F489957

General Info

Members Datasets Scaffolds Average Seq Length
1095 334 2190 68

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0443873|Ga0436364_0443873_232_480
Length 82
Sequence MSTMSAIVAGDFVMQLSARNQIPARVTGINAGEAIANVELDAAGVRLVASITVEAVRQLGLAEGSEVTAVIKASDVILAVPG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
112 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
135 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.48
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 17.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0443873 3300037853 Unclassified 929
2 JGI24737J22298_10202194 3300001990 Unclassified 586
3 JGI25404J52841_10111436 3300003659 Bacteria 575
4 JGI25405J52794_10050403 3300003911 Bacteria 891
5 Ga0070658_10325590 3300005327 Bacteria 1313
6 Ga0070683_100071579 3300005329 Bacteria 3235
7 Ga0070690_100261540 3300005330 Bacteria 1228
8 Ga0068869_100249338 3300005334 Bacteria 1417
9 Ga0068869_100382601 3300005334 Bacteria 1154
10 Ga0070666_10132316 3300005335 Bacteria 1734
11 Ga0070680_100040809 3300005336 Bacteria 3760
12 Ga0070682_100006862 3300005337 Bacteria 6396
13 Ga0070682_100126140 3300005337 Bacteria 1725
14 Ga0068868_100096921 3300005338 Bacteria 2383
15 Ga0068868_100192757 3300005338 Bacteria 1695
16 Ga0070660_100034963 3300005339 Bacteria 3800
17 Ga0070660_100588112 3300005339 Bacteria 930
18 Ga0070660_100794663 3300005339 Unclassified 796
19 Ga0070689_100037639 3300005340 Bacteria 3699
20 Ga0070691_10176070 3300005341 Bacteria 1111
21 Ga0070691_10491977 3300005341 Unclassified 707
22 Ga0070691_10498447 3300005341 Unclassified 703
23 Ga0070691_11056319 3300005341 Bacteria 509
24 Ga0070687_100089816 3300005343 Bacteria 1696
25 Ga0070661_100287572 3300005344 Bacteria 1277
26 Ga0070692_10256097 3300005345 Bacteria 1050
27 Ga0070669_101421567 3300005353 Unclassified 602
28 Ga0070675_100434325 3300005354 Bacteria 1176
29 Ga0070671_100896707 3300005355 Bacteria 774
30 Ga0070674_100013315 3300005356 Bacteria 5081
31 Ga0070674_100284529 3300005356 Bacteria 1312
32 Ga0070673_100137539 3300005364 Bacteria 2058
33 Ga0070673_100941369 3300005364 Bacteria 802
34 Ga0070688_100422401 3300005365 Unclassified 991
35 Ga0070659_100110337 3300005366 Bacteria 2220
36 Ga0070659_100951735 3300005366 Unclassified 752
37 Ga0070659_101063261 3300005366 Unclassified 712
38 Ga0070703_10202194 3300005406 Bacteria 780
39 Ga0070709_10001397 3300005434 Bacteria 13118
40 Ga0070709_10003711 3300005434 Bacteria 8208
41 Ga0070709_10044359 3300005434 Unclassified 2753
42 Ga0070709_10105060 3300005434 Bacteria 1888
43 Ga0070709_10146431 3300005434 Unclassified 1628
44 Ga0070709_10207354 3300005434 Bacteria 1391
45 Ga0070709_10408560 3300005434 Unclassified 1015
46 Ga0070709_10450323 3300005434 Bacteria 970
47 Ga0070709_10458540 3300005434 Bacteria 961
48 Ga0070709_10562942 3300005434 Bacteria 873
49 Ga0070714_100005398 3300005435 Bacteria 9757
50 Ga0070714_100013301 3300005435 Bacteria 6593
51 Ga0070714_100013360 3300005435 Bacteria 6581
52 Ga0070714_100034957 3300005435 Bacteria 4209
53 Ga0070714_100065822 3300005435 Bacteria 3122
54 Ga0070714_100094978 3300005435 Bacteria 2617
55 Ga0070714_100118336 3300005435 Bacteria 2354
56 Ga0070714_100141194 3300005435 Bacteria 2162
57 Ga0070714_100172905 3300005435 Bacteria 1961
58 Ga0070714_100235439 3300005435 Bacteria 1688
59 Ga0070714_100477758 3300005435 Bacteria 1186
60 Ga0070714_100549443 3300005435 Bacteria 1105
61 Ga0070714_100573081 3300005435 Bacteria 1082
62 Ga0070714_100825326 3300005435 Unclassified 898
63 Ga0070714_101802125 3300005435 Unclassified 598
64 Ga0070714_101890711 3300005435 Bacteria 582
65 Ga0070713_100018032 3300005436 Bacteria 5359
66 Ga0070713_100022599 3300005436 Bacteria 4862
67 Ga0070713_100046970 3300005436 Bacteria 3546
68 Ga0070713_100122661 3300005436 Bacteria 2281
69 Ga0070713_100175129 3300005436 Bacteria 1925
70 Ga0070713_100356809 3300005436 Bacteria 1357
71 Ga0070713_100400572 3300005436 Bacteria 1282
72 Ga0070713_100440115 3300005436 Bacteria 1223
73 Ga0070713_100645885 3300005436 Bacteria 1007
74 Ga0070713_100669431 3300005436 Bacteria 989
75 Ga0070713_100872465 3300005436 Bacteria 865
76 Ga0070713_100878916 3300005436 Bacteria 861
77 Ga0070713_100998147 3300005436 Unclassified 807
78 Ga0070713_101050307 3300005436 Bacteria 786
79 Ga0070713_101061029 3300005436 Bacteria 782
80 Ga0070713_101144752 3300005436 Bacteria 752
81 Ga0070713_101289693 3300005436 Bacteria 708
82 Ga0070710_10000564 3300005437 Bacteria 17572
83 Ga0070710_10002530 3300005437 Bacteria 8676
84 Ga0070710_10011960 3300005437 Bacteria 4301
85 Ga0070710_10053545 3300005437 Bacteria 2274
86 Ga0070710_10098243 3300005437 Bacteria 1739
87 Ga0070710_10136861 3300005437 Bacteria 1498
88 Ga0070710_10602762 3300005437 Bacteria 765
89 Ga0070710_10794210 3300005437 Unclassified 676
90 Ga0070710_10852187 3300005437 Bacteria 654
91 Ga0070710_11181783 3300005437 Bacteria 565
92 Ga0070701_10023709 3300005438 Bacteria 2960
93 Ga0070711_100003441 3300005439 Bacteria 9220
94 Ga0070711_100017642 3300005439 Bacteria 4547
95 Ga0070711_100022377 3300005439 Bacteria 4097
96 Ga0070711_100025720 3300005439 Bacteria 3853
97 Ga0070711_100037053 3300005439 Bacteria 3271
98 Ga0070711_100130299 3300005439 Bacteria 1872
99 Ga0070711_100226362 3300005439 Bacteria 1456
100 Ga0070711_100618905 3300005439 Bacteria 905
101 Ga0070711_101199020 3300005439 Bacteria 656
102 Ga0070705_100109285 3300005440 Bacteria 1763
103 Ga0070705_100296538 3300005440 Bacteria 1156
104 Ga0070705_100328952 3300005440 Bacteria 1106
105 Ga0070705_101874171 3300005440 Unclassified 510
106 Ga0070694_100339191 3300005444 Bacteria 1161
107 Ga0070694_101668380 3300005444 Bacteria 542
108 Ga0070708_100013728 3300005445 Bacteria 6644
109 Ga0070708_100711925 3300005445 Bacteria 945
110 Ga0070708_100910492 3300005445 Unclassified 826
111 Ga0070708_100939219 3300005445 Unclassified 811
112 Ga0070663_100195979 3300005455 Bacteria 1574
113 Ga0070678_101107085 3300005456 Unclassified 731
114 Ga0070678_101138474 3300005456 Bacteria 722
115 Ga0070662_100251265 3300005457 Bacteria 1422
116 Ga0070662_100355811 3300005457 Bacteria 1200
117 Ga0070662_101214382 3300005457 Unclassified 648
118 Ga0070681_10237959 3300005458 Unclassified 1734
119 Ga0068867_100861536 3300005459 Unclassified 812
120 Ga0068867_101947685 3300005459 Bacteria 555
121 Ga0070685_10028813 3300005466 Bacteria 3080
122 Ga0070706_100008647 3300005467 Bacteria 9488
123 Ga0070706_100017412 3300005467 Bacteria 6631
124 Ga0070706_100039718 3300005467 Bacteria 4343
125 Ga0070706_100048528 3300005467 Bacteria 3918
126 Ga0070706_100107843 3300005467 Bacteria 2591
127 Ga0070706_100524806 3300005467 Bacteria 1101
128 Ga0070706_100574934 3300005467 Bacteria 1048
129 Ga0070706_101570391 3300005467 Bacteria 601
130 Ga0070707_100000261 3300005468 Bacteria 52696
131 Ga0070707_100038335 3300005468 Bacteria 4577
132 Ga0070707_100068496 3300005468 Bacteria 3416
133 Ga0070707_100347573 3300005468 Bacteria 1440
134 Ga0070707_100920136 3300005468 Bacteria 839
135 Ga0070707_101753116 3300005468 Unclassified 588
136 Ga0070707_101963678 3300005468 Bacteria 552
137 Ga0070698_100000396 3300005471 Bacteria 45923
138 Ga0070698_100001643 3300005471 Bacteria 24933
139 Ga0070698_100016840 3300005471 Bacteria 7710
140 Ga0070698_100024922 3300005471 Bacteria 6235
141 Ga0070698_100068745 3300005471 Bacteria 3559
142 Ga0070698_100094289 3300005471 Bacteria 2972
143 Ga0070698_100140019 3300005471 Bacteria 2371
144 Ga0070698_100181703 3300005471 Bacteria 2042
145 Ga0070698_100256605 3300005471 Bacteria 1681
146 Ga0070699_100001967 3300005518 Bacteria 18553
147 Ga0070699_100613130 3300005518 Bacteria 993
148 Ga0070699_100724894 3300005518 Bacteria 909
149 Ga0070699_100816045 3300005518 Unclassified 854
150 Ga0070699_100857875 3300005518 Unclassified 831
151 Ga0070699_101151406 3300005518 Bacteria 711
152 Ga0070699_101231271 3300005518 Bacteria 687
153 Ga0070679_100358534 3300005530 Unclassified 1406
154 Ga0070684_100200460 3300005535 Bacteria 1817
155 Ga0070697_100012204 3300005536 Bacteria 6727
156 Ga0070697_100042441 3300005536 Bacteria 3680
157 Ga0070697_100521785 3300005536 Unclassified 1040
158 Ga0070697_102103644 3300005536 Bacteria 505
159 Ga0068853_100066910 3300005539 Bacteria 3120
160 Ga0068853_100137020 3300005539 Bacteria 2195
161 Ga0068853_100647992 3300005539 Bacteria 1005
162 Ga0070672_100459976 3300005543 Bacteria 1097
163 Ga0070686_100027795 3300005544 Bacteria 3426
164 Ga0070695_100025310 3300005545 Bacteria 3664
165 Ga0070695_100574710 3300005545 Bacteria 881
166 Ga0070695_101419058 3300005545 Unclassified 576
167 Ga0070696_100201547 3300005546 Bacteria 1486
168 Ga0070696_100273333 3300005546 Bacteria 1285
169 Ga0070696_100379342 3300005546 Unclassified 1101
170 Ga0070693_100191143 3300005547 Bacteria 1324
171 Ga0070693_101156032 3300005547 Unclassified 593
172 Ga0070665_100741309 3300005548 Bacteria 995
173 Ga0070704_100114176 3300005549 Bacteria 2061
174 Ga0070704_101762867 3300005549 Bacteria 573
175 Ga0068855_100433543 3300005563 Bacteria 1436
176 Ga0068855_101822627 3300005563 Bacteria 618
177 Ga0070664_100046231 3300005564 Bacteria 3677
178 Ga0068857_100048065 3300005577 Bacteria 3788
179 Ga0068857_100392165 3300005577 Bacteria 1291
180 Ga0068854_100117339 3300005578 Bacteria 2015
181 Ga0068854_100572322 3300005578 Bacteria 961
182 Ga0068856_100235423 3300005614 Unclassified 1847
183 Ga0068856_100313338 3300005614 Bacteria 1587
184 Ga0068856_100321485 3300005614 Bacteria 1564
185 Ga0068856_102087563 3300005614 Unclassified 576
186 Ga0070702_100025773 3300005615 Bacteria 3154
187 Ga0070702_100811235 3300005615 Unclassified 725
188 Ga0068852_100038762 3300005616 Bacteria 4007
189 Ga0068859_101011630 3300005617 Unclassified 913
190 Ga0068864_100251702 3300005618 Bacteria 1640
191 Ga0068866_10031261 3300005718 Bacteria 2562
192 Ga0068861_100189402 3300005719 Bacteria 1718
193 Ga0068861_100190141 3300005719 Unclassified 1715
194 Ga0068861_101602344 3300005719 Unclassified 641
195 Ga0068870_10067247 3300005840 Bacteria 1943
196 Ga0068863_100069818 3300005841 Bacteria 3321
197 Ga0068863_101247836 3300005841 Unclassified 749
