F489957
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1095 | 334 | 2190 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0443873|Ga0436364_0443873_232_480 |
| Length | 82 |
| Sequence | MSTMSAIVAGDFVMQLSARNQIPARVTGINAGEAIANVELDAAGVRLVASITVEAVRQLGLAEGSEVTAVIKASDVILAVPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 112 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 135 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.48 |
| Rhizosphere | 91.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0443873 | 3300037853 | Unclassified | 929 |
| 2 | JGI24737J22298_10202194 | 3300001990 | Unclassified | 586 |
| 3 | JGI25404J52841_10111436 | 3300003659 | Bacteria | 575 |
| 4 | JGI25405J52794_10050403 | 3300003911 | Bacteria | 891 |
| 5 | Ga0070658_10325590 | 3300005327 | Bacteria | 1313 |
| 6 | Ga0070683_100071579 | 3300005329 | Bacteria | 3235 |
| 7 | Ga0070690_100261540 | 3300005330 | Bacteria | 1228 |
| 8 | Ga0068869_100249338 | 3300005334 | Bacteria | 1417 |
| 9 | Ga0068869_100382601 | 3300005334 | Bacteria | 1154 |
| 10 | Ga0070666_10132316 | 3300005335 | Bacteria | 1734 |
| 11 | Ga0070680_100040809 | 3300005336 | Bacteria | 3760 |
| 12 | Ga0070682_100006862 | 3300005337 | Bacteria | 6396 |
| 13 | Ga0070682_100126140 | 3300005337 | Bacteria | 1725 |
| 14 | Ga0068868_100096921 | 3300005338 | Bacteria | 2383 |
| 15 | Ga0068868_100192757 | 3300005338 | Bacteria | 1695 |
| 16 | Ga0070660_100034963 | 3300005339 | Bacteria | 3800 |
| 17 | Ga0070660_100588112 | 3300005339 | Bacteria | 930 |
| 18 | Ga0070660_100794663 | 3300005339 | Unclassified | 796 |
| 19 | Ga0070689_100037639 | 3300005340 | Bacteria | 3699 |
| 20 | Ga0070691_10176070 | 3300005341 | Bacteria | 1111 |
| 21 | Ga0070691_10491977 | 3300005341 | Unclassified | 707 |
| 22 | Ga0070691_10498447 | 3300005341 | Unclassified | 703 |
| 23 | Ga0070691_11056319 | 3300005341 | Bacteria | 509 |
| 24 | Ga0070687_100089816 | 3300005343 | Bacteria | 1696 |
| 25 | Ga0070661_100287572 | 3300005344 | Bacteria | 1277 |
| 26 | Ga0070692_10256097 | 3300005345 | Bacteria | 1050 |
| 27 | Ga0070669_101421567 | 3300005353 | Unclassified | 602 |
| 28 | Ga0070675_100434325 | 3300005354 | Bacteria | 1176 |
| 29 | Ga0070671_100896707 | 3300005355 | Bacteria | 774 |
| 30 | Ga0070674_100013315 | 3300005356 | Bacteria | 5081 |
| 31 | Ga0070674_100284529 | 3300005356 | Bacteria | 1312 |
| 32 | Ga0070673_100137539 | 3300005364 | Bacteria | 2058 |
| 33 | Ga0070673_100941369 | 3300005364 | Bacteria | 802 |
| 34 | Ga0070688_100422401 | 3300005365 | Unclassified | 991 |
| 35 | Ga0070659_100110337 | 3300005366 | Bacteria | 2220 |
| 36 | Ga0070659_100951735 | 3300005366 | Unclassified | 752 |
| 37 | Ga0070659_101063261 | 3300005366 | Unclassified | 712 |
| 38 | Ga0070703_10202194 | 3300005406 | Bacteria | 780 |
| 39 | Ga0070709_10001397 | 3300005434 | Bacteria | 13118 |
| 40 | Ga0070709_10003711 | 3300005434 | Bacteria | 8208 |
| 41 | Ga0070709_10044359 | 3300005434 | Unclassified | 2753 |
| 42 | Ga0070709_10105060 | 3300005434 | Bacteria | 1888 |
| 43 | Ga0070709_10146431 | 3300005434 | Unclassified | 1628 |
| 44 | Ga0070709_10207354 | 3300005434 | Bacteria | 1391 |
| 45 | Ga0070709_10408560 | 3300005434 | Unclassified | 1015 |
| 46 | Ga0070709_10450323 | 3300005434 | Bacteria | 970 |
| 47 | Ga0070709_10458540 | 3300005434 | Bacteria | 961 |
| 48 | Ga0070709_10562942 | 3300005434 | Bacteria | 873 |
| 49 | Ga0070714_100005398 | 3300005435 | Bacteria | 9757 |
| 50 | Ga0070714_100013301 | 3300005435 | Bacteria | 6593 |
| 51 | Ga0070714_100013360 | 3300005435 | Bacteria | 6581 |
| 52 | Ga0070714_100034957 | 3300005435 | Bacteria | 4209 |
| 53 | Ga0070714_100065822 | 3300005435 | Bacteria | 3122 |
| 54 | Ga0070714_100094978 | 3300005435 | Bacteria | 2617 |
| 55 | Ga0070714_100118336 | 3300005435 | Bacteria | 2354 |
| 56 | Ga0070714_100141194 | 3300005435 | Bacteria | 2162 |
| 57 | Ga0070714_100172905 | 3300005435 | Bacteria | 1961 |
| 58 | Ga0070714_100235439 | 3300005435 | Bacteria | 1688 |
| 59 | Ga0070714_100477758 | 3300005435 | Bacteria | 1186 |
| 60 | Ga0070714_100549443 | 3300005435 | Bacteria | 1105 |
| 61 | Ga0070714_100573081 | 3300005435 | Bacteria | 1082 |
| 62 | Ga0070714_100825326 | 3300005435 | Unclassified | 898 |
| 63 | Ga0070714_101802125 | 3300005435 | Unclassified | 598 |
| 64 | Ga0070714_101890711 | 3300005435 | Bacteria | 582 |
| 65 | Ga0070713_100018032 | 3300005436 | Bacteria | 5359 |
| 66 | Ga0070713_100022599 | 3300005436 | Bacteria | 4862 |
| 67 | Ga0070713_100046970 | 3300005436 | Bacteria | 3546 |
| 68 | Ga0070713_100122661 | 3300005436 | Bacteria | 2281 |
| 69 | Ga0070713_100175129 | 3300005436 | Bacteria | 1925 |
| 70 | Ga0070713_100356809 | 3300005436 | Bacteria | 1357 |
| 71 | Ga0070713_100400572 | 3300005436 | Bacteria | 1282 |
| 72 | Ga0070713_100440115 | 3300005436 | Bacteria | 1223 |
| 73 | Ga0070713_100645885 | 3300005436 | Bacteria | 1007 |
| 74 | Ga0070713_100669431 | 3300005436 | Bacteria | 989 |
| 75 | Ga0070713_100872465 | 3300005436 | Bacteria | 865 |
| 76 | Ga0070713_100878916 | 3300005436 | Bacteria | 861 |
| 77 | Ga0070713_100998147 | 3300005436 | Unclassified | 807 |
| 78 | Ga0070713_101050307 | 3300005436 | Bacteria | 786 |
| 79 | Ga0070713_101061029 | 3300005436 | Bacteria | 782 |
| 80 | Ga0070713_101144752 | 3300005436 | Bacteria | 752 |
| 81 | Ga0070713_101289693 | 3300005436 | Bacteria | 708 |
| 82 | Ga0070710_10000564 | 3300005437 | Bacteria | 17572 |
| 83 | Ga0070710_10002530 | 3300005437 | Bacteria | 8676 |
| 84 | Ga0070710_10011960 | 3300005437 | Bacteria | 4301 |
| 85 | Ga0070710_10053545 | 3300005437 | Bacteria | 2274 |
| 86 | Ga0070710_10098243 | 3300005437 | Bacteria | 1739 |
| 87 | Ga0070710_10136861 | 3300005437 | Bacteria | 1498 |
| 88 | Ga0070710_10602762 | 3300005437 | Bacteria | 765 |
| 89 | Ga0070710_10794210 | 3300005437 | Unclassified | 676 |
| 90 | Ga0070710_10852187 | 3300005437 | Bacteria | 654 |
| 91 | Ga0070710_11181783 | 3300005437 | Bacteria | 565 |
| 92 | Ga0070701_10023709 | 3300005438 | Bacteria | 2960 |
| 93 | Ga0070711_100003441 | 3300005439 | Bacteria | 9220 |
| 94 | Ga0070711_100017642 | 3300005439 | Bacteria | 4547 |
| 95 | Ga0070711_100022377 | 3300005439 | Bacteria | 4097 |
| 96 | Ga0070711_100025720 | 3300005439 | Bacteria | 3853 |
| 97 | Ga0070711_100037053 | 3300005439 | Bacteria | 3271 |
| 98 | Ga0070711_100130299 | 3300005439 | Bacteria | 1872 |
| 99 | Ga0070711_100226362 | 3300005439 | Bacteria | 1456 |
| 100 | Ga0070711_100618905 | 3300005439 | Bacteria | 905 |
| 101 | Ga0070711_101199020 | 3300005439 | Bacteria | 656 |
| 102 | Ga0070705_100109285 | 3300005440 | Bacteria | 1763 |
| 103 | Ga0070705_100296538 | 3300005440 | Bacteria | 1156 |
| 104 | Ga0070705_100328952 | 3300005440 | Bacteria | 1106 |
| 105 | Ga0070705_101874171 | 3300005440 | Unclassified | 510 |
| 106 | Ga0070694_100339191 | 3300005444 | Bacteria | 1161 |
| 107 | Ga0070694_101668380 | 3300005444 | Bacteria | 542 |
| 108 | Ga0070708_100013728 | 3300005445 | Bacteria | 6644 |
| 109 | Ga0070708_100711925 | 3300005445 | Bacteria | 945 |
| 110 | Ga0070708_100910492 | 3300005445 | Unclassified | 826 |
| 111 | Ga0070708_100939219 | 3300005445 | Unclassified | 811 |
| 112 | Ga0070663_100195979 | 3300005455 | Bacteria | 1574 |
| 113 | Ga0070678_101107085 | 3300005456 | Unclassified | 731 |
| 114 | Ga0070678_101138474 | 3300005456 | Bacteria | 722 |
| 115 | Ga0070662_100251265 | 3300005457 | Bacteria | 1422 |
| 116 | Ga0070662_100355811 | 3300005457 | Bacteria | 1200 |
| 117 | Ga0070662_101214382 | 3300005457 | Unclassified | 648 |
| 118 | Ga0070681_10237959 | 3300005458 | Unclassified | 1734 |
| 119 | Ga0068867_100861536 | 3300005459 | Unclassified | 812 |
| 120 | Ga0068867_101947685 | 3300005459 | Bacteria | 555 |
| 121 | Ga0070685_10028813 | 3300005466 | Bacteria | 3080 |
| 122 | Ga0070706_100008647 | 3300005467 | Bacteria | 9488 |
| 123 | Ga0070706_100017412 | 3300005467 | Bacteria | 6631 |
| 124 | Ga0070706_100039718 | 3300005467 | Bacteria | 4343 |
| 125 | Ga0070706_100048528 | 3300005467 | Bacteria | 3918 |
| 126 | Ga0070706_100107843 | 3300005467 | Bacteria | 2591 |
| 127 | Ga0070706_100524806 | 3300005467 | Bacteria | 1101 |
| 128 | Ga0070706_100574934 | 3300005467 | Bacteria | 1048 |
| 129 | Ga0070706_101570391 | 3300005467 | Bacteria | 601 |
| 130 | Ga0070707_100000261 | 3300005468 | Bacteria | 52696 |
| 131 | Ga0070707_100038335 | 3300005468 | Bacteria | 4577 |
| 132 | Ga0070707_100068496 | 3300005468 | Bacteria | 3416 |
| 133 | Ga0070707_100347573 | 3300005468 | Bacteria | 1440 |
| 134 | Ga0070707_100920136 | 3300005468 | Bacteria | 839 |
| 135 | Ga0070707_101753116 | 3300005468 | Unclassified | 588 |
| 136 | Ga0070707_101963678 | 3300005468 | Bacteria | 552 |
| 137 | Ga0070698_100000396 | 3300005471 | Bacteria | 45923 |
| 138 | Ga0070698_100001643 | 3300005471 | Bacteria | 24933 |
| 139 | Ga0070698_100016840 | 3300005471 | Bacteria | 7710 |
| 140 | Ga0070698_100024922 | 3300005471 | Bacteria | 6235 |
| 141 | Ga0070698_100068745 | 3300005471 | Bacteria | 3559 |
| 142 | Ga0070698_100094289 | 3300005471 | Bacteria | 2972 |
| 143 | Ga0070698_100140019 | 3300005471 | Bacteria | 2371 |
| 144 | Ga0070698_100181703 | 3300005471 | Bacteria | 2042 |
| 145 | Ga0070698_100256605 | 3300005471 | Bacteria | 1681 |
| 146 | Ga0070699_100001967 | 3300005518 | Bacteria | 18553 |
| 147 | Ga0070699_100613130 | 3300005518 | Bacteria | 993 |
| 148 | Ga0070699_100724894 | 3300005518 | Bacteria | 909 |
| 149 | Ga0070699_100816045 | 3300005518 | Unclassified | 854 |
| 150 | Ga0070699_100857875 | 3300005518 | Unclassified | 831 |
| 151 | Ga0070699_101151406 | 3300005518 | Bacteria | 711 |
| 152 | Ga0070699_101231271 | 3300005518 | Bacteria | 687 |
| 153 | Ga0070679_100358534 | 3300005530 | Unclassified | 1406 |
| 154 | Ga0070684_100200460 | 3300005535 | Bacteria | 1817 |
| 155 | Ga0070697_100012204 | 3300005536 | Bacteria | 6727 |
| 156 | Ga0070697_100042441 | 3300005536 | Bacteria | 3680 |
| 157 | Ga0070697_100521785 | 3300005536 | Unclassified | 1040 |
| 158 | Ga0070697_102103644 | 3300005536 | Bacteria | 505 |
| 159 | Ga0068853_100066910 | 3300005539 | Bacteria | 3120 |
| 160 | Ga0068853_100137020 | 3300005539 | Bacteria | 2195 |
| 161 | Ga0068853_100647992 | 3300005539 | Bacteria | 1005 |
| 162 | Ga0070672_100459976 | 3300005543 | Bacteria | 1097 |
| 163 | Ga0070686_100027795 | 3300005544 | Bacteria | 3426 |
| 164 | Ga0070695_100025310 | 3300005545 | Bacteria | 3664 |
| 165 | Ga0070695_100574710 | 3300005545 | Bacteria | 881 |
| 166 | Ga0070695_101419058 | 3300005545 | Unclassified | 576 |
| 167 | Ga0070696_100201547 | 3300005546 | Bacteria | 1486 |
| 168 | Ga0070696_100273333 | 3300005546 | Bacteria | 1285 |
| 169 | Ga0070696_100379342 | 3300005546 | Unclassified | 1101 |
| 170 | Ga0070693_100191143 | 3300005547 | Bacteria | 1324 |
| 171 | Ga0070693_101156032 | 3300005547 | Unclassified | 593 |
| 172 | Ga0070665_100741309 | 3300005548 | Bacteria | 995 |
| 173 | Ga0070704_100114176 | 3300005549 | Bacteria | 2061 |
| 174 | Ga0070704_101762867 | 3300005549 | Bacteria | 573 |
| 175 | Ga0068855_100433543 | 3300005563 | Bacteria | 1436 |
| 176 | Ga0068855_101822627 | 3300005563 | Bacteria | 618 |
| 177 | Ga0070664_100046231 | 3300005564 | Bacteria | 3677 |
| 178 | Ga0068857_100048065 | 3300005577 | Bacteria | 3788 |
| 179 | Ga0068857_100392165 | 3300005577 | Bacteria | 1291 |
| 180 | Ga0068854_100117339 | 3300005578 | Bacteria | 2015 |
| 181 | Ga0068854_100572322 | 3300005578 | Bacteria | 961 |
| 182 | Ga0068856_100235423 | 3300005614 | Unclassified | 1847 |
| 183 | Ga0068856_100313338 | 3300005614 | Bacteria | 1587 |
| 184 | Ga0068856_100321485 | 3300005614 | Bacteria | 1564 |
| 185 | Ga0068856_102087563 | 3300005614 | Unclassified | 576 |
| 186 | Ga0070702_100025773 | 3300005615 | Bacteria | 3154 |
| 187 | Ga0070702_100811235 | 3300005615 | Unclassified | 725 |
| 188 | Ga0068852_100038762 | 3300005616 | Bacteria | 4007 |
| 189 | Ga0068859_101011630 | 3300005617 | Unclassified | 913 |
| 190 | Ga0068864_100251702 | 3300005618 | Bacteria | 1640 |
| 191 | Ga0068866_10031261 | 3300005718 | Bacteria | 2562 |
| 192 | Ga0068861_100189402 | 3300005719 | Bacteria | 1718 |
| 193 | Ga0068861_100190141 | 3300005719 | Unclassified | 1715 |
| 194 | Ga0068861_101602344 | 3300005719 | Unclassified | 641 |
| 195 | Ga0068870_10067247 | 3300005840 | Bacteria | 1943 |
| 196 | Ga0068863_100069818 | 3300005841 | Bacteria | 3321 |
| 197 | Ga0068863_101247836 | 3300005841 | Unclassified | 749 |
| 198 | Ga0068863_101287460 | 3300005841 | Unclassified | 738 |
| 199 | Ga0068858_100539887 | 3300005842 | Bacteria | 1128 |
| 200 | Ga0068858_101145381 | 3300005842 | Bacteria | 764 |
| 201 | Ga0068858_102132180 | 3300005842 | Bacteria | 554 |
| 202 | Ga0068860_101423109 | 3300005843 | Bacteria | 714 |
| 203 | Ga0068862_100624434 | 3300005844 | Bacteria | 1037 |
| 204 | Ga0081455_10021117 | 3300005937 | Bacteria | 6114 |
| 205 | Ga0081455_10046999 | 3300005937 | Bacteria | 3741 |
| 206 | Ga0081455_10058834 | 3300005937 | Bacteria | 3249 |
| 207 | Ga0081455_11065072 | 3300005937 | Unclassified | 500 |
| 208 | Ga0081540_1000089 | 3300005983 | Bacteria | 97819 |
