F489935
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1094 | 432 | 2188 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100067503|Ga0068864_1000675032 |
| Length | 304 |
| Sequence | MAEASPDPRRGRSPRLPGGAKLRSGFLAAQSGELRSPAQTGRLGLRKSRRFMRLQDKVALITGGTSGIGEATAVLFAKEGAKIAITGRNEKRGHAVIEQILNGGGQAIFLRTDVRKAAECRGAVEETVSSFGRLDILFNNAGIFYPHTALDCSEEEWDLQIDVNLKGTFLMSKFVLPGMIEQGSGVIINNSSGWGIVGGDAAIAYCASKGGVVLLTKAMAIDHGRQGIRVNCICPGDVDTPMLPEDARMRGQKWEDYLAGCSNRPLGRIGTSDEIAKAALFLASDDSSFMTGATLVVDGGGTAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 141 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 144 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 226 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 255 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 276 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 375 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 377 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 378 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 379 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 391 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 392 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 393 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 394 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 395 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 396 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 397 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 398 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 399 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 400 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 401 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 402 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 403 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 404 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 405 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 406 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 407 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 408 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 409 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 410 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 411 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 412 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 413 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 414 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 415 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 416 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 417 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 418 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 419 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 420 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 421 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 422 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 423 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 424 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 425 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 426 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 427 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 428 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 429 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 430 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 431 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 432 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.98 |
| Metatranscriptomes | 0.27 |
| Isolates | 3.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 1.19 |
| Rhizoplane | 4.48 |
| Rhizosphere | 84.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068864_100067503 | 3300005618 | Bacteria | 3105 |
| 2 | MRS1b_contig_9110685 | 2162886011 | Bacteria | 1241 |
| 3 | JGI24752J21851_1001338 | 3300001976 | Bacteria | 3322 |
| 4 | JGI24740J21852_10000557 | 3300001979 | Bacteria | 15986 |
| 5 | JGI24737J22298_10051769 | 3300001990 | Bacteria | 1246 |
| 6 | JGI24033J26618_1008754 | 3300002155 | Bacteria | 1170 |
| 7 | JGI24034J26672_10004802 | 3300002239 | Bacteria | 1923 |
| 8 | JGI25155J39150_1000061 | 3300002704 | Bacteria | 71144 |
| 9 | JGI25156J39149_1000122 | 3300002705 | Bacteria | 56600 |
| 10 | JGI25162J39368_1000343 | 3300002737 | Bacteria | 40240 |
| 11 | JGI25162J39368_1001828 | 3300002737 | Bacteria | 9959 |
| 12 | JGI25154J39366_1000132 | 3300002738 | Bacteria | 58454 |
| 13 | JGI25157J39369_1000106 | 3300002741 | Bacteria | 71144 |
| 14 | JGI25151J46595_10000285 | 3300003187 | Bacteria | 57259 |
| 15 | JGI25151J46595_10006958 | 3300003187 | Bacteria | 5605 |
| 16 | JGI25406J46586_10020708 | 3300003203 | Bacteria | 2653 |
| 17 | JGI25165J46597_1000448 | 3300003214 | Bacteria | 41488 |
| 18 | JGI25165J46597_1002332 | 3300003214 | Bacteria | 6407 |