198 Ga0068863_101287460 3300005841 Unclassified 738
199 Ga0068858_100539887 3300005842 Bacteria 1128
200 Ga0068858_101145381 3300005842 Bacteria 764
201 Ga0068858_102132180 3300005842 Bacteria 554
202 Ga0068860_101423109 3300005843 Bacteria 714
203 Ga0068862_100624434 3300005844 Bacteria 1037
204 Ga0081455_10021117 3300005937 Bacteria 6114
205 Ga0081455_10046999 3300005937 Bacteria 3741
206 Ga0081455_10058834 3300005937 Bacteria 3249
207 Ga0081455_11065072 3300005937 Unclassified 500
208 Ga0081540_1000089 3300005983 Bacteria 97819
209 Ga0081540_1002152 3300005983 Bacteria 16368
210 Ga0070717_10001816 3300006028 Bacteria 14916
211 Ga0070717_10007042 3300006028 Bacteria 8326
212 Ga0070717_10019846 3300006028 Bacteria 5277
213 Ga0070717_10022471 3300006028 Bacteria 4985
214 Ga0070717_10025987 3300006028 Bacteria 4667
215 Ga0070717_10256786 3300006028 Unclassified 1545
216 Ga0070717_10435464 3300006028 Bacteria 1180
217 Ga0070717_10552894 3300006028 Unclassified 1042
218 Ga0070717_11425576 3300006028 Bacteria 629
219 Ga0070717_12106754 3300006028 Unclassified 507
220 Ga0075432_10169055 3300006058 Bacteria 849
221 Ga0070715_10002583 3300006163 Bacteria 5590
222 Ga0070715_10044483 3300006163 Bacteria 1877
223 Ga0070715_10086220 3300006163 Bacteria 1435
224 Ga0070715_10413660 3300006163 Bacteria 753
225 Ga0070716_100000834 3300006173 Bacteria 13301
226 Ga0070716_100002733 3300006173 Bacteria 8178
227 Ga0070716_100012302 3300006173 Bacteria 4334
228 Ga0070716_100019222 3300006173 Bacteria 3568
229 Ga0070716_100053890 3300006173 Bacteria 2295
230 Ga0070716_100214542 3300006173 Bacteria 1288
231 Ga0070716_100235008 3300006173 Bacteria 1240
232 Ga0070716_100468701 3300006173 Bacteria 922
233 Ga0070712_100007242 3300006175 Bacteria 6924
234 Ga0070712_100061825 3300006175 Bacteria 2647
235 Ga0070712_100092124 3300006175 Unclassified 2222
236 Ga0070712_100097103 3300006175 Bacteria 2170
237 Ga0070712_100120554 3300006175 Bacteria 1973
238 Ga0070712_100210162 3300006175 Bacteria 1534
239 Ga0070712_100246863 3300006175 Bacteria 1424
240 Ga0070712_100452274 3300006175 Bacteria 1069
241 Ga0070712_100488579 3300006175 Bacteria 1030
242 Ga0070712_100752543 3300006175 Unclassified 834
243 Ga0070712_100814641 3300006175 Unclassified 801
244 Ga0070712_100920157 3300006175 Unclassified 754
245 Ga0070712_100927791 3300006175 Bacteria 751
246 Ga0070712_101760659 3300006175 Bacteria 542
247 Ga0075427_10097858 3300006194 Unclassified 544
248 Ga0097621_100140470 3300006237 Bacteria 2063
249 Ga0097621_100267296 3300006237 Bacteria 1502
250 Ga0097621_101642473 3300006237 Bacteria 611
251 Ga0068871_100101145 3300006358 Bacteria 2416
252 Ga0068871_100774758 3300006358 Unclassified 883
253 Ga0068871_101365541 3300006358 Bacteria 667
254 Ga0075428_100815074 3300006844 Bacteria 992
255 Ga0075430_100090736 3300006846 Bacteria 2556
256 Ga0075431_100049882 3300006847 Bacteria 4315
257 Ga0075433_10021467 3300006852 Bacteria 5415
258 Ga0075433_10242343 3300006852 Bacteria 1600
259 Ga0075433_10260193 3300006852 Bacteria 1538
260 Ga0075434_100002174 3300006871 Bacteria 17093
261 Ga0075434_100059421 3300006871 Bacteria 3800
262 Ga0075434_100104542 3300006871 Bacteria 2841
263 Ga0075434_100363886 3300006871 Bacteria 1467
264 Ga0075434_100375173 3300006871 Bacteria 1443
265 Ga0075434_100656034 3300006871 Unclassified 1067
266 Ga0075434_101245220 3300006871 Bacteria 755
267 Ga0075429_100196053 3300006880 Bacteria 1769
268 Ga0075429_101346626 3300006880 Unclassified 622
269 Ga0068865_100354319 3300006881 Bacteria 1190
270 Ga0068865_100500278 3300006881 Bacteria 1013
271 Ga0075436_100008768 3300006914 Bacteria 6916
272 Ga0075436_100081876 3300006914 Bacteria 2238
273 Ga0075436_100147314 3300006914 Bacteria 1655
274 Ga0075436_100298394 3300006914 Bacteria 1154
275 Ga0075436_100333942 3300006914 Bacteria 1090
276 Ga0097620_101011812 3300006931 Unclassified 913
277 Ga0075435_100009069 3300007076 Bacteria 7177
278 Ga0075435_100060423 3300007076 Bacteria 3073
279 Ga0075435_100067619 3300007076 Bacteria 2910
280 Ga0075435_100070450 3300007076 Bacteria 2854
281 Ga0075435_100475926 3300007076 Unclassified 1078
282 Ga0099794_10595697 3300007265 Bacteria 585
283 Ga0099795_10015744 3300007788 Bacteria 2376
284 Ga0105251_10150147 3300009011 Bacteria 1053
285 Ga0105244_10334364 3300009036 Bacteria 699
286 Ga0111539_10392236 3300009094 Unclassified 1617
287 Ga0105245_10032107 3300009098 Bacteria 4649
288 Ga0105245_10228332 3300009098 Unclassified 1799
289 Ga0105245_10498876 3300009098 Unclassified 1233
290 Ga0105245_11476322 3300009098 Unclassified 730
291 Ga0105247_10139316 3300009101 Bacteria 1588
292 Ga0105247_10783028 3300009101 Bacteria 726
293 Ga0114129_10003160 3300009147 Bacteria 23102
294 Ga0114129_10876409 3300009147 Bacteria 1139
295 Ga0105243_10019200 3300009148 Bacteria 5183
296 Ga0105243_10045527 3300009148 Bacteria 3448
297 Ga0105243_12359556 3300009148 Unclassified 570
298 Ga0105241_10064387 3300009174 Bacteria 2830
299 Ga0105241_10518494 3300009174 Bacteria 1065
300 Ga0105241_10851337 3300009174 Bacteria 843
301 Ga0105241_11001701 3300009174 Unclassified 782
302 Ga0105242_10160483 3300009176 Bacteria 1967
303 Ga0105242_10281043 3300009176 Bacteria 1512
304 Ga0105242_10390723 3300009176 Unclassified 1296
305 Ga0105242_10533273 3300009176 Bacteria 1122
306 Ga0105242_11027579 3300009176 Bacteria 834
307 Ga0105242_12206200 3300009176 Bacteria 596
308 Ga0105242_12270087 3300009176 Bacteria 589
309 Ga0105248_10545830 3300009177 Bacteria 1308
310 Ga0105248_10825769 3300009177 Unclassified 1046
311 Ga0105248_11011606 3300009177 Bacteria 939
312 Ga0105237_10542289 3300009545 Bacteria 1170
313 Ga0105237_11484501 3300009545 Bacteria 684
314 Ga0105238_10231917 3300009551 Bacteria 1823
315 Ga0105238_11359044 3300009551 Bacteria 737
316 Ga0105238_12117322 3300009551 Bacteria 597
317 Ga0105238_12394117 3300009551 Bacteria 563
318 Ga0105249_10035835 3300009553 Bacteria 4499
319 Ga0105249_10109249 3300009553 Bacteria 2612
320 Ga0105249_10195678 3300009553 Bacteria 1976
321 Ga0105249_10228945 3300009553 Bacteria 1833
322 Ga0105249_12009361 3300009553 Unclassified 651
323 Ga0099796_10104642 3300010159 Bacteria 1070
324 Ga0099796_10108237 3300010159 Bacteria 1055
325 Ga0099796_10239135 3300010159 Bacteria 750
326 Ga0105239_10348016 3300010375 Unclassified 1673
327 Ga0105239_10354649 3300010375 Bacteria 1656
328 Ga0105239_12937993 3300010375 Unclassified 556
329 Ga0105246_11596787 3300011119 Bacteria 616
330 Ga0157337_1003591 3300012483 Bacteria 948
331 Ga0157338_1015828 3300012515 Bacteria 827
332 Ga0157373_10105951 3300013100 Unclassified 1977
333 Ga0157373_10546744 3300013100 Unclassified 840
334 Ga0157371_11006655 3300013102 Bacteria 636
335 Ga0157369_10592282 3300013105 Unclassified 1145
336 Ga0157369_11008101 3300013105 Unclassified 852
337 Ga0157369_11988091 3300013105 Unclassified 590
338 Ga0157374_10901774 3300013296 Unclassified 902
339 Ga0157374_10956067 3300013296 Bacteria 875
340 Ga0157378_10613305 3300013297 Unclassified 1100
341 Ga0157378_11264647 3300013297 Unclassified 778
342 Ga0163162_10025354 3300013306 Bacteria 5859
343 Ga0163162_10095780 3300013306 Bacteria 3056
344 Ga0163162_11170801 3300013306 Bacteria 872
345 Ga0157372_10155313 3300013307 Bacteria 2643
346 Ga0157372_10610925 3300013307 Bacteria 1271
347 Ga0157372_10790304 3300013307 Unclassified 1103
348 Ga0157375_10596100 3300013308 Bacteria 1264
349 Ga0157375_11305286 3300013308 Unclassified 853
350 Ga0157375_11549912 3300013308 Bacteria 783
351 Ga0157375_13373706 3300013308 Unclassified 532
352 Ga0163163_10017694 3300014325 Bacteria 6654
353 Ga0157380_10037201 3300014326 Bacteria 3769
354 Ga0157380_10157500 3300014326 Bacteria 1970
355 Ga0157380_10914601 3300014326 Unclassified 904
356 Ga0157380_13025899 3300014326 Unclassified 536
357 Ga0157380_13548149 3300014326 Bacteria 500
358 Ga0157377_10114505 3300014745 Unclassified 1626
359 Ga0157377_11317830 3300014745 Unclassified 565
360 Ga0157379_12148884 3300014968 Bacteria 554
361 Ga0157376_10596496 3300014969 Unclassified 1099
362 Ga0157376_11773932 3300014969 Unclassified 653
363 Ga0157376_12336943 3300014969 Bacteria 574
364 Ga0163161_10174487 3300017792 Bacteria 1645
365 Ga0163161_10216587 3300017792 Bacteria 1481
366 Ga0163161_10278630 3300017792 Bacteria 1311
367 Ga0197907_10736962 3300020069 Unclassified 959
368 Ga0206356_10020970 3300020070 Bacteria 1489
369 Ga0206354_10041121 3300020081 Bacteria 2008
370 Ga0206353_11136400 3300020082 Bacteria 828
371 Ga0213874_10006980 3300021377 Bacteria 2694
372 Ga0213876_10116935 3300021384 Bacteria 1415
373 Ga0213875_10000778 3300021388 Bacteria 23813
374 Ga0213875_10001469 3300021388 Bacteria 15255
375 Ga0213875_10025785 3300021388 Bacteria 2798
376 Ga0213875_10060985 3300021388 Bacteria 1763
377 Ga0213875_10062680 3300021388 Bacteria 1739
378 Ga0213875_10067895 3300021388 Unclassified 1665
379 Ga0224572_1007442 3300024225 Unclassified 2006
380 Ga0228598_1038676 3300024227 Unclassified 941
381 Ga0207653_10022345 3300025885 Bacteria 2009
382 Ga0207692_10000710 3300025898 Bacteria 11703
383 Ga0207692_10004964 3300025898 Bacteria 5295
384 Ga0207692_10005520 3300025898 Bacteria 5072
385 Ga0207692_10036978 3300025898 Bacteria 2385
386 Ga0207692_10086889 3300025898 Bacteria 1686
387 Ga0207692_10276208 3300025898 Bacteria 1015
388 Ga0207692_10459583 3300025898 Bacteria 803
389 Ga0207692_10955647 3300025898 Unclassified 565
390 Ga0207642_10105735 3300025899 Bacteria 1423
391 Ga0207710_10179231 3300025900 Bacteria 1039
392 Ga0207688_10014232 3300025901 Bacteria 4329
393 Ga0207680_10025782 3300025903 Bacteria 3247
394 Ga0207685_10007255 3300025905 Bacteria 3077
395 Ga0207685_10069220 3300025905 Bacteria 1425
396 Ga0207685_10228854 3300025905 Bacteria 888
397 Ga0207699_10000150 3300025906 Bacteria 45175
398 Ga0207699_10000409 3300025906 Bacteria 22037
399 Ga0207699_10003451 3300025906 Bacteria 7536
400 Ga0207699_10004294 3300025906 Bacteria 6816
401 Ga0207699_10034201 3300025906 Bacteria 2880
402 Ga0207699_10413921 3300025906 Unclassified 962
403 Ga0207643_10056250 3300025908 Bacteria 2237
404 Ga0207705_11304640 3300025909 Bacteria 554