| 209 | Ga0081540_1002152 | 3300005983 | Bacteria | 16368 |
| 210 | Ga0070717_10001816 | 3300006028 | Bacteria | 14916 |
| 211 | Ga0070717_10007042 | 3300006028 | Bacteria | 8326 |
| 212 | Ga0070717_10019846 | 3300006028 | Bacteria | 5277 |
| 213 | Ga0070717_10022471 | 3300006028 | Bacteria | 4985 |
| 214 | Ga0070717_10025987 | 3300006028 | Bacteria | 4667 |
| 215 | Ga0070717_10256786 | 3300006028 | Unclassified | 1545 |
| 216 | Ga0070717_10435464 | 3300006028 | Bacteria | 1180 |
| 217 | Ga0070717_10552894 | 3300006028 | Unclassified | 1042 |
| 218 | Ga0070717_11425576 | 3300006028 | Bacteria | 629 |
| 219 | Ga0070717_12106754 | 3300006028 | Unclassified | 507 |
| 220 | Ga0075432_10169055 | 3300006058 | Bacteria | 849 |
| 221 | Ga0070715_10002583 | 3300006163 | Bacteria | 5590 |
| 222 | Ga0070715_10044483 | 3300006163 | Bacteria | 1877 |
| 223 | Ga0070715_10086220 | 3300006163 | Bacteria | 1435 |
| 224 | Ga0070715_10413660 | 3300006163 | Bacteria | 753 |
| 225 | Ga0070716_100000834 | 3300006173 | Bacteria | 13301 |
| 226 | Ga0070716_100002733 | 3300006173 | Bacteria | 8178 |
| 227 | Ga0070716_100012302 | 3300006173 | Bacteria | 4334 |
| 228 | Ga0070716_100019222 | 3300006173 | Bacteria | 3568 |
| 229 | Ga0070716_100053890 | 3300006173 | Bacteria | 2295 |
| 230 | Ga0070716_100214542 | 3300006173 | Bacteria | 1288 |
| 231 | Ga0070716_100235008 | 3300006173 | Bacteria | 1240 |
| 232 | Ga0070716_100468701 | 3300006173 | Bacteria | 922 |
| 233 | Ga0070712_100007242 | 3300006175 | Bacteria | 6924 |
| 234 | Ga0070712_100061825 | 3300006175 | Bacteria | 2647 |
| 235 | Ga0070712_100092124 | 3300006175 | Unclassified | 2222 |
| 236 | Ga0070712_100097103 | 3300006175 | Bacteria | 2170 |
| 237 | Ga0070712_100120554 | 3300006175 | Bacteria | 1973 |
| 238 | Ga0070712_100210162 | 3300006175 | Bacteria | 1534 |
| 239 | Ga0070712_100246863 | 3300006175 | Bacteria | 1424 |
| 240 | Ga0070712_100452274 | 3300006175 | Bacteria | 1069 |
| 241 | Ga0070712_100488579 | 3300006175 | Bacteria | 1030 |
| 242 | Ga0070712_100752543 | 3300006175 | Unclassified | 834 |
| 243 | Ga0070712_100814641 | 3300006175 | Unclassified | 801 |
| 244 | Ga0070712_100920157 | 3300006175 | Unclassified | 754 |
| 245 | Ga0070712_100927791 | 3300006175 | Bacteria | 751 |
| 246 | Ga0070712_101760659 | 3300006175 | Bacteria | 542 |
| 247 | Ga0075427_10097858 | 3300006194 | Unclassified | 544 |
| 248 | Ga0097621_100140470 | 3300006237 | Bacteria | 2063 |
| 249 | Ga0097621_100267296 | 3300006237 | Bacteria | 1502 |
| 250 | Ga0097621_101642473 | 3300006237 | Bacteria | 611 |
| 251 | Ga0068871_100101145 | 3300006358 | Bacteria | 2416 |
| 252 | Ga0068871_100774758 | 3300006358 | Unclassified | 883 |
| 253 | Ga0068871_101365541 | 3300006358 | Bacteria | 667 |
| 254 | Ga0075428_100815074 | 3300006844 | Bacteria | 992 |
| 255 | Ga0075430_100090736 | 3300006846 | Bacteria | 2556 |
| 256 | Ga0075431_100049882 | 3300006847 | Bacteria | 4315 |
| 257 | Ga0075433_10021467 | 3300006852 | Bacteria | 5415 |
| 258 | Ga0075433_10242343 | 3300006852 | Bacteria | 1600 |
| 259 | Ga0075433_10260193 | 3300006852 | Bacteria | 1538 |
| 260 | Ga0075434_100002174 | 3300006871 | Bacteria | 17093 |
| 261 | Ga0075434_100059421 | 3300006871 | Bacteria | 3800 |
| 262 | Ga0075434_100104542 | 3300006871 | Bacteria | 2841 |
| 263 | Ga0075434_100363886 | 3300006871 | Bacteria | 1467 |
| 264 | Ga0075434_100375173 | 3300006871 | Bacteria | 1443 |
| 265 | Ga0075434_100656034 | 3300006871 | Unclassified | 1067 |
| 266 | Ga0075434_101245220 | 3300006871 | Bacteria | 755 |
| 267 | Ga0075429_100196053 | 3300006880 | Bacteria | 1769 |
| 268 | Ga0075429_101346626 | 3300006880 | Unclassified | 622 |
| 269 | Ga0068865_100354319 | 3300006881 | Bacteria | 1190 |
| 270 | Ga0068865_100500278 | 3300006881 | Bacteria | 1013 |
| 271 | Ga0075436_100008768 | 3300006914 | Bacteria | 6916 |
| 272 | Ga0075436_100081876 | 3300006914 | Bacteria | 2238 |
| 273 | Ga0075436_100147314 | 3300006914 | Bacteria | 1655 |
| 274 | Ga0075436_100298394 | 3300006914 | Bacteria | 1154 |
| 275 | Ga0075436_100333942 | 3300006914 | Bacteria | 1090 |
| 276 | Ga0097620_101011812 | 3300006931 | Unclassified | 913 |
| 277 | Ga0075435_100009069 | 3300007076 | Bacteria | 7177 |
| 278 | Ga0075435_100060423 | 3300007076 | Bacteria | 3073 |
| 279 | Ga0075435_100067619 | 3300007076 | Bacteria | 2910 |
| 280 | Ga0075435_100070450 | 3300007076 | Bacteria | 2854 |
| 281 | Ga0075435_100475926 | 3300007076 | Unclassified | 1078 |
| 282 | Ga0099794_10595697 | 3300007265 | Bacteria | 585 |
| 283 | Ga0099795_10015744 | 3300007788 | Bacteria | 2376 |
| 284 | Ga0105251_10150147 | 3300009011 | Bacteria | 1053 |
| 285 | Ga0105244_10334364 | 3300009036 | Bacteria | 699 |
| 286 | Ga0111539_10392236 | 3300009094 | Unclassified | 1617 |
| 287 | Ga0105245_10032107 | 3300009098 | Bacteria | 4649 |
| 288 | Ga0105245_10228332 | 3300009098 | Unclassified | 1799 |
| 289 | Ga0105245_10498876 | 3300009098 | Unclassified | 1233 |
| 290 | Ga0105245_11476322 | 3300009098 | Unclassified | 730 |
| 291 | Ga0105247_10139316 | 3300009101 | Bacteria | 1588 |
| 292 | Ga0105247_10783028 | 3300009101 | Bacteria | 726 |
| 293 | Ga0114129_10003160 | 3300009147 | Bacteria | 23102 |
| 294 | Ga0114129_10876409 | 3300009147 | Bacteria | 1139 |
| 295 | Ga0105243_10019200 | 3300009148 | Bacteria | 5183 |
| 296 | Ga0105243_10045527 | 3300009148 | Bacteria | 3448 |
| 297 | Ga0105243_12359556 | 3300009148 | Unclassified | 570 |
| 298 | Ga0105241_10064387 | 3300009174 | Bacteria | 2830 |
| 299 | Ga0105241_10518494 | 3300009174 | Bacteria | 1065 |
| 300 | Ga0105241_10851337 | 3300009174 | Bacteria | 843 |
| 301 | Ga0105241_11001701 | 3300009174 | Unclassified | 782 |
| 302 | Ga0105242_10160483 | 3300009176 | Bacteria | 1967 |
| 303 | Ga0105242_10281043 | 3300009176 | Bacteria | 1512 |
| 304 | Ga0105242_10390723 | 3300009176 | Unclassified | 1296 |
| 305 | Ga0105242_10533273 | 3300009176 | Bacteria | 1122 |
| 306 | Ga0105242_11027579 | 3300009176 | Bacteria | 834 |
| 307 | Ga0105242_12206200 | 3300009176 | Bacteria | 596 |
| 308 | Ga0105242_12270087 | 3300009176 | Bacteria | 589 |
| 309 | Ga0105248_10545830 | 3300009177 | Bacteria | 1308 |
| 310 | Ga0105248_10825769 | 3300009177 | Unclassified | 1046 |
| 311 | Ga0105248_11011606 | 3300009177 | Bacteria | 939 |
| 312 | Ga0105237_10542289 | 3300009545 | Bacteria | 1170 |
| 313 | Ga0105237_11484501 | 3300009545 | Bacteria | 684 |
| 314 | Ga0105238_10231917 | 3300009551 | Bacteria | 1823 |
| 315 | Ga0105238_11359044 | 3300009551 | Bacteria | 737 |
| 316 | Ga0105238_12117322 | 3300009551 | Bacteria | 597 |
| 317 | Ga0105238_12394117 | 3300009551 | Bacteria | 563 |
| 318 | Ga0105249_10035835 | 3300009553 | Bacteria | 4499 |
| 319 | Ga0105249_10109249 | 3300009553 | Bacteria | 2612 |
| 320 | Ga0105249_10195678 | 3300009553 | Bacteria | 1976 |
| 321 | Ga0105249_10228945 | 3300009553 | Bacteria | 1833 |
| 322 | Ga0105249_12009361 | 3300009553 | Unclassified | 651 |
| 323 | Ga0099796_10104642 | 3300010159 | Bacteria | 1070 |
| 324 | Ga0099796_10108237 | 3300010159 | Bacteria | 1055 |
| 325 | Ga0099796_10239135 | 3300010159 | Bacteria | 750 |
| 326 | Ga0105239_10348016 | 3300010375 | Unclassified | 1673 |
| 327 | Ga0105239_10354649 | 3300010375 | Bacteria | 1656 |
| 328 | Ga0105239_12937993 | 3300010375 | Unclassified | 556 |
| 329 | Ga0105246_11596787 | 3300011119 | Bacteria | 616 |
| 330 | Ga0157337_1003591 | 3300012483 | Bacteria | 948 |
| 331 | Ga0157338_1015828 | 3300012515 | Bacteria | 827 |
| 332 | Ga0157373_10105951 | 3300013100 | Unclassified | 1977 |
| 333 | Ga0157373_10546744 | 3300013100 | Unclassified | 840 |
| 334 | Ga0157371_11006655 | 3300013102 | Bacteria | 636 |
| 335 | Ga0157369_10592282 | 3300013105 | Unclassified | 1145 |
| 336 | Ga0157369_11008101 | 3300013105 | Unclassified | 852 |
| 337 | Ga0157369_11988091 | 3300013105 | Unclassified | 590 |
| 338 | Ga0157374_10901774 | 3300013296 | Unclassified | 902 |
| 339 | Ga0157374_10956067 | 3300013296 | Bacteria | 875 |
| 340 | Ga0157378_10613305 | 3300013297 | Unclassified | 1100 |
| 341 | Ga0157378_11264647 | 3300013297 | Unclassified | 778 |
| 342 | Ga0163162_10025354 | 3300013306 | Bacteria | 5859 |
| 343 | Ga0163162_10095780 | 3300013306 | Bacteria | 3056 |
| 344 | Ga0163162_11170801 | 3300013306 | Bacteria | 872 |
| 345 | Ga0157372_10155313 | 3300013307 | Bacteria | 2643 |
| 346 | Ga0157372_10610925 | 3300013307 | Bacteria | 1271 |
| 347 | Ga0157372_10790304 | 3300013307 | Unclassified | 1103 |
| 348 | Ga0157375_10596100 | 3300013308 | Bacteria | 1264 |
| 349 | Ga0157375_11305286 | 3300013308 | Unclassified | 853 |
| 350 | Ga0157375_11549912 | 3300013308 | Bacteria | 783 |
| 351 | Ga0157375_13373706 | 3300013308 | Unclassified | 532 |
| 352 | Ga0163163_10017694 | 3300014325 | Bacteria | 6654 |
| 353 | Ga0157380_10037201 | 3300014326 | Bacteria | 3769 |
| 354 | Ga0157380_10157500 | 3300014326 | Bacteria | 1970 |
| 355 | Ga0157380_10914601 | 3300014326 | Unclassified | 904 |
| 356 | Ga0157380_13025899 | 3300014326 | Unclassified | 536 |
| 357 | Ga0157380_13548149 | 3300014326 | Bacteria | 500 |
| 358 | Ga0157377_10114505 | 3300014745 | Unclassified | 1626 |
| 359 | Ga0157377_11317830 | 3300014745 | Unclassified | 565 |
| 360 | Ga0157379_12148884 | 3300014968 | Bacteria | 554 |
| 361 | Ga0157376_10596496 | 3300014969 | Unclassified | 1099 |
| 362 | Ga0157376_11773932 | 3300014969 | Unclassified | 653 |
| 363 | Ga0157376_12336943 | 3300014969 | Bacteria | 574 |
| 364 | Ga0163161_10174487 | 3300017792 | Bacteria | 1645 |
| 365 | Ga0163161_10216587 | 3300017792 | Bacteria | 1481 |
| 366 | Ga0163161_10278630 | 3300017792 | Bacteria | 1311 |
| 367 | Ga0197907_10736962 | 3300020069 | Unclassified | 959 |
| 368 | Ga0206356_10020970 | 3300020070 | Bacteria | 1489 |
| 369 | Ga0206354_10041121 | 3300020081 | Bacteria | 2008 |
| 370 | Ga0206353_11136400 | 3300020082 | Bacteria | 828 |
| 371 | Ga0213874_10006980 | 3300021377 | Bacteria | 2694 |
| 372 | Ga0213876_10116935 | 3300021384 | Bacteria | 1415 |
| 373 | Ga0213875_10000778 | 3300021388 | Bacteria | 23813 |
| 374 | Ga0213875_10001469 | 3300021388 | Bacteria | 15255 |
| 375 | Ga0213875_10025785 | 3300021388 | Bacteria | 2798 |
| 376 | Ga0213875_10060985 | 3300021388 | Bacteria | 1763 |
| 377 | Ga0213875_10062680 | 3300021388 | Bacteria | 1739 |
| 378 | Ga0213875_10067895 | 3300021388 | Unclassified | 1665 |
| 379 | Ga0224572_1007442 | 3300024225 | Unclassified | 2006 |
| 380 | Ga0228598_1038676 | 3300024227 | Unclassified | 941 |
| 381 | Ga0207653_10022345 | 3300025885 | Bacteria | 2009 |
| 382 | Ga0207692_10000710 | 3300025898 | Bacteria | 11703 |
| 383 | Ga0207692_10004964 | 3300025898 | Bacteria | 5295 |
| 384 | Ga0207692_10005520 | 3300025898 | Bacteria | 5072 |
| 385 | Ga0207692_10036978 | 3300025898 | Bacteria | 2385 |
| 386 | Ga0207692_10086889 | 3300025898 | Bacteria | 1686 |
| 387 | Ga0207692_10276208 | 3300025898 | Bacteria | 1015 |
| 388 | Ga0207692_10459583 | 3300025898 | Bacteria | 803 |
| 389 | Ga0207692_10955647 | 3300025898 | Unclassified | 565 |
| 390 | Ga0207642_10105735 | 3300025899 | Bacteria | 1423 |
| 391 | Ga0207710_10179231 | 3300025900 | Bacteria | 1039 |
| 392 | Ga0207688_10014232 | 3300025901 | Bacteria | 4329 |
| 393 | Ga0207680_10025782 | 3300025903 | Bacteria | 3247 |
| 394 | Ga0207685_10007255 | 3300025905 | Bacteria | 3077 |
| 395 | Ga0207685_10069220 | 3300025905 | Bacteria | 1425 |
| 396 | Ga0207685_10228854 | 3300025905 | Bacteria | 888 |
| 397 | Ga0207699_10000150 | 3300025906 | Bacteria | 45175 |
| 398 | Ga0207699_10000409 | 3300025906 | Bacteria | 22037 |
| 399 | Ga0207699_10003451 | 3300025906 | Bacteria | 7536 |
| 400 | Ga0207699_10004294 | 3300025906 | Bacteria | 6816 |
| 401 | Ga0207699_10034201 | 3300025906 | Bacteria | 2880 |
| 402 | Ga0207699_10413921 | 3300025906 | Unclassified | 962 |
| 403 | Ga0207643_10056250 | 3300025908 | Bacteria | 2237 |
| 404 | Ga0207705_11304640 | 3300025909 | Bacteria | 554 |
| 405 | Ga0207684_10001073 | 3300025910 | Bacteria | 30613 |
| 406 | Ga0207684_10008615 | 3300025910 | Bacteria | 9062 |
| 407 | Ga0207684_10038737 | 3300025910 | Bacteria | 4045 |
| 408 | Ga0207684_10055802 | 3300025910 | Bacteria | 3351 |
| 409 | Ga0207684_10075263 | 3300025910 | Bacteria | 2869 |
| 410 | Ga0207684_10912749 | 3300025910 | Bacteria | 738 |
| 411 | Ga0207654_10102836 | 3300025911 | Bacteria | 1763 |
| 412 | Ga0207654_10783197 | 3300025911 | Bacteria | 688 |
| 413 | Ga0207707_10929849 | 3300025912 | Bacteria | 717 |
| 414 | Ga0207671_11249658 | 3300025914 | Unclassified | 580 |
| 415 | Ga0207693_10011623 | 3300025915 | Bacteria | 7123 |
| 416 | Ga0207693_10015861 | 3300025915 | Bacteria | 6034 |
| 417 | Ga0207693_10081252 | 3300025915 | Bacteria | 2537 |
| 418 | Ga0207693_10083300 | 3300025915 | Bacteria | 2505 |
| 419 | Ga0207693_10156272 | 3300025915 | Bacteria | 1794 |
| 420 | Ga0207693_10171012 | 3300025915 | Bacteria | 1711 |
| 421 | Ga0207693_10297972 | 3300025915 | Bacteria | 1263 |
| 422 | Ga0207693_10337450 | 3300025915 | Unclassified | 1180 |
| 423 | Ga0207693_11048626 | 3300025915 | Bacteria | 621 |
| 424 | Ga0207663_10004946 | 3300025916 | Bacteria | 6675 |
| 425 | Ga0207663_10006883 | 3300025916 | Bacteria | 5858 |