| 19 | rootH1_10075866 | 3300003316 | Bacteria | 1205 |
| 20 | rootH2_10032239 | 3300003320 | Bacteria | 32858 |
| 21 | rootH2_10044892 | 3300003320 | Bacteria | 5700 |
| 22 | rootH2_10142949 | 3300003320 | Unclassified | 1720 |
| 23 | rootH2_10297647 | 3300003320 | Unclassified | 1285 |
| 24 | rootL2_10000825 | 3300003322 | Bacteria | 30356 |
| 25 | rootL2_10028893 | 3300003322 | Bacteria | 5663 |
| 26 | rootL2_10047860 | 3300003322 | Bacteria | 3741 |
| 27 | rootH1_10022429 | 3300003323 | Bacteria | 9846 |
| 28 | rootH1_10024211 | 3300003323 | Bacteria | 3005 |
| 29 | rootH1_10176177 | 3300003323 | Bacteria | 1679 |
| 30 | rootH1_10206279 | 3300003323 | Unclassified | 1197 |
| 31 | Ga0065715_10105165 | 3300005293 | Unclassified | 2895 |
| 32 | Ga0070658_10134759 | 3300005327 | Unclassified | 2060 |
| 33 | Ga0070676_10102310 | 3300005328 | Bacteria | 1772 |
| 34 | Ga0070676_10110021 | 3300005328 | Unclassified | 1714 |
| 35 | Ga0070683_100000835 | 3300005329 | Bacteria | 22828 |
| 36 | Ga0070683_100002634 | 3300005329 | Bacteria | 14344 |
| 37 | Ga0070683_100230084 | 3300005329 | Unclassified | 1762 |
| 38 | Ga0070683_100381057 | 3300005329 | Bacteria | 1344 |
| 39 | Ga0070683_100464131 | 3300005329 | Unclassified | 1208 |
| 40 | Ga0070690_100000456 | 3300005330 | Bacteria | 20589 |
| 41 | Ga0070690_100069261 | 3300005330 | Unclassified | 2289 |
| 42 | Ga0070670_100033767 | 3300005331 | Bacteria | 4405 |
| 43 | Ga0070670_100509783 | 3300005331 | Bacteria | 1070 |
| 44 | Ga0070677_10005282 | 3300005333 | Bacteria | 4251 |
| 45 | Ga0070677_10045508 | 3300005333 | Bacteria | 1751 |
| 46 | Ga0068869_100024527 | 3300005334 | Bacteria | 4177 |
| 47 | Ga0070666_10001743 | 3300005335 | Bacteria | 13267 |
| 48 | Ga0070666_10017198 | 3300005335 | Bacteria | 4634 |
| 49 | Ga0070666_10074125 | 3300005335 | Bacteria | 2319 |
| 50 | Ga0070666_10339811 | 3300005335 | Unclassified | 1073 |
| 51 | Ga0070680_100183000 | 3300005336 | Bacteria | 1765 |
| 52 | Ga0070680_100413974 | 3300005336 | Bacteria | 1150 |
| 53 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 54 | Ga0070682_100020786 | 3300005337 | Unclassified | 3867 |
| 55 | Ga0068868_100001806 | 3300005338 | Bacteria | 14694 |
| 56 | Ga0068868_100005079 | 3300005338 | Bacteria | 9243 |
| 57 | Ga0068868_100015998 | 3300005338 | Bacteria | 5562 |
| 58 | Ga0068868_100037089 | 3300005338 | Bacteria | 3777 |
| 59 | Ga0070660_100002663 | 3300005339 | Bacteria | 12266 |
| 60 | Ga0070660_100015316 | 3300005339 | Bacteria | 5534 |
| 61 | Ga0070689_100009333 | 3300005340 | Bacteria | 6956 |
| 62 | Ga0070689_100025654 | 3300005340 | Bacteria | 4430 |
| 63 | Ga0070661_100005786 | 3300005344 | Bacteria | 8501 |
| 64 | Ga0070668_100019735 | 3300005347 | Bacteria | 5076 |
| 65 | Ga0070668_100079760 | 3300005347 | Unclassified | 2563 |
| 66 | Ga0070668_100116547 | 3300005347 | Bacteria | 2130 |
| 67 | Ga0070668_100160023 | 3300005347 | Bacteria | 1826 |
| 68 | Ga0070669_100007505 | 3300005353 | Bacteria | 7811 |
| 69 | Ga0070669_100016363 | 3300005353 | Bacteria | 5291 |
| 70 | Ga0070669_100065518 | 3300005353 | Bacteria | 2676 |
| 71 | Ga0070669_100107548 | 3300005353 | Bacteria | 2113 |
| 72 | Ga0070675_100024719 | 3300005354 | Bacteria | 4811 |
| 73 | Ga0070675_100062372 | 3300005354 | Bacteria | 3080 |
| 74 | Ga0070675_100085408 | 3300005354 | Bacteria | 2637 |
| 75 | Ga0070671_100088123 | 3300005355 | Unclassified | 2597 |
| 76 | Ga0070671_100126410 | 3300005355 | Bacteria | 2152 |
| 77 | Ga0070671_100250484 | 3300005355 | Bacteria | 1504 |
| 78 | Ga0070674_100133925 | 3300005356 | Bacteria | 1852 |
| 79 | Ga0070673_100125075 | 3300005364 | Unclassified | 2150 |
| 80 | Ga0070688_100138167 | 3300005365 | Bacteria | 1652 |
| 81 | Ga0070688_100195274 | 3300005365 | Bacteria | 1412 |
| 82 | Ga0070659_100018980 | 3300005366 | Bacteria | 5199 |
| 83 | Ga0070659_100044681 | 3300005366 | Unclassified | 3469 |
| 84 | Ga0070667_100000282 | 3300005367 | Bacteria | 57538 |
| 85 | Ga0070667_100118369 | 3300005367 | Bacteria | 2302 |
| 86 | Ga0070667_100185199 | 3300005367 | Bacteria | 1842 |
| 87 | Ga0070667_100619029 | 3300005367 | Bacteria | 998 |
| 88 | Ga0070709_10000171 | 3300005434 | Bacteria | 40897 |
| 89 | Ga0070709_10007066 | 3300005434 | Bacteria | 6138 |
| 90 | Ga0070709_10015415 | 3300005434 | Bacteria | 4349 |
| 91 | Ga0070709_10055565 | 3300005434 | Bacteria | 2500 |
| 92 | Ga0070709_10062094 | 3300005434 | Bacteria | 2381 |
| 93 | Ga0070709_10066684 | 3300005434 | Bacteria | 2309 |
| 94 | Ga0070709_10082286 | 3300005434 | Bacteria | 2103 |
| 95 | Ga0070709_10135753 | 3300005434 | Bacteria | 1685 |
| 96 | Ga0070709_10213544 | 3300005434 | Bacteria | 1372 |
| 97 | Ga0070709_10217632 | 3300005434 | Bacteria | 1360 |
| 98 | Ga0070709_10261451 | 3300005434 | Bacteria | 1250 |
| 99 | Ga0070714_100005715 | 3300005435 | Bacteria | 9531 |