405 Ga0207684_10001073 3300025910 Bacteria 30613
406 Ga0207684_10008615 3300025910 Bacteria 9062
407 Ga0207684_10038737 3300025910 Bacteria 4045
408 Ga0207684_10055802 3300025910 Bacteria 3351
409 Ga0207684_10075263 3300025910 Bacteria 2869
410 Ga0207684_10912749 3300025910 Bacteria 738
411 Ga0207654_10102836 3300025911 Bacteria 1763
412 Ga0207654_10783197 3300025911 Bacteria 688
413 Ga0207707_10929849 3300025912 Bacteria 717
414 Ga0207671_11249658 3300025914 Unclassified 580
415 Ga0207693_10011623 3300025915 Bacteria 7123
416 Ga0207693_10015861 3300025915 Bacteria 6034
417 Ga0207693_10081252 3300025915 Bacteria 2537
418 Ga0207693_10083300 3300025915 Bacteria 2505
419 Ga0207693_10156272 3300025915 Bacteria 1794
420 Ga0207693_10171012 3300025915 Bacteria 1711
421 Ga0207693_10297972 3300025915 Bacteria 1263
422 Ga0207693_10337450 3300025915 Unclassified 1180
423 Ga0207693_11048626 3300025915 Bacteria 621
424 Ga0207663_10004946 3300025916 Bacteria 6675
425 Ga0207663_10006883 3300025916 Bacteria 5858
426 Ga0207663_10008833 3300025916 Bacteria 5296
427 Ga0207663_10042210 3300025916 Bacteria 2786
428 Ga0207663_10131645 3300025916 Bacteria 1729
429 Ga0207663_10380878 3300025916 Bacteria 1075
430 Ga0207663_10420863 3300025916 Bacteria 1025
431 Ga0207663_10523231 3300025916 Bacteria 924
432 Ga0207663_10984069 3300025916 Bacteria 676
433 Ga0207657_10009239 3300025919 Bacteria 9936
434 Ga0207657_10101950 3300025919 Bacteria 2381
435 Ga0207649_10326005 3300025920 Bacteria 1130
436 Ga0207652_10341711 3300025921 Bacteria 1351
437 Ga0207652_11485441 3300025921 Bacteria 582
438 Ga0207646_10001025 3300025922 Bacteria 35704
439 Ga0207646_10001028 3300025922 Bacteria 35654
440 Ga0207646_10041799 3300025922 Bacteria 4119
441 Ga0207646_10376086 3300025922 Bacteria 1283
442 Ga0207646_10927125 3300025922 Unclassified 772
443 Ga0207646_11410661 3300025922 Bacteria 605
444 Ga0207694_11079589 3300025924 Unclassified 679
445 Ga0207659_10032251 3300025926 Bacteria 3593
446 Ga0207659_10667457 3300025926 Bacteria 889
447 Ga0207687_10484030 3300025927 Unclassified 1031
448 Ga0207687_10638932 3300025927 Bacteria 900
449 Ga0207687_10864892 3300025927 Bacteria 773
450 Ga0207700_10000935 3300025928 Bacteria 16792
451 Ga0207700_10002068 3300025928 Bacteria 11476
452 Ga0207700_10008073 3300025928 Bacteria 6493
453 Ga0207700_10010239 3300025928 Bacteria 5902
454 Ga0207700_10123749 3300025928 Bacteria 2100
455 Ga0207700_10182259 3300025928 Bacteria 1759
456 Ga0207700_10208025 3300025928 Bacteria 1652
457 Ga0207700_10340830 3300025928 Unclassified 1303
458 Ga0207700_10553498 3300025928 Bacteria 1021
459 Ga0207700_11321841 3300025928 Bacteria 642
460 Ga0207664_10001780 3300025929 Bacteria 14188
461 Ga0207664_10002171 3300025929 Bacteria 12912
462 Ga0207664_10017089 3300025929 Bacteria 5307
463 Ga0207664_10026003 3300025929 Bacteria 4418
464 Ga0207664_10031593 3300025929 Bacteria 4052
465 Ga0207664_10131497 3300025929 Bacteria 2107
466 Ga0207664_10214388 3300025929 Bacteria 1667
467 Ga0207664_10259799 3300025929 Bacteria 1518
468 Ga0207664_10539055 3300025929 Bacteria 1046
469 Ga0207664_10656500 3300025929 Bacteria 943
470 Ga0207664_10750446 3300025929 Unclassified 878
471 Ga0207664_10817055 3300025929 Unclassified 838
472 Ga0207664_10878115 3300025929 Bacteria 806
473 Ga0207664_11015707 3300025929 Bacteria 743
474 Ga0207664_11047209 3300025929 Bacteria 730
475 Ga0207664_11192723 3300025929 Bacteria 679
476 Ga0207664_11569227 3300025929 Bacteria 580
477 Ga0207644_10351908 3300025931 Bacteria 1196
478 Ga0207644_11878974 3300025931 Bacteria 501
479 Ga0207690_10391829 3300025932 Bacteria 1106
480 Ga0207690_10502797 3300025932 Unclassified 980
481 Ga0207706_10010344 3300025933 Bacteria 8528
482 Ga0207706_10287960 3300025933 Bacteria 1432
483 Ga0207706_10437705 3300025933 Bacteria 1132
484 Ga0207686_10223961 3300025934 Unclassified 1360
485 Ga0207686_10653180 3300025934 Bacteria 832
486 Ga0207686_10794626 3300025934 Unclassified 758
487 Ga0207686_11015274 3300025934 Bacteria 673
488 Ga0207709_10093308 3300025935 Bacteria 1973
489 Ga0207709_10128173 3300025935 Bacteria 1725
490 Ga0207670_10720209 3300025936 Bacteria 827
491 Ga0207704_10130470 3300025938 Bacteria 1739
492 Ga0207704_10378582 3300025938 Bacteria 1110
493 Ga0207665_10001548 3300025939 Bacteria 15470
494 Ga0207665_10001912 3300025939 Bacteria 14048
495 Ga0207665_10017852 3300025939 Bacteria 4664
496 Ga0207665_10027812 3300025939 Bacteria 3736
497 Ga0207665_10047675 3300025939 Bacteria 2873
498 Ga0207665_10047865 3300025939 Bacteria 2868
499 Ga0207665_10499802 3300025939 Bacteria 939
500 Ga0207665_11145711 3300025939 Bacteria 620
501 Ga0207665_11173366 3300025939 Bacteria 612
502 Ga0207691_10186810 3300025940 Bacteria 1809
503 Ga0207711_10168246 3300025941 Bacteria 1988
504 Ga0207711_10548560 3300025941 Bacteria 1078
505 Ga0207689_10000637 3300025942 Bacteria 33477
506 Ga0207689_10138779 3300025942 Bacteria 2002
507 Ga0207679_10163772 3300025945 Bacteria 1823
508 Ga0207679_11483547 3300025945 Unclassified 622
509 Ga0207667_10368194 3300025949 Bacteria 1465
510 Ga0207667_11496347 3300025949 Bacteria 646
511 Ga0207667_11559416 3300025949 Bacteria 630
512 Ga0207651_10317262 3300025960 Bacteria 1302
513 Ga0207712_10429894 3300025961 Unclassified 1116
514 Ga0207712_10624965 3300025961 Unclassified 934
515 Ga0207712_11671436 3300025961 Unclassified 571
516 Ga0207668_10302392 3300025972 Bacteria 1321
517 Ga0207668_11938172 3300025972 Bacteria 531
518 Ga0207640_10178470 3300025981 Bacteria 1590
519 Ga0207640_10972833 3300025981 Unclassified 745
520 Ga0207640_11056627 3300025981 Unclassified 717
521 Ga0207658_10698510 3300025986 Bacteria 917
522 Ga0207677_11627766 3300026023 Unclassified 598
523 Ga0207703_11570746 3300026035 Bacteria 633
524 Ga0207639_10106209 3300026041 Bacteria 2279
525 Ga0207639_10258384 3300026041 Bacteria 1522
526 Ga0207678_10031219 3300026067 Bacteria 4648
527 Ga0207708_10187270 3300026075 Bacteria 1645
528 Ga0207702_10135659 3300026078 Bacteria 2220
529 Ga0207702_10170922 3300026078 Bacteria 1993
530 Ga0207702_10477887 3300026078 Bacteria 1212
531 Ga0207641_10652680 3300026088 Bacteria 1033
532 Ga0207648_10603787 3300026089 Bacteria 1011
533 Ga0207648_11022060 3300026089 Bacteria 774
534 Ga0207674_10346472 3300026116 Bacteria 1436
535 Ga0207675_100003528 3300026118 Bacteria 15258
536 Ga0207675_100232528 3300026118 Bacteria 1779
537 Ga0207683_10029746 3300026121 Bacteria 4730
538 Ga0207683_10033055 3300026121 Bacteria 4493
539 Ga0207698_10789153 3300026142 Bacteria 951
540 Ga0207698_11601873 3300026142 Unclassified 667
541 Ga0207428_10668051 3300027907 Bacteria 745
542 Ga0268264_10502172 3300028381 Bacteria 1183
543 Ga0265336_10044462 3300028666 Bacteria 1351
544 Ga0265338_10007034 3300028800 Bacteria 14115
545 Ga0265777_114550 3300030877 Bacteria 608
546 Ga0265765_1052407 3300030879 Unclassified 563
547 Ga0265760_10111565 3300031090 Bacteria 871
548 Ga0265760_10274613 3300031090 Bacteria 590
549 Ga0307513_10407775 3300031456 Bacteria 1092
550 Ga0307409_100108617 3300031995 Bacteria 2321
551 Ga0307416_100632906 3300032002 Bacteria 1153
552 Ga0373948_0060942 3300034817 Unclassified 828
553 Ga0373950_0137905 3300034818 Bacteria 550
554 Ga0373959_0041606 3300034820 Bacteria 966
555 Ga0373959_0104786 3300034820 Bacteria 677
556 Ga0373959_0125544 3300034820 Unclassified 631
557 Ga0373938_0034390 3300034957 Bacteria 1101
558 Ga0373926_0004896 3300035083 Bacteria 4402
559 Ga0373926_0220167 3300035083 Unclassified 733
560 Ga0373928_0016328 3300035084 Unclassified 1519
561 Ga0373934_0016134 3300035086 Bacteria 2837
562 Ga0373934_0100681 3300035086 Bacteria 1168
563 Ga0373934_0277830 3300035086 Unclassified 694
564 Ga0373940_0046305 3300035088 Unclassified 1210
565 Ga0373940_0155295 3300035088 Bacteria 731
566 Ga0373944_0060465 3300035089 Unclassified 1214
567 Ga0373944_0160943 3300035089 Unclassified 796
568 Ga0373949_0042471 3300035090 Unclassified 1122
569 Ga0373951_0036488 3300035091 Bacteria 1173
570 Ga0373952_0036525 3300035092 Unclassified 1116
571 Ga0373952_0212019 3300035092 Bacteria 572
572 Ga0373923_0009757 3300035111 Bacteria 3471
573 Ga0373923_0012459 3300035111 Bacteria 3144
574 Ga0373923_0043802 3300035111 Unclassified 1853
575 Ga0373923_0513211 3300035111 Bacteria 585
576 Ga0373932_0002043 3300035112 Bacteria 5282
577 Ga0373932_0098947 3300035112 Bacteria 946
578 Ga0373936_0005671 3300035113 Bacteria 4709
579 Ga0373936_0015057 3300035113 Bacteria 2961
580 Ga0373936_0019677 3300035113 Bacteria 2617
581 Ga0373939_0008703 3300035114 Bacteria 2495
582 Ga0373939_0035465 3300035114 Bacteria 1470
583 Ga0373939_0225473 3300035114 Bacteria 719
584 Ga0373941_0132624 3300035115 Unclassified 899
585 Ga0373945_0000857 3300035116 Bacteria 8960
586 Ga0373945_0023253 3300035116 Unclassified 2140
587 Ga0373945_0316906 3300035116 Bacteria 671
588 Ga0373945_0385135 3300035116 Bacteria 613
589 Ga0373953_0001440 3300035117 Bacteria 6893
590 Ga0373953_0066337 3300035117 Bacteria 1483
591 Ga0373953_0307196 3300035117 Bacteria 692
592 Ga0373954_0040317 3300035118 Bacteria 2175
593 Ga0373954_0049363 3300035118 Bacteria 1973
594 Ga0373954_0433238 3300035118 Bacteria 651
595 Ga0373956_0010874 3300035119 Bacteria 3741
596 Ga0373956_0041268 3300035119 Bacteria 2048
597 Ga0373956_0123017 3300035119 Bacteria 1212
598 Ga0373956_0183982 3300035119 Bacteria 988
599 Ga0373956_0222512 3300035119 Bacteria 896
600 Ga0373957_0000395 3300035120 Bacteria 11073
601 Ga0373957_0064997 3300035120 Bacteria 1419
602 Ga0373957_0294393 3300035120 Unclassified 688
603 Ga0373957_0295714 3300035120 Bacteria 686
604 Ga0373957_0486632 3300035120 Bacteria 536
605 Ga0373960_0026252 3300035121 Bacteria 1590
606 Ga0373960_0064645 3300035121 Bacteria 1117
607 Ga0373960_0157632 3300035121 Bacteria 779
608 Ga0373943_0010787 3300035170 Bacteria 4102
609 Ga0373943_0105732 3300035170 Unclassified 1478
610 Ga0373943_0115711 3300035170 Bacteria 1420
611 Ga0373943_0161921 3300035170 Bacteria 1219
612 Ga0373943_0957198 3300035170 Bacteria 513
613 Ga0373946_0007574 3300035171 Bacteria 3973
614 Ga0373946_0244551 3300035171 Bacteria 873
615 Ga0373955_0006906 3300035172 Bacteria 5190
616 Ga0373955_0087325 3300035172 Bacteria 1772