| 426 | Ga0207663_10008833 | 3300025916 | Bacteria | 5296 |
| 427 | Ga0207663_10042210 | 3300025916 | Bacteria | 2786 |
| 428 | Ga0207663_10131645 | 3300025916 | Bacteria | 1729 |
| 429 | Ga0207663_10380878 | 3300025916 | Bacteria | 1075 |
| 430 | Ga0207663_10420863 | 3300025916 | Bacteria | 1025 |
| 431 | Ga0207663_10523231 | 3300025916 | Bacteria | 924 |
| 432 | Ga0207663_10984069 | 3300025916 | Bacteria | 676 |
| 433 | Ga0207657_10009239 | 3300025919 | Bacteria | 9936 |
| 434 | Ga0207657_10101950 | 3300025919 | Bacteria | 2381 |
| 435 | Ga0207649_10326005 | 3300025920 | Bacteria | 1130 |
| 436 | Ga0207652_10341711 | 3300025921 | Bacteria | 1351 |
| 437 | Ga0207652_11485441 | 3300025921 | Bacteria | 582 |
| 438 | Ga0207646_10001025 | 3300025922 | Bacteria | 35704 |
| 439 | Ga0207646_10001028 | 3300025922 | Bacteria | 35654 |
| 440 | Ga0207646_10041799 | 3300025922 | Bacteria | 4119 |
| 441 | Ga0207646_10376086 | 3300025922 | Bacteria | 1283 |
| 442 | Ga0207646_10927125 | 3300025922 | Unclassified | 772 |
| 443 | Ga0207646_11410661 | 3300025922 | Bacteria | 605 |
| 444 | Ga0207694_11079589 | 3300025924 | Unclassified | 679 |
| 445 | Ga0207659_10032251 | 3300025926 | Bacteria | 3593 |
| 446 | Ga0207659_10667457 | 3300025926 | Bacteria | 889 |
| 447 | Ga0207687_10484030 | 3300025927 | Unclassified | 1031 |
| 448 | Ga0207687_10638932 | 3300025927 | Bacteria | 900 |
| 449 | Ga0207687_10864892 | 3300025927 | Bacteria | 773 |
| 450 | Ga0207700_10000935 | 3300025928 | Bacteria | 16792 |
| 451 | Ga0207700_10002068 | 3300025928 | Bacteria | 11476 |
| 452 | Ga0207700_10008073 | 3300025928 | Bacteria | 6493 |
| 453 | Ga0207700_10010239 | 3300025928 | Bacteria | 5902 |
| 454 | Ga0207700_10123749 | 3300025928 | Bacteria | 2100 |
| 455 | Ga0207700_10182259 | 3300025928 | Bacteria | 1759 |
| 456 | Ga0207700_10208025 | 3300025928 | Bacteria | 1652 |
| 457 | Ga0207700_10340830 | 3300025928 | Unclassified | 1303 |
| 458 | Ga0207700_10553498 | 3300025928 | Bacteria | 1021 |
| 459 | Ga0207700_11321841 | 3300025928 | Bacteria | 642 |
| 460 | Ga0207664_10001780 | 3300025929 | Bacteria | 14188 |
| 461 | Ga0207664_10002171 | 3300025929 | Bacteria | 12912 |
| 462 | Ga0207664_10017089 | 3300025929 | Bacteria | 5307 |
| 463 | Ga0207664_10026003 | 3300025929 | Bacteria | 4418 |
| 464 | Ga0207664_10031593 | 3300025929 | Bacteria | 4052 |
| 465 | Ga0207664_10131497 | 3300025929 | Bacteria | 2107 |
| 466 | Ga0207664_10214388 | 3300025929 | Bacteria | 1667 |
| 467 | Ga0207664_10259799 | 3300025929 | Bacteria | 1518 |
| 468 | Ga0207664_10539055 | 3300025929 | Bacteria | 1046 |
| 469 | Ga0207664_10656500 | 3300025929 | Bacteria | 943 |
| 470 | Ga0207664_10750446 | 3300025929 | Unclassified | 878 |
| 471 | Ga0207664_10817055 | 3300025929 | Unclassified | 838 |
| 472 | Ga0207664_10878115 | 3300025929 | Bacteria | 806 |
| 473 | Ga0207664_11015707 | 3300025929 | Bacteria | 743 |
| 474 | Ga0207664_11047209 | 3300025929 | Bacteria | 730 |
| 475 | Ga0207664_11192723 | 3300025929 | Bacteria | 679 |
| 476 | Ga0207664_11569227 | 3300025929 | Bacteria | 580 |
| 477 | Ga0207644_10351908 | 3300025931 | Bacteria | 1196 |
| 478 | Ga0207644_11878974 | 3300025931 | Bacteria | 501 |
| 479 | Ga0207690_10391829 | 3300025932 | Bacteria | 1106 |
| 480 | Ga0207690_10502797 | 3300025932 | Unclassified | 980 |
| 481 | Ga0207706_10010344 | 3300025933 | Bacteria | 8528 |
| 482 | Ga0207706_10287960 | 3300025933 | Bacteria | 1432 |
| 483 | Ga0207706_10437705 | 3300025933 | Bacteria | 1132 |
| 484 | Ga0207686_10223961 | 3300025934 | Unclassified | 1360 |
| 485 | Ga0207686_10653180 | 3300025934 | Bacteria | 832 |
| 486 | Ga0207686_10794626 | 3300025934 | Unclassified | 758 |
| 487 | Ga0207686_11015274 | 3300025934 | Bacteria | 673 |
| 488 | Ga0207709_10093308 | 3300025935 | Bacteria | 1973 |
| 489 | Ga0207709_10128173 | 3300025935 | Bacteria | 1725 |
| 490 | Ga0207670_10720209 | 3300025936 | Bacteria | 827 |
| 491 | Ga0207704_10130470 | 3300025938 | Bacteria | 1739 |
| 492 | Ga0207704_10378582 | 3300025938 | Bacteria | 1110 |
| 493 | Ga0207665_10001548 | 3300025939 | Bacteria | 15470 |
| 494 | Ga0207665_10001912 | 3300025939 | Bacteria | 14048 |
| 495 | Ga0207665_10017852 | 3300025939 | Bacteria | 4664 |
| 496 | Ga0207665_10027812 | 3300025939 | Bacteria | 3736 |
| 497 | Ga0207665_10047675 | 3300025939 | Bacteria | 2873 |
| 498 | Ga0207665_10047865 | 3300025939 | Bacteria | 2868 |
| 499 | Ga0207665_10499802 | 3300025939 | Bacteria | 939 |
| 500 | Ga0207665_11145711 | 3300025939 | Bacteria | 620 |
| 501 | Ga0207665_11173366 | 3300025939 | Bacteria | 612 |
| 502 | Ga0207691_10186810 | 3300025940 | Bacteria | 1809 |
| 503 | Ga0207711_10168246 | 3300025941 | Bacteria | 1988 |
| 504 | Ga0207711_10548560 | 3300025941 | Bacteria | 1078 |
| 505 | Ga0207689_10000637 | 3300025942 | Bacteria | 33477 |
| 506 | Ga0207689_10138779 | 3300025942 | Bacteria | 2002 |
| 507 | Ga0207679_10163772 | 3300025945 | Bacteria | 1823 |
| 508 | Ga0207679_11483547 | 3300025945 | Unclassified | 622 |
| 509 | Ga0207667_10368194 | 3300025949 | Bacteria | 1465 |
| 510 | Ga0207667_11496347 | 3300025949 | Bacteria | 646 |
| 511 | Ga0207667_11559416 | 3300025949 | Bacteria | 630 |
| 512 | Ga0207651_10317262 | 3300025960 | Bacteria | 1302 |
| 513 | Ga0207712_10429894 | 3300025961 | Unclassified | 1116 |
| 514 | Ga0207712_10624965 | 3300025961 | Unclassified | 934 |
| 515 | Ga0207712_11671436 | 3300025961 | Unclassified | 571 |
| 516 | Ga0207668_10302392 | 3300025972 | Bacteria | 1321 |
| 517 | Ga0207668_11938172 | 3300025972 | Bacteria | 531 |
| 518 | Ga0207640_10178470 | 3300025981 | Bacteria | 1590 |
| 519 | Ga0207640_10972833 | 3300025981 | Unclassified | 745 |
| 520 | Ga0207640_11056627 | 3300025981 | Unclassified | 717 |
| 521 | Ga0207658_10698510 | 3300025986 | Bacteria | 917 |
| 522 | Ga0207677_11627766 | 3300026023 | Unclassified | 598 |
| 523 | Ga0207703_11570746 | 3300026035 | Bacteria | 633 |
| 524 | Ga0207639_10106209 | 3300026041 | Bacteria | 2279 |
| 525 | Ga0207639_10258384 | 3300026041 | Bacteria | 1522 |
| 526 | Ga0207678_10031219 | 3300026067 | Bacteria | 4648 |
| 527 | Ga0207708_10187270 | 3300026075 | Bacteria | 1645 |
| 528 | Ga0207702_10135659 | 3300026078 | Bacteria | 2220 |
| 529 | Ga0207702_10170922 | 3300026078 | Bacteria | 1993 |
| 530 | Ga0207702_10477887 | 3300026078 | Bacteria | 1212 |
| 531 | Ga0207641_10652680 | 3300026088 | Bacteria | 1033 |
| 532 | Ga0207648_10603787 | 3300026089 | Bacteria | 1011 |
| 533 | Ga0207648_11022060 | 3300026089 | Bacteria | 774 |
| 534 | Ga0207674_10346472 | 3300026116 | Bacteria | 1436 |
| 535 | Ga0207675_100003528 | 3300026118 | Bacteria | 15258 |
| 536 | Ga0207675_100232528 | 3300026118 | Bacteria | 1779 |
| 537 | Ga0207683_10029746 | 3300026121 | Bacteria | 4730 |
| 538 | Ga0207683_10033055 | 3300026121 | Bacteria | 4493 |
| 539 | Ga0207698_10789153 | 3300026142 | Bacteria | 951 |
| 540 | Ga0207698_11601873 | 3300026142 | Unclassified | 667 |
| 541 | Ga0207428_10668051 | 3300027907 | Bacteria | 745 |
| 542 | Ga0268264_10502172 | 3300028381 | Bacteria | 1183 |
| 543 | Ga0265336_10044462 | 3300028666 | Bacteria | 1351 |
| 544 | Ga0265338_10007034 | 3300028800 | Bacteria | 14115 |
| 545 | Ga0265777_114550 | 3300030877 | Bacteria | 608 |
| 546 | Ga0265765_1052407 | 3300030879 | Unclassified | 563 |
| 547 | Ga0265760_10111565 | 3300031090 | Bacteria | 871 |
| 548 | Ga0265760_10274613 | 3300031090 | Bacteria | 590 |
| 549 | Ga0307513_10407775 | 3300031456 | Bacteria | 1092 |
| 550 | Ga0307409_100108617 | 3300031995 | Bacteria | 2321 |
| 551 | Ga0307416_100632906 | 3300032002 | Bacteria | 1153 |
| 552 | Ga0373948_0060942 | 3300034817 | Unclassified | 828 |
| 553 | Ga0373950_0137905 | 3300034818 | Bacteria | 550 |
| 554 | Ga0373959_0041606 | 3300034820 | Bacteria | 966 |
| 555 | Ga0373959_0104786 | 3300034820 | Bacteria | 677 |
| 556 | Ga0373959_0125544 | 3300034820 | Unclassified | 631 |
| 557 | Ga0373938_0034390 | 3300034957 | Bacteria | 1101 |
| 558 | Ga0373926_0004896 | 3300035083 | Bacteria | 4402 |
| 559 | Ga0373926_0220167 | 3300035083 | Unclassified | 733 |
| 560 | Ga0373928_0016328 | 3300035084 | Unclassified | 1519 |
| 561 | Ga0373934_0016134 | 3300035086 | Bacteria | 2837 |
| 562 | Ga0373934_0100681 | 3300035086 | Bacteria | 1168 |
| 563 | Ga0373934_0277830 | 3300035086 | Unclassified | 694 |
| 564 | Ga0373940_0046305 | 3300035088 | Unclassified | 1210 |
| 565 | Ga0373940_0155295 | 3300035088 | Bacteria | 731 |
| 566 | Ga0373944_0060465 | 3300035089 | Unclassified | 1214 |
| 567 | Ga0373944_0160943 | 3300035089 | Unclassified | 796 |
| 568 | Ga0373949_0042471 | 3300035090 | Unclassified | 1122 |
| 569 | Ga0373951_0036488 | 3300035091 | Bacteria | 1173 |
| 570 | Ga0373952_0036525 | 3300035092 | Unclassified | 1116 |
| 571 | Ga0373952_0212019 | 3300035092 | Bacteria | 572 |
| 572 | Ga0373923_0009757 | 3300035111 | Bacteria | 3471 |
| 573 | Ga0373923_0012459 | 3300035111 | Bacteria | 3144 |
| 574 | Ga0373923_0043802 | 3300035111 | Unclassified | 1853 |
| 575 | Ga0373923_0513211 | 3300035111 | Bacteria | 585 |
| 576 | Ga0373932_0002043 | 3300035112 | Bacteria | 5282 |
| 577 | Ga0373932_0098947 | 3300035112 | Bacteria | 946 |
| 578 | Ga0373936_0005671 | 3300035113 | Bacteria | 4709 |
| 579 | Ga0373936_0015057 | 3300035113 | Bacteria | 2961 |
| 580 | Ga0373936_0019677 | 3300035113 | Bacteria | 2617 |
| 581 | Ga0373939_0008703 | 3300035114 | Bacteria | 2495 |
| 582 | Ga0373939_0035465 | 3300035114 | Bacteria | 1470 |
| 583 | Ga0373939_0225473 | 3300035114 | Bacteria | 719 |
| 584 | Ga0373941_0132624 | 3300035115 | Unclassified | 899 |
| 585 | Ga0373945_0000857 | 3300035116 | Bacteria | 8960 |
| 586 | Ga0373945_0023253 | 3300035116 | Unclassified | 2140 |
| 587 | Ga0373945_0316906 | 3300035116 | Bacteria | 671 |
| 588 | Ga0373945_0385135 | 3300035116 | Bacteria | 613 |
| 589 | Ga0373953_0001440 | 3300035117 | Bacteria | 6893 |
| 590 | Ga0373953_0066337 | 3300035117 | Bacteria | 1483 |
| 591 | Ga0373953_0307196 | 3300035117 | Bacteria | 692 |
| 592 | Ga0373954_0040317 | 3300035118 | Bacteria | 2175 |
| 593 | Ga0373954_0049363 | 3300035118 | Bacteria | 1973 |
| 594 | Ga0373954_0433238 | 3300035118 | Bacteria | 651 |
| 595 | Ga0373956_0010874 | 3300035119 | Bacteria | 3741 |
| 596 | Ga0373956_0041268 | 3300035119 | Bacteria | 2048 |
| 597 | Ga0373956_0123017 | 3300035119 | Bacteria | 1212 |
| 598 | Ga0373956_0183982 | 3300035119 | Bacteria | 988 |
| 599 | Ga0373956_0222512 | 3300035119 | Bacteria | 896 |
| 600 | Ga0373957_0000395 | 3300035120 | Bacteria | 11073 |
| 601 | Ga0373957_0064997 | 3300035120 | Bacteria | 1419 |
| 602 | Ga0373957_0294393 | 3300035120 | Unclassified | 688 |
| 603 | Ga0373957_0295714 | 3300035120 | Bacteria | 686 |
| 604 | Ga0373957_0486632 | 3300035120 | Bacteria | 536 |
| 605 | Ga0373960_0026252 | 3300035121 | Bacteria | 1590 |
| 606 | Ga0373960_0064645 | 3300035121 | Bacteria | 1117 |
| 607 | Ga0373960_0157632 | 3300035121 | Bacteria | 779 |
| 608 | Ga0373943_0010787 | 3300035170 | Bacteria | 4102 |
| 609 | Ga0373943_0105732 | 3300035170 | Unclassified | 1478 |
| 610 | Ga0373943_0115711 | 3300035170 | Bacteria | 1420 |
| 611 | Ga0373943_0161921 | 3300035170 | Bacteria | 1219 |
| 612 | Ga0373943_0957198 | 3300035170 | Bacteria | 513 |
| 613 | Ga0373946_0007574 | 3300035171 | Bacteria | 3973 |
| 614 | Ga0373946_0244551 | 3300035171 | Bacteria | 873 |
| 615 | Ga0373955_0006906 | 3300035172 | Bacteria | 5190 |
| 616 | Ga0373955_0087325 | 3300035172 | Bacteria | 1772 |
| 617 | Ga0373955_0192919 | 3300035172 | Bacteria | 1212 |
| 618 | Ga0373955_0217215 | 3300035172 | Unclassified | 1141 |
| 619 | Ga0373955_0612365 | 3300035172 | Unclassified | 667 |
| 620 | Ga0373955_1001435 | 3300035172 | Unclassified | 515 |
| 621 | Ga0373942_0003432 | 3300035207 | Bacteria | 3724 |
| 622 | Ga0373942_0063436 | 3300035207 | Unclassified | 1063 |
| 623 | Ga0373961_0007728 | 3300035241 | Bacteria | 2605 |
| 624 | Ga0373961_0032347 | 3300035241 | Bacteria | 1466 |
| 625 | Ga0373961_0066038 | 3300035241 | Bacteria | 1109 |
| 626 | Ga0373962_0024534 | 3300035242 | Unclassified | 1613 |
| 627 | Ga0373962_0024678 | 3300035242 | Bacteria | 1610 |
| 628 | Ga0373962_0297724 | 3300035242 | Bacteria | 572 |
| 629 | Ga0373924_0016147 | 3300035410 | Bacteria | 2848 |
| 630 | Ga0373924_0019354 | 3300035410 | Bacteria | 2637 |
| 631 | Ga0373924_0044595 | 3300035410 | Unclassified | 1822 |
| 632 | Ga0373924_0438091 | 3300035410 | Bacteria | 585 |
| 633 | Ga0373931_0005023 | 3300035691 | Bacteria | 6084 |
| 634 | Ga0373931_0007023 | 3300035691 | Bacteria | 5297 |
| 635 | Ga0373931_0120410 | 3300035691 | Bacteria | 1499 |
| 636 | Ga0373931_0138730 | 3300035691 | Bacteria | 1406 |
| 637 | Ga0373931_0531873 | 3300035691 | Bacteria | 762 |
| 638 | Ga0373931_0634663 | 3300035691 | Unclassified | 701 |
| 639 | Ga0373935_0021843 | 3300035692 | Bacteria | 3918 |
| 640 | Ga0373935_0022631 | 3300035692 | Bacteria | 3856 |
| 641 | Ga0373935_0126102 | 3300035692 | Bacteria | 1715 |
| 642 | Ga0373935_0157726 | 3300035692 | Bacteria | 1544 |
| 643 | Ga0373935_0281125 | 3300035692 | Bacteria | 1172 |
| 644 | Ga0373935_0563822 | 3300035692 | Bacteria | 831 |