| 100 | Ga0070714_100062758 | 3300005435 | Bacteria | 3193 |
| 101 | Ga0070714_100165917 | 3300005435 | Bacteria | 2001 |
| 102 | Ga0070714_100404690 | 3300005435 | Bacteria | 1291 |
| 103 | Ga0070713_100000029 | 3300005436 | Bacteria | 90705 |
| 104 | Ga0070713_100005399 | 3300005436 | Bacteria | 8731 |
| 105 | Ga0070713_100007877 | 3300005436 | Bacteria | 7516 |
| 106 | Ga0070713_100027293 | 3300005436 | Bacteria | 4493 |
| 107 | Ga0070713_100040711 | 3300005436 | Bacteria | 3779 |
| 108 | Ga0070713_100077093 | 3300005436 | Bacteria | 2833 |
| 109 | Ga0070713_100146693 | 3300005436 | Bacteria | 2095 |
| 110 | Ga0070713_100165640 | 3300005436 | Bacteria | 1976 |
| 111 | Ga0070713_100220874 | 3300005436 | Bacteria | 1719 |
| 112 | Ga0070713_100256001 | 3300005436 | Bacteria | 1598 |
| 113 | Ga0070713_100317214 | 3300005436 | Bacteria | 1439 |
| 114 | Ga0070713_100355641 | 3300005436 | Bacteria | 1360 |
| 115 | Ga0070713_100390336 | 3300005436 | Bacteria | 1298 |
| 116 | Ga0070713_100482589 | 3300005436 | Bacteria | 1168 |
| 117 | Ga0070713_100543846 | 3300005436 | Bacteria | 1099 |
| 118 | Ga0070710_10000598 | 3300005437 | Bacteria | 17193 |
| 119 | Ga0070710_10011509 | 3300005437 | Bacteria | 4371 |
| 120 | Ga0070710_10049192 | 3300005437 | Bacteria | 2358 |
| 121 | Ga0070710_10090705 | 3300005437 | Bacteria | 1802 |
| 122 | Ga0070711_100000329 | 3300005439 | Bacteria | 24414 |
| 123 | Ga0070711_100000531 | 3300005439 | Bacteria | 19818 |
| 124 | Ga0070711_100016610 | 3300005439 | Bacteria | 4674 |
| 125 | Ga0070711_100111794 | 3300005439 | Bacteria | 2006 |
| 126 | Ga0070711_100255574 | 3300005439 | Bacteria | 1376 |
| 127 | Ga0070711_100276683 | 3300005439 | Bacteria | 1326 |
| 128 | Ga0070711_100283514 | 3300005439 | Bacteria | 1312 |
| 129 | Ga0070711_100315371 | 3300005439 | Bacteria | 1247 |
| 130 | Ga0070711_100405217 | 3300005439 | Bacteria | 1108 |
| 131 | Ga0070700_100049751 | 3300005441 | Unclassified | 2603 |
| 132 | Ga0070700_100135504 | 3300005441 | Bacteria | 1667 |
| 133 | Ga0070708_100000137 | 3300005445 | Bacteria | 50233 |
| 134 | Ga0070708_100026379 | 3300005445 | Unclassified | 4972 |
| 135 | Ga0070708_100031260 | 3300005445 | Bacteria | 4608 |
| 136 | Ga0070708_100044277 | 3300005445 | Bacteria | 3913 |
| 137 | Ga0070708_100055157 | 3300005445 | Bacteria | 3533 |
| 138 | Ga0070708_100088023 | 3300005445 | Bacteria | 2823 |
| 139 | Ga0070708_100184144 | 3300005445 | Bacteria | 1953 |
| 140 | Ga0070708_100209516 | 3300005445 | Bacteria | 1826 |
| 141 | Ga0070708_100209983 | 3300005445 | Bacteria | 1824 |
| 142 | Ga0070708_100331605 | 3300005445 | Unclassified | 1434 |
| 143 | Ga0070663_100227315 | 3300005455 | Bacteria | 1468 |
| 144 | Ga0070663_100276609 | 3300005455 | Unclassified | 1336 |
| 145 | Ga0070678_100036353 | 3300005456 | Bacteria | 3447 |
| 146 | Ga0070662_100001639 | 3300005457 | Bacteria | 13806 |
| 147 | Ga0070662_100094574 | 3300005457 | Bacteria | 2250 |
| 148 | Ga0070662_100166757 | 3300005457 | Unclassified | 1726 |
| 149 | Ga0070681_10072329 | 3300005458 | Bacteria | 3411 |
| 150 | Ga0070681_10105458 | 3300005458 | Bacteria | 2760 |
| 151 | Ga0070681_10194820 | 3300005458 | Bacteria | 1946 |
| 152 | Ga0070681_10259038 | 3300005458 | Unclassified | 1651 |
| 153 | Ga0068867_100027614 | 3300005459 | Bacteria | 4081 |
| 154 | Ga0070685_10001550 | 3300005466 | Bacteria | 12120 |
| 155 | Ga0070706_100001270 | 3300005467 | Bacteria | 26946 |
| 156 | Ga0070706_100003237 | 3300005467 | Bacteria | 16080 |
| 157 | Ga0070706_100004092 | 3300005467 | Bacteria | 14183 |
| 158 | Ga0070706_100016580 | 3300005467 | Bacteria | 6805 |
| 159 | Ga0070706_100046278 | 3300005467 | Bacteria | 4017 |
| 160 | Ga0070706_100395620 | 3300005467 | Bacteria | 1286 |
| 161 | Ga0070707_100000651 | 3300005468 | Bacteria | 34704 |
| 162 | Ga0070707_100084062 | 3300005468 | Bacteria | 3075 |
| 163 | Ga0070707_100102607 | 3300005468 | Bacteria | 2771 |
| 164 | Ga0070707_100118639 | 3300005468 | Bacteria | 2568 |
| 165 | Ga0070707_100143024 | 3300005468 | Bacteria | 2328 |
| 166 | Ga0070707_100197424 | 3300005468 | Bacteria | 1961 |
| 167 | Ga0070707_100208746 | 3300005468 | Unclassified | 1904 |
| 168 | Ga0070707_100399460 | 3300005468 | Bacteria | 1334 |
| 169 | Ga0070698_100000902 | 3300005471 | Bacteria | 32626 |
| 170 | Ga0070698_100269082 | 3300005471 | Bacteria | 1636 |
| 171 | Ga0070699_100000439 | 3300005518 | Bacteria | 39981 |
| 172 | Ga0070699_100033576 | 3300005518 | Bacteria | 4433 |
| 173 | Ga0070699_100035250 | 3300005518 | Bacteria | 4325 |
| 174 | Ga0070699_100111319 | 3300005518 | Bacteria | 2404 |
| 175 | Ga0070699_100243814 | 3300005518 | Bacteria | 1605 |
| 176 | Ga0070679_100006873 | 3300005530 | Bacteria | 10610 |
| 177 | Ga0070679_100041877 | 3300005530 | Bacteria | 4559 |
| 178 | Ga0070679_100574765 | 3300005530 | Bacteria | 1070 |
| 179 | Ga0070684_100001425 | 3300005535 | Bacteria | 17223 |
