307513_10092563 Ga0307513_100925632 299
851 3300031548 Ga0307408_100427210 Ga0307408_1004272101 299
852 3300031731 Ga0307405_10142180 Ga0307405_101421802 299
853 3300031824 Ga0307413_10041923 Ga0307413_100419233 299
854 3300031824 Ga0307413_10139104 Ga0307413_101391042 299
855 3300031824 Ga0307413_10170290 Ga0307413_101702902 299
856 3300031852 Ga0307410_10006651 Ga0307410_100066513 299
857 3300031852 Ga0307410_10018682 Ga0307410_100186822 299
858 3300031852 Ga0307410_10087383 Ga0307410_100873832 299
859 3300031852 Ga0307410_10342705 Ga0307410_103427052 299
860 3300031852 Ga0307410_10388316 Ga0307410_103883162 299
861 3300031901 Ga0307406_10031477 Ga0307406_100314772 299
862 3300031901 Ga0307406_10104163 Ga0307406_101041632 299
863 3300031901 Ga0307406_10288210 Ga0307406_102882102 299
864 3300031903 Ga0307407_10004673 Ga0307407_100046734 299
865 3300031903 Ga0307407_10010415 Ga0307407_100104152 299
866 3300031903 Ga0307407_10015197 Ga0307407_100151972 299
867 3300031903 Ga0307407_10016371 Ga0307407_100163715 299
868 3300031903 Ga0307407_10062237 Ga0307407_100622372 299
869 3300031995 Ga0307409_100016694 Ga0307409_1000166944 299
870 3300031995 Ga0307409_100030018 Ga0307409_1000300182 299
871 3300031995 Ga0307409_100038144 Ga0307409_1000381442 299
872 3300031995 Ga0307409_100060483 Ga0307409_1000604834 299
873 3300031995 Ga0307409_100063299 Ga0307409_1000632992 299
874 3300031995 Ga0307409_100097167 Ga0307409_1000971672 299
875 3300031995 Ga0307409_100240713 Ga0307409_1002407132 299
876 3300031995 Ga0307409_100440840 Ga0307409_1004408402 299
877 3300032002 Ga0307416_100002883 Ga0307416_1000028838 299
878 3300032002 Ga0307416_100012921 Ga0307416_1000129213 299
879 3300032002 Ga0307416_100048729 Ga0307416_1000487294 299
880 3300032002 Ga0307416_100051207 Ga0307416_1000512073 299
881 3300032002 Ga0307416_100065621 Ga0307416_1000656212 299
882 3300032002 Ga0307416_100186307 Ga0307416_1001863072 299
883 3300032005 Ga0307411_10068352 Ga0307411_100683522 299
884 3300032005 Ga0307411_10076823 Ga0307411_100768232 299
885 3300032005 Ga0307411_10095665 Ga0307411_100956652 299
886 3300032126 Ga0307415_100007652 Ga0307415_1000076522 299
887 3300032126 Ga0307415_100009492 Ga0307415_1000094925 299
888 3300032126 Ga0307415_100021802 Ga0307415_1000218021 299
889 3300032126 Ga0307415_100026466 Ga0307415_1000264662 299
890 3300032126 Ga0307415_100089813 Ga0307415_1000898132 299
891 3300032126 Ga0307415_100107507 Ga0307415_1001075073 299
892 3300032126 Ga0307415_100620128 Ga0307415_1006201281 299
893 3300034957 Ga0373938_0031409 Ga0373938_0031409_204_1103 299
894 3300035083 Ga0373926_0027830 Ga0373926_0027830_322_1257 299
895 3300035086 Ga0373934_0002754 Ga0373934_0002754_4855_5754 299
896 3300035089 Ga0373944_0011334 Ga0373944_0011334_1012_1947 299
897 3300035111 Ga0373923_0023500 Ga0373923_0023500_583_1482 299
898 3300035111 Ga0373923_0055474 Ga0373923_0055474_636_1571 299
899 3300035113 Ga0373936_0026431 Ga0373936_0026431_982_1917 299