617 Ga0373955_0192919 3300035172 Bacteria 1212
618 Ga0373955_0217215 3300035172 Unclassified 1141
619 Ga0373955_0612365 3300035172 Unclassified 667
620 Ga0373955_1001435 3300035172 Unclassified 515
621 Ga0373942_0003432 3300035207 Bacteria 3724
622 Ga0373942_0063436 3300035207 Unclassified 1063
623 Ga0373961_0007728 3300035241 Bacteria 2605
624 Ga0373961_0032347 3300035241 Bacteria 1466
625 Ga0373961_0066038 3300035241 Bacteria 1109
626 Ga0373962_0024534 3300035242 Unclassified 1613
627 Ga0373962_0024678 3300035242 Bacteria 1610
628 Ga0373962_0297724 3300035242 Bacteria 572
629 Ga0373924_0016147 3300035410 Bacteria 2848
630 Ga0373924_0019354 3300035410 Bacteria 2637
631 Ga0373924_0044595 3300035410 Unclassified 1822
632 Ga0373924_0438091 3300035410 Bacteria 585
633 Ga0373931_0005023 3300035691 Bacteria 6084
634 Ga0373931_0007023 3300035691 Bacteria 5297
635 Ga0373931_0120410 3300035691 Bacteria 1499
636 Ga0373931_0138730 3300035691 Bacteria 1406
637 Ga0373931_0531873 3300035691 Bacteria 762
638 Ga0373931_0634663 3300035691 Unclassified 701
639 Ga0373935_0021843 3300035692 Bacteria 3918
640 Ga0373935_0022631 3300035692 Bacteria 3856
641 Ga0373935_0126102 3300035692 Bacteria 1715
642 Ga0373935_0157726 3300035692 Bacteria 1544
643 Ga0373935_0281125 3300035692 Bacteria 1172
644 Ga0373935_0563822 3300035692 Bacteria 831
645 Ga0373935_0634342 3300035692 Unclassified 783
646 Ga0373935_0665669 3300035692 Bacteria 764
647 Ga0373927_0007575 3300035695 Bacteria 7347
648 Ga0373927_0097977 3300035695 Bacteria 1906
649 Ga0373927_0155042 3300035695 Bacteria 1500
650 Ga0373927_0740895 3300035695 Bacteria 649
651 Ga0373933_0003771 3300035724 Bacteria 8374
652 Ga0373933_0008292 3300035724 Bacteria 5674
653 Ga0373933_0009211 3300035724 Bacteria 5391
654 Ga0373933_0012435 3300035724 Bacteria 4699
655 Ga0373933_0121146 3300035724 Bacteria 1638
656 Ga0373933_0314095 3300035724 Bacteria 1015
657 Ga0373933_0318605 3300035724 Bacteria 1008
658 Ga0373933_0478285 3300035724 Unclassified 815
659 Ga0373933_0654484 3300035724 Bacteria 690
660 Ga0373947_0004813 3300035725 Bacteria 7903
661 Ga0373947_0025467 3300035725 Bacteria 3451
662 Ga0373947_0027635 3300035725 Bacteria 3322
663 Ga0373947_0114431 3300035725 Unclassified 1708
664 Ga0373947_0475185 3300035725 Bacteria 848
665 Ga0373947_0667643 3300035725 Unclassified 709
666 Ga0373947_0708974 3300035725 Bacteria 687
667 Ga0373937_0004787 3300036401 Bacteria 11496
668 Ga0373937_0019543 3300036401 Bacteria 6061
669 Ga0373937_0042732 3300036401 Bacteria 4135
670 Ga0373937_0043353 3300036401 Bacteria 4106
671 Ga0373937_0209103 3300036401 Bacteria 1835
672 Ga0373937_0248247 3300036401 Bacteria 1677
673 Ga0373937_0528675 3300036401 Unclassified 1120
674 Ga0373925_0006165 3300037068 Bacteria 8853
675 Ga0373925_0030042 3300037068 Bacteria 3987
676 Ga0373925_0040068 3300037068 Unclassified 3467
677 Ga0373925_0100518 3300037068 Bacteria 2222
678 Ga0373925_0144386 3300037068 Bacteria 1864
679 Ga0373925_0480922 3300037068 Bacteria 1019
680 Ga0373925_0921331 3300037068 Unclassified 720
681 Ga0373925_1021646 3300037068 Bacteria 681
682 Ga0373925_1710896 3300037068 Unclassified 513
683 Ga0436364_0105925 3300037853 Bacteria 2360
684 Ga0436364_0377973 3300037853 Bacteria 58023
685 Ga0436364_0679842 3300037853 Bacteria 12069
686 Ga0436364_1006315 3300037853 Bacteria 3222
687 Ga0436364_1177344 3300037853 Bacteria 768
688 Ga0436364_1305843 3300037853 Bacteria 2391
689 Ga0436364_1383024 3300037853 Bacteria 3570
690 Ga0436364_1401376 3300037853 Bacteria 69007
691 Ga0436365_0303082 3300039437 Bacteria 2724
692 Ga0436365_0768004 3300039437 Unclassified 1257
693 Ga0436360_0269636 3300039438 Unclassified 536
694 Ga0436360_0622341 3300039438 Unclassified 679
695 Ga0436361_0346318 3300039447 Bacteria 694
696 Ga0436363_0070686 3300039450 Unclassified 609
697 Ga0436363_1072037 3300039450 Bacteria 697
698 Ga0436363_1532046 3300039450 Bacteria 1123
699 Ga0436363_1600052 3300039450 Bacteria 1191
700 Ga0466963_0567570 3300044694 Bacteria 801
701 Ga0466957_0154636 3300044842 Bacteria 1486
702 Ga0466957_0750243 3300044842 Bacteria 691
703 Ga0466959_0743012 3300045049 Unclassified 657
704 Ga0466959_1003874 3300045049 Unclassified 556
705 Ga0466958_0335282 3300045836 Unclassified 973
706 Ga0466958_0405013 3300045836 Bacteria 881
707 Ga0466967_0003373 3300045976 Bacteria 10399
708 Ga0466967_1056694 3300045976 Unclassified 809
709 Ga0466967_1979044 3300045976 Unclassified 579
710 Ga0495592_0043709 3300046454 Bacteria 3350
711 Ga0495592_0049681 3300046454 Bacteria 3117
712 Ga0495592_0066530 3300046454 Bacteria 2637
713 Ga0495592_0198939 3300046454 Bacteria 1353
714 Ga0495603_0001884 3300046455 Bacteria 12373
715 Ga0495603_0016821 3300046455 Bacteria 4425
716 Ga0495603_0039723 3300046455 Bacteria 2818
717 Ga0495603_0487476 3300046455 Bacteria 706
718 Ga0495629_0002427 3300046459 Bacteria 14320
719 Ga0495629_0013068 3300046459 Bacteria 5999
720 Ga0495629_0076352 3300046459 Bacteria 2339
721 Ga0495629_0343383 3300046459 Unclassified 1019
722 Ga0495629_0839706 3300046459 Unclassified 604
723 Ga0495641_0005488 3300046461 Bacteria 8549
724 Ga0495641_0007308 3300046461 Bacteria 6919
725 Ga0495641_0058474 3300046461 Bacteria 1744
726 Ga0495641_0103798 3300046461 Bacteria 1268
727 Ga0495641_0240700 3300046461 Bacteria 813
728 Ga0495641_0355878 3300046461 Bacteria 662
729 Ga0495651_0001931 3300046462 Bacteria 16031
730 Ga0495651_0016617 3300046462 Bacteria 5699
731 Ga0495651_0029872 3300046462 Bacteria 4249
732 Ga0495651_0033587 3300046462 Bacteria 4001
733 Ga0495651_0045262 3300046462 Unclassified 3410
734 Ga0495651_0049114 3300046462 Bacteria 3257
735 Ga0495651_0182644 3300046462 Unclassified 1483
736 Ga0495653_0006982 3300046463 Bacteria 9270
737 Ga0495653_0014251 3300046463 Bacteria 6482
738 Ga0495653_0020561 3300046463 Bacteria 5350
739 Ga0495653_0103196 3300046463 Bacteria 2062
740 Ga0495653_0132000 3300046463 Bacteria 1767
741 Ga0495653_0175537 3300046463 Bacteria 1475
742 Ga0495653_0593515 3300046463 Bacteria 681
743 Ga0495653_0907430 3300046463 Bacteria 524
744 Ga0495580_0006966 3300046472 Bacteria 9117
745 Ga0495580_0009215 3300046472 Bacteria 7779
746 Ga0495580_0365004 3300046472 Bacteria 977
747 Ga0495582_0002516 3300046473 Bacteria 10200
748 Ga0495582_0006049 3300046473 Bacteria 6744
749 Ga0495582_0039320 3300046473 Bacteria 2604
750 Ga0495582_0056608 3300046473 Bacteria 2161
751 Ga0495582_0746379 3300046473 Bacteria 566
752 Ga0495639_0001397 3300046475 Bacteria 10819
753 Ga0495639_0034558 3300046475 Bacteria 2262
754 Ga0495639_0156267 3300046475 Bacteria 1102
755 Ga0495662_0004842 3300046476 Bacteria 6743
756 Ga0495662_0005405 3300046476 Bacteria 6392
757 Ga0495662_0054148 3300046476 Bacteria 1938
758 Ga0495664_0001454 3300046477 Bacteria 12550
759 Ga0495664_0029636 3300046477 Bacteria 3202
760 Ga0495664_0051629 3300046477 Bacteria 2441
761 Ga0495664_0062254 3300046477 Bacteria 2222
762 Ga0495664_0205015 3300046477 Bacteria 1195
763 Ga0495664_0296910 3300046477 Bacteria 975
764 Ga0495664_0516619 3300046477 Unclassified 713
765 Ga0495664_0862793 3300046477 Bacteria 530
766 Ga0495664_0874113 3300046477 Unclassified 526
767 Ga0495585_0568439 3300046492 Unclassified 535
768 Ga0495594_0038259 3300046499 Bacteria 2619
769 Ga0495594_0295108 3300046499 Bacteria 924
770 Ga0495594_0467370 3300046499 Bacteria 717
771 Ga0495608_0013803 3300046511 Bacteria 5604
772 Ga0495608_0038855 3300046511 Bacteria 3193
773 Ga0495608_0045323 3300046511 Bacteria 2931
774 Ga0495608_0047249 3300046511 Bacteria 2862
775 Ga0495608_0165064 3300046511 Bacteria 1407
776 Ga0495608_0290401 3300046511 Bacteria 1013
777 Ga0495618_0014069 3300046514 Bacteria 4871
778 Ga0495618_0045208 3300046514 Bacteria 2777
779 Ga0495618_0101216 3300046514 Bacteria 1844
780 Ga0495618_0437177 3300046514 Unclassified 795
781 Ga0495618_0453110 3300046514 Bacteria 778
782 Ga0495628_0043904 3300046516 Bacteria 3558
783 Ga0495628_0157921 3300046516 Unclassified 1724
784 Ga0495628_0395377 3300046516 Bacteria 1010
785 Ga0495628_0851393 3300046516 Bacteria 635
786 Ga0495630_0007894 3300046517 Bacteria 7631
787 Ga0495630_0008368 3300046517 Bacteria 7424
788 Ga0495630_0045139 3300046517 Bacteria 3292
789 Ga0495630_0054253 3300046517 Bacteria 3003
790 Ga0495630_0073679 3300046517 Bacteria 2571
791 Ga0495630_0276169 3300046517 Unclassified 1284
792 Ga0495630_0496375 3300046517 Bacteria 936
793 Ga0495666_0004981 3300046526 Bacteria 6721
794 Ga0495666_0121301 3300046526 Bacteria 1224
795 Ga0495666_0141036 3300046526 Bacteria 1124
796 Ga0495652_0038079 3300046529 Bacteria 4168
797 Ga0495652_0187607 3300046529 Bacteria 1581
798 Ga0495652_0214883 3300046529 Bacteria 1449
799 Ga0495652_0226750 3300046529 Bacteria 1400
800 Ga0495652_0359950 3300046529 Bacteria 1040
801 Ga0495652_0418654 3300046529 Bacteria 944
802 Ga0495652_0452665 3300046529 Unclassified 898
803 Ga0495652_0479880 3300046529 Bacteria 865
804 Ga0495652_0641625 3300046529 Bacteria 720
805 Ga0495652_0817250 3300046529 Unclassified 619
806 Ga0495652_1034761 3300046529 Unclassified 536
807 Ga0495665_0039083 3300046531 Bacteria 2528
808 Ga0495665_0043227 3300046531 Bacteria 2396
809 Ga0495665_0083604 3300046531 Bacteria 1678
810 Ga0495665_0161966 3300046531 Bacteria 1166
811 Ga0495665_0185388 3300046531 Unclassified 1080
812 Ga0495640_0011299 3300046533 Bacteria 6874
813 Ga0495640_0030403 3300046533 Bacteria 3866
814 Ga0495640_0035817 3300046533 Bacteria 3511
815 Ga0495640_0044795 3300046533 Bacteria 3074
816 Ga0495640_0507840 3300046533 Bacteria 733
817 Ga0495586_0080183 3300046535 Bacteria 1793
818 Ga0495586_0131097 3300046535 Bacteria 1403
819 Ga0495586_0226551 3300046535 Bacteria 1063
820 Ga0495586_0567474 3300046535 Bacteria 655
821 Ga0495587_0005768 3300046536 Bacteria 8069
822 Ga0495587_0009878 3300046536 Bacteria 6092
823 Ga0495587_0037601 3300046536 Bacteria 2905
824 Ga0495587_0232225 3300046536 Bacteria 1039
825 Ga0495587_0234689 3300046536 Unclassified 1033
826 Ga0495645_0061367 3300046543 Bacteria 2724
827 Ga0495645_0099890 3300046543 Bacteria 2064
828 Ga0495645_0145931 3300046543 Bacteria 1648
829 Ga0495645_0385621 3300046543 Unclassified 895