| 645 | Ga0373935_0634342 | 3300035692 | Unclassified | 783 |
| 646 | Ga0373935_0665669 | 3300035692 | Bacteria | 764 |
| 647 | Ga0373927_0007575 | 3300035695 | Bacteria | 7347 |
| 648 | Ga0373927_0097977 | 3300035695 | Bacteria | 1906 |
| 649 | Ga0373927_0155042 | 3300035695 | Bacteria | 1500 |
| 650 | Ga0373927_0740895 | 3300035695 | Bacteria | 649 |
| 651 | Ga0373933_0003771 | 3300035724 | Bacteria | 8374 |
| 652 | Ga0373933_0008292 | 3300035724 | Bacteria | 5674 |
| 653 | Ga0373933_0009211 | 3300035724 | Bacteria | 5391 |
| 654 | Ga0373933_0012435 | 3300035724 | Bacteria | 4699 |
| 655 | Ga0373933_0121146 | 3300035724 | Bacteria | 1638 |
| 656 | Ga0373933_0314095 | 3300035724 | Bacteria | 1015 |
| 657 | Ga0373933_0318605 | 3300035724 | Bacteria | 1008 |
| 658 | Ga0373933_0478285 | 3300035724 | Unclassified | 815 |
| 659 | Ga0373933_0654484 | 3300035724 | Bacteria | 690 |
| 660 | Ga0373947_0004813 | 3300035725 | Bacteria | 7903 |
| 661 | Ga0373947_0025467 | 3300035725 | Bacteria | 3451 |
| 662 | Ga0373947_0027635 | 3300035725 | Bacteria | 3322 |
| 663 | Ga0373947_0114431 | 3300035725 | Unclassified | 1708 |
| 664 | Ga0373947_0475185 | 3300035725 | Bacteria | 848 |
| 665 | Ga0373947_0667643 | 3300035725 | Unclassified | 709 |
| 666 | Ga0373947_0708974 | 3300035725 | Bacteria | 687 |
| 667 | Ga0373937_0004787 | 3300036401 | Bacteria | 11496 |
| 668 | Ga0373937_0019543 | 3300036401 | Bacteria | 6061 |
| 669 | Ga0373937_0042732 | 3300036401 | Bacteria | 4135 |
| 670 | Ga0373937_0043353 | 3300036401 | Bacteria | 4106 |
| 671 | Ga0373937_0209103 | 3300036401 | Bacteria | 1835 |
| 672 | Ga0373937_0248247 | 3300036401 | Bacteria | 1677 |
| 673 | Ga0373937_0528675 | 3300036401 | Unclassified | 1120 |
| 674 | Ga0373925_0006165 | 3300037068 | Bacteria | 8853 |
| 675 | Ga0373925_0030042 | 3300037068 | Bacteria | 3987 |
| 676 | Ga0373925_0040068 | 3300037068 | Unclassified | 3467 |
| 677 | Ga0373925_0100518 | 3300037068 | Bacteria | 2222 |
| 678 | Ga0373925_0144386 | 3300037068 | Bacteria | 1864 |
| 679 | Ga0373925_0480922 | 3300037068 | Bacteria | 1019 |
| 680 | Ga0373925_0921331 | 3300037068 | Unclassified | 720 |
| 681 | Ga0373925_1021646 | 3300037068 | Bacteria | 681 |
| 682 | Ga0373925_1710896 | 3300037068 | Unclassified | 513 |
| 683 | Ga0436364_0105925 | 3300037853 | Bacteria | 2360 |
| 684 | Ga0436364_0377973 | 3300037853 | Bacteria | 58023 |
| 685 | Ga0436364_0679842 | 3300037853 | Bacteria | 12069 |
| 686 | Ga0436364_1006315 | 3300037853 | Bacteria | 3222 |
| 687 | Ga0436364_1177344 | 3300037853 | Bacteria | 768 |
| 688 | Ga0436364_1305843 | 3300037853 | Bacteria | 2391 |
| 689 | Ga0436364_1383024 | 3300037853 | Bacteria | 3570 |
| 690 | Ga0436364_1401376 | 3300037853 | Bacteria | 69007 |
| 691 | Ga0436365_0303082 | 3300039437 | Bacteria | 2724 |
| 692 | Ga0436365_0768004 | 3300039437 | Unclassified | 1257 |
| 693 | Ga0436360_0269636 | 3300039438 | Unclassified | 536 |
| 694 | Ga0436360_0622341 | 3300039438 | Unclassified | 679 |
| 695 | Ga0436361_0346318 | 3300039447 | Bacteria | 694 |
| 696 | Ga0436363_0070686 | 3300039450 | Unclassified | 609 |
| 697 | Ga0436363_1072037 | 3300039450 | Bacteria | 697 |
| 698 | Ga0436363_1532046 | 3300039450 | Bacteria | 1123 |
| 699 | Ga0436363_1600052 | 3300039450 | Bacteria | 1191 |
| 700 | Ga0466963_0567570 | 3300044694 | Bacteria | 801 |
| 701 | Ga0466957_0154636 | 3300044842 | Bacteria | 1486 |
| 702 | Ga0466957_0750243 | 3300044842 | Bacteria | 691 |
| 703 | Ga0466959_0743012 | 3300045049 | Unclassified | 657 |
| 704 | Ga0466959_1003874 | 3300045049 | Unclassified | 556 |
| 705 | Ga0466958_0335282 | 3300045836 | Unclassified | 973 |
| 706 | Ga0466958_0405013 | 3300045836 | Bacteria | 881 |
| 707 | Ga0466967_0003373 | 3300045976 | Bacteria | 10399 |
| 708 | Ga0466967_1056694 | 3300045976 | Unclassified | 809 |
| 709 | Ga0466967_1979044 | 3300045976 | Unclassified | 579 |
| 710 | Ga0495592_0043709 | 3300046454 | Bacteria | 3350 |
| 711 | Ga0495592_0049681 | 3300046454 | Bacteria | 3117 |
| 712 | Ga0495592_0066530 | 3300046454 | Bacteria | 2637 |
| 713 | Ga0495592_0198939 | 3300046454 | Bacteria | 1353 |
| 714 | Ga0495603_0001884 | 3300046455 | Bacteria | 12373 |
| 715 | Ga0495603_0016821 | 3300046455 | Bacteria | 4425 |
| 716 | Ga0495603_0039723 | 3300046455 | Bacteria | 2818 |
| 717 | Ga0495603_0487476 | 3300046455 | Bacteria | 706 |
| 718 | Ga0495629_0002427 | 3300046459 | Bacteria | 14320 |
| 719 | Ga0495629_0013068 | 3300046459 | Bacteria | 5999 |
| 720 | Ga0495629_0076352 | 3300046459 | Bacteria | 2339 |
| 721 | Ga0495629_0343383 | 3300046459 | Unclassified | 1019 |
| 722 | Ga0495629_0839706 | 3300046459 | Unclassified | 604 |
| 723 | Ga0495641_0005488 | 3300046461 | Bacteria | 8549 |
| 724 | Ga0495641_0007308 | 3300046461 | Bacteria | 6919 |
| 725 | Ga0495641_0058474 | 3300046461 | Bacteria | 1744 |
| 726 | Ga0495641_0103798 | 3300046461 | Bacteria | 1268 |
| 727 | Ga0495641_0240700 | 3300046461 | Bacteria | 813 |
| 728 | Ga0495641_0355878 | 3300046461 | Bacteria | 662 |
| 729 | Ga0495651_0001931 | 3300046462 | Bacteria | 16031 |
| 730 | Ga0495651_0016617 | 3300046462 | Bacteria | 5699 |
| 731 | Ga0495651_0029872 | 3300046462 | Bacteria | 4249 |
| 732 | Ga0495651_0033587 | 3300046462 | Bacteria | 4001 |
| 733 | Ga0495651_0045262 | 3300046462 | Unclassified | 3410 |
| 734 | Ga0495651_0049114 | 3300046462 | Bacteria | 3257 |
| 735 | Ga0495651_0182644 | 3300046462 | Unclassified | 1483 |
| 736 | Ga0495653_0006982 | 3300046463 | Bacteria | 9270 |
| 737 | Ga0495653_0014251 | 3300046463 | Bacteria | 6482 |
| 738 | Ga0495653_0020561 | 3300046463 | Bacteria | 5350 |
| 739 | Ga0495653_0103196 | 3300046463 | Bacteria | 2062 |
| 740 | Ga0495653_0132000 | 3300046463 | Bacteria | 1767 |
| 741 | Ga0495653_0175537 | 3300046463 | Bacteria | 1475 |
| 742 | Ga0495653_0593515 | 3300046463 | Bacteria | 681 |
| 743 | Ga0495653_0907430 | 3300046463 | Bacteria | 524 |
| 744 | Ga0495580_0006966 | 3300046472 | Bacteria | 9117 |
| 745 | Ga0495580_0009215 | 3300046472 | Bacteria | 7779 |
| 746 | Ga0495580_0365004 | 3300046472 | Bacteria | 977 |
| 747 | Ga0495582_0002516 | 3300046473 | Bacteria | 10200 |
| 748 | Ga0495582_0006049 | 3300046473 | Bacteria | 6744 |
| 749 | Ga0495582_0039320 | 3300046473 | Bacteria | 2604 |
| 750 | Ga0495582_0056608 | 3300046473 | Bacteria | 2161 |
| 751 | Ga0495582_0746379 | 3300046473 | Bacteria | 566 |
| 752 | Ga0495639_0001397 | 3300046475 | Bacteria | 10819 |
| 753 | Ga0495639_0034558 | 3300046475 | Bacteria | 2262 |
| 754 | Ga0495639_0156267 | 3300046475 | Bacteria | 1102 |
| 755 | Ga0495662_0004842 | 3300046476 | Bacteria | 6743 |
| 756 | Ga0495662_0005405 | 3300046476 | Bacteria | 6392 |
| 757 | Ga0495662_0054148 | 3300046476 | Bacteria | 1938 |
| 758 | Ga0495664_0001454 | 3300046477 | Bacteria | 12550 |
| 759 | Ga0495664_0029636 | 3300046477 | Bacteria | 3202 |
| 760 | Ga0495664_0051629 | 3300046477 | Bacteria | 2441 |
| 761 | Ga0495664_0062254 | 3300046477 | Bacteria | 2222 |
| 762 | Ga0495664_0205015 | 3300046477 | Bacteria | 1195 |
| 763 | Ga0495664_0296910 | 3300046477 | Bacteria | 975 |
| 764 | Ga0495664_0516619 | 3300046477 | Unclassified | 713 |
| 765 | Ga0495664_0862793 | 3300046477 | Bacteria | 530 |
| 766 | Ga0495664_0874113 | 3300046477 | Unclassified | 526 |
| 767 | Ga0495585_0568439 | 3300046492 | Unclassified | 535 |
| 768 | Ga0495594_0038259 | 3300046499 | Bacteria | 2619 |
| 769 | Ga0495594_0295108 | 3300046499 | Bacteria | 924 |
| 770 | Ga0495594_0467370 | 3300046499 | Bacteria | 717 |
| 771 | Ga0495608_0013803 | 3300046511 | Bacteria | 5604 |
| 772 | Ga0495608_0038855 | 3300046511 | Bacteria | 3193 |
| 773 | Ga0495608_0045323 | 3300046511 | Bacteria | 2931 |
| 774 | Ga0495608_0047249 | 3300046511 | Bacteria | 2862 |
| 775 | Ga0495608_0165064 | 3300046511 | Bacteria | 1407 |
| 776 | Ga0495608_0290401 | 3300046511 | Bacteria | 1013 |
| 777 | Ga0495618_0014069 | 3300046514 | Bacteria | 4871 |
| 778 | Ga0495618_0045208 | 3300046514 | Bacteria | 2777 |
| 779 | Ga0495618_0101216 | 3300046514 | Bacteria | 1844 |
| 780 | Ga0495618_0437177 | 3300046514 | Unclassified | 795 |
| 781 | Ga0495618_0453110 | 3300046514 | Bacteria | 778 |
| 782 | Ga0495628_0043904 | 3300046516 | Bacteria | 3558 |
| 783 | Ga0495628_0157921 | 3300046516 | Unclassified | 1724 |
| 784 | Ga0495628_0395377 | 3300046516 | Bacteria | 1010 |
| 785 | Ga0495628_0851393 | 3300046516 | Bacteria | 635 |
| 786 | Ga0495630_0007894 | 3300046517 | Bacteria | 7631 |
| 787 | Ga0495630_0008368 | 3300046517 | Bacteria | 7424 |
| 788 | Ga0495630_0045139 | 3300046517 | Bacteria | 3292 |
| 789 | Ga0495630_0054253 | 3300046517 | Bacteria | 3003 |
| 790 | Ga0495630_0073679 | 3300046517 | Bacteria | 2571 |
| 791 | Ga0495630_0276169 | 3300046517 | Unclassified | 1284 |
| 792 | Ga0495630_0496375 | 3300046517 | Bacteria | 936 |
| 793 | Ga0495666_0004981 | 3300046526 | Bacteria | 6721 |
| 794 | Ga0495666_0121301 | 3300046526 | Bacteria | 1224 |
| 795 | Ga0495666_0141036 | 3300046526 | Bacteria | 1124 |
| 796 | Ga0495652_0038079 | 3300046529 | Bacteria | 4168 |
| 797 | Ga0495652_0187607 | 3300046529 | Bacteria | 1581 |
| 798 | Ga0495652_0214883 | 3300046529 | Bacteria | 1449 |
| 799 | Ga0495652_0226750 | 3300046529 | Bacteria | 1400 |
| 800 | Ga0495652_0359950 | 3300046529 | Bacteria | 1040 |
| 801 | Ga0495652_0418654 | 3300046529 | Bacteria | 944 |
| 802 | Ga0495652_0452665 | 3300046529 | Unclassified | 898 |
| 803 | Ga0495652_0479880 | 3300046529 | Bacteria | 865 |
| 804 | Ga0495652_0641625 | 3300046529 | Bacteria | 720 |
| 805 | Ga0495652_0817250 | 3300046529 | Unclassified | 619 |
| 806 | Ga0495652_1034761 | 3300046529 | Unclassified | 536 |
| 807 | Ga0495665_0039083 | 3300046531 | Bacteria | 2528 |
| 808 | Ga0495665_0043227 | 3300046531 | Bacteria | 2396 |
| 809 | Ga0495665_0083604 | 3300046531 | Bacteria | 1678 |
| 810 | Ga0495665_0161966 | 3300046531 | Bacteria | 1166 |
| 811 | Ga0495665_0185388 | 3300046531 | Unclassified | 1080 |
| 812 | Ga0495640_0011299 | 3300046533 | Bacteria | 6874 |
| 813 | Ga0495640_0030403 | 3300046533 | Bacteria | 3866 |
| 814 | Ga0495640_0035817 | 3300046533 | Bacteria | 3511 |
| 815 | Ga0495640_0044795 | 3300046533 | Bacteria | 3074 |
| 816 | Ga0495640_0507840 | 3300046533 | Bacteria | 733 |
| 817 | Ga0495586_0080183 | 3300046535 | Bacteria | 1793 |
| 818 | Ga0495586_0131097 | 3300046535 | Bacteria | 1403 |
| 819 | Ga0495586_0226551 | 3300046535 | Bacteria | 1063 |
| 820 | Ga0495586_0567474 | 3300046535 | Bacteria | 655 |
| 821 | Ga0495587_0005768 | 3300046536 | Bacteria | 8069 |
| 822 | Ga0495587_0009878 | 3300046536 | Bacteria | 6092 |
| 823 | Ga0495587_0037601 | 3300046536 | Bacteria | 2905 |
| 824 | Ga0495587_0232225 | 3300046536 | Bacteria | 1039 |
| 825 | Ga0495587_0234689 | 3300046536 | Unclassified | 1033 |
| 826 | Ga0495645_0061367 | 3300046543 | Bacteria | 2724 |
| 827 | Ga0495645_0099890 | 3300046543 | Bacteria | 2064 |
| 828 | Ga0495645_0145931 | 3300046543 | Bacteria | 1648 |
| 829 | Ga0495645_0385621 | 3300046543 | Unclassified | 895 |
| 830 | Ga0495645_0862572 | 3300046543 | Bacteria | 539 |
| 831 | Ga0495622_0063965 | 3300046557 | Bacteria | 1702 |
| 832 | Ga0495667_0001128 | 3300046559 | Bacteria | 17388 |
| 833 | Ga0495667_0002989 | 3300046559 | Bacteria | 11339 |
| 834 | Ga0495667_0013187 | 3300046559 | Bacteria | 5597 |
| 835 | Ga0495667_0036410 | 3300046559 | Bacteria | 3285 |
| 836 | Ga0495667_0126551 | 3300046559 | Bacteria | 1648 |
| 837 | Ga0495667_0131551 | 3300046559 | Bacteria | 1614 |
| 838 | Ga0495667_0926346 | 3300046559 | Unclassified | 533 |
| 839 | Ga0495656_0054356 | 3300046615 | Bacteria | 1723 |
| 840 | Ga0495656_0546682 | 3300046615 | Bacteria | 617 |
| 841 | Ga0495634_0018598 | 3300046642 | Bacteria | 4943 |
| 842 | Ga0495634_0022260 | 3300046642 | Bacteria | 4466 |
| 843 | Ga0495634_0196835 | 3300046642 | Bacteria | 1254 |
| 844 | Ga0495634_0214396 | 3300046642 | Bacteria | 1190 |
| 845 | Ga0495634_0590870 | 3300046642 | Unclassified | 645 |
| 846 | Ga0495635_0003541 | 3300046663 | Bacteria | 10808 |
| 847 | Ga0495635_0011673 | 3300046663 | Bacteria | 6157 |
| 848 | Ga0495635_0015907 | 3300046663 | Bacteria | 5255 |
| 849 | Ga0495635_0072084 | 3300046663 | Bacteria | 2367 |
| 850 | Ga0495635_0142258 | 3300046663 | Bacteria | 1633 |
| 851 | Ga0495635_0146243 | 3300046663 | Bacteria | 1609 |
| 852 | Ga0495635_0732528 | 3300046663 | Bacteria | 640 |
| 853 | Ga0495588_0656516 | 3300046674 | Bacteria | 549 |
| 854 | Ga0495657_0013621 | 3300046675 | Bacteria | 5995 |
| 855 | Ga0495657_0013795 | 3300046675 | Bacteria | 5948 |
| 856 | Ga0495657_0029482 | 3300046675 | Bacteria | 3848 |
| 857 | Ga0495657_0043047 | 3300046675 | Bacteria | 3080 |
| 858 | Ga0495657_0057990 | 3300046675 | Bacteria | 2572 |
| 859 | Ga0495657_0134572 | 3300046675 | Bacteria | 1545 |
| 860 | Ga0495599_0007731 | 3300046678 | Bacteria | 6526 |
| 861 | Ga0495599_0084819 | 3300046678 | Bacteria | 1978 |
| 862 | Ga0495599_0120858 | 3300046678 | Bacteria | 1628 |
| 863 | Ga0495623_0026081 | 3300046679 | Bacteria | 3764 |
| 864 | Ga0495623_0033379 | 3300046679 | Bacteria | 3303 |
| 865 | Ga0495623_0069692 | 3300046679 | Bacteria | 2191 |
| 866 | Ga0495623_0559007 | 3300046679 | Bacteria | 598 |