900 3300035113 Ga0373936_0055578 Ga0373936_0055578_320_1219 299
901 3300035116 Ga0373945_0039542 Ga0373945_0039542_736_1671 299
902 3300035117 Ga0373953_0000821 Ga0373953_0000821_3046_3945 299
903 3300035118 Ga0373954_0001563 Ga0373954_0001563_2479_3378 299
904 3300035119 Ga0373956_0003221 Ga0373956_0003221_1063_1962 299
905 3300035120 Ga0373957_0001428 Ga0373957_0001428_81_1016 299
906 3300035170 Ga0373943_0048468 Ga0373943_0048468_973_1908 299
907 3300035171 Ga0373946_0013175 Ga0373946_0013175_2135_3034 299
908 3300035172 Ga0373955_0082888 Ga0373955_0082888_230_1165 299
909 3300035172 Ga0373955_0108511 Ga0373955_0108511_320_1219 299
910 3300035410 Ga0373924_0016500 Ga0373924_0016500_1907_2806 299
911 3300035695 Ga0373927_0040940 Ga0373927_0040940_1700_2599 299
912 3300035724 Ga0373933_0005000 Ga0373933_0005000_384_1283 299
913 3300035725 Ga0373947_0023550 Ga0373947_0023550_1298_2233 299
914 3300035725 Ga0373947_0056553 Ga0373947_0056553_1184_2083 299
915 3300036401 Ga0373937_0010654 Ga0373937_0010654_4169_5068 299
916 3300036401 Ga0373937_0208215 Ga0373937_0208215_202_1137 299
917 3300037068 Ga0373925_0031453 Ga0373925_0031453_36_935 299
918 3300037068 Ga0373925_0093661 Ga0373925_0093661_799_1734 299
919 3300037418 Ga0395900_0026320 Ga0395900_0026320_4996_5922 299
920 3300037466 Ga0395898_0169591 Ga0395898_0169591_265_1200 299
921 3300037471 Ga0395905_0054291 Ga0395905_0054291_136_1053 299
922 3300037471 Ga0395905_0190772 Ga0395905_0190772_929_1828 299
923 3300037853 Ga0436364_0849504 Ga0436364_0849504_43_942 299
924 3300037853 Ga0436364_1495084 Ga0436364_1495084_1378_2277 299
925 3300038443 Ga0395901_0139889 Ga0395901_0139889_1214_2113 299
926 3300038443 Ga0395901_0148039 Ga0395901_0148039_1176_2111 299
927 3300039437 Ga0436365_1063556 Ga0436365_1063556_100_999 299
928 3300039437 Ga0436365_1544034 Ga0436365_1544034_174_1073 299
929 3300044683 Ga0466965_0069717 Ga0466965_0069717_543_1442 299
930 3300044683 Ga0466965_0093393 Ga0466965_0093393_110_1033 299
931 3300044693 Ga0466961_0035163 Ga0466961_0035163_866_1789 299
932 3300044765 Ga0466970_0015359 Ga0466970_0015359_2177_3106 299
933 3300044842 Ga0466957_0084176 Ga0466957_0084176_698_1627 299
934 3300044901 Ga0466960_0047414 Ga0466960_0047414_373_1272 299
935 3300044901 Ga0466960_0054466 Ga0466960_0054466_435_1385 299
936 3300044901 Ga0466960_0098125 Ga0466960_0098125_487_1410 299
937 3300045976 Ga0466967_0065708 Ga0466967_0065708_738_1637 299
938 3300045976 Ga0466967_0143725 Ga0466967_0143725_901_1818 299
939 3300045976 Ga0466967_0153107 Ga0466967_0153107_410_1345 299
940 3300045976 Ga0466967_0495608 Ga0466967_0495608_15_914 299
941 3300046454 Ga0495592_0000397 Ga0495592_0000397_205_1104 299
942 3300046454 Ga0495592_0008095 Ga0495592_0008095_205_1104 299
943 3300046455 Ga0495603_0095528 Ga0495603_0095528_60_971 299
944 3300046459 Ga0495629_0107549 Ga0495629_0107549_330_1265 299