830 Ga0495645_0862572 3300046543 Bacteria 539
831 Ga0495622_0063965 3300046557 Bacteria 1702
832 Ga0495667_0001128 3300046559 Bacteria 17388
833 Ga0495667_0002989 3300046559 Bacteria 11339
834 Ga0495667_0013187 3300046559 Bacteria 5597
835 Ga0495667_0036410 3300046559 Bacteria 3285
836 Ga0495667_0126551 3300046559 Bacteria 1648
837 Ga0495667_0131551 3300046559 Bacteria 1614
838 Ga0495667_0926346 3300046559 Unclassified 533
839 Ga0495656_0054356 3300046615 Bacteria 1723
840 Ga0495656_0546682 3300046615 Bacteria 617
841 Ga0495634_0018598 3300046642 Bacteria 4943
842 Ga0495634_0022260 3300046642 Bacteria 4466
843 Ga0495634_0196835 3300046642 Bacteria 1254
844 Ga0495634_0214396 3300046642 Bacteria 1190
845 Ga0495634_0590870 3300046642 Unclassified 645
846 Ga0495635_0003541 3300046663 Bacteria 10808
847 Ga0495635_0011673 3300046663 Bacteria 6157
848 Ga0495635_0015907 3300046663 Bacteria 5255
849 Ga0495635_0072084 3300046663 Bacteria 2367
850 Ga0495635_0142258 3300046663 Bacteria 1633
851 Ga0495635_0146243 3300046663 Bacteria 1609
852 Ga0495635_0732528 3300046663 Bacteria 640
853 Ga0495588_0656516 3300046674 Bacteria 549
854 Ga0495657_0013621 3300046675 Bacteria 5995
855 Ga0495657_0013795 3300046675 Bacteria 5948
856 Ga0495657_0029482 3300046675 Bacteria 3848
857 Ga0495657_0043047 3300046675 Bacteria 3080
858 Ga0495657_0057990 3300046675 Bacteria 2572
859 Ga0495657_0134572 3300046675 Bacteria 1545
860 Ga0495599_0007731 3300046678 Bacteria 6526
861 Ga0495599_0084819 3300046678 Bacteria 1978
862 Ga0495599_0120858 3300046678 Bacteria 1628
863 Ga0495623_0026081 3300046679 Bacteria 3764
864 Ga0495623_0033379 3300046679 Bacteria 3303
865 Ga0495623_0069692 3300046679 Bacteria 2191
866 Ga0495623_0559007 3300046679 Bacteria 598
867 Ga0495646_0014834 3300046680 Bacteria 4950
868 Ga0495646_0039940 3300046680 Bacteria 2891
869 Ga0495646_0337090 3300046680 Unclassified 792
870 Ga0495646_0695396 3300046680 Bacteria 511
871 Ga0495647_0002984 3300046681 Bacteria 5380
872 Ga0495647_0043419 3300046681 Bacteria 1720
873 Ga0495647_0300136 3300046681 Unclassified 724
874 Ga0495658_0007556 3300046683 Bacteria 5387
875 Ga0495658_0023564 3300046683 Bacteria 3268
876 Ga0495658_0079429 3300046683 Bacteria 1922
877 Ga0495658_0140515 3300046683 Unclassified 1476
878 Ga0495658_0357199 3300046683 Unclassified 929
879 Ga0495658_0770177 3300046683 Unclassified 616
880 Ga0495613_0010937 3300046689 Bacteria 6736
881 Ga0495613_0040395 3300046689 Bacteria 3457
882 Ga0495613_0302208 3300046689 Bacteria 1107
883 Ga0495624_0041428 3300046690 Bacteria 2945
884 Ga0495624_0045325 3300046690 Bacteria 2800
885 Ga0495624_0075697 3300046690 Bacteria 2090
886 Ga0495624_0251814 3300046690 Bacteria 1068
887 Ga0495670_0287547 3300046691 Bacteria 880
888 Ga0495600_0007024 3300046809 Bacteria 6878
889 Ga0495600_0009905 3300046809 Bacteria 5902
890 Ga0495600_0029377 3300046809 Bacteria 3559
891 Ga0495600_0462237 3300046809 Unclassified 784
892 Ga0495600_0518791 3300046809 Bacteria 731
893 Ga0495581_0001789 3300047315 Bacteria 12005
894 Ga0495581_0006628 3300047315 Bacteria 6708
895 Ga0495581_0020589 3300047315 Bacteria 3827
896 Ga0495581_0033225 3300047315 Bacteria 2987
897 Ga0495604_0006908 3300047317 Bacteria 8997
898 Ga0495604_0011917 3300047317 Bacteria 6914
899 Ga0495604_0014246 3300047317 Bacteria 6338
900 Ga0495604_0055234 3300047317 Bacteria 3061
901 Ga0495604_0111258 3300047317 Bacteria 1997
902 Ga0495604_0220828 3300047317 Bacteria 1305
903 Ga0495604_1044164 3300047317 Bacteria 504
904 Ga0495674_0037957 3300047319 Bacteria 4327
905 Ga0495674_0091354 3300047319 Bacteria 2600
906 Ga0495674_0175002 3300047319 Unclassified 1789
907 Ga0495674_0246110 3300047319 Bacteria 1472
908 Ga0495674_0417424 3300047319 Bacteria 1081
909 Ga0495674_0474938 3300047319 Bacteria 1002
910 Ga0495674_0547662 3300047319 Bacteria 921
911 Ga0495674_0748817 3300047319 Bacteria 763
912 Ga0495674_0869235 3300047319 Bacteria 698
913 Ga0495674_1092874 3300047319 Bacteria 607
914 Ga0495674_1209162 3300047319 Bacteria 571
915 Ga0495676_0019767 3300047321 Bacteria 5920
916 Ga0495676_0023723 3300047321 Bacteria 5319
917 Ga0495676_0080861 3300047321 Bacteria 2465
918 Ga0495676_0200289 3300047321 Bacteria 1388
919 Ga0495676_0400440 3300047321 Unclassified 911
920 Ga0495676_0434099 3300047321 Bacteria 868
921 Ga0495676_0441943 3300047321 Unclassified 859
922 Ga0495680_0005813 3300047322 Bacteria 11548
923 Ga0495680_0007024 3300047322 Bacteria 10382
924 Ga0495680_0008161 3300047322 Bacteria 9545
925 Ga0495680_0012284 3300047322 Bacteria 7545
926 Ga0495680_0025800 3300047322 Bacteria 4858
927 Ga0495680_0039127 3300047322 Bacteria 3785
928 Ga0495680_0291150 3300047322 Bacteria 1148
929 Ga0495680_0623993 3300047322 Bacteria 719
930 Ga0495680_0732845 3300047322 Bacteria 650
931 Ga0495675_0012751 3300047444 Bacteria 5294
932 Ga0495675_0013817 3300047444 Bacteria 5103
933 Ga0495675_0022321 3300047444 Bacteria 4034
934 Ga0495675_0099302 3300047444 Bacteria 1823
935 Ga0495675_0170925 3300047444 Bacteria 1335
936 Ga0495684_0008155 3300047471 Bacteria 8102
937 Ga0495684_0013873 3300047471 Bacteria 6199
938 Ga0495684_0021270 3300047471 Bacteria 4997
939 Ga0495684_0027462 3300047471 Bacteria 4369
940 Ga0495684_0043023 3300047471 Bacteria 3457
941 Ga0495684_0107490 3300047471 Bacteria 2107
942 Ga0495684_0227390 3300047471 Bacteria 1365
943 Ga0495684_0328927 3300047471 Bacteria 1090
944 Ga0495684_0471291 3300047471 Unclassified 869
945 Ga0495593_0002377 3300047673 Bacteria 11305
946 Ga0495593_0004968 3300047673 Bacteria 7877
947 Ga0495593_0035071 3300047673 Bacteria 2725
948 Ga0495593_0044899 3300047673 Bacteria 2361
949 Ga0495602_0054740 3300048088 Bacteria 3519
950 Ga0495602_0099899 3300048088 Bacteria 2384
951 Ga0495602_0111751 3300048088 Bacteria 2218
952 Ga0495602_0117041 3300048088 Bacteria 2152
953 Ga0495602_0135452 3300048088 Bacteria 1957
954 Ga0495602_0480664 3300048088 Bacteria 872
955 Ga0495602_1148917 3300048088 Bacteria 507
956 Ga0495614_0024138 3300048089 Bacteria 2625
957 Ga0495614_0253699 3300048089 Bacteria 805
958 Ga0495614_0507508 3300048089 Bacteria 574
959 Ga0496100_0160498 3300048903 Bacteria 1611
960 Ga0496100_0192929 3300048903 Bacteria 1480
961 Ga0496100_0263269 3300048903 Bacteria 1279
962 Ga0496100_1621281 3300048903 Unclassified 511
963 Ga0496101_0030527 3300048904 Bacteria 3780
964 Ga0496101_0064367 3300048904 Bacteria 2671
965 Ga0496101_0352028 3300048904 Bacteria 1157
966 Ga0496101_0665505 3300048904 Bacteria 822
967 Ga0496102_0088723 3300048905 Bacteria 2860
968 Ga0496102_0119224 3300048905 Bacteria 2463
969 Ga0496102_0292786 3300048905 Bacteria 1534
970 Ga0496102_0298910 3300048905 Bacteria 1517
971 Ga0496102_0307783 3300048905 Bacteria 1493
972 Ga0496103_0017239 3300048906 Bacteria 4320
973 Ga0496103_0201743 3300048906 Unclassified 1279
974 Ga0496103_0339444 3300048906 Bacteria 966
975 Ga0496104_0005558 3300048907 Bacteria 11038
976 Ga0496104_0012036 3300048907 Bacteria 7764
977 Ga0496104_0553161 3300048907 Bacteria 1061
978 Ga0496104_1366231 3300048907 Unclassified 611
979 Ga0496104_1406913 3300048907 Unclassified 600
980 Ga0496105_0001173 3300048908 Bacteria 18253
981 Ga0496105_0001930 3300048908 Bacteria 14896
982 Ga0496105_0016692 3300048908 Bacteria 5865
983 Ga0496105_0790005 3300048908 Bacteria 722
984 Ga0496105_1072199 3300048908 Unclassified 599
985 Ga0496106_0053070 3300048909 Bacteria 3060
986 Ga0496106_0161806 3300048909 Bacteria 1770
987 Ga0496106_0167631 3300048909 Bacteria 1739
988 Ga0496106_0283453 3300048909 Bacteria 1327
989 Ga0496106_1012401 3300048909 Bacteria 653
990 Ga0496107_0030892 3300048910 Bacteria 3820
991 Ga0496107_0560711 3300048910 Bacteria 846
992 Ga0496107_0673765 3300048910 Bacteria 762
993 Ga0496107_0957028 3300048910 Bacteria 622
994 Ga0496107_0969630 3300048910 Unclassified 618
995 Ga0496107_1073144 3300048910 Bacteria 582
996 Ga0496108_0043675 3300048911 Bacteria 3743
997 Ga0496108_0127846 3300048911 Bacteria 2183
998 Ga0496108_0232051 3300048911 Unclassified 1605
999 Ga0496108_0407957 3300048911 Bacteria 1187
1000 Ga0496108_1178587 3300048911 Bacteria 648
1001 Ga0496108_1311530 3300048911 Bacteria 608
1002 Ga0496109_0030550 3300048912 Bacteria 4829
1003 Ga0496109_0138031 3300048912 Bacteria 2279
1004 Ga0496109_0276437 3300048912 Bacteria 1582
1005 Ga0496109_0540341 3300048912 Unclassified 1099
1006 Ga0496109_1196981 3300048912 Unclassified 696
1007 Ga0496110_0254655 3300048913 Bacteria 1598
1008 Ga0496110_0355769 3300048913 Bacteria 1334
1009 Ga0496110_0632246 3300048913 Bacteria 969
1010 Ga0496110_0735396 3300048913 Bacteria 889
1011 Ga0496111_0067859 3300048914 Bacteria 2591
1012 Ga0496111_0224570 3300048914 Unclassified 1395
1013 Ga0496112_0125053 3300048915 Bacteria 2542
1014 Ga0496112_0142017 3300048915 Bacteria 2370
1015 Ga0496112_0221523 3300048915 Unclassified 1848
1016 Ga0496113_0035625 3300048916 Bacteria 3640
1017 Ga0496113_0107297 3300048916 Bacteria 2170
1018 Ga0496113_0226392 3300048916 Unclassified 1491
1019 Ga0496113_0229378 3300048916 Bacteria 1480
1020 Ga0496113_0392809 3300048916 Bacteria 1113
1021 Ga0496114_0004915 3300048917 Bacteria 10411
1022 Ga0496114_0005249 3300048917 Bacteria 10125
1023 Ga0496114_0021533 3300048917 Bacteria 5245
1024 Ga0496114_0988059 3300048917 Bacteria 725
1025 Ga0496115_0001816 3300048918 Bacteria 15268
1026 Ga0496115_0004006 3300048918 Bacteria 10629
1027 Ga0496115_0063941 3300048918 Bacteria 2969
1028 Ga0496115_0082329 3300048918 Bacteria 2622
1029 Ga0496115_1152863 3300048918 Unclassified 585
1030 Ga0496126_0804144 3300048929 Unclassified 721
1031 Ga0496126_1140488 3300048929 Bacteria 577
1032 Ga0501034_0030504 3300049571 Bacteria 5481
1033 Ga0501036_0013958 3300049572 Bacteria 6679
1034 Ga0501038_0015519 3300049574 Bacteria 6924
1035 Ga0501038_0321290 3300049574 Bacteria 1211
1036 Ga0501042_0001499 3300049578 Bacteria 13792
1037 Ga0501043_0026956 3300049579 Bacteria 4509
1038 Ga0501047_0007973 3300049581 Bacteria 9986
1039 Ga0501047_0619187 3300049581 Bacteria 903
1040 Ga0501048_0007396 3300049582 Bacteria 8321
1041 Ga0501074_0000131 3300049590 Bacteria 38492
1042 Ga0501044_0097071 3300049823 Bacteria 2968
1043 Ga0501044_0575698 3300049823 Bacteria 1021