| 180 | Ga0070684_100013041 | 3300005535 | Bacteria | 6687 |
| 181 | Ga0070684_100013231 | 3300005535 | Bacteria | 6646 |
| 182 | Ga0070697_100000031 | 3300005536 | Bacteria | 110959 |
| 183 | Ga0070697_100000265 | 3300005536 | Bacteria | 42493 |
| 184 | Ga0070697_100006312 | 3300005536 | Bacteria | 9175 |
| 185 | Ga0070697_100016810 | 3300005536 | Bacteria | 5754 |
| 186 | Ga0070697_100037929 | 3300005536 | Bacteria | 3892 |
| 187 | Ga0070697_100053398 | 3300005536 | Bacteria | 3284 |
| 188 | Ga0070697_100053953 | 3300005536 | Bacteria | 3267 |
| 189 | Ga0070697_100372830 | 3300005536 | Bacteria | 1235 |
| 190 | Ga0068853_100043468 | 3300005539 | Bacteria | 3843 |
| 191 | Ga0068853_100172173 | 3300005539 | Bacteria | 1959 |
| 192 | Ga0068853_100261110 | 3300005539 | Bacteria | 1592 |
| 193 | Ga0068853_100362457 | 3300005539 | Bacteria | 1350 |
| 194 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 195 | Ga0070672_100003522 | 3300005543 | Bacteria | 10146 |
| 196 | Ga0070672_100058900 | 3300005543 | Bacteria | 3020 |
| 197 | Ga0070686_100120705 | 3300005544 | Bacteria | 1799 |
| 198 | Ga0070686_100128115 | 3300005544 | Bacteria | 1752 |
| 199 | Ga0070686_100185767 | 3300005544 | Bacteria | 1480 |
| 200 | Ga0070696_100107624 | 3300005546 | Bacteria | 2005 |
| 201 | Ga0070696_100159704 | 3300005546 | Bacteria | 1660 |
| 202 | Ga0070696_100389163 | 3300005546 | Bacteria | 1088 |
| 203 | Ga0070665_100038334 | 3300005548 | Bacteria | 4818 |
| 204 | Ga0070665_100132617 | 3300005548 | Bacteria | 2493 |
| 205 | Ga0070665_100379245 | 3300005548 | Unclassified | 1421 |
| 206 | Ga0070704_100321264 | 3300005549 | Bacteria | 1297 |
| 207 | Ga0070704_100601639 | 3300005549 | Bacteria | 966 |
| 208 | Ga0068855_100021308 | 3300005563 | Bacteria | 7772 |
| 209 | Ga0068855_100022936 | 3300005563 | Bacteria | 7481 |
| 210 | Ga0068855_100056535 | 3300005563 | Bacteria | 4604 |
| 211 | Ga0068855_100297149 | 3300005563 | Bacteria | 1789 |
| 212 | Ga0070664_100009088 | 3300005564 | Bacteria | 8065 |
| 213 | Ga0070664_100619004 | 3300005564 | Bacteria | 1005 |
| 214 | Ga0068857_100576830 | 3300005577 | Bacteria | 1061 |
| 215 | Ga0068854_100093534 | 3300005578 | Bacteria | 2241 |
| 216 | Ga0068854_100147591 | 3300005578 | Bacteria | 1811 |
| 217 | Ga0068854_100185212 | 3300005578 | Bacteria | 1628 |
| 218 | Ga0068856_100001651 | 3300005614 | Bacteria | 23387 |
| 219 | Ga0068856_100006407 | 3300005614 | Bacteria | 11549 |
| 220 | Ga0068856_100009226 | 3300005614 | Bacteria | 9593 |
| 221 | Ga0068856_100066743 | 3300005614 | Bacteria | 3555 |
| 222 | Ga0068856_100080518 | 3300005614 | Bacteria | 3230 |
| 223 | Ga0068856_100097010 | 3300005614 | Unclassified | 2937 |
| 224 | Ga0068856_100232394 | 3300005614 | Bacteria | 1859 |
| 225 | Ga0068856_100678746 | 3300005614 | Bacteria | 1051 |
| 226 | Ga0068856_100979569 | 3300005614 | Bacteria | 864 |
| 227 | Ga0070702_100015282 | 3300005615 | Bacteria | 3917 |
| 228 | Ga0070702_100334723 | 3300005615 | Bacteria | 1060 |
| 229 | Ga0068852_100003785 | 3300005616 | Bacteria | 10607 |
| 230 | Ga0068852_100007483 | 3300005616 | Bacteria | 7971 |
| 231 | Ga0068852_100417196 | 3300005616 | Bacteria | 1323 |
| 232 | Ga0068859_100002112 | 3300005617 | Bacteria | 20238 |
| 233 | Ga0068859_100125511 | 3300005617 | Bacteria | 2635 |
| 234 | Ga0068864_100048826 | 3300005618 | Unclassified | 3639 |
| 235 | Ga0068864_100160340 | 3300005618 | Bacteria | 2044 |
| 236 | Ga0068864_100214480 | 3300005618 | Bacteria | 1774 |
| 237 | Ga0068866_10054809 | 3300005718 | Bacteria | 2045 |
| 238 | Ga0068861_100054860 | 3300005719 | Bacteria | 3037 |
| 239 | Ga0068861_100713501 | 3300005719 | Bacteria | 933 |
| 240 | Ga0068851_10036662 | 3300005834 | Bacteria | 2456 |
| 241 | Ga0068851_10113968 | 3300005834 | Bacteria | 1446 |
| 242 | Ga0068870_10088609 | 3300005840 | Bacteria | 1725 |
| 243 | Ga0068863_100022945 | 3300005841 | Bacteria | 5964 |
| 244 | Ga0068863_100060590 | 3300005841 | Bacteria | 3579 |
| 245 | Ga0068863_100076218 | 3300005841 | Bacteria | 3173 |
| 246 | Ga0068863_100154139 | 3300005841 | Bacteria | 2199 |
| 247 | Ga0068863_100403994 | 3300005841 | Unclassified | 1336 |
| 248 | Ga0068858_100000871 | 3300005842 | Bacteria | 31216 |
| 249 | Ga0068858_100065088 | 3300005842 | Bacteria | 3373 |
| 250 | Ga0068858_100543497 | 3300005842 | Bacteria | 1124 |
| 251 | Ga0068860_100000830 | 3300005843 | Bacteria | 34607 |
| 252 | Ga0068860_100001349 | 3300005843 | Bacteria | 26682 |
| 253 | Ga0068860_100198774 | 3300005843 | Bacteria | 1942 |
| 254 | Ga0068860_100249569 | 3300005843 | Bacteria | 1728 |
| 255 | Ga0068860_100502358 | 3300005843 | Bacteria | 1211 |
| 256 | Ga0068860_100652223 | 3300005843 | Bacteria | 1060 |
| 257 | Ga0068862_100021739 | 3300005844 | Bacteria | 5365 |
| 258 | Ga0068862_100030172 | 3300005844 | Bacteria | 4569 |