945 3300046461 Ga0495641_0051291 Ga0495641_0051291_293_1192 299
946 3300046461 Ga0495641_0057979 Ga0495641_0057979_150_1049 299
947 3300046462 Ga0495651_0126575 Ga0495651_0126575_767_1666 299
948 3300046462 Ga0495651_0126576 Ga0495651_0126576_205_1104 299
949 3300046463 Ga0495653_0120545 Ga0495653_0120545_205_1104 299
950 3300046473 Ga0495582_0079567 Ga0495582_0079567_830_1765 299
951 3300046477 Ga0495664_0007931 Ga0495664_0007931_205_1104 299
952 3300046477 Ga0495664_0087709 Ga0495664_0087709_205_1104 299
953 3300046511 Ga0495608_0089230 Ga0495608_0089230_330_1229 299
954 3300046511 Ga0495608_0089231 Ga0495608_0089231_767_1666 299
955 3300046511 Ga0495608_0105594 Ga0495608_0105594_872_1771 299
956 3300046514 Ga0495618_0009751 Ga0495618_0009751_197_1096 299
957 3300046516 Ga0495628_0005043 Ga0495628_0005043_330_1229 299
958 3300046516 Ga0495628_0122322 Ga0495628_0122322_330_1229 299
959 3300046517 Ga0495630_0055169 Ga0495630_0055169_1312_2247 299
960 3300046517 Ga0495630_0152328 Ga0495630_0152328_767_1666 299
961 3300046529 Ga0495652_0002110 Ga0495652_0002110_179_1078 299
962 3300046529 Ga0495652_0049416 Ga0495652_0049416_2104_3003 299
963 3300046529 Ga0495652_0108948 Ga0495652_0108948_1058_1957 299
964 3300046531 Ga0495665_0093433 Ga0495665_0093433_332_1267 299
965 3300046533 Ga0495640_0067173 Ga0495640_0067173_749_1648 299
966 3300046535 Ga0495586_0015106 Ga0495586_0015106_14_913 299
967 3300046536 Ga0495587_0029133 Ga0495587_0029133_202_1101 299
968 3300046536 Ga0495587_0099998 Ga0495587_0099998_188_1087 299
969 3300046543 Ga0495645_0003234 Ga0495645_0003234_251_1150 299
970 3300046543 Ga0495645_0010242 Ga0495645_0010242_3043_3942 299
971 3300046559 Ga0495667_0011880 Ga0495667_0011880_205_1104 299
972 3300046559 Ga0495667_0114499 Ga0495667_0114499_639_1538 299
973 3300046642 Ga0495634_0021736 Ga0495634_0021736_30_929 299
974 3300046663 Ga0495635_0074934 Ga0495635_0074934_205_1104 299
975 3300046663 Ga0495635_0111827 Ga0495635_0111827_762_1661 299
976 3300046675 Ga0495657_0192128 Ga0495657_0192128_200_1099 299
977 3300046678 Ga0495599_0017017 Ga0495599_0017017_330_1229 299
978 3300046678 Ga0495599_0084661 Ga0495599_0084661_330_1229 299
979 3300046679 Ga0495623_0019997 Ga0495623_0019997_3166_4065 299
980 3300046679 Ga0495623_0100901 Ga0495623_0100901_673_1572 299
981 3300046680 Ga0495646_0002659 Ga0495646_0002659_269_1168 299
982 3300046680 Ga0495646_0004480 Ga0495646_0004480_3046_3945 299
983 3300046683 Ga0495658_0086658 Ga0495658_0086658_330_1229 299
984 3300046689 Ga0495613_0039703 Ga0495613_0039703_2353_3288 299
985 3300046690 Ga0495624_0137472 Ga0495624_0137472_358_1293 299
986 3300046809 Ga0495600_0009608 Ga0495600_0009608_285_1184 299
987 3300046809 Ga0495600_0056669 Ga0495600_0056669_688_1623 299
988 3300047317 Ga0495604_0004132 Ga0495604_0004132_678_1613 299
989 3300047317 Ga0495604_0042757 Ga0495604_0042757_578_1477 299
990 3300047319 Ga0495674_0088829 Ga0495674_0088829_1539_2438 299