1044 nmdc:mga05p37_281870_c1 3300050507 Bacteria 1981
1045 nmdc:mga05p37_428806_c1 3300050507 Bacteria 1537
1046 nmdc:mga05p37_5557_c1 3300050507 Bacteria 14821
1047 nmdc:mga09592_82282_c1 3300050508 Bacteria 2743
1048 nmdc:mga06r32_247613_c1 3300050510 Bacteria 1770
1049 nmdc:mga08y16_133214_c1 3300050511 Bacteria 2583
1050 nmdc:mga08y16_354509_c1 3300050511 Bacteria 1507
1051 nmdc:mga0n895_1015897_c1 3300050512 Bacteria 810
1052 nmdc:mga0n895_1473240_c1 3300050512 Bacteria 648
1053 nmdc:mga0n895_178154_c1 3300050512 Bacteria 2157
1054 nmdc:mga0n895_192967_c1 3300050512 Bacteria 2068
1055 nmdc:mga0n895_34833_c1 3300050512 Bacteria 4849
1056 nmdc:mga0n895_52873_c1 3300050512 Unclassified 3989
1057 nmdc:mga0n895_594341_c1 3300050512 Unclassified 1110
1058 nmdc:mga0n895_647492_c1 3300050512 Unclassified 1056
1059 nmdc:mga0n895_87229_c1 3300050512 Bacteria 3118
1060 nmdc:mga0rr50_110389_c1 3300050513 Bacteria 2175
1061 nmdc:mga0rr50_1633114_c1 3300050513 Bacteria 544
1062 nmdc:mga0rr50_23525_c1 3300050513 Bacteria 4250
1063 nmdc:mga0rr50_261359_c1 3300050513 Bacteria 1440
1064 nmdc:mga0rr50_30018_c1 3300050513 Bacteria 3843
1065 nmdc:mga0rr50_42924_c1 3300050513 Bacteria 3306
1066 nmdc:mga0rr50_542932_c1 3300050513 Bacteria 990
1067 nmdc:mga0rr50_71005_c1 3300050513 Bacteria 2655
1068 nmdc:mga08x19_169247_c1 3300050514 Bacteria 1488
1069 nmdc:mga08x19_170974_c1 3300050514 Bacteria 1480
1070 nmdc:mga08x19_325655_c1 3300050514 Bacteria 1070
1071 nmdc:mga08x19_387814_c1 3300050514 Unclassified 979
1072 nmdc:mga08x19_587874_c1 3300050514 Bacteria 789
1073 nmdc:mga08x19_81998_c1 3300050514 Bacteria 2119
1074 nmdc:mga08x19_907361_c1 3300050514 Bacteria 626
1075 nmdc:mga0a205_108248_c1 3300050515 Bacteria 2677
1076 nmdc:mga0a205_251256_c1 3300050515 Bacteria 1648
1077 nmdc:mga0a205_950212_c1 3300050515 Bacteria 706
1078 Ga0495601_0025376 3300053077 Bacteria 3654
1079 Ga0495601_0056027 3300053077 Unclassified 2496
1080 Ga0495601_0063959 3300053077 Bacteria 2339
1081 Ga0495601_0401533 3300053077 Bacteria 889
1082 Ga0495601_0495685 3300053077 Bacteria 788
1083 Ga0495612_0002023 3300053078 Bacteria 8357
1084 Ga0495612_0163773 3300053078 Bacteria 972
1085 Ga0495612_0419798 3300053078 Bacteria 609
1086 Ga0495595_0028612 3300053084 Bacteria 2489
1087 Ga0495595_0060876 3300053084 Bacteria 1767
1088 Ga0495595_0097391 3300053084 Bacteria 1417
1089 Ga0495595_0323644 3300053084 Unclassified 776
1090 Ga0495595_0487705 3300053084 Unclassified 628
1091 Ga0495619_0027633 3300053085 Bacteria 3656
1092 Ga0495619_0109402 3300053085 Bacteria 1887
1093 Ga0495619_0135727 3300053085 Unclassified 1692
1094 Ga0495619_0173812 3300053085 Bacteria 1490
1095 Ga0495619_0369461 3300053085 Unclassified 991
1096 Ga0436364_0443873
1097 JGI24737J22298_10202194
1098 JGI25404J52841_10111436
1099 JGI25405J52794_10050403
1100 Ga0070658_10325590
1101 Ga0070683_100071579
1102 Ga0070690_100261540
1103 Ga0068869_100249338
1104 Ga0068869_100382601
1105 Ga0070666_10132316
1106 Ga0070680_100040809
1107 Ga0070682_100006862
1108 Ga0070682_100126140
1109 Ga0068868_100096921
1110 Ga0068868_100192757
1111 Ga0070660_100034963
1112 Ga0070660_100588112
1113 Ga0070660_100794663
1114 Ga0070689_100037639
1115 Ga0070691_10176070
1116 Ga0070691_10491977
1117 Ga0070691_10498447
1118 Ga0070691_11056319
1119 Ga0070687_100089816
1120 Ga0070661_100287572
1121 Ga0070692_10256097
1122 Ga0070669_101421567
1123 Ga0070675_100434325
1124 Ga0070671_100896707
1125 Ga0070674_100013315
1126 Ga0070674_100284529
1127 Ga0070673_100137539
1128 Ga0070673_100941369
1129 Ga0070688_100422401
1130 Ga0070659_100110337
1131 Ga0070659_100951735
1132 Ga0070659_101063261
1133 Ga0070703_10202194
1134 Ga0070709_10001397
1135 Ga0070709_10003711
1136 Ga0070709_10044359
1137 Ga0070709_10105060
1138 Ga0070709_10146431
1139 Ga0070709_10207354
1140 Ga0070709_10408560
1141 Ga0070709_10450323
1142 Ga0070709_10458540
1143 Ga0070709_10562942
1144 Ga0070714_100005398
1145 Ga0070714_100013301
1146 Ga0070714_100013360
1147 Ga0070714_100034957
1148 Ga0070714_100065822
1149 Ga0070714_100094978
1150 Ga0070714_100118336
1151 Ga0070714_100141194
1152 Ga0070714_100172905
1153 Ga0070714_100235439
1154 Ga0070714_100477758
1155 Ga0070714_100549443
1156 Ga0070714_100573081
1157 Ga0070714_100825326
1158 Ga0070714_101802125
1159 Ga0070714_101890711
1160 Ga0070713_100018032
1161 Ga0070713_100022599
1162 Ga0070713_100046970
1163 Ga0070713_100122661
1164 Ga0070713_100175129
1165 Ga0070713_100356809
1166 Ga0070713_100400572
1167 Ga0070713_100440115
1168 Ga0070713_100645885
1169 Ga0070713_100669431
1170 Ga0070713_100872465
1171 Ga0070713_100878916
1172 Ga0070713_100998147
1173 Ga0070713_101050307
1174 Ga0070713_101061029
1175 Ga0070713_101144752
1176 Ga0070713_101289693
1177 Ga0070710_10000564
1178 Ga0070710_10002530
1179 Ga0070710_10011960
1180 Ga0070710_10053545
1181 Ga0070710_10098243
1182 Ga0070710_10136861
1183 Ga0070710_10602762
1184 Ga0070710_10794210
1185 Ga0070710_10852187
1186 Ga0070710_11181783
1187 Ga0070701_10023709
1188 Ga0070711_100003441
1189 Ga0070711_100017642
1190 Ga0070711_100022377
1191 Ga0070711_100025720
1192 Ga0070711_100037053
1193 Ga0070711_100130299
1194 Ga0070711_100226362
1195 Ga0070711_100618905
1196 Ga0070711_101199020
1197 Ga0070705_100109285
1198 Ga0070705_100296538
1199 Ga0070705_100328952
1200 Ga0070705_101874171
1201 Ga0070694_100339191
1202 Ga0070694_101668380
1203 Ga0070708_100013728
1204 Ga0070708_100711925
1205 Ga0070708_100910492
1206 Ga0070708_100939219
1207 Ga0070663_100195979
1208 Ga0070678_101107085
1209 Ga0070678_101138474
1210 Ga0070662_100251265
1211 Ga0070662_100355811
1212 Ga0070662_101214382
1213 Ga0070681_10237959
1214 Ga0068867_100861536
1215 Ga0068867_101947685
1216 Ga0070685_10028813
1217 Ga0070706_100008647
1218 Ga0070706_100017412
1219 Ga0070706_100039718
1220 Ga0070706_100048528
1221 Ga0070706_100107843
1222 Ga0070706_100524806
1223 Ga0070706_100574934
1224 Ga0070706_101570391
1225 Ga0070707_100000261
1226 Ga0070707_100038335
1227 Ga0070707_100068496
1228 Ga0070707_100347573
1229 Ga0070707_100920136
1230 Ga0070707_101753116
1231 Ga0070707_101963678
1232 Ga0070698_100000396
1233 Ga0070698_100001643
1234 Ga0070698_100016840
1235 Ga0070698_100024922
1236 Ga0070698_100068745
1237 Ga0070698_100094289
1238 Ga0070698_100140019
1239 Ga0070698_100181703
1240 Ga0070698_100256605
1241 Ga0070699_100001967
1242 Ga0070699_100613130
1243 Ga0070699_100724894
1244 Ga0070699_100816045
1245 Ga0070699_100857875
1246 Ga0070699_101151406
1247 Ga0070699_101231271
1248 Ga0070679_100358534
1249 Ga0070684_100200460
1250 Ga0070697_100012204
1251 Ga0070697_100042441
1252 Ga0070697_100521785
1253 Ga0070697_102103644
1254 Ga0068853_100066910
1255 Ga0068853_100137020
1256 Ga0068853_100647992
1257 Ga0070672_100459976
1258 Ga0070686_100027795
1259 Ga0070695_100025310
1260 Ga0070695_100574710
1261 Ga0070695_101419058
1262 Ga0070696_100201547
1263 Ga0070696_100273333
1264 Ga0070696_100379342
1265 Ga0070693_100191143
1266 Ga0070693_101156032
1267 Ga0070665_100741309
1268 Ga0070704_100114176
1269 Ga0070704_101762867
1270 Ga0068855_100433543
1271 Ga0068855_101822627
1272 Ga0070664_100046231
1273 Ga0068857_100048065
1274 Ga0068857_100392165
1275 Ga0068854_100117339
1276 Ga0068854_100572322
1277 Ga0068856_100235423
1278 Ga0068856_100313338
1279 Ga0068856_100321485
1280 Ga0068856_102087563
1281 Ga0070702_100025773
1282 Ga0070702_100811235
1283 Ga0068852_100038762
1284 Ga0068859_101011630
1285 Ga0068864_100251702
1286 Ga0068866_10031261
1287 Ga0068861_100189402
1288 Ga0068861_100190141
1289 Ga0068861_101602344
1290 Ga0068870_10067247
1291 Ga0068863_100069818
1292 Ga0068863_101247836
1293 Ga0068863_101287460
1294 Ga0068858_100539887
1295 Ga0068858_101145381
1296 Ga0068858_102132180
1297 Ga0068860_101423109
1298 Ga0068862_100624434
1299 Ga0081455_10021117
1300 Ga0081455_10046999
1301 Ga0081455_10058834
1302 Ga0081455_11065072
1303 Ga0081540_1000089
1304 Ga0081540_1002152
1305 Ga0070717_10001816
1306 Ga0070717_10007042
1307 Ga0070717_10019846
1308 Ga0070717_10022471
1309 Ga0070717_10025987
1310 Ga0070717_10256786
1311 Ga0070717_10435464
1312 Ga0070717_10552894
1313 Ga0070717_11425576
1314 Ga0070717_12106754
1315 Ga0075432_10169055
1316 Ga0070715_10002583
1317 Ga0070715_10044483
1318 Ga0070715_10086220
1319 Ga0070715_10413660
1320 Ga0070716_100000834
1321 Ga0070716_100002733
1322 Ga0070716_100012302
1323 Ga0070716_100019222
1324 Ga0070716_100053890
1325 Ga0070716_100214542
1326 Ga0070716_100235008
1327 Ga0070716_100468701
1328 Ga0070712_100007242
1329 Ga0070712_100061825
1330 Ga0070712_100092124
1331 Ga0070712_100097103
1332 Ga0070712_100120554
1333 Ga0070712_100210162
1334 Ga0070712_100246863
1335 Ga0070712_100452274
1336 Ga0070712_100488579
1337 Ga0070712_100752543
1338 Ga0070712_100814641
1339 Ga0070712_100920157
1340 Ga0070712_100927791
1341 Ga0070712_101760659
1342 Ga0075427_10097858
1343 Ga0097621_100140470
1344 Ga0097621_100267296
1345 Ga0097621_101642473
1346 Ga0068871_100101145
1347 Ga0068871_100774758
1348 Ga0068871_101365541
1349 Ga0075428_100815074
1350 Ga0075430_100090736
1351 Ga0075431_100049882
1352 Ga0075433_10021467
1353 Ga0075433_10242343
1354 Ga0075433_10260193
1355 Ga0075434_100002174
1356 Ga0075434_100059421
1357 Ga0075434_100104542
1358 Ga0075434_100363886
1359 Ga0075434_100375173
1360 Ga0075434_100656034
1361 Ga0075434_101245220
1362 Ga0075429_100196053
1363 Ga0075429_101346626
1364 Ga0068865_100354319
1365 Ga0068865_100500278
1366 Ga0075436_100008768
1367 Ga0075436_100081876
1368 Ga0075436_100147314
1369 Ga0075436_100298394
1370 Ga0075436_100333942
1371 Ga0097620_101011812
1372 Ga0075435_100009069
1373 Ga0075435_100060423
1374 Ga0075435_100067619
1375 Ga0075435_100070450
1376 Ga0075435_100475926
1377 Ga0099794_10595697
1378 Ga0099795_10015744
1379 Ga0105251_10150147
1380 Ga0105244_10334364
1381 Ga0111539_10392236
1382 Ga0105245_10032107
1383 Ga0105245_10228332
1384 Ga0105245_10498876
1385 Ga0105245_11476322
1386 Ga0105247_10139316
1387 Ga0105247_10783028
1388 Ga0114129_10003160
1389 Ga0114129_10876409
1390 Ga0105243_10019200
1391 Ga0105243_10045527
1392 Ga0105243_12359556
1393 Ga0105241_10064387
1394 Ga0105241_10518494
1395 Ga0105241_10851337