| 867 | Ga0495646_0014834 | 3300046680 | Bacteria | 4950 |
| 868 | Ga0495646_0039940 | 3300046680 | Bacteria | 2891 |
| 869 | Ga0495646_0337090 | 3300046680 | Unclassified | 792 |
| 870 | Ga0495646_0695396 | 3300046680 | Bacteria | 511 |
| 871 | Ga0495647_0002984 | 3300046681 | Bacteria | 5380 |
| 872 | Ga0495647_0043419 | 3300046681 | Bacteria | 1720 |
| 873 | Ga0495647_0300136 | 3300046681 | Unclassified | 724 |
| 874 | Ga0495658_0007556 | 3300046683 | Bacteria | 5387 |
| 875 | Ga0495658_0023564 | 3300046683 | Bacteria | 3268 |
| 876 | Ga0495658_0079429 | 3300046683 | Bacteria | 1922 |
| 877 | Ga0495658_0140515 | 3300046683 | Unclassified | 1476 |
| 878 | Ga0495658_0357199 | 3300046683 | Unclassified | 929 |
| 879 | Ga0495658_0770177 | 3300046683 | Unclassified | 616 |
| 880 | Ga0495613_0010937 | 3300046689 | Bacteria | 6736 |
| 881 | Ga0495613_0040395 | 3300046689 | Bacteria | 3457 |
| 882 | Ga0495613_0302208 | 3300046689 | Bacteria | 1107 |
| 883 | Ga0495624_0041428 | 3300046690 | Bacteria | 2945 |
| 884 | Ga0495624_0045325 | 3300046690 | Bacteria | 2800 |
| 885 | Ga0495624_0075697 | 3300046690 | Bacteria | 2090 |
| 886 | Ga0495624_0251814 | 3300046690 | Bacteria | 1068 |
| 887 | Ga0495670_0287547 | 3300046691 | Bacteria | 880 |
| 888 | Ga0495600_0007024 | 3300046809 | Bacteria | 6878 |
| 889 | Ga0495600_0009905 | 3300046809 | Bacteria | 5902 |
| 890 | Ga0495600_0029377 | 3300046809 | Bacteria | 3559 |
| 891 | Ga0495600_0462237 | 3300046809 | Unclassified | 784 |
| 892 | Ga0495600_0518791 | 3300046809 | Bacteria | 731 |
| 893 | Ga0495581_0001789 | 3300047315 | Bacteria | 12005 |
| 894 | Ga0495581_0006628 | 3300047315 | Bacteria | 6708 |
| 895 | Ga0495581_0020589 | 3300047315 | Bacteria | 3827 |
| 896 | Ga0495581_0033225 | 3300047315 | Bacteria | 2987 |
| 897 | Ga0495604_0006908 | 3300047317 | Bacteria | 8997 |
| 898 | Ga0495604_0011917 | 3300047317 | Bacteria | 6914 |
| 899 | Ga0495604_0014246 | 3300047317 | Bacteria | 6338 |
| 900 | Ga0495604_0055234 | 3300047317 | Bacteria | 3061 |
| 901 | Ga0495604_0111258 | 3300047317 | Bacteria | 1997 |
| 902 | Ga0495604_0220828 | 3300047317 | Bacteria | 1305 |
| 903 | Ga0495604_1044164 | 3300047317 | Bacteria | 504 |
| 904 | Ga0495674_0037957 | 3300047319 | Bacteria | 4327 |
| 905 | Ga0495674_0091354 | 3300047319 | Bacteria | 2600 |
| 906 | Ga0495674_0175002 | 3300047319 | Unclassified | 1789 |
| 907 | Ga0495674_0246110 | 3300047319 | Bacteria | 1472 |
| 908 | Ga0495674_0417424 | 3300047319 | Bacteria | 1081 |
| 909 | Ga0495674_0474938 | 3300047319 | Bacteria | 1002 |
| 910 | Ga0495674_0547662 | 3300047319 | Bacteria | 921 |
| 911 | Ga0495674_0748817 | 3300047319 | Bacteria | 763 |
| 912 | Ga0495674_0869235 | 3300047319 | Bacteria | 698 |
| 913 | Ga0495674_1092874 | 3300047319 | Bacteria | 607 |
| 914 | Ga0495674_1209162 | 3300047319 | Bacteria | 571 |
| 915 | Ga0495676_0019767 | 3300047321 | Bacteria | 5920 |
| 916 | Ga0495676_0023723 | 3300047321 | Bacteria | 5319 |
| 917 | Ga0495676_0080861 | 3300047321 | Bacteria | 2465 |
| 918 | Ga0495676_0200289 | 3300047321 | Bacteria | 1388 |
| 919 | Ga0495676_0400440 | 3300047321 | Unclassified | 911 |
| 920 | Ga0495676_0434099 | 3300047321 | Bacteria | 868 |
| 921 | Ga0495676_0441943 | 3300047321 | Unclassified | 859 |
| 922 | Ga0495680_0005813 | 3300047322 | Bacteria | 11548 |
| 923 | Ga0495680_0007024 | 3300047322 | Bacteria | 10382 |
| 924 | Ga0495680_0008161 | 3300047322 | Bacteria | 9545 |
| 925 | Ga0495680_0012284 | 3300047322 | Bacteria | 7545 |
| 926 | Ga0495680_0025800 | 3300047322 | Bacteria | 4858 |
| 927 | Ga0495680_0039127 | 3300047322 | Bacteria | 3785 |
| 928 | Ga0495680_0291150 | 3300047322 | Bacteria | 1148 |
| 929 | Ga0495680_0623993 | 3300047322 | Bacteria | 719 |
| 930 | Ga0495680_0732845 | 3300047322 | Bacteria | 650 |
| 931 | Ga0495675_0012751 | 3300047444 | Bacteria | 5294 |
| 932 | Ga0495675_0013817 | 3300047444 | Bacteria | 5103 |
| 933 | Ga0495675_0022321 | 3300047444 | Bacteria | 4034 |
| 934 | Ga0495675_0099302 | 3300047444 | Bacteria | 1823 |
| 935 | Ga0495675_0170925 | 3300047444 | Bacteria | 1335 |
| 936 | Ga0495684_0008155 | 3300047471 | Bacteria | 8102 |
| 937 | Ga0495684_0013873 | 3300047471 | Bacteria | 6199 |
| 938 | Ga0495684_0021270 | 3300047471 | Bacteria | 4997 |
| 939 | Ga0495684_0027462 | 3300047471 | Bacteria | 4369 |
| 940 | Ga0495684_0043023 | 3300047471 | Bacteria | 3457 |
| 941 | Ga0495684_0107490 | 3300047471 | Bacteria | 2107 |
| 942 | Ga0495684_0227390 | 3300047471 | Bacteria | 1365 |
| 943 | Ga0495684_0328927 | 3300047471 | Bacteria | 1090 |
| 944 | Ga0495684_0471291 | 3300047471 | Unclassified | 869 |
| 945 | Ga0495593_0002377 | 3300047673 | Bacteria | 11305 |
| 946 | Ga0495593_0004968 | 3300047673 | Bacteria | 7877 |
| 947 | Ga0495593_0035071 | 3300047673 | Bacteria | 2725 |
| 948 | Ga0495593_0044899 | 3300047673 | Bacteria | 2361 |
| 949 | Ga0495602_0054740 | 3300048088 | Bacteria | 3519 |
| 950 | Ga0495602_0099899 | 3300048088 | Bacteria | 2384 |
| 951 | Ga0495602_0111751 | 3300048088 | Bacteria | 2218 |
| 952 | Ga0495602_0117041 | 3300048088 | Bacteria | 2152 |
| 953 | Ga0495602_0135452 | 3300048088 | Bacteria | 1957 |
| 954 | Ga0495602_0480664 | 3300048088 | Bacteria | 872 |
| 955 | Ga0495602_1148917 | 3300048088 | Bacteria | 507 |
| 956 | Ga0495614_0024138 | 3300048089 | Bacteria | 2625 |
| 957 | Ga0495614_0253699 | 3300048089 | Bacteria | 805 |
| 958 | Ga0495614_0507508 | 3300048089 | Bacteria | 574 |
| 959 | Ga0496100_0160498 | 3300048903 | Bacteria | 1611 |
| 960 | Ga0496100_0192929 | 3300048903 | Bacteria | 1480 |
| 961 | Ga0496100_0263269 | 3300048903 | Bacteria | 1279 |
| 962 | Ga0496100_1621281 | 3300048903 | Unclassified | 511 |
| 963 | Ga0496101_0030527 | 3300048904 | Bacteria | 3780 |
| 964 | Ga0496101_0064367 | 3300048904 | Bacteria | 2671 |
| 965 | Ga0496101_0352028 | 3300048904 | Bacteria | 1157 |
| 966 | Ga0496101_0665505 | 3300048904 | Bacteria | 822 |
| 967 | Ga0496102_0088723 | 3300048905 | Bacteria | 2860 |
| 968 | Ga0496102_0119224 | 3300048905 | Bacteria | 2463 |
| 969 | Ga0496102_0292786 | 3300048905 | Bacteria | 1534 |
| 970 | Ga0496102_0298910 | 3300048905 | Bacteria | 1517 |
| 971 | Ga0496102_0307783 | 3300048905 | Bacteria | 1493 |
| 972 | Ga0496103_0017239 | 3300048906 | Bacteria | 4320 |
| 973 | Ga0496103_0201743 | 3300048906 | Unclassified | 1279 |
| 974 | Ga0496103_0339444 | 3300048906 | Bacteria | 966 |
| 975 | Ga0496104_0005558 | 3300048907 | Bacteria | 11038 |
| 976 | Ga0496104_0012036 | 3300048907 | Bacteria | 7764 |
| 977 | Ga0496104_0553161 | 3300048907 | Bacteria | 1061 |
| 978 | Ga0496104_1366231 | 3300048907 | Unclassified | 611 |
| 979 | Ga0496104_1406913 | 3300048907 | Unclassified | 600 |
| 980 | Ga0496105_0001173 | 3300048908 | Bacteria | 18253 |
| 981 | Ga0496105_0001930 | 3300048908 | Bacteria | 14896 |
| 982 | Ga0496105_0016692 | 3300048908 | Bacteria | 5865 |
| 983 | Ga0496105_0790005 | 3300048908 | Bacteria | 722 |
| 984 | Ga0496105_1072199 | 3300048908 | Unclassified | 599 |
| 985 | Ga0496106_0053070 | 3300048909 | Bacteria | 3060 |
| 986 | Ga0496106_0161806 | 3300048909 | Bacteria | 1770 |
| 987 | Ga0496106_0167631 | 3300048909 | Bacteria | 1739 |
| 988 | Ga0496106_0283453 | 3300048909 | Bacteria | 1327 |
| 989 | Ga0496106_1012401 | 3300048909 | Bacteria | 653 |
| 990 | Ga0496107_0030892 | 3300048910 | Bacteria | 3820 |
| 991 | Ga0496107_0560711 | 3300048910 | Bacteria | 846 |
| 992 | Ga0496107_0673765 | 3300048910 | Bacteria | 762 |
| 993 | Ga0496107_0957028 | 3300048910 | Bacteria | 622 |
| 994 | Ga0496107_0969630 | 3300048910 | Unclassified | 618 |
| 995 | Ga0496107_1073144 | 3300048910 | Bacteria | 582 |
| 996 | Ga0496108_0043675 | 3300048911 | Bacteria | 3743 |
| 997 | Ga0496108_0127846 | 3300048911 | Bacteria | 2183 |
| 998 | Ga0496108_0232051 | 3300048911 | Unclassified | 1605 |
| 999 | Ga0496108_0407957 | 3300048911 | Bacteria | 1187 |
| 1000 | Ga0496108_1178587 | 3300048911 | Bacteria | 648 |
| 1001 | Ga0496108_1311530 | 3300048911 | Bacteria | 608 |
| 1002 | Ga0496109_0030550 | 3300048912 | Bacteria | 4829 |
| 1003 | Ga0496109_0138031 | 3300048912 | Bacteria | 2279 |
| 1004 | Ga0496109_0276437 | 3300048912 | Bacteria | 1582 |
| 1005 | Ga0496109_0540341 | 3300048912 | Unclassified | 1099 |
| 1006 | Ga0496109_1196981 | 3300048912 | Unclassified | 696 |
| 1007 | Ga0496110_0254655 | 3300048913 | Bacteria | 1598 |
| 1008 | Ga0496110_0355769 | 3300048913 | Bacteria | 1334 |
| 1009 | Ga0496110_0632246 | 3300048913 | Bacteria | 969 |
| 1010 | Ga0496110_0735396 | 3300048913 | Bacteria | 889 |
| 1011 | Ga0496111_0067859 | 3300048914 | Bacteria | 2591 |
| 1012 | Ga0496111_0224570 | 3300048914 | Unclassified | 1395 |
| 1013 | Ga0496112_0125053 | 3300048915 | Bacteria | 2542 |
| 1014 | Ga0496112_0142017 | 3300048915 | Bacteria | 2370 |
| 1015 | Ga0496112_0221523 | 3300048915 | Unclassified | 1848 |
| 1016 | Ga0496113_0035625 | 3300048916 | Bacteria | 3640 |
| 1017 | Ga0496113_0107297 | 3300048916 | Bacteria | 2170 |
| 1018 | Ga0496113_0226392 | 3300048916 | Unclassified | 1491 |
| 1019 | Ga0496113_0229378 | 3300048916 | Bacteria | 1480 |
| 1020 | Ga0496113_0392809 | 3300048916 | Bacteria | 1113 |
| 1021 | Ga0496114_0004915 | 3300048917 | Bacteria | 10411 |
| 1022 | Ga0496114_0005249 | 3300048917 | Bacteria | 10125 |
| 1023 | Ga0496114_0021533 | 3300048917 | Bacteria | 5245 |
| 1024 | Ga0496114_0988059 | 3300048917 | Bacteria | 725 |
| 1025 | Ga0496115_0001816 | 3300048918 | Bacteria | 15268 |
| 1026 | Ga0496115_0004006 | 3300048918 | Bacteria | 10629 |
| 1027 | Ga0496115_0063941 | 3300048918 | Bacteria | 2969 |
| 1028 | Ga0496115_0082329 | 3300048918 | Bacteria | 2622 |
| 1029 | Ga0496115_1152863 | 3300048918 | Unclassified | 585 |
| 1030 | Ga0496126_0804144 | 3300048929 | Unclassified | 721 |
| 1031 | Ga0496126_1140488 | 3300048929 | Bacteria | 577 |
| 1032 | Ga0501034_0030504 | 3300049571 | Bacteria | 5481 |
| 1033 | Ga0501036_0013958 | 3300049572 | Bacteria | 6679 |
| 1034 | Ga0501038_0015519 | 3300049574 | Bacteria | 6924 |
| 1035 | Ga0501038_0321290 | 3300049574 | Bacteria | 1211 |
| 1036 | Ga0501042_0001499 | 3300049578 | Bacteria | 13792 |
| 1037 | Ga0501043_0026956 | 3300049579 | Bacteria | 4509 |
| 1038 | Ga0501047_0007973 | 3300049581 | Bacteria | 9986 |
| 1039 | Ga0501047_0619187 | 3300049581 | Bacteria | 903 |
| 1040 | Ga0501048_0007396 | 3300049582 | Bacteria | 8321 |
| 1041 | Ga0501074_0000131 | 3300049590 | Bacteria | 38492 |
| 1042 | Ga0501044_0097071 | 3300049823 | Bacteria | 2968 |
| 1043 | Ga0501044_0575698 | 3300049823 | Bacteria | 1021 |
| 1044 | nmdc:mga05p37_281870_c1 | 3300050507 | Bacteria | 1981 |
| 1045 | nmdc:mga05p37_428806_c1 | 3300050507 | Bacteria | 1537 |
| 1046 | nmdc:mga05p37_5557_c1 | 3300050507 | Bacteria | 14821 |
| 1047 | nmdc:mga09592_82282_c1 | 3300050508 | Bacteria | 2743 |
| 1048 | nmdc:mga06r32_247613_c1 | 3300050510 | Bacteria | 1770 |
| 1049 | nmdc:mga08y16_133214_c1 | 3300050511 | Bacteria | 2583 |
| 1050 | nmdc:mga08y16_354509_c1 | 3300050511 | Bacteria | 1507 |
| 1051 | nmdc:mga0n895_1015897_c1 | 3300050512 | Bacteria | 810 |
| 1052 | nmdc:mga0n895_1473240_c1 | 3300050512 | Bacteria | 648 |
| 1053 | nmdc:mga0n895_178154_c1 | 3300050512 | Bacteria | 2157 |
| 1054 | nmdc:mga0n895_192967_c1 | 3300050512 | Bacteria | 2068 |
| 1055 | nmdc:mga0n895_34833_c1 | 3300050512 | Bacteria | 4849 |
| 1056 | nmdc:mga0n895_52873_c1 | 3300050512 | Unclassified | 3989 |
| 1057 | nmdc:mga0n895_594341_c1 | 3300050512 | Unclassified | 1110 |
| 1058 | nmdc:mga0n895_647492_c1 | 3300050512 | Unclassified | 1056 |
| 1059 | nmdc:mga0n895_87229_c1 | 3300050512 | Bacteria | 3118 |
| 1060 | nmdc:mga0rr50_110389_c1 | 3300050513 | Bacteria | 2175 |
| 1061 | nmdc:mga0rr50_1633114_c1 | 3300050513 | Bacteria | 544 |
| 1062 | nmdc:mga0rr50_23525_c1 | 3300050513 | Bacteria | 4250 |
| 1063 | nmdc:mga0rr50_261359_c1 | 3300050513 | Bacteria | 1440 |
| 1064 | nmdc:mga0rr50_30018_c1 | 3300050513 | Bacteria | 3843 |
| 1065 | nmdc:mga0rr50_42924_c1 | 3300050513 | Bacteria | 3306 |
| 1066 | nmdc:mga0rr50_542932_c1 | 3300050513 | Bacteria | 990 |
| 1067 | nmdc:mga0rr50_71005_c1 | 3300050513 | Bacteria | 2655 |
| 1068 | nmdc:mga08x19_169247_c1 | 3300050514 | Bacteria | 1488 |
| 1069 | nmdc:mga08x19_170974_c1 | 3300050514 | Bacteria | 1480 |
| 1070 | nmdc:mga08x19_325655_c1 | 3300050514 | Bacteria | 1070 |
| 1071 | nmdc:mga08x19_387814_c1 | 3300050514 | Unclassified | 979 |
| 1072 | nmdc:mga08x19_587874_c1 | 3300050514 | Bacteria | 789 |
| 1073 | nmdc:mga08x19_81998_c1 | 3300050514 | Bacteria | 2119 |
| 1074 | nmdc:mga08x19_907361_c1 | 3300050514 | Bacteria | 626 |
| 1075 | nmdc:mga0a205_108248_c1 | 3300050515 | Bacteria | 2677 |
| 1076 | nmdc:mga0a205_251256_c1 | 3300050515 | Bacteria | 1648 |
| 1077 | nmdc:mga0a205_950212_c1 | 3300050515 | Bacteria | 706 |
| 1078 | Ga0495601_0025376 | 3300053077 | Bacteria | 3654 |
| 1079 | Ga0495601_0056027 | 3300053077 | Unclassified | 2496 |
| 1080 | Ga0495601_0063959 | 3300053077 | Bacteria | 2339 |
| 1081 | Ga0495601_0401533 | 3300053077 | Bacteria | 889 |
| 1082 | Ga0495601_0495685 | 3300053077 | Bacteria | 788 |
| 1083 | Ga0495612_0002023 | 3300053078 | Bacteria | 8357 |