991 3300047321 Ga0495676_0085788 Ga0495676_0085788_737_1636 299
992 3300047321 Ga0495676_0124145 Ga0495676_0124145_736_1671 299
993 3300047322 Ga0495680_0001602 Ga0495680_0001602_20178_21077 299
994 3300047322 Ga0495680_0096739 Ga0495680_0096739_539_1438 299
995 3300047322 Ga0495680_0120073 Ga0495680_0120073_101_1000 299
996 3300047444 Ga0495675_0034575 Ga0495675_0034575_205_1104 299
997 3300047444 Ga0495675_0225124 Ga0495675_0225124_205_1104 299
998 3300047471 Ga0495684_0000603 Ga0495684_0000603_27785_28684 299
999 3300047471 Ga0495684_0138994 Ga0495684_0138994_721_1620 299
1000 3300048088 Ga0495602_0017251 Ga0495602_0017251_1030_1929 299
1001 3300048088 Ga0495602_0018432 Ga0495602_0018432_5799_6734 299
1002 3300048903 Ga0496100_0252908 Ga0496100_0252908_251_1150 299
1003 3300048904 Ga0496101_0013820 Ga0496101_0013820_3933_4862 299
1004 3300048905 Ga0496102_0008782 Ga0496102_0008782_7708_8637 299
1005 3300048905 Ga0496102_0079766 Ga0496102_0079766_1933_2868 299
1006 3300048905 Ga0496102_0136298 Ga0496102_0136298_624_1559 299
1007 3300048905 Ga0496102_0154518 Ga0496102_0154518_1083_1982 299
1008 3300048905 Ga0496102_0177590 Ga0496102_0177590_168_1067 299
1009 3300048905 Ga0496102_0601730 Ga0496102_0601730_53_952 299
1010 3300048906 Ga0496103_0048923 Ga0496103_0048923_98_997 299
1011 3300048906 Ga0496103_0085930 Ga0496103_0085930_459_1388 299
1012 3300048906 Ga0496103_0160825 Ga0496103_0160825_411_1394 299
1013 3300048907 Ga0496104_0030323 Ga0496104_0030323_1479_2414 299
1014 3300048907 Ga0496104_0072786 Ga0496104_0072786_2087_3070 299
1015 3300048907 Ga0496104_0234198 Ga0496104_0234198_789_1688 299
1016 3300048908 Ga0496105_0013044 Ga0496105_0013044_1597_2580 299
1017 3300048908 Ga0496105_0151400 Ga0496105_0151400_761_1660 299
1018 3300048910 Ga0496107_0038148 Ga0496107_0038148_542_1441 299
1019 3300048910 Ga0496107_0071877 Ga0496107_0071877_88_987 299
1020 3300048910 Ga0496107_0144379 Ga0496107_0144379_612_1595 299
1021 3300048910 Ga0496107_0317528 Ga0496107_0317528_229_1128 299
1022 3300048910 Ga0496107_0438783 Ga0496107_0438783_47_946 299
1023 3300048911 Ga0496108_0170747 Ga0496108_0170747_366_1349 299
1024 3300048911 Ga0496108_0279324 Ga0496108_0279324_363_1274 299
1025 3300048912 Ga0496109_0088079 Ga0496109_0088079_392_1291 299
1026 3300048912 Ga0496109_0195396 Ga0496109_0195396_819_1718 299
1027 3300048912 Ga0496109_0224563 Ga0496109_0224563_470_1372 299
1028 3300048912 Ga0496109_0550688 Ga0496109_0550688_167_1069 299
1029 3300048913 Ga0496110_0079099 Ga0496110_0079099_1709_2620 299
1030 3300048913 Ga0496110_0082241 Ga0496110_0082241_288_1271 299
1031 3300048913 Ga0496110_0083440 Ga0496110_0083440_1029_1928 299
1032 3300048913 Ga0496110_0088856 Ga0496110_0088856_899_1798 299
1033 3300048913 Ga0496110_0296797 Ga0496110_0296797_396_1295 299
1034 3300048913 Ga0496110_0369646 Ga0496110_0369646_12_923 299
1035 3300048914 Ga0496111_0012659 Ga0496111_0012659_1722_2633 299
1036 3300048915 Ga0496112_0154324 Ga0496112_0154324_689_1624 299