1396 Ga0105241_11001701
1397 Ga0105242_10160483
1398 Ga0105242_10281043
1399 Ga0105242_10390723
1400 Ga0105242_10533273
1401 Ga0105242_11027579
1402 Ga0105242_12206200
1403 Ga0105242_12270087
1404 Ga0105248_10545830
1405 Ga0105248_10825769
1406 Ga0105248_11011606
1407 Ga0105237_10542289
1408 Ga0105237_11484501
1409 Ga0105238_10231917
1410 Ga0105238_11359044
1411 Ga0105238_12117322
1412 Ga0105238_12394117
1413 Ga0105249_10035835
1414 Ga0105249_10109249
1415 Ga0105249_10195678
1416 Ga0105249_10228945
1417 Ga0105249_12009361
1418 Ga0099796_10104642
1419 Ga0099796_10108237
1420 Ga0099796_10239135
1421 Ga0105239_10348016
1422 Ga0105239_10354649
1423 Ga0105239_12937993
1424 Ga0105246_11596787
1425 Ga0157337_1003591
1426 Ga0157338_1015828
1427 Ga0157373_10105951
1428 Ga0157373_10546744
1429 Ga0157371_11006655
1430 Ga0157369_10592282
1431 Ga0157369_11008101
1432 Ga0157369_11988091
1433 Ga0157374_10901774
1434 Ga0157374_10956067
1435 Ga0157378_10613305
1436 Ga0157378_11264647
1437 Ga0163162_10025354
1438 Ga0163162_10095780
1439 Ga0163162_11170801
1440 Ga0157372_10155313
1441 Ga0157372_10610925
1442 Ga0157372_10790304
1443 Ga0157375_10596100
1444 Ga0157375_11305286
1445 Ga0157375_11549912
1446 Ga0157375_13373706
1447 Ga0163163_10017694
1448 Ga0157380_10037201
1449 Ga0157380_10157500
1450 Ga0157380_10914601
1451 Ga0157380_13025899
1452 Ga0157380_13548149
1453 Ga0157377_10114505
1454 Ga0157377_11317830
1455 Ga0157379_12148884
1456 Ga0157376_10596496
1457 Ga0157376_11773932
1458 Ga0157376_12336943
1459 Ga0163161_10174487
1460 Ga0163161_10216587
1461 Ga0163161_10278630
1462 Ga0197907_10736962
1463 Ga0206356_10020970
1464 Ga0206354_10041121
1465 Ga0206353_11136400
1466 Ga0213874_10006980
1467 Ga0213876_10116935
1468 Ga0213875_10000778
1469 Ga0213875_10001469
1470 Ga0213875_10025785
1471 Ga0213875_10060985
1472 Ga0213875_10062680
1473 Ga0213875_10067895
1474 Ga0224572_1007442
1475 Ga0228598_1038676
1476 Ga0207653_10022345
1477 Ga0207692_10000710
1478 Ga0207692_10004964
1479 Ga0207692_10005520
1480 Ga0207692_10036978
1481 Ga0207692_10086889
1482 Ga0207692_10276208
1483 Ga0207692_10459583
1484 Ga0207692_10955647
1485 Ga0207642_10105735
1486 Ga0207710_10179231
1487 Ga0207688_10014232
1488 Ga0207680_10025782
1489 Ga0207685_10007255
1490 Ga0207685_10069220
1491 Ga0207685_10228854
1492 Ga0207699_10000150
1493 Ga0207699_10000409
1494 Ga0207699_10003451
1495 Ga0207699_10004294
1496 Ga0207699_10034201
1497 Ga0207699_10413921
1498 Ga0207643_10056250
1499 Ga0207705_11304640
1500 Ga0207684_10001073
1501 Ga0207684_10008615
1502 Ga0207684_10038737
1503 Ga0207684_10055802
1504 Ga0207684_10075263
1505 Ga0207684_10912749
1506 Ga0207654_10102836
1507 Ga0207654_10783197
1508 Ga0207707_10929849
1509 Ga0207671_11249658
1510 Ga0207693_10011623
1511 Ga0207693_10015861
1512 Ga0207693_10081252
1513 Ga0207693_10083300
1514 Ga0207693_10156272
1515 Ga0207693_10171012
1516 Ga0207693_10297972
1517 Ga0207693_10337450
1518 Ga0207693_11048626
1519 Ga0207663_10004946
1520 Ga0207663_10006883
1521 Ga0207663_10008833
1522 Ga0207663_10042210
1523 Ga0207663_10131645
1524 Ga0207663_10380878
1525 Ga0207663_10420863
1526 Ga0207663_10523231
1527 Ga0207663_10984069
1528 Ga0207657_10009239
1529 Ga0207657_10101950
1530 Ga0207649_10326005
1531 Ga0207652_10341711
1532 Ga0207652_11485441
1533 Ga0207646_10001025
1534 Ga0207646_10001028
1535 Ga0207646_10041799
1536 Ga0207646_10376086
1537 Ga0207646_10927125
1538 Ga0207646_11410661
1539 Ga0207694_11079589
1540 Ga0207659_10032251
1541 Ga0207659_10667457
1542 Ga0207687_10484030
1543 Ga0207687_10638932
1544 Ga0207687_10864892
1545 Ga0207700_10000935
1546 Ga0207700_10002068
1547 Ga0207700_10008073
1548 Ga0207700_10010239
1549 Ga0207700_10123749
1550 Ga0207700_10182259
1551 Ga0207700_10208025
1552 Ga0207700_10340830
1553 Ga0207700_10553498
1554 Ga0207700_11321841
1555 Ga0207664_10001780
1556 Ga0207664_10002171
1557 Ga0207664_10017089
1558 Ga0207664_10026003
1559 Ga0207664_10031593
1560 Ga0207664_10131497
1561 Ga0207664_10214388
1562 Ga0207664_10259799
1563 Ga0207664_10539055
1564 Ga0207664_10656500
1565 Ga0207664_10750446
1566 Ga0207664_10817055
1567 Ga0207664_10878115
1568 Ga0207664_11015707
1569 Ga0207664_11047209
1570 Ga0207664_11192723
1571 Ga0207664_11569227
1572 Ga0207644_10351908
1573 Ga0207644_11878974
1574 Ga0207690_10391829
1575 Ga0207690_10502797
1576 Ga0207706_10010344
1577 Ga0207706_10287960
1578 Ga0207706_10437705
1579 Ga0207686_10223961
1580 Ga0207686_10653180
1581 Ga0207686_10794626
1582 Ga0207686_11015274
1583 Ga0207709_10093308
1584 Ga0207709_10128173
1585 Ga0207670_10720209
1586 Ga0207704_10130470
1587 Ga0207704_10378582
1588 Ga0207665_10001548
1589 Ga0207665_10001912
1590 Ga0207665_10017852
1591 Ga0207665_10027812
1592 Ga0207665_10047675
1593 Ga0207665_10047865
1594 Ga0207665_10499802
1595 Ga0207665_11145711
1596 Ga0207665_11173366
1597 Ga0207691_10186810
1598 Ga0207711_10168246
1599 Ga0207711_10548560
1600 Ga0207689_10000637
1601 Ga0207689_10138779
1602 Ga0207679_10163772
1603 Ga0207679_11483547
1604 Ga0207667_10368194
1605 Ga0207667_11496347
1606 Ga0207667_11559416
1607 Ga0207651_10317262
1608 Ga0207712_10429894
1609 Ga0207712_10624965
1610 Ga0207712_11671436
1611 Ga0207668_10302392
1612 Ga0207668_11938172
1613 Ga0207640_10178470
1614 Ga0207640_10972833
1615 Ga0207640_11056627
1616 Ga0207658_10698510
1617 Ga0207677_11627766
1618 Ga0207703_11570746
1619 Ga0207639_10106209
1620 Ga0207639_10258384
1621 Ga0207678_10031219
1622 Ga0207708_10187270
1623 Ga0207702_10135659
1624 Ga0207702_10170922
1625 Ga0207702_10477887
1626 Ga0207641_10652680
1627 Ga0207648_10603787
1628 Ga0207648_11022060
1629 Ga0207674_10346472
1630 Ga0207675_100003528
1631 Ga0207675_100232528
1632 Ga0207683_10029746
1633 Ga0207683_10033055
1634 Ga0207698_10789153
1635 Ga0207698_11601873
1636 Ga0207428_10668051
1637 Ga0268264_10502172
1638 Ga0265336_10044462
1639 Ga0265338_10007034
1640 Ga0265777_114550
1641 Ga0265765_1052407
1642 Ga0265760_10111565
1643 Ga0265760_10274613
1644 Ga0307513_10407775
1645 Ga0307409_100108617
1646 Ga0307416_100632906
1647 Ga0373948_0060942
1648 Ga0373950_0137905
1649 Ga0373959_0041606
1650 Ga0373959_0104786
1651 Ga0373959_0125544
1652 Ga0373938_0034390
1653 Ga0373926_0004896
1654 Ga0373926_0220167
1655 Ga0373928_0016328
1656 Ga0373934_0016134
1657 Ga0373934_0100681
1658 Ga0373934_0277830
1659 Ga0373940_0046305
1660 Ga0373940_0155295
1661 Ga0373944_0060465
1662 Ga0373944_0160943
1663 Ga0373949_0042471
1664 Ga0373951_0036488
1665 Ga0373952_0036525
1666 Ga0373952_0212019
1667 Ga0373923_0009757
1668 Ga0373923_0012459
1669 Ga0373923_0043802
1670 Ga0373923_0513211
1671 Ga0373932_0002043
1672 Ga0373932_0098947
1673 Ga0373936_0005671
1674 Ga0373936_0015057
1675 Ga0373936_0019677
1676 Ga0373939_0008703
1677 Ga0373939_0035465
1678 Ga0373939_0225473
1679 Ga0373941_0132624
1680 Ga0373945_0000857
1681 Ga0373945_0023253
1682 Ga0373945_0316906
1683 Ga0373945_0385135
1684 Ga0373953_0001440
1685 Ga0373953_0066337
1686 Ga0373953_0307196
1687 Ga0373954_0040317
1688 Ga0373954_0049363
1689 Ga0373954_0433238
1690 Ga0373956_0010874
1691 Ga0373956_0041268
1692 Ga0373956_0123017
1693 Ga0373956_0183982
1694 Ga0373956_0222512
1695 Ga0373957_0000395
1696 Ga0373957_0064997
1697 Ga0373957_0294393
1698 Ga0373957_0295714
1699 Ga0373957_0486632
1700 Ga0373960_0026252
1701 Ga0373960_0064645
1702 Ga0373960_0157632
1703 Ga0373943_0010787
1704 Ga0373943_0105732
1705 Ga0373943_0115711
1706 Ga0373943_0161921
1707 Ga0373943_0957198
1708 Ga0373946_0007574
1709 Ga0373946_0244551
1710 Ga0373955_0006906
1711 Ga0373955_0087325
1712 Ga0373955_0192919
1713 Ga0373955_0217215
1714 Ga0373955_0612365
1715 Ga0373955_1001435
1716 Ga0373942_0003432
1717 Ga0373942_0063436
1718 Ga0373961_0007728
1719 Ga0373961_0032347
1720 Ga0373961_0066038
1721 Ga0373962_0024534
1722 Ga0373962_0024678
1723 Ga0373962_0297724
1724 Ga0373924_0016147
1725 Ga0373924_0019354
1726 Ga0373924_0044595
1727 Ga0373924_0438091
1728 Ga0373931_0005023
1729 Ga0373931_0007023
1730 Ga0373931_0120410
1731 Ga0373931_0138730
1732 Ga0373931_0531873
1733 Ga0373931_0634663
1734 Ga0373935_0021843
1735 Ga0373935_0022631
1736 Ga0373935_0126102
1737 Ga0373935_0157726
1738 Ga0373935_0281125
1739 Ga0373935_0563822
1740 Ga0373935_0634342
1741 Ga0373935_0665669
1742 Ga0373927_0007575
1743 Ga0373927_0097977
1744 Ga0373927_0155042
1745 Ga0373927_0740895
1746 Ga0373933_0003771
1747 Ga0373933_0008292
1748 Ga0373933_0009211
1749 Ga0373933_0012435
1750 Ga0373933_0121146
1751 Ga0373933_0314095
1752 Ga0373933_0318605
1753 Ga0373933_0478285
1754 Ga0373933_0654484
1755 Ga0373947_0004813
1756 Ga0373947_0025467
1757 Ga0373947_0027635
1758 Ga0373947_0114431
1759 Ga0373947_0475185
1760 Ga0373947_0667643
1761 Ga0373947_0708974
1762 Ga0373937_0004787
1763 Ga0373937_0019543
1764 Ga0373937_0042732
1765 Ga0373937_0043353
1766 Ga0373937_0209103
1767 Ga0373937_0248247
1768 Ga0373937_0528675
1769 Ga0373925_0006165
1770 Ga0373925_0030042
1771 Ga0373925_0040068
1772 Ga0373925_0100518
1773 Ga0373925_0144386
1774 Ga0373925_0480922
1775 Ga0373925_0921331
1776 Ga0373925_1021646
1777 Ga0373925_1710896
1778 Ga0436364_0105925
1779 Ga0436364_0377973
1780 Ga0436364_0679842
1781 Ga0436364_1006315
1782 Ga0436364_1177344
1783 Ga0436364_1305843
1784 Ga0436364_1383024
1785 Ga0436364_1401376
1786 Ga0436365_0303082
1787 Ga0436365_0768004
1788 Ga0436360_0269636
1789 Ga0436360_0622341
1790 Ga0436361_0346318
1791 Ga0436363_0070686
1792 Ga0436363_1072037
1793 Ga0436363_1532046
1794 Ga0436363_1600052
1795 Ga0466963_0567570
1796 Ga0466957_0154636
1797 Ga0466957_0750243
1798 Ga0466959_0743012
1799 Ga0466959_1003874
1800 Ga0466958_0335282
1801 Ga0466958_0405013
1802 Ga0466967_0003373
1803 Ga0466967_1056694
1804 Ga0466967_1979044
1805 Ga0495592_0043709
1806 Ga0495592_0049681
1807 Ga0495592_0066530
1808 Ga0495592_0198939
1809 Ga0495603_0001884
1810 Ga0495603_0016821
1811 Ga0495603_0039723
1812 Ga0495603_0487476
1813 Ga0495629_0002427
1814 Ga0495629_0013068
1815 Ga0495629_0076352
1816 Ga0495629_0343383
1817 Ga0495629_0839706
1818 Ga0495641_0005488
1819 Ga0495641_0007308
1820 Ga0495641_0058474
1821 Ga0495641_0103798
1822 Ga0495641_0240700
1823 Ga0495641_0355878
1824 Ga0495651_0001931
1825 Ga0495651_0016617
1826 Ga0495651_0029872