| 259 | Ga0068862_100078041 | 3300005844 | Bacteria | 2869 |
| 260 | Ga0081455_10008262 | 3300005937 | Bacteria | 10853 |
| 261 | Ga0081540_1024855 | 3300005983 | Bacteria | 3465 |
| 262 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 263 | Ga0070717_10003539 | 3300006028 | Bacteria | 11199 |
| 264 | Ga0070717_10003613 | 3300006028 | Bacteria | 11088 |
| 265 | Ga0070717_10007234 | 3300006028 | Bacteria | 8233 |
| 266 | Ga0070717_10010660 | 3300006028 | Bacteria | 6948 |
| 267 | Ga0070717_10021483 | 3300006028 | Bacteria | 5086 |
| 268 | Ga0070717_10034270 | 3300006028 | Unclassified | 4103 |
| 269 | Ga0070717_10040703 | 3300006028 | Bacteria | 3786 |
| 270 | Ga0070717_10051701 | 3300006028 | Bacteria | 3383 |
| 271 | Ga0070717_10080812 | 3300006028 | Bacteria | 2728 |
| 272 | Ga0070717_10106609 | 3300006028 | Bacteria | 2386 |
| 273 | Ga0070717_10120276 | 3300006028 | Bacteria | 2249 |
| 274 | Ga0070717_10256065 | 3300006028 | Bacteria | 1547 |
| 275 | Ga0070717_10580210 | 3300006028 | Bacteria | 1017 |
| 276 | Ga0075365_10011855 | 3300006038 | Bacteria | 5145 |
| 277 | Ga0070715_10051016 | 3300006163 | Bacteria | 1778 |
| 278 | Ga0070715_10053810 | 3300006163 | Bacteria | 1741 |
| 279 | Ga0070715_10103544 | 3300006163 | Bacteria | 1332 |
| 280 | Ga0070716_100000682 | 3300006173 | Bacteria | 14524 |
| 281 | Ga0070716_100004580 | 3300006173 | Bacteria | 6625 |
| 282 | Ga0070716_100012268 | 3300006173 | Bacteria | 4340 |
| 283 | Ga0070716_100017366 | 3300006173 | Unclassified | 3729 |
| 284 | Ga0070716_100025229 | 3300006173 | Bacteria | 3170 |
| 285 | Ga0070716_100188029 | 3300006173 | Bacteria | 1362 |
| 286 | Ga0070716_100197545 | 3300006173 | Bacteria | 1334 |
| 287 | Ga0070716_100249545 | 3300006173 | Bacteria | 1208 |
| 288 | Ga0070716_100296467 | 3300006173 | Bacteria | 1123 |
| 289 | Ga0070712_100000542 | 3300006175 | Bacteria | 21816 |
| 290 | Ga0070712_100002276 | 3300006175 | Bacteria | 11821 |
| 291 | Ga0070712_100008763 | 3300006175 | Bacteria | 6368 |
| 292 | Ga0070712_100013608 | 3300006175 | Bacteria | 5202 |
| 293 | Ga0070712_100015048 | 3300006175 | Bacteria | 4974 |
| 294 | Ga0070712_100021048 | 3300006175 | Bacteria | 4277 |
| 295 | Ga0070712_100024315 | 3300006175 | Unclassified | 4013 |
| 296 | Ga0070712_100192763 | 3300006175 | Bacteria | 1596 |
| 297 | Ga0070712_100470080 | 3300006175 | Bacteria | 1050 |
| 298 | Ga0075369_10008398 | 3300006186 | Bacteria | 3970 |
| 299 | Ga0075366_10001905 | 3300006195 | Bacteria | 10544 |
| 300 | Ga0097621_100093431 | 3300006237 | Bacteria | 2521 |
| 301 | Ga0097621_100641226 | 3300006237 | Bacteria | 974 |
| 302 | Ga0068871_100038979 | 3300006358 | Bacteria | 3799 |
| 303 | Ga0068871_100435399 | 3300006358 | Bacteria | 1173 |
| 304 | Ga0075430_100001163 | 3300006846 | Bacteria | 21045 |
| 305 | Ga0075430_100098606 | 3300006846 | Unclassified | 2441 |
| 306 | Ga0075431_100004149 | 3300006847 | Bacteria | 14151 |
| 307 | Ga0075431_100127579 | 3300006847 | Bacteria | 2625 |
| 308 | Ga0075433_10002861 | 3300006852 | Bacteria | 13223 |
| 309 | Ga0075433_10014138 | 3300006852 | Bacteria | 6512 |
| 310 | Ga0075433_10029132 | 3300006852 | Bacteria | 4701 |
| 311 | Ga0075433_10053371 | 3300006852 | Bacteria | 3524 |
| 312 | Ga0075433_10451889 | 3300006852 | Bacteria | 1133 |
| 313 | Ga0075434_100000195 | 3300006871 | Bacteria | 40479 |
| 314 | Ga0075434_100000895 | 3300006871 | Bacteria | 23884 |
| 315 | Ga0075434_100013552 | 3300006871 | Bacteria | 7765 |
| 316 | Ga0075434_100098424 | 3300006871 | Bacteria | 2930 |
| 317 | Ga0075434_100102473 | 3300006871 | Bacteria | 2870 |
| 318 | Ga0075434_100151150 | 3300006871 | Bacteria | 2342 |
| 319 | Ga0075434_100382916 | 3300006871 | Bacteria | 1427 |
| 320 | Ga0075434_100450425 | 3300006871 | Bacteria | 1308 |
| 321 | Ga0068865_100014673 | 3300006881 | Bacteria | 4984 |
| 322 | Ga0075436_100001331 | 3300006914 | Bacteria | 16801 |
| 323 | Ga0075436_100008675 | 3300006914 | Bacteria | 6947 |
| 324 | Ga0075436_100020426 | 3300006914 | Bacteria | 4546 |
| 325 | Ga0075436_100020921 | 3300006914 | Bacteria | 4487 |
| 326 | Ga0075436_100032955 | 3300006914 | Bacteria | 3569 |
| 327 | Ga0075436_100074720 | 3300006914 | Bacteria | 2346 |
| 328 | Ga0075436_100298156 | 3300006914 | Bacteria | 1155 |
| 329 | Ga0097620_100002112 | 3300006931 | Bacteria | 20238 |
| 330 | Ga0097620_100125518 | 3300006931 | Bacteria | 2635 |
| 331 | Ga0075435_100000065 | 3300007076 | Bacteria | 54666 |
| 332 | Ga0075435_100006798 | 3300007076 | Bacteria | 8116 |
| 333 | Ga0075435_100020039 | 3300007076 | Bacteria | 5115 |
| 334 | Ga0075435_100027951 | 3300007076 | Bacteria | 4418 |
| 335 | Ga0075435_100059868 | 3300007076 | Bacteria | 3087 |
| 336 | Ga0075435_100118493 | 3300007076 | Bacteria | 2207 |
| 337 | Ga0075435_100233540 | 3300007076 | Bacteria | 1563 |
| 338 | Ga0099794_10000092 | 3300007265 | Bacteria | 33008 |