| 1084 | Ga0495612_0163773 | 3300053078 | Bacteria | 972 |
| 1085 | Ga0495612_0419798 | 3300053078 | Bacteria | 609 |
| 1086 | Ga0495595_0028612 | 3300053084 | Bacteria | 2489 |
| 1087 | Ga0495595_0060876 | 3300053084 | Bacteria | 1767 |
| 1088 | Ga0495595_0097391 | 3300053084 | Bacteria | 1417 |
| 1089 | Ga0495595_0323644 | 3300053084 | Unclassified | 776 |
| 1090 | Ga0495595_0487705 | 3300053084 | Unclassified | 628 |
| 1091 | Ga0495619_0027633 | 3300053085 | Bacteria | 3656 |
| 1092 | Ga0495619_0109402 | 3300053085 | Bacteria | 1887 |
| 1093 | Ga0495619_0135727 | 3300053085 | Unclassified | 1692 |
| 1094 | Ga0495619_0173812 | 3300053085 | Bacteria | 1490 |
| 1095 | Ga0495619_0369461 | 3300053085 | Unclassified | 991 |
| 1096 | Ga0436364_0443873 | |||
| 1097 | JGI24737J22298_10202194 | |||
| 1098 | JGI25404J52841_10111436 | |||
| 1099 | JGI25405J52794_10050403 | |||
| 1100 | Ga0070658_10325590 | |||
| 1101 | Ga0070683_100071579 | |||
| 1102 | Ga0070690_100261540 | |||
| 1103 | Ga0068869_100249338 | |||
| 1104 | Ga0068869_100382601 | |||
| 1105 | Ga0070666_10132316 | |||
| 1106 | Ga0070680_100040809 | |||
| 1107 | Ga0070682_100006862 | |||
| 1108 | Ga0070682_100126140 | |||
| 1109 | Ga0068868_100096921 | |||
| 1110 | Ga0068868_100192757 | |||
| 1111 | Ga0070660_100034963 | |||
| 1112 | Ga0070660_100588112 | |||
| 1113 | Ga0070660_100794663 | |||
| 1114 | Ga0070689_100037639 | |||
| 1115 | Ga0070691_10176070 | |||
| 1116 | Ga0070691_10491977 | |||
| 1117 | Ga0070691_10498447 | |||
| 1118 | Ga0070691_11056319 | |||
| 1119 | Ga0070687_100089816 | |||
| 1120 | Ga0070661_100287572 | |||
| 1121 | Ga0070692_10256097 | |||
| 1122 | Ga0070669_101421567 | |||
| 1123 | Ga0070675_100434325 | |||
| 1124 | Ga0070671_100896707 | |||
| 1125 | Ga0070674_100013315 | |||
| 1126 | Ga0070674_100284529 | |||
| 1127 | Ga0070673_100137539 | |||
| 1128 | Ga0070673_100941369 | |||
| 1129 | Ga0070688_100422401 | |||
| 1130 | Ga0070659_100110337 | |||
| 1131 | Ga0070659_100951735 | |||
| 1132 | Ga0070659_101063261 | |||
| 1133 | Ga0070703_10202194 | |||
| 1134 | Ga0070709_10001397 | |||
| 1135 | Ga0070709_10003711 | |||
| 1136 | Ga0070709_10044359 | |||
| 1137 | Ga0070709_10105060 | |||
| 1138 | Ga0070709_10146431 | |||
| 1139 | Ga0070709_10207354 | |||
| 1140 | Ga0070709_10408560 | |||
| 1141 | Ga0070709_10450323 | |||
| 1142 | Ga0070709_10458540 | |||
| 1143 | Ga0070709_10562942 | |||
| 1144 | Ga0070714_100005398 | |||
| 1145 | Ga0070714_100013301 | |||
| 1146 | Ga0070714_100013360 | |||
| 1147 | Ga0070714_100034957 | |||
| 1148 | Ga0070714_100065822 | |||
| 1149 | Ga0070714_100094978 | |||
| 1150 | Ga0070714_100118336 | |||
| 1151 | Ga0070714_100141194 | |||
| 1152 | Ga0070714_100172905 | |||
| 1153 | Ga0070714_100235439 | |||
| 1154 | Ga0070714_100477758 | |||
| 1155 | Ga0070714_100549443 | |||
| 1156 | Ga0070714_100573081 | |||
| 1157 | Ga0070714_100825326 | |||
| 1158 | Ga0070714_101802125 | |||
| 1159 | Ga0070714_101890711 | |||
| 1160 | Ga0070713_100018032 | |||
| 1161 | Ga0070713_100022599 | |||
| 1162 | Ga0070713_100046970 | |||
| 1163 | Ga0070713_100122661 | |||
| 1164 | Ga0070713_100175129 | |||
| 1165 | Ga0070713_100356809 | |||
| 1166 | Ga0070713_100400572 | |||
| 1167 | Ga0070713_100440115 | |||
| 1168 | Ga0070713_100645885 | |||
| 1169 | Ga0070713_100669431 | |||
| 1170 | Ga0070713_100872465 | |||
| 1171 | Ga0070713_100878916 | |||
| 1172 | Ga0070713_100998147 | |||
| 1173 | Ga0070713_101050307 | |||
| 1174 | Ga0070713_101061029 | |||
| 1175 | Ga0070713_101144752 | |||
| 1176 | Ga0070713_101289693 | |||
| 1177 | Ga0070710_10000564 | |||
| 1178 | Ga0070710_10002530 | |||
| 1179 | Ga0070710_10011960 | |||
| 1180 | Ga0070710_10053545 | |||
| 1181 | Ga0070710_10098243 | |||
| 1182 | Ga0070710_10136861 | |||
| 1183 | Ga0070710_10602762 | |||
| 1184 | Ga0070710_10794210 | |||
| 1185 | Ga0070710_10852187 | |||
| 1186 | Ga0070710_11181783 | |||
| 1187 | Ga0070701_10023709 | |||
| 1188 | Ga0070711_100003441 | |||
| 1189 | Ga0070711_100017642 | |||
| 1190 | Ga0070711_100022377 | |||
| 1191 | Ga0070711_100025720 | |||
| 1192 | Ga0070711_100037053 | |||
| 1193 | Ga0070711_100130299 | |||
| 1194 | Ga0070711_100226362 | |||
| 1195 | Ga0070711_100618905 | |||
| 1196 | Ga0070711_101199020 | |||
| 1197 | Ga0070705_100109285 | |||
| 1198 | Ga0070705_100296538 | |||
| 1199 | Ga0070705_100328952 | |||
| 1200 | Ga0070705_101874171 | |||
| 1201 | Ga0070694_100339191 | |||
| 1202 | Ga0070694_101668380 | |||
| 1203 | Ga0070708_100013728 | |||
| 1204 | Ga0070708_100711925 | |||
| 1205 | Ga0070708_100910492 | |||
| 1206 | Ga0070708_100939219 | |||
| 1207 | Ga0070663_100195979 | |||
| 1208 | Ga0070678_101107085 | |||
| 1209 | Ga0070678_101138474 | |||
| 1210 | Ga0070662_100251265 | |||
| 1211 | Ga0070662_100355811 | |||
| 1212 | Ga0070662_101214382 | |||
| 1213 | Ga0070681_10237959 | |||
| 1214 | Ga0068867_100861536 | |||
| 1215 | Ga0068867_101947685 | |||
| 1216 | Ga0070685_10028813 | |||
| 1217 | Ga0070706_100008647 | |||
| 1218 | Ga0070706_100017412 | |||
| 1219 | Ga0070706_100039718 | |||
| 1220 | Ga0070706_100048528 | |||
| 1221 | Ga0070706_100107843 | |||
| 1222 | Ga0070706_100524806 | |||
| 1223 | Ga0070706_100574934 | |||
| 1224 | Ga0070706_101570391 | |||
| 1225 | Ga0070707_100000261 | |||
| 1226 | Ga0070707_100038335 | |||
| 1227 | Ga0070707_100068496 | |||
| 1228 | Ga0070707_100347573 | |||
| 1229 | Ga0070707_100920136 | |||
| 1230 | Ga0070707_101753116 | |||
| 1231 | Ga0070707_101963678 | |||
| 1232 | Ga0070698_100000396 | |||
| 1233 | Ga0070698_100001643 | |||
| 1234 | Ga0070698_100016840 | |||
| 1235 | Ga0070698_100024922 | |||
| 1236 | Ga0070698_100068745 | |||
| 1237 | Ga0070698_100094289 | |||
| 1238 | Ga0070698_100140019 | |||
| 1239 | Ga0070698_100181703 | |||
| 1240 | Ga0070698_100256605 | |||
| 1241 | Ga0070699_100001967 | |||
| 1242 | Ga0070699_100613130 | |||
| 1243 | Ga0070699_100724894 | |||
| 1244 | Ga0070699_100816045 | |||
| 1245 | Ga0070699_100857875 | |||
| 1246 | Ga0070699_101151406 | |||
| 1247 | Ga0070699_101231271 | |||
| 1248 | Ga0070679_100358534 | |||
| 1249 | Ga0070684_100200460 | |||
| 1250 | Ga0070697_100012204 | |||
| 1251 | Ga0070697_100042441 | |||
| 1252 | Ga0070697_100521785 | |||
| 1253 | Ga0070697_102103644 | |||
| 1254 | Ga0068853_100066910 | |||
| 1255 | Ga0068853_100137020 | |||
| 1256 | Ga0068853_100647992 | |||
| 1257 | Ga0070672_100459976 | |||
| 1258 | Ga0070686_100027795 | |||
| 1259 | Ga0070695_100025310 | |||
| 1260 | Ga0070695_100574710 | |||
| 1261 | Ga0070695_101419058 | |||
| 1262 | Ga0070696_100201547 | |||
| 1263 | Ga0070696_100273333 | |||
| 1264 | Ga0070696_100379342 | |||
| 1265 | Ga0070693_100191143 | |||
| 1266 | Ga0070693_101156032 | |||
| 1267 | Ga0070665_100741309 | |||
| 1268 | Ga0070704_100114176 | |||
| 1269 | Ga0070704_101762867 | |||
| 1270 | Ga0068855_100433543 | |||
| 1271 | Ga0068855_101822627 | |||
| 1272 | Ga0070664_100046231 | |||
| 1273 | Ga0068857_100048065 | |||
| 1274 | Ga0068857_100392165 | |||
| 1275 | Ga0068854_100117339 | |||
| 1276 | Ga0068854_100572322 | |||
| 1277 | Ga0068856_100235423 | |||
| 1278 | Ga0068856_100313338 | |||
| 1279 | Ga0068856_100321485 | |||
| 1280 | Ga0068856_102087563 | |||
| 1281 | Ga0070702_100025773 | |||
| 1282 | Ga0070702_100811235 | |||
| 1283 | Ga0068852_100038762 | |||
| 1284 | Ga0068859_101011630 | |||
| 1285 | Ga0068864_100251702 | |||
| 1286 | Ga0068866_10031261 | |||
| 1287 | Ga0068861_100189402 | |||
| 1288 | Ga0068861_100190141 | |||
| 1289 | Ga0068861_101602344 | |||
| 1290 | Ga0068870_10067247 | |||
| 1291 | Ga0068863_100069818 | |||
| 1292 | Ga0068863_101247836 | |||
| 1293 | Ga0068863_101287460 | |||
| 1294 | Ga0068858_100539887 | |||
| 1295 | Ga0068858_101145381 | |||
| 1296 | Ga0068858_102132180 | |||
| 1297 | Ga0068860_101423109 | |||
| 1298 | Ga0068862_100624434 | |||
| 1299 | Ga0081455_10021117 | |||
| 1300 | Ga0081455_10046999 | |||
| 1301 | Ga0081455_10058834 | |||
| 1302 | Ga0081455_11065072 | |||
| 1303 | Ga0081540_1000089 | |||
| 1304 | Ga0081540_1002152 | |||
| 1305 | Ga0070717_10001816 | |||
| 1306 | Ga0070717_10007042 | |||
| 1307 | Ga0070717_10019846 | |||
| 1308 | Ga0070717_10022471 | |||
| 1309 | Ga0070717_10025987 | |||
| 1310 | Ga0070717_10256786 | |||
| 1311 | Ga0070717_10435464 | |||
| 1312 | Ga0070717_10552894 | |||
| 1313 | Ga0070717_11425576 | |||
| 1314 | Ga0070717_12106754 | |||
| 1315 | Ga0075432_10169055 | |||
| 1316 | Ga0070715_10002583 | |||
| 1317 | Ga0070715_10044483 | |||
| 1318 | Ga0070715_10086220 | |||
| 1319 | Ga0070715_10413660 | |||
| 1320 | Ga0070716_100000834 | |||
| 1321 | Ga0070716_100002733 | |||
| 1322 | Ga0070716_100012302 | |||
| 1323 | Ga0070716_100019222 | |||
| 1324 | Ga0070716_100053890 | |||
| 1325 | Ga0070716_100214542 | |||
| 1326 | Ga0070716_100235008 | |||
| 1327 | Ga0070716_100468701 | |||
| 1328 | Ga0070712_100007242 | |||
| 1329 | Ga0070712_100061825 | |||
| 1330 | Ga0070712_100092124 | |||
| 1331 | Ga0070712_100097103 | |||
| 1332 | Ga0070712_100120554 | |||
| 1333 | Ga0070712_100210162 | |||
| 1334 | Ga0070712_100246863 | |||
| 1335 | Ga0070712_100452274 | |||
| 1336 | Ga0070712_100488579 | |||
| 1337 | Ga0070712_100752543 | |||
| 1338 | Ga0070712_100814641 | |||
| 1339 | Ga0070712_100920157 | |||
| 1340 | Ga0070712_100927791 | |||
| 1341 | Ga0070712_101760659 | |||
| 1342 | Ga0075427_10097858 | |||
| 1343 | Ga0097621_100140470 | |||
| 1344 | Ga0097621_100267296 | |||
| 1345 | Ga0097621_101642473 | |||
| 1346 | Ga0068871_100101145 | |||
| 1347 | Ga0068871_100774758 | |||
| 1348 | Ga0068871_101365541 | |||
| 1349 | Ga0075428_100815074 | |||
| 1350 | Ga0075430_100090736 | |||
| 1351 | Ga0075431_100049882 | |||
| 1352 | Ga0075433_10021467 | |||
| 1353 | Ga0075433_10242343 | |||
| 1354 | Ga0075433_10260193 | |||
| 1355 | Ga0075434_100002174 | |||
| 1356 | Ga0075434_100059421 | |||
| 1357 | Ga0075434_100104542 | |||
| 1358 | Ga0075434_100363886 | |||
| 1359 | Ga0075434_100375173 | |||
| 1360 | Ga0075434_100656034 | |||
| 1361 | Ga0075434_101245220 | |||
| 1362 | Ga0075429_100196053 | |||
| 1363 | Ga0075429_101346626 | |||
| 1364 | Ga0068865_100354319 | |||
| 1365 | Ga0068865_100500278 | |||
| 1366 | Ga0075436_100008768 | |||
| 1367 | Ga0075436_100081876 | |||
| 1368 | Ga0075436_100147314 | |||
| 1369 | Ga0075436_100298394 | |||
| 1370 | Ga0075436_100333942 | |||
| 1371 | Ga0097620_101011812 | |||
| 1372 | Ga0075435_100009069 | |||
| 1373 | Ga0075435_100060423 | |||
| 1374 | Ga0075435_100067619 | |||
| 1375 | Ga0075435_100070450 | |||
| 1376 | Ga0075435_100475926 | |||
| 1377 | Ga0099794_10595697 | |||
| 1378 | Ga0099795_10015744 | |||
| 1379 | Ga0105251_10150147 | |||
| 1380 | Ga0105244_10334364 | |||
| 1381 | Ga0111539_10392236 | |||
| 1382 | Ga0105245_10032107 | |||
| 1383 | Ga0105245_10228332 | |||
| 1384 | Ga0105245_10498876 | |||
| 1385 | Ga0105245_11476322 | |||
| 1386 | Ga0105247_10139316 | |||
| 1387 | Ga0105247_10783028 | |||
| 1388 | Ga0114129_10003160 | |||
| 1389 | Ga0114129_10876409 | |||
| 1390 | Ga0105243_10019200 | |||
| 1391 | Ga0105243_10045527 | |||
| 1392 | Ga0105243_12359556 | |||
| 1393 | Ga0105241_10064387 | |||
| 1394 | Ga0105241_10518494 | |||
| 1395 | Ga0105241_10851337 | |||
| 1396 | Ga0105241_11001701 | |||
| 1397 | Ga0105242_10160483 | |||
| 1398 | Ga0105242_10281043 | |||
| 1399 | Ga0105242_10390723 | |||
| 1400 | Ga0105242_10533273 | |||
| 1401 | Ga0105242_11027579 | |||
| 1402 | Ga0105242_12206200 | |||
| 1403 | Ga0105242_12270087 | |||
| 1404 | Ga0105248_10545830 | |||
| 1405 | Ga0105248_10825769 | |||
| 1406 | Ga0105248_11011606 | |||
| 1407 | Ga0105237_10542289 | |||
| 1408 | Ga0105237_11484501 | |||
| 1409 | Ga0105238_10231917 | |||
| 1410 | Ga0105238_11359044 | |||
| 1411 | Ga0105238_12117322 | |||
| 1412 | Ga0105238_12394117 | |||
| 1413 | Ga0105249_10035835 | |||
| 1414 | Ga0105249_10109249 | |||
| 1415 | Ga0105249_10195678 | |||
| 1416 | Ga0105249_10228945 | |||
| 1417 | Ga0105249_12009361 | |||
| 1418 | Ga0099796_10104642 | |||
| 1419 | Ga0099796_10108237 | |||
| 1420 | Ga0099796_10239135 | |||
| 1421 | Ga0105239_10348016 | |||
| 1422 | Ga0105239_10354649 | |||
| 1423 | Ga0105239_12937993 | |||
| 1424 | Ga0105246_11596787 | |||
| 1425 | Ga0157337_1003591 | |||
| 1426 | Ga0157338_1015828 | |||
| 1427 | Ga0157373_10105951 | |||
| 1428 | Ga0157373_10546744 | |||
| 1429 | Ga0157371_11006655 | |||
| 1430 | Ga0157369_10592282 | |||
| 1431 | Ga0157369_11008101 | |||
| 1432 | Ga0157369_11988091 | |||
| 1433 | Ga0157374_10901774 | |||
| 1434 | Ga0157374_10956067 | |||
| 1435 | Ga0157378_10613305 | |||
| 1436 | Ga0157378_11264647 | |||
| 1437 | Ga0163162_10025354 | |||
| 1438 | Ga0163162_10095780 | |||
| 1439 | Ga0163162_11170801 | |||
| 1440 | Ga0157372_10155313 | |||
| 1441 | Ga0157372_10610925 | |||
| 1442 | Ga0157372_10790304 | |||
| 1443 | Ga0157375_10596100 | |||
| 1444 | Ga0157375_11305286 | |||
| 1445 | Ga0157375_11549912 | |||
| 1446 | Ga0157375_13373706 | |||
| 1447 | Ga0163163_10017694 | |||
| 1448 | Ga0157380_10037201 | |||
| 1449 | Ga0157380_10157500 | |||
| 1450 | Ga0157380_10914601 | |||
| 1451 | Ga0157380_13025899 | |||
| 1452 | Ga0157380_13548149 | |||
| 1453 | Ga0157377_10114505 | |||
| 1454 | Ga0157377_11317830 | |||