1037 3300048916 Ga0496113_0036543 Ga0496113_0036543_1221_2120 299
1038 3300048916 Ga0496113_0358369 Ga0496113_0358369_40_939 299
1039 3300048917 Ga0496114_0002152 Ga0496114_0002152_13591_14574 299
1040 3300048917 Ga0496114_0033141 Ga0496114_0033141_2863_3762 299
1041 3300048917 Ga0496114_0160447 Ga0496114_0160447_531_1430 299
1042 3300048917 Ga0496114_0303922 Ga0496114_0303922_252_1151 299
1043 3300048924 Ga0496121_0035843 Ga0496121_0035843_932_1867 299
1044 3300048926 Ga0496123_0078694 Ga0496123_0078694_183_1109 299
1045 3300048929 Ga0496126_0000039 Ga0496126_0000039_220751_221650 299
1046 3300049514 Ga0501291_020713 Ga0501291_020713_32_931 299
1047 3300049521 Ga0501298_023437 Ga0501298_023437_216_1115 299
1048 3300049568 Ga0501031_0060482 Ga0501031_0060482_950_1849 299
1049 3300049569 Ga0501032_0059829 Ga0501032_0059829_1168_2067 299
1050 3300049572 Ga0501036_0017266 Ga0501036_0017266_263_1162 299
1051 3300049572 Ga0501036_0033743 Ga0501036_0033743_738_1655 299
1052 3300049573 Ga0501037_0091380 Ga0501037_0091380_848_1747 299
1053 3300049576 Ga0501040_0011354 Ga0501040_0011354_815_1714 299
1054 3300049577 Ga0501041_0069015 Ga0501041_0069015_356_1255 299
1055 3300049577 Ga0501041_0140093 Ga0501041_0140093_108_1025 299
1056 3300049578 Ga0501042_0046751 Ga0501042_0046751_442_1341 299
1057 3300049580 Ga0501046_0010342 Ga0501046_0010342_2580_3479 299
1058 3300049583 Ga0501067_0104913 Ga0501067_0104913_110_1009 299
1059 3300049583 Ga0501067_0166254 Ga0501067_0166254_39_974 299
1060 3300049584 Ga0501068_0056147 Ga0501068_0056147_719_1618 299
1061 3300049588 Ga0501072_0052339 Ga0501072_0052339_1831_2730 299
1062 3300049588 Ga0501072_0054608 Ga0501072_0054608_1006_1905 299
1063 3300049590 Ga0501074_0093115 Ga0501074_0093115_433_1332 299
1064 3300049590 Ga0501074_0106098 Ga0501074_0106098_687_1604 299
1065 3300049591 Ga0501075_0009610 Ga0501075_0009610_5115_6014 299
1066 3300049592 Ga0501076_0086503 Ga0501076_0086503_582_1481 299
1067 3300049593 Ga0501077_0011162 Ga0501077_0011162_3065_3964 299
1068 3300049741 Ga0501079_0079143 Ga0501079_0079143_609_1508 299
1069 3300049743 Ga0501081_0017918 Ga0501081_0017918_671_1570 299
1070 3300049743 Ga0501081_0329002 Ga0501081_0329002_185_1084 299
1071 3300049744 Ga0501083_0112653 Ga0501083_0112653_555_1454 299
1072 3300049822 Ga0501035_0032558 Ga0501035_0032558_620_1519 299
1073 3300049824 Ga0501045_0002747 Ga0501045_0002747_6267_7166 299
1074 3300050490 nmdc:mga03n38_92194_c1 nmdc:mga03n38_92194_c1_175_1110 299
1075 3300050490 nmdc:mga03n38_9497_c1 nmdc:mga03n38_9497_c1_1900_2799 299
1076 3300050491 nmdc:mga00v17_199295_c1 nmdc:mga00v17_199295_c1_36_935 299
1077 3300050491 nmdc:mga00v17_30291_c1 nmdc:mga00v17_30291_c1_1458_2393 299
1078 3300050491 nmdc:mga00v17_89878_c1 nmdc:mga00v17_89878_c1_971_1870 299
1079 3300050492 nmdc:mga0yw44_119425_c1 nmdc:mga0yw44_119425_c1_759_1658 299
1080 3300050492 nmdc:mga0yw44_98052_c1 nmdc:mga0yw44_98052_c1_947_1846 299