| 339 | Ga0099794_10001902 | 3300007265 | Bacteria | 7487 |
| 340 | Ga0099794_10011947 | 3300007265 | Bacteria | 3732 |
| 341 | Ga0099794_10012750 | 3300007265 | Bacteria | 3639 |
| 342 | Ga0099794_10096956 | 3300007265 | Bacteria | 1468 |
| 343 | Ga0099795_10059480 | 3300007788 | Unclassified | 1414 |
| 344 | Ga0105251_10035508 | 3300009011 | Bacteria | 2459 |
| 345 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 346 | Ga0105240_10138314 | 3300009093 | Bacteria | 2914 |
| 347 | Ga0105240_10243353 | 3300009093 | Bacteria | 2084 |
| 348 | Ga0105240_10583120 | 3300009093 | Bacteria | 1233 |
| 349 | Ga0105240_10807754 | 3300009093 | Bacteria | 1015 |
| 350 | Ga0105240_10860192 | 3300009093 | Bacteria | 978 |
| 351 | Ga0111539_10510630 | 3300009094 | Bacteria | 1400 |
| 352 | Ga0105247_10007660 | 3300009101 | Bacteria | 6608 |
| 353 | Ga0105247_10286033 | 3300009101 | Bacteria | 1139 |
| 354 | Ga0114129_10006586 | 3300009147 | Bacteria | 16490 |
| 355 | Ga0114129_10036391 | 3300009147 | Bacteria | 6952 |
| 356 | Ga0114129_10084537 | 3300009147 | Bacteria | 4405 |
| 357 | Ga0114129_10124086 | 3300009147 | Bacteria | 3552 |
| 358 | Ga0114129_10238217 | 3300009147 | Bacteria | 2447 |
| 359 | Ga0105243_10089358 | 3300009148 | Bacteria | 2532 |
| 360 | Ga0105241_10027728 | 3300009174 | Bacteria | 4217 |
| 361 | Ga0105241_10031153 | 3300009174 | Bacteria | 3992 |
| 362 | Ga0105241_10176339 | 3300009174 | Bacteria | 1769 |
| 363 | Ga0105241_10212839 | 3300009174 | Bacteria | 1620 |
| 364 | Ga0105241_10303268 | 3300009174 | Bacteria | 1371 |
| 365 | Ga0105241_10443124 | 3300009174 | Bacteria | 1147 |
| 366 | Ga0105242_10052001 | 3300009176 | Bacteria | 3341 |
| 367 | Ga0105248_10001890 | 3300009177 | Bacteria | 23227 |
| 368 | Ga0105248_10045188 | 3300009177 | Bacteria | 4939 |
| 369 | Ga0105248_10136773 | 3300009177 | Bacteria | 2764 |
| 370 | Ga0105248_10226466 | 3300009177 | Bacteria | 2104 |
| 371 | Ga0105248_10686222 | 3300009177 | Bacteria | 1155 |
| 372 | Ga0105237_10006938 | 3300009545 | Bacteria | 12485 |
| 373 | Ga0105237_10064347 | 3300009545 | Bacteria | 3664 |
| 374 | Ga0105237_10084099 | 3300009545 | Bacteria | 3173 |
| 375 | Ga0105237_10152615 | 3300009545 | Bacteria | 2306 |
| 376 | Ga0105237_10339311 | 3300009545 | Bacteria | 1507 |
| 377 | Ga0105238_10018247 | 3300009551 | Bacteria | 7136 |
| 378 | Ga0105238_10052374 | 3300009551 | Bacteria | 4103 |
| 379 | Ga0105249_10018692 | 3300009553 | Bacteria | 6173 |
| 380 | Ga0105249_10027986 | 3300009553 | Bacteria | 5088 |
| 381 | Ga0105249_10151312 | 3300009553 | Bacteria | 2234 |
| 382 | Ga0105239_10031532 | 3300010375 | Bacteria | 5828 |
| 383 | Ga0105239_10566828 | 3300010375 | Bacteria | 1294 |
| 384 | Ga0105239_11255413 | 3300010375 | Bacteria | 854 |
| 385 | Ga0105246_10004331 | 3300011119 | Bacteria | 8633 |
| 386 | Ga0105246_10120475 | 3300011119 | Bacteria | 1943 |
| 387 | Ga0157373_10005392 | 3300013100 | Bacteria | 9605 |
| 388 | Ga0157373_10150939 | 3300013100 | Bacteria | 1634 |
| 389 | Ga0157373_10508049 | 3300013100 | Unclassified | 871 |
| 390 | Ga0157373_10522060 | 3300013100 | Bacteria | 859 |
| 391 | Ga0157371_10012541 | 3300013102 | Bacteria | 6473 |
| 392 | Ga0157370_10063658 | 3300013104 | Bacteria | 3493 |
| 393 | Ga0157369_10019476 | 3300013105 | Bacteria | 7592 |
| 394 | Ga0157369_10031551 | 3300013105 | Bacteria | 5834 |
| 395 | Ga0157369_10088555 | 3300013105 | Bacteria | 3304 |
| 396 | Ga0157369_10119503 | 3300013105 | Bacteria | 2797 |
| 397 | Ga0157369_10281269 | 3300013105 | Bacteria | 1733 |
| 398 | Ga0157374_10032515 | 3300013296 | Bacteria | 4751 |
| 399 | Ga0157374_10122109 | 3300013296 | Bacteria | 2515 |
| 400 | Ga0157374_10122928 | 3300013296 | Bacteria | 2507 |
| 401 | Ga0157374_10132304 | 3300013296 | Bacteria | 2415 |
| 402 | Ga0157374_10235467 | 3300013296 | Bacteria | 1799 |
| 403 | Ga0157374_10242479 | 3300013296 | Bacteria | 1772 |
| 404 | Ga0157378_10060322 | 3300013297 | Bacteria | 3385 |
| 405 | Ga0157378_10499318 | 3300013297 | Bacteria | 1215 |
| 406 | Ga0163162_10001058 | 3300013306 | Bacteria | 25595 |
| 407 | Ga0163162_10062073 | 3300013306 | Bacteria | 3777 |
| 408 | Ga0163162_10079760 | 3300013306 | Bacteria | 3340 |
| 409 | Ga0163162_10083112 | 3300013306 | Bacteria | 3275 |
| 410 | Ga0157372_10020581 | 3300013307 | Bacteria | 7121 |
| 411 | Ga0157372_10023668 | 3300013307 | Bacteria | 6663 |
| 412 | Ga0157372_10081819 | 3300013307 | Bacteria | 3655 |
| 413 | Ga0157372_10190156 | 3300013307 | Bacteria | 2378 |
| 414 | Ga0157372_10197800 | 3300013307 | Bacteria | 2328 |
| 415 | Ga0157375_10004658 | 3300013308 | Bacteria | 11925 |
| 416 | Ga0157375_10019511 | 3300013308 | Bacteria | 6168 |
| 417 | Ga0157375_10244236 | 3300013308 | Bacteria | 1955 |
| 418 | Ga0157375_10964237 | 3300013308 | Bacteria | 994 |
| 419 | Ga0163163_10065182 | 3300014325 | Bacteria | 3615 |