| 1455 | Ga0157379_12148884 | |||
| 1456 | Ga0157376_10596496 | |||
| 1457 | Ga0157376_11773932 | |||
| 1458 | Ga0157376_12336943 | |||
| 1459 | Ga0163161_10174487 | |||
| 1460 | Ga0163161_10216587 | |||
| 1461 | Ga0163161_10278630 | |||
| 1462 | Ga0197907_10736962 | |||
| 1463 | Ga0206356_10020970 | |||
| 1464 | Ga0206354_10041121 | |||
| 1465 | Ga0206353_11136400 | |||
| 1466 | Ga0213874_10006980 | |||
| 1467 | Ga0213876_10116935 | |||
| 1468 | Ga0213875_10000778 | |||
| 1469 | Ga0213875_10001469 | |||
| 1470 | Ga0213875_10025785 | |||
| 1471 | Ga0213875_10060985 | |||
| 1472 | Ga0213875_10062680 | |||
| 1473 | Ga0213875_10067895 | |||
| 1474 | Ga0224572_1007442 | |||
| 1475 | Ga0228598_1038676 | |||
| 1476 | Ga0207653_10022345 | |||
| 1477 | Ga0207692_10000710 | |||
| 1478 | Ga0207692_10004964 | |||
| 1479 | Ga0207692_10005520 | |||
| 1480 | Ga0207692_10036978 | |||
| 1481 | Ga0207692_10086889 | |||
| 1482 | Ga0207692_10276208 | |||
| 1483 | Ga0207692_10459583 | |||
| 1484 | Ga0207692_10955647 | |||
| 1485 | Ga0207642_10105735 | |||
| 1486 | Ga0207710_10179231 | |||
| 1487 | Ga0207688_10014232 | |||
| 1488 | Ga0207680_10025782 | |||
| 1489 | Ga0207685_10007255 | |||
| 1490 | Ga0207685_10069220 | |||
| 1491 | Ga0207685_10228854 | |||
| 1492 | Ga0207699_10000150 | |||
| 1493 | Ga0207699_10000409 | |||
| 1494 | Ga0207699_10003451 | |||
| 1495 | Ga0207699_10004294 | |||
| 1496 | Ga0207699_10034201 | |||
| 1497 | Ga0207699_10413921 | |||
| 1498 | Ga0207643_10056250 | |||
| 1499 | Ga0207705_11304640 | |||
| 1500 | Ga0207684_10001073 | |||
| 1501 | Ga0207684_10008615 | |||
| 1502 | Ga0207684_10038737 | |||
| 1503 | Ga0207684_10055802 | |||
| 1504 | Ga0207684_10075263 | |||
| 1505 | Ga0207684_10912749 | |||
| 1506 | Ga0207654_10102836 | |||
| 1507 | Ga0207654_10783197 | |||
| 1508 | Ga0207707_10929849 | |||
| 1509 | Ga0207671_11249658 | |||
| 1510 | Ga0207693_10011623 | |||
| 1511 | Ga0207693_10015861 | |||
| 1512 | Ga0207693_10081252 | |||
| 1513 | Ga0207693_10083300 | |||
| 1514 | Ga0207693_10156272 | |||
| 1515 | Ga0207693_10171012 | |||
| 1516 | Ga0207693_10297972 | |||
| 1517 | Ga0207693_10337450 | |||
| 1518 | Ga0207693_11048626 | |||
| 1519 | Ga0207663_10004946 | |||
| 1520 | Ga0207663_10006883 | |||
| 1521 | Ga0207663_10008833 | |||
| 1522 | Ga0207663_10042210 | |||
| 1523 | Ga0207663_10131645 | |||
| 1524 | Ga0207663_10380878 | |||
| 1525 | Ga0207663_10420863 | |||
| 1526 | Ga0207663_10523231 | |||
| 1527 | Ga0207663_10984069 | |||
| 1528 | Ga0207657_10009239 | |||
| 1529 | Ga0207657_10101950 | |||
| 1530 | Ga0207649_10326005 | |||
| 1531 | Ga0207652_10341711 | |||
| 1532 | Ga0207652_11485441 | |||
| 1533 | Ga0207646_10001025 | |||
| 1534 | Ga0207646_10001028 | |||
| 1535 | Ga0207646_10041799 | |||
| 1536 | Ga0207646_10376086 | |||
| 1537 | Ga0207646_10927125 | |||
| 1538 | Ga0207646_11410661 | |||
| 1539 | Ga0207694_11079589 | |||
| 1540 | Ga0207659_10032251 | |||
| 1541 | Ga0207659_10667457 | |||
| 1542 | Ga0207687_10484030 | |||
| 1543 | Ga0207687_10638932 | |||
| 1544 | Ga0207687_10864892 | |||
| 1545 | Ga0207700_10000935 | |||
| 1546 | Ga0207700_10002068 | |||
| 1547 | Ga0207700_10008073 | |||
| 1548 | Ga0207700_10010239 | |||
| 1549 | Ga0207700_10123749 | |||
| 1550 | Ga0207700_10182259 | |||
| 1551 | Ga0207700_10208025 | |||
| 1552 | Ga0207700_10340830 | |||
| 1553 | Ga0207700_10553498 | |||
| 1554 | Ga0207700_11321841 | |||
| 1555 | Ga0207664_10001780 | |||
| 1556 | Ga0207664_10002171 | |||
| 1557 | Ga0207664_10017089 | |||
| 1558 | Ga0207664_10026003 | |||
| 1559 | Ga0207664_10031593 | |||
| 1560 | Ga0207664_10131497 | |||
| 1561 | Ga0207664_10214388 | |||
| 1562 | Ga0207664_10259799 | |||
| 1563 | Ga0207664_10539055 | |||
| 1564 | Ga0207664_10656500 | |||
| 1565 | Ga0207664_10750446 | |||
| 1566 | Ga0207664_10817055 | |||
| 1567 | Ga0207664_10878115 | |||
| 1568 | Ga0207664_11015707 | |||
| 1569 | Ga0207664_11047209 | |||
| 1570 | Ga0207664_11192723 | |||
| 1571 | Ga0207664_11569227 | |||
| 1572 | Ga0207644_10351908 | |||
| 1573 | Ga0207644_11878974 | |||
| 1574 | Ga0207690_10391829 | |||
| 1575 | Ga0207690_10502797 | |||
| 1576 | Ga0207706_10010344 | |||
| 1577 | Ga0207706_10287960 | |||
| 1578 | Ga0207706_10437705 | |||
| 1579 | Ga0207686_10223961 | |||
| 1580 | Ga0207686_10653180 | |||
| 1581 | Ga0207686_10794626 | |||
| 1582 | Ga0207686_11015274 | |||
| 1583 | Ga0207709_10093308 | |||
| 1584 | Ga0207709_10128173 | |||
| 1585 | Ga0207670_10720209 | |||
| 1586 | Ga0207704_10130470 | |||
| 1587 | Ga0207704_10378582 | |||
| 1588 | Ga0207665_10001548 | |||
| 1589 | Ga0207665_10001912 | |||
| 1590 | Ga0207665_10017852 | |||
| 1591 | Ga0207665_10027812 | |||
| 1592 | Ga0207665_10047675 | |||
| 1593 | Ga0207665_10047865 | |||
| 1594 | Ga0207665_10499802 | |||
| 1595 | Ga0207665_11145711 | |||
| 1596 | Ga0207665_11173366 | |||
| 1597 | Ga0207691_10186810 | |||
| 1598 | Ga0207711_10168246 | |||
| 1599 | Ga0207711_10548560 | |||
| 1600 | Ga0207689_10000637 | |||
| 1601 | Ga0207689_10138779 | |||
| 1602 | Ga0207679_10163772 | |||
| 1603 | Ga0207679_11483547 | |||
| 1604 | Ga0207667_10368194 | |||
| 1605 | Ga0207667_11496347 | |||
| 1606 | Ga0207667_11559416 | |||
| 1607 | Ga0207651_10317262 | |||
| 1608 | Ga0207712_10429894 | |||
| 1609 | Ga0207712_10624965 | |||
| 1610 | Ga0207712_11671436 | |||
| 1611 | Ga0207668_10302392 | |||
| 1612 | Ga0207668_11938172 | |||
| 1613 | Ga0207640_10178470 | |||
| 1614 | Ga0207640_10972833 | |||
| 1615 | Ga0207640_11056627 | |||
| 1616 | Ga0207658_10698510 | |||
| 1617 | Ga0207677_11627766 | |||
| 1618 | Ga0207703_11570746 | |||
| 1619 | Ga0207639_10106209 | |||
| 1620 | Ga0207639_10258384 | |||
| 1621 | Ga0207678_10031219 | |||
| 1622 | Ga0207708_10187270 | |||
| 1623 | Ga0207702_10135659 | |||
| 1624 | Ga0207702_10170922 | |||
| 1625 | Ga0207702_10477887 | |||
| 1626 | Ga0207641_10652680 | |||
| 1627 | Ga0207648_10603787 | |||
| 1628 | Ga0207648_11022060 | |||
| 1629 | Ga0207674_10346472 | |||
| 1630 | Ga0207675_100003528 | |||
| 1631 | Ga0207675_100232528 | |||
| 1632 | Ga0207683_10029746 | |||
| 1633 | Ga0207683_10033055 | |||
| 1634 | Ga0207698_10789153 | |||
| 1635 | Ga0207698_11601873 | |||
| 1636 | Ga0207428_10668051 | |||
| 1637 | Ga0268264_10502172 | |||
| 1638 | Ga0265336_10044462 | |||
| 1639 | Ga0265338_10007034 | |||
| 1640 | Ga0265777_114550 | |||
| 1641 | Ga0265765_1052407 | |||
| 1642 | Ga0265760_10111565 | |||
| 1643 | Ga0265760_10274613 | |||
| 1644 | Ga0307513_10407775 | |||
| 1645 | Ga0307409_100108617 | |||
| 1646 | Ga0307416_100632906 | |||
| 1647 | Ga0373948_0060942 | |||
| 1648 | Ga0373950_0137905 | |||
| 1649 | Ga0373959_0041606 | |||
| 1650 | Ga0373959_0104786 | |||
| 1651 | Ga0373959_0125544 | |||
| 1652 | Ga0373938_0034390 | |||
| 1653 | Ga0373926_0004896 | |||
| 1654 | Ga0373926_0220167 | |||
| 1655 | Ga0373928_0016328 | |||
| 1656 | Ga0373934_0016134 | |||
| 1657 | Ga0373934_0100681 | |||
| 1658 | Ga0373934_0277830 | |||
| 1659 | Ga0373940_0046305 | |||
| 1660 | Ga0373940_0155295 | |||
| 1661 | Ga0373944_0060465 | |||
| 1662 | Ga0373944_0160943 | |||
| 1663 | Ga0373949_0042471 | |||
| 1664 | Ga0373951_0036488 | |||
| 1665 | Ga0373952_0036525 | |||
| 1666 | Ga0373952_0212019 | |||
| 1667 | Ga0373923_0009757 | |||
| 1668 | Ga0373923_0012459 | |||
| 1669 | Ga0373923_0043802 | |||
| 1670 | Ga0373923_0513211 | |||
| 1671 | Ga0373932_0002043 | |||
| 1672 | Ga0373932_0098947 | |||
| 1673 | Ga0373936_0005671 | |||
| 1674 | Ga0373936_0015057 | |||
| 1675 | Ga0373936_0019677 | |||
| 1676 | Ga0373939_0008703 | |||
| 1677 | Ga0373939_0035465 | |||
| 1678 | Ga0373939_0225473 | |||
| 1679 | Ga0373941_0132624 | |||
| 1680 | Ga0373945_0000857 | |||
| 1681 | Ga0373945_0023253 | |||
| 1682 | Ga0373945_0316906 | |||
| 1683 | Ga0373945_0385135 | |||
| 1684 | Ga0373953_0001440 | |||
| 1685 | Ga0373953_0066337 | |||
| 1686 | Ga0373953_0307196 | |||
| 1687 | Ga0373954_0040317 | |||
| 1688 | Ga0373954_0049363 | |||
| 1689 | Ga0373954_0433238 | |||
| 1690 | Ga0373956_0010874 | |||
| 1691 | Ga0373956_0041268 | |||
| 1692 | Ga0373956_0123017 | |||
| 1693 | Ga0373956_0183982 | |||
| 1694 | Ga0373956_0222512 | |||
| 1695 | Ga0373957_0000395 | |||
| 1696 | Ga0373957_0064997 | |||
| 1697 | Ga0373957_0294393 | |||
| 1698 | Ga0373957_0295714 | |||
| 1699 | Ga0373957_0486632 | |||
| 1700 | Ga0373960_0026252 | |||
| 1701 | Ga0373960_0064645 | |||
| 1702 | Ga0373960_0157632 | |||
| 1703 | Ga0373943_0010787 | |||
| 1704 | Ga0373943_0105732 | |||
| 1705 | Ga0373943_0115711 | |||
| 1706 | Ga0373943_0161921 | |||
| 1707 | Ga0373943_0957198 | |||
| 1708 | Ga0373946_0007574 | |||
| 1709 | Ga0373946_0244551 | |||
| 1710 | Ga0373955_0006906 | |||
| 1711 | Ga0373955_0087325 | |||
| 1712 | Ga0373955_0192919 | |||
| 1713 | Ga0373955_0217215 | |||
| 1714 | Ga0373955_0612365 | |||
| 1715 | Ga0373955_1001435 | |||
| 1716 | Ga0373942_0003432 | |||
| 1717 | Ga0373942_0063436 | |||
| 1718 | Ga0373961_0007728 | |||
| 1719 | Ga0373961_0032347 | |||
| 1720 | Ga0373961_0066038 | |||
| 1721 | Ga0373962_0024534 | |||
| 1722 | Ga0373962_0024678 | |||
| 1723 | Ga0373962_0297724 | |||
| 1724 | Ga0373924_0016147 | |||
| 1725 | Ga0373924_0019354 | |||
| 1726 | Ga0373924_0044595 | |||
| 1727 | Ga0373924_0438091 | |||
| 1728 | Ga0373931_0005023 | |||
| 1729 | Ga0373931_0007023 | |||
| 1730 | Ga0373931_0120410 | |||
| 1731 | Ga0373931_0138730 | |||
| 1732 | Ga0373931_0531873 | |||
| 1733 | Ga0373931_0634663 | |||
| 1734 | Ga0373935_0021843 | |||
| 1735 | Ga0373935_0022631 | |||
| 1736 | Ga0373935_0126102 | |||
| 1737 | Ga0373935_0157726 | |||
| 1738 | Ga0373935_0281125 | |||
| 1739 | Ga0373935_0563822 | |||
| 1740 | Ga0373935_0634342 | |||
| 1741 | Ga0373935_0665669 | |||
| 1742 | Ga0373927_0007575 | |||
| 1743 | Ga0373927_0097977 | |||
| 1744 | Ga0373927_0155042 | |||
| 1745 | Ga0373927_0740895 | |||
| 1746 | Ga0373933_0003771 | |||
| 1747 | Ga0373933_0008292 | |||
| 1748 | Ga0373933_0009211 | |||
| 1749 | Ga0373933_0012435 | |||
| 1750 | Ga0373933_0121146 | |||
| 1751 | Ga0373933_0314095 | |||
| 1752 | Ga0373933_0318605 | |||
| 1753 | Ga0373933_0478285 | |||
| 1754 | Ga0373933_0654484 | |||
| 1755 | Ga0373947_0004813 | |||
| 1756 | Ga0373947_0025467 | |||
| 1757 | Ga0373947_0027635 | |||
| 1758 | Ga0373947_0114431 | |||
| 1759 | Ga0373947_0475185 | |||
| 1760 | Ga0373947_0667643 | |||
| 1761 | Ga0373947_0708974 | |||
| 1762 | Ga0373937_0004787 | |||
| 1763 | Ga0373937_0019543 | |||
| 1764 | Ga0373937_0042732 | |||
| 1765 | Ga0373937_0043353 | |||
| 1766 | Ga0373937_0209103 | |||
| 1767 | Ga0373937_0248247 | |||
| 1768 | Ga0373937_0528675 | |||
| 1769 | Ga0373925_0006165 | |||
| 1770 | Ga0373925_0030042 | |||
| 1771 | Ga0373925_0040068 | |||
| 1772 | Ga0373925_0100518 | |||
| 1773 | Ga0373925_0144386 | |||
| 1774 | Ga0373925_0480922 | |||
| 1775 | Ga0373925_0921331 | |||
| 1776 | Ga0373925_1021646 | |||
| 1777 | Ga0373925_1710896 | |||
| 1778 | Ga0436364_0105925 | |||
| 1779 | Ga0436364_0377973 | |||
| 1780 | Ga0436364_0679842 | |||
| 1781 | Ga0436364_1006315 | |||
| 1782 | Ga0436364_1177344 | |||
| 1783 | Ga0436364_1305843 | |||
| 1784 | Ga0436364_1383024 | |||
| 1785 | Ga0436364_1401376 | |||
| 1786 | Ga0436365_0303082 | |||
| 1787 | Ga0436365_0768004 | |||
| 1788 | Ga0436360_0269636 | |||
| 1789 | Ga0436360_0622341 | |||
| 1790 | Ga0436361_0346318 | |||
| 1791 | Ga0436363_0070686 | |||
| 1792 | Ga0436363_1072037 | |||
| 1793 | Ga0436363_1532046 | |||
| 1794 | Ga0436363_1600052 | |||
| 1795 | Ga0466963_0567570 | |||
| 1796 | Ga0466957_0154636 | |||
| 1797 | Ga0466957_0750243 | |||
| 1798 | Ga0466959_0743012 | |||
| 1799 | Ga0466959_1003874 | |||
| 1800 | Ga0466958_0335282 | |||
| 1801 | Ga0466958_0405013 | |||
| 1802 | Ga0466967_0003373 | |||
| 1803 | Ga0466967_1056694 | |||
| 1804 | Ga0466967_1979044 | |||
| 1805 | Ga0495592_0043709 | |||
| 1806 | Ga0495592_0049681 | |||
| 1807 | Ga0495592_0066530 | |||
| 1808 | Ga0495592_0198939 | |||
| 1809 | Ga0495603_0001884 | |||
| 1810 | Ga0495603_0016821 | |||
| 1811 | Ga0495603_0039723 | |||
| 1812 | Ga0495603_0487476 | |||
| 1813 | Ga0495629_0002427 | |||
| 1814 | Ga0495629_0013068 | |||
| 1815 | Ga0495629_0076352 | |||
| 1816 | Ga0495629_0343383 | |||
| 1817 | Ga0495629_0839706 | |||
| 1818 | Ga0495641_0005488 | |||
| 1819 | Ga0495641_0007308 | |||
| 1820 | Ga0495641_0058474 | |||
| 1821 | Ga0495641_0103798 | |||
| 1822 | Ga0495641_0240700 | |||
| 1823 | Ga0495641_0355878 | |||
| 1824 | Ga0495651_0001931 | |||
| 1825 | Ga0495651_0016617 | |||
| 1826 | Ga0495651_0029872 | |||
| 1827 | Ga0495651_0033587 | |||
| 1828 | Ga0495651_0045262 | |||
| 1829 | Ga0495651_0049114 | |||
| 1830 | Ga0495651_0182644 | |||
| 1831 | Ga0495653_0006982 | |||
| 1832 | Ga0495653_0014251 | |||
| 1833 | Ga0495653_0020561 | |||
| 1834 | Ga0495653_0103196 | |||
| 1835 | Ga0495653_0132000 | |||
| 1836 | Ga0495653_0175537 | |||
| 1837 | Ga0495653_0593515 | |||
| 1838 | Ga0495653_0907430 | |||
| 1839 | Ga0495580_0006966 | |||
| 1840 | Ga0495580_0009215 | |||
| 1841 | Ga0495580_0365004 | |||
| 1842 | Ga0495582_0002516 | |||
| 1843 | Ga0495582_0006049 | |||
| 1844 | Ga0495582_0039320 | |||
| 1845 | Ga0495582_0056608 | |||
| 1846 | Ga0495582_0746379 | |||
| 1847 | Ga0495639_0001397 | |||