1081 3300050494 nmdc:mga06z11_8413_c1 nmdc:mga06z11_8413_c1_2157_3056 299
1082 3300050495 nmdc:mga04h51_23893_c1 nmdc:mga04h51_23893_c1_586_1521 299
1083 3300050496 nmdc:mga07m45_101514_c1 nmdc:mga07m45_101514_c1_507_1442 299
1084 3300050496 nmdc:mga07m45_44396_c1 nmdc:mga07m45_44396_c1_852_1751 299
1085 3300050510 nmdc:mga06r32_191537_c1 nmdc:mga06r32_191537_c1_832_1731 299
1086 3300050511 nmdc:mga08y16_201480_c1 nmdc:mga08y16_201480_c1_667_1566 299
1087 3300050511 nmdc:mga08y16_62979_c1 nmdc:mga08y16_62979_c1_2608_3519 299
1088 3300050511 nmdc:mga08y16_692626_c1 nmdc:mga08y16_692626_c1_38_937 299
1089 3300050513 nmdc:mga0rr50_403682_c1 nmdc:mga0rr50_403682_c1_111_1010 299
1090 3300050515 nmdc:mga0a205_124922_c1 nmdc:mga0a205_124922_c1_640_1575 299
1091 3300053077 Ga0495601_0209487 Ga0495601_0209487_202_1137 299
1092 3300053078 Ga0495612_0013400 Ga0495612_0013400_15_950 299
1093 3300053084 Ga0495595_0123021 Ga0495595_0123021_248_1147 299
1094 3300053085 Ga0495619_0023815 Ga0495619_0023815_1661_2596 299
1095 3300053102 Ga0500554_078163 Ga0500554_078163_37_936 299
1096 3300053140 Ga0500573_0018977 Ga0500573_0018977_1368_2309 299
1097 3300053153 Ga0500616_0000060 Ga0500616_0000060_140436_141338 299
1098 3300053153 Ga0500616_0000792 Ga0500616_0000792_17976_18878 299
1099 3300054114 Ga0501084_0158009 Ga0501084_0158009_587_1486 299
1100 3300059492 Ga0587073_0015132 Ga0587073_0015132_64_963 299
1101 3300060346 Ga0587111_0020289 Ga0587111_0020289_22_957 299
1102 3300060353 Ga0501082_0237345 Ga0501082_0237345_189_1088 299
1103 3300061734 Ga0530510_0030715 Ga0530510_0030715_2116_3015 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

194

0.9

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

150

229

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9173 1 211
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.9074 1 211
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9036 2 216
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9006 2 216
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.8993 1 211
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 2 219 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 2 211 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 2 220 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.932 2 206 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3L7J281-F1-model_v4 ATP-binding cassette domain-containing protein 0.9929 1 215 GO:0005524
GO:0016887
AF-A0A3N0DQ34-F1-model_v4 ATP-binding cassette domain-containing protein 0.9841 2 216 GO:0005524
GO:0016887
AF-A0A0S9DLE0-F1-model_v4 ABC transporter domain-containing protein 0.947 2 216 GO:0005524
GO:0016887
GO:0046677
AF-A0A6G8KU53-F1-model_v4 ATP-binding cassette domain-containing protein 0.9468 2 215 GO:0005524
GO:0016887
AF-A0A7H2BMT5-F1-model_v4 ABC transporter ATP-binding protein 0.9461 2 216 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map