| 420 | Ga0163163_10106923 | 3300014325 | Bacteria | 2824 |
| 421 | Ga0157380_10021711 | 3300014326 | Bacteria | 4819 |
| 422 | Ga0157380_10531954 | 3300014326 | Bacteria | 1149 |
| 423 | Ga0182008_10096120 | 3300014497 | Unclassified | 1462 |
| 424 | Ga0157377_10118034 | 3300014745 | Bacteria | 1604 |
| 425 | Ga0157379_10004276 | 3300014968 | Bacteria | 12196 |
| 426 | Ga0157379_10009361 | 3300014968 | Bacteria | 8535 |
| 427 | Ga0157376_10108440 | 3300014969 | Bacteria | 2439 |
| 428 | Ga0157376_10163450 | 3300014969 | Bacteria | 2020 |
| 429 | Ga0182006_1026090 | 3300015261 | Bacteria | 2395 |
| 430 | Ga0182007_10008105 | 3300015262 | Bacteria | 4337 |
| 431 | Ga0182007_10009986 | 3300015262 | Unclassified | 3781 |
| 432 | Ga0182007_10010012 | 3300015262 | Bacteria | 3775 |
| 433 | Ga0163161_10159673 | 3300017792 | Unclassified | 1719 |
| 434 | Ga0163161_10469336 | 3300017792 | Bacteria | 1020 |
| 435 | Ga0213872_10005572 | 3300021361 | Bacteria | 6437 |
| 436 | Ga0213872_10136821 | 3300021361 | Bacteria | 1076 |
| 437 | Ga0213874_10003840 | 3300021377 | Bacteria | 3376 |
| 438 | Ga0213875_10164406 | 3300021388 | Bacteria | 1041 |
| 439 | Ga0228598_1005430 | 3300024227 | Unclassified | 2664 |
| 440 | Ga0209435_100081 | 3300025206 | Bacteria | 47006 |
| 441 | Ga0209760_104944 | 3300025207 | Bacteria | 1119 |
| 442 | Ga0209563_103575 | 3300025230 | Bacteria | 3174 |
| 443 | Ga0209437_100153 | 3300025233 | Bacteria | 154068 |
| 444 | Ga0209437_100201 | 3300025233 | Bacteria | 119080 |
| 445 | Ga0209646_1000064 | 3300025246 | Bacteria | 246524 |
| 446 | Ga0209646_1008468 | 3300025246 | Bacteria | 1652 |
| 447 | Ga0209026_1000053 | 3300025250 | Bacteria | 246524 |
| 448 | Ga0209677_100466 | 3300025253 | Bacteria | 23292 |
| 449 | Ga0209677_101561 | 3300025253 | Bacteria | 9747 |
| 450 | Ga0209759_1000042 | 3300025256 | Bacteria | 246524 |
| 451 | Ga0209233_1000175 | 3300025261 | Bacteria | 144221 |
| 452 | Ga0209233_1000226 | 3300025261 | Bacteria | 103045 |
| 453 | Ga0209233_1000338 | 3300025261 | Bacteria | 46030 |
| 454 | Ga0209025_1000114 | 3300025294 | Bacteria | 218921 |
| 455 | Ga0209025_1000584 | 3300025294 | Bacteria | 66147 |
| 456 | Ga0209758_1005459 | 3300025297 | Bacteria | 9774 |
| 457 | Ga0207697_10010855 | 3300025315 | Unclassified | 3876 |
| 458 | Ga0207656_10088770 | 3300025321 | Bacteria | 1400 |
| 459 | Ga0207682_10010502 | 3300025893 | Bacteria | 3629 |
| 460 | Ga0207682_10036606 | 3300025893 | Bacteria | 1986 |
| 461 | Ga0207692_10036401 | 3300025898 | Bacteria | 2399 |
| 462 | Ga0207692_10246345 | 3300025898 | Bacteria | 1069 |
| 463 | Ga0207692_10339026 | 3300025898 | Unclassified | 924 |
| 464 | Ga0207642_10013339 | 3300025899 | Bacteria | 2997 |
| 465 | Ga0207710_10127902 | 3300025900 | Bacteria | 1218 |
| 466 | Ga0207688_10005078 | 3300025901 | Bacteria | 7158 |
| 467 | Ga0207680_10000344 | 3300025903 | Bacteria | 22220 |
| 468 | Ga0207680_10049190 | 3300025903 | Unclassified | 2508 |
| 469 | Ga0207647_10021795 | 3300025904 | Bacteria | 4268 |
| 470 | Ga0207685_10008371 | 3300025905 | Bacteria | 2942 |
| 471 | Ga0207699_10000491 | 3300025906 | Bacteria | 19853 |
| 472 | Ga0207699_10009842 | 3300025906 | Bacteria | 4777 |
| 473 | Ga0207699_10015899 | 3300025906 | Bacteria | 3923 |
| 474 | Ga0207699_10035151 | 3300025906 | Bacteria | 2849 |
| 475 | Ga0207699_10069024 | 3300025906 | Bacteria | 2153 |
| 476 | Ga0207699_10089842 | 3300025906 | Bacteria | 1926 |
| 477 | Ga0207699_10148203 | 3300025906 | Bacteria | 1549 |
| 478 | Ga0207699_10178003 | 3300025906 | Bacteria | 1428 |
| 479 | Ga0207699_10226216 | 3300025906 | Bacteria | 1279 |
| 480 | Ga0207645_10005119 | 3300025907 | Bacteria | 9591 |
| 481 | Ga0207645_10009704 | 3300025907 | Bacteria | 6651 |
| 482 | Ga0207643_10000133 | 3300025908 | Bacteria | 50506 |
| 483 | Ga0207705_10294393 | 3300025909 | Unclassified | 1244 |
| 484 | Ga0207705_10465892 | 3300025909 | Bacteria | 980 |
| 485 | Ga0207684_10000705 | 3300025910 | Bacteria | 39440 |
| 486 | Ga0207684_10000811 | 3300025910 | Bacteria | 36097 |
| 487 | Ga0207684_10002252 | 3300025910 | Bacteria | 19648 |
| 488 | Ga0207684_10037395 | 3300025910 | Bacteria | 4119 |
| 489 | Ga0207684_10095761 | 3300025910 | Bacteria | 2533 |
| 490 | Ga0207684_10282362 | 3300025910 | Bacteria | 1432 |
| 491 | Ga0207654_10001902 | 3300025911 | Bacteria | 10835 |
| 492 | Ga0207654_10002085 | 3300025911 | Bacteria | 10239 |
| 493 | Ga0207654_10161255 | 3300025911 | Bacteria | 1449 |
| 494 | Ga0207654_10172944 | 3300025911 | Bacteria | 1404 |
| 495 | Ga0207707_10006740 | 3300025912 | Bacteria | 10028 |
| 496 | Ga0207707_10020123 | 3300025912 | Bacteria | 5825 |
| 497 | Ga0207707_10028403 | 3300025912 | Unclassified | 4890 |
| 498 | Ga0207707_10094171 | 3300025912 | Bacteria | 2617 |
| 499 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 500 | Ga0207695_10006005 | 3300025913 | Bacteria | 15875 |