| 1848 | Ga0495639_0034558 | |||
| 1849 | Ga0495639_0156267 | |||
| 1850 | Ga0495662_0004842 | |||
| 1851 | Ga0495662_0005405 | |||
| 1852 | Ga0495662_0054148 | |||
| 1853 | Ga0495664_0001454 | |||
| 1854 | Ga0495664_0029636 | |||
| 1855 | Ga0495664_0051629 | |||
| 1856 | Ga0495664_0062254 | |||
| 1857 | Ga0495664_0205015 | |||
| 1858 | Ga0495664_0296910 | |||
| 1859 | Ga0495664_0516619 | |||
| 1860 | Ga0495664_0862793 | |||
| 1861 | Ga0495664_0874113 | |||
| 1862 | Ga0495585_0568439 | |||
| 1863 | Ga0495594_0038259 | |||
| 1864 | Ga0495594_0295108 | |||
| 1865 | Ga0495594_0467370 | |||
| 1866 | Ga0495608_0013803 | |||
| 1867 | Ga0495608_0038855 | |||
| 1868 | Ga0495608_0045323 | |||
| 1869 | Ga0495608_0047249 | |||
| 1870 | Ga0495608_0165064 | |||
| 1871 | Ga0495608_0290401 | |||
| 1872 | Ga0495618_0014069 | |||
| 1873 | Ga0495618_0045208 | |||
| 1874 | Ga0495618_0101216 | |||
| 1875 | Ga0495618_0437177 | |||
| 1876 | Ga0495618_0453110 | |||
| 1877 | Ga0495628_0043904 | |||
| 1878 | Ga0495628_0157921 | |||
| 1879 | Ga0495628_0395377 | |||
| 1880 | Ga0495628_0851393 | |||
| 1881 | Ga0495630_0007894 | |||
| 1882 | Ga0495630_0008368 | |||
| 1883 | Ga0495630_0045139 | |||
| 1884 | Ga0495630_0054253 | |||
| 1885 | Ga0495630_0073679 | |||
| 1886 | Ga0495630_0276169 | |||
| 1887 | Ga0495630_0496375 | |||
| 1888 | Ga0495666_0004981 | |||
| 1889 | Ga0495666_0121301 | |||
| 1890 | Ga0495666_0141036 | |||
| 1891 | Ga0495652_0038079 | |||
| 1892 | Ga0495652_0187607 | |||
| 1893 | Ga0495652_0214883 | |||
| 1894 | Ga0495652_0226750 | |||
| 1895 | Ga0495652_0359950 | |||
| 1896 | Ga0495652_0418654 | |||
| 1897 | Ga0495652_0452665 | |||
| 1898 | Ga0495652_0479880 | |||
| 1899 | Ga0495652_0641625 | |||
| 1900 | Ga0495652_0817250 | |||
| 1901 | Ga0495652_1034761 | |||
| 1902 | Ga0495665_0039083 | |||
| 1903 | Ga0495665_0043227 | |||
| 1904 | Ga0495665_0083604 | |||
| 1905 | Ga0495665_0161966 | |||
| 1906 | Ga0495665_0185388 | |||
| 1907 | Ga0495640_0011299 | |||
| 1908 | Ga0495640_0030403 | |||
| 1909 | Ga0495640_0035817 | |||
| 1910 | Ga0495640_0044795 | |||
| 1911 | Ga0495640_0507840 | |||
| 1912 | Ga0495586_0080183 | |||
| 1913 | Ga0495586_0131097 | |||
| 1914 | Ga0495586_0226551 | |||
| 1915 | Ga0495586_0567474 | |||
| 1916 | Ga0495587_0005768 | |||
| 1917 | Ga0495587_0009878 | |||
| 1918 | Ga0495587_0037601 | |||
| 1919 | Ga0495587_0232225 | |||
| 1920 | Ga0495587_0234689 | |||
| 1921 | Ga0495645_0061367 | |||
| 1922 | Ga0495645_0099890 | |||
| 1923 | Ga0495645_0145931 | |||
| 1924 | Ga0495645_0385621 | |||
| 1925 | Ga0495645_0862572 | |||
| 1926 | Ga0495622_0063965 | |||
| 1927 | Ga0495667_0001128 | |||
| 1928 | Ga0495667_0002989 | |||
| 1929 | Ga0495667_0013187 | |||
| 1930 | Ga0495667_0036410 | |||
| 1931 | Ga0495667_0126551 | |||
| 1932 | Ga0495667_0131551 | |||
| 1933 | Ga0495667_0926346 | |||
| 1934 | Ga0495656_0054356 | |||
| 1935 | Ga0495656_0546682 | |||
| 1936 | Ga0495634_0018598 | |||
| 1937 | Ga0495634_0022260 | |||
| 1938 | Ga0495634_0196835 | |||
| 1939 | Ga0495634_0214396 | |||
| 1940 | Ga0495634_0590870 | |||
| 1941 | Ga0495635_0003541 | |||
| 1942 | Ga0495635_0011673 | |||
| 1943 | Ga0495635_0015907 | |||
| 1944 | Ga0495635_0072084 | |||
| 1945 | Ga0495635_0142258 | |||
| 1946 | Ga0495635_0146243 | |||
| 1947 | Ga0495635_0732528 | |||
| 1948 | Ga0495588_0656516 | |||
| 1949 | Ga0495657_0013621 | |||
| 1950 | Ga0495657_0013795 | |||
| 1951 | Ga0495657_0029482 | |||
| 1952 | Ga0495657_0043047 | |||
| 1953 | Ga0495657_0057990 | |||
| 1954 | Ga0495657_0134572 | |||
| 1955 | Ga0495599_0007731 | |||
| 1956 | Ga0495599_0084819 | |||
| 1957 | Ga0495599_0120858 | |||
| 1958 | Ga0495623_0026081 | |||
| 1959 | Ga0495623_0033379 | |||
| 1960 | Ga0495623_0069692 | |||
| 1961 | Ga0495623_0559007 | |||
| 1962 | Ga0495646_0014834 | |||
| 1963 | Ga0495646_0039940 | |||
| 1964 | Ga0495646_0337090 | |||
| 1965 | Ga0495646_0695396 | |||
| 1966 | Ga0495647_0002984 | |||
| 1967 | Ga0495647_0043419 | |||
| 1968 | Ga0495647_0300136 | |||
| 1969 | Ga0495658_0007556 | |||
| 1970 | Ga0495658_0023564 | |||
| 1971 | Ga0495658_0079429 | |||
| 1972 | Ga0495658_0140515 | |||
| 1973 | Ga0495658_0357199 | |||
| 1974 | Ga0495658_0770177 | |||
| 1975 | Ga0495613_0010937 | |||
| 1976 | Ga0495613_0040395 | |||
| 1977 | Ga0495613_0302208 | |||
| 1978 | Ga0495624_0041428 | |||
| 1979 | Ga0495624_0045325 | |||
| 1980 | Ga0495624_0075697 | |||
| 1981 | Ga0495624_0251814 | |||
| 1982 | Ga0495670_0287547 | |||
| 1983 | Ga0495600_0007024 | |||
| 1984 | Ga0495600_0009905 | |||
| 1985 | Ga0495600_0029377 | |||
| 1986 | Ga0495600_0462237 | |||
| 1987 | Ga0495600_0518791 | |||
| 1988 | Ga0495581_0001789 | |||
| 1989 | Ga0495581_0006628 | |||
| 1990 | Ga0495581_0020589 | |||
| 1991 | Ga0495581_0033225 | |||
| 1992 | Ga0495604_0006908 | |||
| 1993 | Ga0495604_0011917 | |||
| 1994 | Ga0495604_0014246 | |||
| 1995 | Ga0495604_0055234 | |||
| 1996 | Ga0495604_0111258 | |||
| 1997 | Ga0495604_0220828 | |||
| 1998 | Ga0495604_1044164 | |||
| 1999 | Ga0495674_0037957 | |||
| 2000 | Ga0495674_0091354 | |||
| 2001 | Ga0495674_0175002 | |||
| 2002 | Ga0495674_0246110 | |||
| 2003 | Ga0495674_0417424 | |||
| 2004 | Ga0495674_0474938 | |||
| 2005 | Ga0495674_0547662 | |||
| 2006 | Ga0495674_0748817 | |||
| 2007 | Ga0495674_0869235 | |||
| 2008 | Ga0495674_1092874 | |||
| 2009 | Ga0495674_1209162 | |||
| 2010 | Ga0495676_0019767 | |||
| 2011 | Ga0495676_0023723 | |||
| 2012 | Ga0495676_0080861 | |||
| 2013 | Ga0495676_0200289 | |||
| 2014 | Ga0495676_0400440 | |||
| 2015 | Ga0495676_0434099 | |||
| 2016 | Ga0495676_0441943 | |||
| 2017 | Ga0495680_0005813 | |||
| 2018 | Ga0495680_0007024 | |||
| 2019 | Ga0495680_0008161 | |||
| 2020 | Ga0495680_0012284 | |||
| 2021 | Ga0495680_0025800 | |||
| 2022 | Ga0495680_0039127 | |||
| 2023 | Ga0495680_0291150 | |||
| 2024 | Ga0495680_0623993 | |||
| 2025 | Ga0495680_0732845 | |||
| 2026 | Ga0495675_0012751 | |||
| 2027 | Ga0495675_0013817 | |||
| 2028 | Ga0495675_0022321 | |||
| 2029 | Ga0495675_0099302 | |||
| 2030 | Ga0495675_0170925 | |||
| 2031 | Ga0495684_0008155 | |||
| 2032 | Ga0495684_0013873 | |||
| 2033 | Ga0495684_0021270 | |||
| 2034 | Ga0495684_0027462 | |||
| 2035 | Ga0495684_0043023 | |||
| 2036 | Ga0495684_0107490 | |||
| 2037 | Ga0495684_0227390 | |||
| 2038 | Ga0495684_0328927 | |||
| 2039 | Ga0495684_0471291 | |||
| 2040 | Ga0495593_0002377 | |||
| 2041 | Ga0495593_0004968 | |||
| 2042 | Ga0495593_0035071 | |||
| 2043 | Ga0495593_0044899 | |||
| 2044 | Ga0495602_0054740 | |||
| 2045 | Ga0495602_0099899 | |||
| 2046 | Ga0495602_0111751 | |||
| 2047 | Ga0495602_0117041 | |||
| 2048 | Ga0495602_0135452 | |||
| 2049 | Ga0495602_0480664 | |||
| 2050 | Ga0495602_1148917 | |||
| 2051 | Ga0495614_0024138 | |||
| 2052 | Ga0495614_0253699 | |||
| 2053 | Ga0495614_0507508 | |||
| 2054 | Ga0496100_0160498 | |||
| 2055 | Ga0496100_0192929 | |||
| 2056 | Ga0496100_0263269 | |||
| 2057 | Ga0496100_1621281 | |||
| 2058 | Ga0496101_0030527 | |||
| 2059 | Ga0496101_0064367 | |||
| 2060 | Ga0496101_0352028 | |||
| 2061 | Ga0496101_0665505 | |||
| 2062 | Ga0496102_0088723 | |||
| 2063 | Ga0496102_0119224 | |||
| 2064 | Ga0496102_0292786 | |||
| 2065 | Ga0496102_0298910 | |||
| 2066 | Ga0496102_0307783 | |||
| 2067 | Ga0496103_0017239 | |||
| 2068 | Ga0496103_0201743 | |||
| 2069 | Ga0496103_0339444 | |||
| 2070 | Ga0496104_0005558 | |||
| 2071 | Ga0496104_0012036 | |||
| 2072 | Ga0496104_0553161 | |||
| 2073 | Ga0496104_1366231 | |||
| 2074 | Ga0496104_1406913 | |||
| 2075 | Ga0496105_0001173 | |||
| 2076 | Ga0496105_0001930 | |||
| 2077 | Ga0496105_0016692 | |||
| 2078 | Ga0496105_0790005 | |||
| 2079 | Ga0496105_1072199 | |||
| 2080 | Ga0496106_0053070 | |||
| 2081 | Ga0496106_0161806 | |||
| 2082 | Ga0496106_0167631 | |||
| 2083 | Ga0496106_0283453 | |||
| 2084 | Ga0496106_1012401 | |||
| 2085 | Ga0496107_0030892 | |||
| 2086 | Ga0496107_0560711 | |||
| 2087 | Ga0496107_0673765 | |||
| 2088 | Ga0496107_0957028 | |||
| 2089 | Ga0496107_0969630 | |||
| 2090 | Ga0496107_1073144 | |||
| 2091 | Ga0496108_0043675 | |||
| 2092 | Ga0496108_0127846 | |||
| 2093 | Ga0496108_0232051 | |||
| 2094 | Ga0496108_0407957 | |||
| 2095 | Ga0496108_1178587 | |||
| 2096 | Ga0496108_1311530 | |||
| 2097 | Ga0496109_0030550 | |||
| 2098 | Ga0496109_0138031 | |||
| 2099 | Ga0496109_0276437 | |||
| 2100 | Ga0496109_0540341 | |||
| 2101 | Ga0496109_1196981 | |||
| 2102 | Ga0496110_0254655 | |||
| 2103 | Ga0496110_0355769 | |||
| 2104 | Ga0496110_0632246 | |||
| 2105 | Ga0496110_0735396 | |||
| 2106 | Ga0496111_0067859 | |||
| 2107 | Ga0496111_0224570 | |||
| 2108 | Ga0496112_0125053 | |||
| 2109 | Ga0496112_0142017 | |||
| 2110 | Ga0496112_0221523 | |||
| 2111 | Ga0496113_0035625 | |||
| 2112 | Ga0496113_0107297 | |||
| 2113 | Ga0496113_0226392 | |||
| 2114 | Ga0496113_0229378 | |||
| 2115 | Ga0496113_0392809 | |||
| 2116 | Ga0496114_0004915 | |||
| 2117 | Ga0496114_0005249 | |||
| 2118 | Ga0496114_0021533 | |||
| 2119 | Ga0496114_0988059 | |||
| 2120 | Ga0496115_0001816 | |||
| 2121 | Ga0496115_0004006 | |||
| 2122 | Ga0496115_0063941 | |||
| 2123 | Ga0496115_0082329 | |||
| 2124 | Ga0496115_1152863 | |||
| 2125 | Ga0496126_0804144 | |||
| 2126 | Ga0496126_1140488 | |||
| 2127 | Ga0501034_0030504 | |||
| 2128 | Ga0501036_0013958 | |||
| 2129 | Ga0501038_0015519 | |||
| 2130 | Ga0501038_0321290 | |||
| 2131 | Ga0501042_0001499 | |||
| 2132 | Ga0501043_0026956 | |||
| 2133 | Ga0501047_0007973 | |||
| 2134 | Ga0501047_0619187 | |||
| 2135 | Ga0501048_0007396 | |||
| 2136 | Ga0501074_0000131 | |||
| 2137 | Ga0501044_0097071 | |||
| 2138 | Ga0501044_0575698 | |||
| 2139 | nmdc:mga05p37_281870_c1 | |||
| 2140 | nmdc:mga05p37_428806_c1 | |||
| 2141 | nmdc:mga05p37_5557_c1 | |||
| 2142 | nmdc:mga09592_82282_c1 | |||
| 2143 | nmdc:mga06r32_247613_c1 | |||
| 2144 | nmdc:mga08y16_133214_c1 | |||
| 2145 | nmdc:mga08y16_354509_c1 | |||
| 2146 | nmdc:mga0n895_1015897_c1 | |||
| 2147 | nmdc:mga0n895_1473240_c1 | |||
| 2148 | nmdc:mga0n895_178154_c1 | |||
| 2149 | nmdc:mga0n895_192967_c1 | |||
| 2150 | nmdc:mga0n895_34833_c1 | |||
| 2151 | nmdc:mga0n895_52873_c1 | |||
| 2152 | nmdc:mga0n895_594341_c1 | |||
| 2153 | nmdc:mga0n895_647492_c1 | |||
| 2154 | nmdc:mga0n895_87229_c1 | |||
| 2155 | nmdc:mga0rr50_110389_c1 | |||
| 2156 | nmdc:mga0rr50_1633114_c1 | |||
| 2157 | nmdc:mga0rr50_23525_c1 | |||
| 2158 | nmdc:mga0rr50_261359_c1 | |||
| 2159 | nmdc:mga0rr50_30018_c1 | |||
| 2160 | nmdc:mga0rr50_42924_c1 | |||
| 2161 | nmdc:mga0rr50_542932_c1 | |||
| 2162 | nmdc:mga0rr50_71005_c1 | |||
| 2163 | nmdc:mga08x19_169247_c1 | |||
| 2164 | nmdc:mga08x19_170974_c1 | |||
| 2165 | nmdc:mga08x19_325655_c1 | |||
| 2166 | nmdc:mga08x19_387814_c1 | |||
| 2167 | nmdc:mga08x19_587874_c1 | |||
| 2168 | nmdc:mga08x19_81998_c1 | |||
| 2169 | nmdc:mga08x19_907361_c1 | |||
| 2170 | nmdc:mga0a205_108248_c1 | |||
| 2171 | nmdc:mga0a205_251256_c1 | |||
| 2172 | nmdc:mga0a205_950212_c1 | |||
| 2173 | Ga0495601_0025376 | |||
| 2174 | Ga0495601_0056027 | |||
| 2175 | Ga0495601_0063959 | |||
| 2176 | Ga0495601_0401533 | |||
| 2177 | Ga0495601_0495685 | |||
| 2178 | Ga0495612_0002023 | |||
| 2179 | Ga0495612_0163773 | |||
| 2180 | Ga0495612_0419798 | |||
| 2181 | Ga0495595_0028612 | |||
| 2182 | Ga0495595_0060876 | |||
| 2183 | Ga0495595_0097391 | |||
| 2184 | Ga0495595_0323644 | |||
| 2185 | Ga0495595_0487705 | |||
| 2186 | Ga0495619_0027633 | |||
| 2187 | Ga0495619_0109402 | |||
| 2188 | Ga0495619_0135727 | |||
| 2189 | Ga0495619_0173812 | |||
| 2190 | Ga0495619_0369461 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h9s-assembly1.cif.gz_B | molybdate bound complex of dimop domain of mode from e.coli | 0.9465 | 7 | 55 |
| 1b9m-assembly1.cif.gz_A | regulator from escherichia coli | 0.9323 | 7 | 55 |
| 1b9n-assembly1.cif.gz_B | regulator from escherichia coli | 0.9319 | 7 | 55 |
| 7ur8-assembly1.cif.gz_A | 170_h_ob, a small beta-barrel de novo designed protein | 0.931 | 7 | 55 |
| 7kmy-assembly4.cif.gz_M | structure of mtb lpd bound to 010705 | 0.9215 | 11 | 38 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQM1_268_326_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9605 | 7 | 56 | 2.40.50.140 |
| af_Q2G1F0_304_346_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9371 | 11 | 41 | 2.40.50.140 |
| af_A0A0R0G2M3_144_398_3.30.70.1990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.917 | 11 | 38 | 3.30.70.1990 |
| af_P09833_289_351_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9157 | 2 | 64 | 2.40.50.100 |
| 1gunB00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9155 | 2 | 67 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1N2B9-F1-model_v4 | Molybdenum ABC transporter, ATP-binding protein | 0.9965 | 7 | 59 |
GO:0005524
GO:0005886 GO:0015689 GO:0016887 |
| AF-A0A7C2KUB8-F1-model_v4 | Transporter | 0.9963 | 7 | 59 |
GO:0015689
|
| AF-A0A7Y0Q7P7-F1-model_v4 | Molybdenum ABC transporter ATP-binding protein | 0.9959 | 7 | 59 |
GO:0005524
GO:0005886 GO:0015098 GO:0016887 GO:0140359 |
| AF-A0A690UZ41-F1-model_v4 | Molybdenum-pterin-binding protein | 0.9943 | 11 | 52 |
|
| AF-A0A1Y3A1X4-F1-model_v4 | Mop domain-containing protein | 0.9935 | 7 | 55 |
GO:0015689
|