1827 Ga0495651_0033587
1828 Ga0495651_0045262
1829 Ga0495651_0049114
1830 Ga0495651_0182644
1831 Ga0495653_0006982
1832 Ga0495653_0014251
1833 Ga0495653_0020561
1834 Ga0495653_0103196
1835 Ga0495653_0132000
1836 Ga0495653_0175537
1837 Ga0495653_0593515
1838 Ga0495653_0907430
1839 Ga0495580_0006966
1840 Ga0495580_0009215
1841 Ga0495580_0365004
1842 Ga0495582_0002516
1843 Ga0495582_0006049
1844 Ga0495582_0039320
1845 Ga0495582_0056608
1846 Ga0495582_0746379
1847 Ga0495639_0001397
1848 Ga0495639_0034558
1849 Ga0495639_0156267
1850 Ga0495662_0004842
1851 Ga0495662_0005405
1852 Ga0495662_0054148
1853 Ga0495664_0001454
1854 Ga0495664_0029636
1855 Ga0495664_0051629
1856 Ga0495664_0062254
1857 Ga0495664_0205015
1858 Ga0495664_0296910
1859 Ga0495664_0516619
1860 Ga0495664_0862793
1861 Ga0495664_0874113
1862 Ga0495585_0568439
1863 Ga0495594_0038259
1864 Ga0495594_0295108
1865 Ga0495594_0467370
1866 Ga0495608_0013803
1867 Ga0495608_0038855
1868 Ga0495608_0045323
1869 Ga0495608_0047249
1870 Ga0495608_0165064
1871 Ga0495608_0290401
1872 Ga0495618_0014069
1873 Ga0495618_0045208
1874 Ga0495618_0101216
1875 Ga0495618_0437177
1876 Ga0495618_0453110
1877 Ga0495628_0043904
1878 Ga0495628_0157921
1879 Ga0495628_0395377
1880 Ga0495628_0851393
1881 Ga0495630_0007894
1882 Ga0495630_0008368
1883 Ga0495630_0045139
1884 Ga0495630_0054253
1885 Ga0495630_0073679
1886 Ga0495630_0276169
1887 Ga0495630_0496375
1888 Ga0495666_0004981
1889 Ga0495666_0121301
1890 Ga0495666_0141036
1891 Ga0495652_0038079
1892 Ga0495652_0187607
1893 Ga0495652_0214883
1894 Ga0495652_0226750
1895 Ga0495652_0359950
1896 Ga0495652_0418654
1897 Ga0495652_0452665
1898 Ga0495652_0479880
1899 Ga0495652_0641625
1900 Ga0495652_0817250
1901 Ga0495652_1034761
1902 Ga0495665_0039083
1903 Ga0495665_0043227
1904 Ga0495665_0083604
1905 Ga0495665_0161966
1906 Ga0495665_0185388
1907 Ga0495640_0011299
1908 Ga0495640_0030403
1909 Ga0495640_0035817
1910 Ga0495640_0044795
1911 Ga0495640_0507840
1912 Ga0495586_0080183
1913 Ga0495586_0131097
1914 Ga0495586_0226551
1915 Ga0495586_0567474
1916 Ga0495587_0005768
1917 Ga0495587_0009878
1918 Ga0495587_0037601
1919 Ga0495587_0232225
1920 Ga0495587_0234689
1921 Ga0495645_0061367
1922 Ga0495645_0099890
1923 Ga0495645_0145931
1924 Ga0495645_0385621
1925 Ga0495645_0862572
1926 Ga0495622_0063965
1927 Ga0495667_0001128
1928 Ga0495667_0002989
1929 Ga0495667_0013187
1930 Ga0495667_0036410
1931 Ga0495667_0126551
1932 Ga0495667_0131551
1933 Ga0495667_0926346
1934 Ga0495656_0054356
1935 Ga0495656_0546682
1936 Ga0495634_0018598
1937 Ga0495634_0022260
1938 Ga0495634_0196835
1939 Ga0495634_0214396
1940 Ga0495634_0590870
1941 Ga0495635_0003541
1942 Ga0495635_0011673
1943 Ga0495635_0015907
1944 Ga0495635_0072084
1945 Ga0495635_0142258
1946 Ga0495635_0146243
1947 Ga0495635_0732528
1948 Ga0495588_0656516
1949 Ga0495657_0013621
1950 Ga0495657_0013795
1951 Ga0495657_0029482
1952 Ga0495657_0043047
1953 Ga0495657_0057990
1954 Ga0495657_0134572
1955 Ga0495599_0007731
1956 Ga0495599_0084819
1957 Ga0495599_0120858
1958 Ga0495623_0026081
1959 Ga0495623_0033379
1960 Ga0495623_0069692
1961 Ga0495623_0559007
1962 Ga0495646_0014834
1963 Ga0495646_0039940
1964 Ga0495646_0337090
1965 Ga0495646_0695396
1966 Ga0495647_0002984
1967 Ga0495647_0043419
1968 Ga0495647_0300136
1969 Ga0495658_0007556
1970 Ga0495658_0023564
1971 Ga0495658_0079429
1972 Ga0495658_0140515
1973 Ga0495658_0357199
1974 Ga0495658_0770177
1975 Ga0495613_0010937
1976 Ga0495613_0040395
1977 Ga0495613_0302208
1978 Ga0495624_0041428
1979 Ga0495624_0045325
1980 Ga0495624_0075697
1981 Ga0495624_0251814
1982 Ga0495670_0287547
1983 Ga0495600_0007024
1984 Ga0495600_0009905
1985 Ga0495600_0029377
1986 Ga0495600_0462237
1987 Ga0495600_0518791
1988 Ga0495581_0001789
1989 Ga0495581_0006628
1990 Ga0495581_0020589
1991 Ga0495581_0033225
1992 Ga0495604_0006908
1993 Ga0495604_0011917
1994 Ga0495604_0014246
1995 Ga0495604_0055234
1996 Ga0495604_0111258
1997 Ga0495604_0220828
1998 Ga0495604_1044164
1999 Ga0495674_0037957
2000 Ga0495674_0091354
2001 Ga0495674_0175002
2002 Ga0495674_0246110
2003 Ga0495674_0417424
2004 Ga0495674_0474938
2005 Ga0495674_0547662
2006 Ga0495674_0748817
2007 Ga0495674_0869235
2008 Ga0495674_1092874
2009 Ga0495674_1209162
2010 Ga0495676_0019767
2011 Ga0495676_0023723
2012 Ga0495676_0080861
2013 Ga0495676_0200289
2014 Ga0495676_0400440
2015 Ga0495676_0434099
2016 Ga0495676_0441943
2017 Ga0495680_0005813
2018 Ga0495680_0007024
2019 Ga0495680_0008161
2020 Ga0495680_0012284
2021 Ga0495680_0025800
2022 Ga0495680_0039127
2023 Ga0495680_0291150
2024 Ga0495680_0623993
2025 Ga0495680_0732845
2026 Ga0495675_0012751
2027 Ga0495675_0013817
2028 Ga0495675_0022321
2029 Ga0495675_0099302
2030 Ga0495675_0170925
2031 Ga0495684_0008155
2032 Ga0495684_0013873
2033 Ga0495684_0021270
2034 Ga0495684_0027462
2035 Ga0495684_0043023
2036 Ga0495684_0107490
2037 Ga0495684_0227390
2038 Ga0495684_0328927
2039 Ga0495684_0471291
2040 Ga0495593_0002377
2041 Ga0495593_0004968
2042 Ga0495593_0035071
2043 Ga0495593_0044899
2044 Ga0495602_0054740
2045 Ga0495602_0099899
2046 Ga0495602_0111751
2047 Ga0495602_0117041
2048 Ga0495602_0135452
2049 Ga0495602_0480664
2050 Ga0495602_1148917
2051 Ga0495614_0024138
2052 Ga0495614_0253699
2053 Ga0495614_0507508
2054 Ga0496100_0160498
2055 Ga0496100_0192929
2056 Ga0496100_0263269
2057 Ga0496100_1621281
2058 Ga0496101_0030527
2059 Ga0496101_0064367
2060 Ga0496101_0352028
2061 Ga0496101_0665505
2062 Ga0496102_0088723
2063 Ga0496102_0119224
2064 Ga0496102_0292786
2065 Ga0496102_0298910
2066 Ga0496102_0307783
2067 Ga0496103_0017239
2068 Ga0496103_0201743
2069 Ga0496103_0339444
2070 Ga0496104_0005558
2071 Ga0496104_0012036
2072 Ga0496104_0553161
2073 Ga0496104_1366231
2074 Ga0496104_1406913
2075 Ga0496105_0001173
2076 Ga0496105_0001930
2077 Ga0496105_0016692
2078 Ga0496105_0790005
2079 Ga0496105_1072199
2080 Ga0496106_0053070
2081 Ga0496106_0161806
2082 Ga0496106_0167631
2083 Ga0496106_0283453
2084 Ga0496106_1012401
2085 Ga0496107_0030892
2086 Ga0496107_0560711
2087 Ga0496107_0673765
2088 Ga0496107_0957028
2089 Ga0496107_0969630
2090 Ga0496107_1073144
2091 Ga0496108_0043675
2092 Ga0496108_0127846
2093 Ga0496108_0232051
2094 Ga0496108_0407957
2095 Ga0496108_1178587
2096 Ga0496108_1311530
2097 Ga0496109_0030550
2098 Ga0496109_0138031
2099 Ga0496109_0276437
2100 Ga0496109_0540341
2101 Ga0496109_1196981
2102 Ga0496110_0254655
2103 Ga0496110_0355769
2104 Ga0496110_0632246
2105 Ga0496110_0735396
2106 Ga0496111_0067859
2107 Ga0496111_0224570
2108 Ga0496112_0125053
2109 Ga0496112_0142017
2110 Ga0496112_0221523
2111 Ga0496113_0035625
2112 Ga0496113_0107297
2113 Ga0496113_0226392
2114 Ga0496113_0229378
2115 Ga0496113_0392809
2116 Ga0496114_0004915
2117 Ga0496114_0005249
2118 Ga0496114_0021533
2119 Ga0496114_0988059
2120 Ga0496115_0001816
2121 Ga0496115_0004006
2122 Ga0496115_0063941
2123 Ga0496115_0082329
2124 Ga0496115_1152863
2125 Ga0496126_0804144
2126 Ga0496126_1140488
2127 Ga0501034_0030504
2128 Ga0501036_0013958
2129 Ga0501038_0015519
2130 Ga0501038_0321290
2131 Ga0501042_0001499
2132 Ga0501043_0026956
2133 Ga0501047_0007973
2134 Ga0501047_0619187
2135 Ga0501048_0007396
2136 Ga0501074_0000131
2137 Ga0501044_0097071
2138 Ga0501044_0575698
2139 nmdc:mga05p37_281870_c1
2140 nmdc:mga05p37_428806_c1
2141 nmdc:mga05p37_5557_c1
2142 nmdc:mga09592_82282_c1
2143 nmdc:mga06r32_247613_c1
2144 nmdc:mga08y16_133214_c1
2145 nmdc:mga08y16_354509_c1
2146 nmdc:mga0n895_1015897_c1
2147 nmdc:mga0n895_1473240_c1
2148 nmdc:mga0n895_178154_c1
2149 nmdc:mga0n895_192967_c1
2150 nmdc:mga0n895_34833_c1
2151 nmdc:mga0n895_52873_c1
2152 nmdc:mga0n895_594341_c1
2153 nmdc:mga0n895_647492_c1
2154 nmdc:mga0n895_87229_c1
2155 nmdc:mga0rr50_110389_c1
2156 nmdc:mga0rr50_1633114_c1
2157 nmdc:mga0rr50_23525_c1
2158 nmdc:mga0rr50_261359_c1
2159 nmdc:mga0rr50_30018_c1
2160 nmdc:mga0rr50_42924_c1
2161 nmdc:mga0rr50_542932_c1
2162 nmdc:mga0rr50_71005_c1
2163 nmdc:mga08x19_169247_c1
2164 nmdc:mga08x19_170974_c1
2165 nmdc:mga08x19_325655_c1
2166 nmdc:mga08x19_387814_c1
2167 nmdc:mga08x19_587874_c1
2168 nmdc:mga08x19_81998_c1
2169 nmdc:mga08x19_907361_c1
2170 nmdc:mga0a205_108248_c1
2171 nmdc:mga0a205_251256_c1
2172 nmdc:mga0a205_950212_c1
2173 Ga0495601_0025376
2174 Ga0495601_0056027
2175 Ga0495601_0063959
2176 Ga0495601_0401533
2177 Ga0495601_0495685
2178 Ga0495612_0002023
2179 Ga0495612_0163773
2180 Ga0495612_0419798
2181 Ga0495595_0028612
2182 Ga0495595_0060876
2183 Ga0495595_0097391
2184 Ga0495595_0323644
2185 Ga0495595_0487705
2186 Ga0495619_0027633
2187 Ga0495619_0109402
2188 Ga0495619_0135727
2189 Ga0495619_0173812
2190 Ga0495619_0369461

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03459

TOBE

TOBE domain

16

78

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h9s-assembly1.cif.gz_B molybdate bound complex of dimop domain of mode from e.coli 0.9465 7 55
1b9m-assembly1.cif.gz_A regulator from escherichia coli 0.9323 7 55
1b9n-assembly1.cif.gz_B regulator from escherichia coli 0.9319 7 55
7ur8-assembly1.cif.gz_A 170_h_ob, a small beta-barrel de novo designed protein 0.931 7 55
7kmy-assembly4.cif.gz_M structure of mtb lpd bound to 010705 0.9215 11 38
ID Description Score Start End Superfamily
af_P9WQM1_268_326_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9605 7 56 2.40.50.140
af_Q2G1F0_304_346_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9371 11 41 2.40.50.140
af_A0A0R0G2M3_144_398_3.30.70.1990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.917 11 38 3.30.70.1990
af_P09833_289_351_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9157 2 64 2.40.50.100
1gunB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9155 2 67 2.40.50.100
ID Description Score Start End GO Terms
AF-Q1N2B9-F1-model_v4 Molybdenum ABC transporter, ATP-binding protein 0.9965 7 59 GO:0005524
GO:0005886
GO:0015689
GO:0016887
AF-A0A7C2KUB8-F1-model_v4 Transporter 0.9963 7 59 GO:0015689
AF-A0A7Y0Q7P7-F1-model_v4 Molybdenum ABC transporter ATP-binding protein 0.9959 7 59 GO:0005524
GO:0005886
GO:0015098
GO:0016887
GO:0140359
AF-A0A690UZ41-F1-model_v4 Molybdenum-pterin-binding protein 0.9943 11 52
AF-A0A1Y3A1X4-F1-model_v4 Mop domain-containing protein 0.9935 7 55 GO:0015689

Map