| 501 | Ga0207695_10340107 | 3300025913 | Bacteria | 1388 |
| 502 | Ga0207671_10001611 | 3300025914 | Bacteria | 25670 |
| 503 | Ga0207693_10000031 | 3300025915 | Bacteria | 117500 |
| 504 | Ga0207693_10001029 | 3300025915 | Bacteria | 24949 |
| 505 | Ga0207693_10002423 | 3300025915 | Bacteria | 16201 |
| 506 | Ga0207693_10010541 | 3300025915 | Bacteria | 7501 |
| 507 | Ga0207693_10013900 | 3300025915 | Bacteria | 6483 |
| 508 | Ga0207693_10014377 | 3300025915 | Bacteria | 6366 |
| 509 | Ga0207693_10017024 | 3300025915 | Bacteria | 5804 |
| 510 | Ga0207693_10050827 | 3300025915 | Bacteria | 3254 |
| 511 | Ga0207693_10055443 | 3300025915 | Bacteria | 3110 |
| 512 | Ga0207693_10136756 | 3300025915 | Bacteria | 1927 |
| 513 | Ga0207693_10291916 | 3300025915 | Unclassified | 1278 |
| 514 | Ga0207663_10001507 | 3300025916 | Bacteria | 10874 |
| 515 | Ga0207663_10003723 | 3300025916 | Bacteria | 7510 |
| 516 | Ga0207663_10017716 | 3300025916 | Unclassified | 3976 |
| 517 | Ga0207663_10034816 | 3300025916 | Bacteria | 3015 |
| 518 | Ga0207663_10235305 | 3300025916 | Bacteria | 1340 |
| 519 | Ga0207663_10238573 | 3300025916 | Bacteria | 1332 |
| 520 | Ga0207663_10372323 | 3300025916 | Bacteria | 1086 |
| 521 | Ga0207660_10216404 | 3300025917 | Bacteria | 1502 |
| 522 | Ga0207662_10436054 | 3300025918 | Bacteria | 894 |
| 523 | Ga0207657_10001503 | 3300025919 | Bacteria | 24928 |
| 524 | Ga0207657_10001593 | 3300025919 | Bacteria | 24379 |
| 525 | Ga0207657_10021527 | 3300025919 | Bacteria | 6063 |
| 526 | Ga0207649_10000241 | 3300025920 | Bacteria | 44222 |
| 527 | Ga0207652_10004952 | 3300025921 | Bacteria | 10786 |
| 528 | Ga0207652_10289070 | 3300025921 | Bacteria | 1479 |
| 529 | Ga0207652_10298619 | 3300025921 | Bacteria | 1454 |
| 530 | Ga0207646_10000494 | 3300025922 | Bacteria | 52791 |
| 531 | Ga0207646_10119073 | 3300025922 | Bacteria | 2372 |
| 532 | Ga0207646_10121366 | 3300025922 | Bacteria | 2348 |
| 533 | Ga0207646_10168304 | 3300025922 | Unclassified | 1979 |
| 534 | Ga0207646_10178522 | 3300025922 | Bacteria | 1918 |
| 535 | Ga0207646_10255306 | 3300025922 | Bacteria | 1584 |
| 536 | Ga0207646_10443792 | 3300025922 | Bacteria | 1171 |
| 537 | Ga0207681_10023821 | 3300025923 | Bacteria | 3921 |
| 538 | Ga0207681_10059437 | 3300025923 | Bacteria | 2620 |
| 539 | Ga0207681_10326180 | 3300025923 | Bacteria | 1222 |
| 540 | Ga0207694_10039331 | 3300025924 | Bacteria | 3640 |
| 541 | Ga0207650_10000124 | 3300025925 | Bacteria | 97031 |
| 542 | Ga0207650_10011152 | 3300025925 | Bacteria | 6181 |
| 543 | Ga0207650_10162216 | 3300025925 | Bacteria | 1772 |
| 544 | Ga0207659_10050339 | 3300025926 | Bacteria | 2959 |
| 545 | Ga0207659_10053620 | 3300025926 | Bacteria | 2877 |
| 546 | Ga0207659_10205892 | 3300025926 | Bacteria | 1574 |
| 547 | Ga0207687_10008822 | 3300025927 | Bacteria | 6591 |
| 548 | Ga0207687_10474328 | 3300025927 | Bacteria | 1041 |
| 549 | Ga0207700_10000160 | 3300025928 | Bacteria | 40173 |
| 550 | Ga0207700_10006581 | 3300025928 | Bacteria | 7036 |
| 551 | Ga0207700_10067821 | 3300025928 | Bacteria | 2732 |
| 552 | Ga0207700_10087124 | 3300025928 | Bacteria | 2455 |
| 553 | Ga0207700_10193770 | 3300025928 | Bacteria | 1709 |
| 554 | Ga0207700_10249664 | 3300025928 | Bacteria | 1515 |
| 555 | Ga0207700_10357839 | 3300025928 | Bacteria | 1272 |
| 556 | Ga0207700_10395686 | 3300025928 | Bacteria | 1210 |
| 557 | Ga0207700_10588055 | 3300025928 | Bacteria | 990 |
| 558 | Ga0207664_10000582 | 3300025929 | Bacteria | 25512 |
| 559 | Ga0207664_10004389 | 3300025929 | Bacteria | 9553 |
| 560 | Ga0207664_10027352 | 3300025929 | Bacteria | 4322 |
| 561 | Ga0207664_10035543 | 3300025929 | Bacteria | 3845 |
| 562 | Ga0207664_10057057 | 3300025929 | Bacteria | 3103 |
| 563 | Ga0207664_10374547 | 3300025929 | Bacteria | 1263 |
| 564 | Ga0207644_10044710 | 3300025931 | Bacteria | 3147 |
| 565 | Ga0207644_10389227 | 3300025931 | Bacteria | 1138 |
| 566 | Ga0207690_10121152 | 3300025932 | Bacteria | 1900 |
| 567 | Ga0207690_10244583 | 3300025932 | Bacteria | 1383 |
| 568 | Ga0207706_10000389 | 3300025933 | Bacteria | 47573 |
| 569 | Ga0207706_10006249 | 3300025933 | Bacteria | 11073 |
| 570 | Ga0207706_10056596 | 3300025933 | Bacteria | 3457 |
| 571 | Ga0207706_10084594 | 3300025933 | Bacteria | 2789 |
| 572 | Ga0207686_10208872 | 3300025934 | Bacteria | 1402 |
| 573 | Ga0207686_10356082 | 3300025934 | Bacteria | 1103 |
| 574 | Ga0207670_10005533 | 3300025936 | Bacteria | 6943 |
| 575 | Ga0207704_10127658 | 3300025938 | Unclassified | 1754 |
| 576 | Ga0207704_10226491 | 3300025938 | Bacteria | 1387 |
| 577 | Ga0207704_10271717 | 3300025938 | Bacteria | 1284 |
| 578 | Ga0207665_10000147 | 3300025939 | Bacteria | 47628 |
| 579 | Ga0207665_10002765 | 3300025939 | Bacteria | 11758 |
| 580 | Ga0207665_10004252 | 3300025939 | Bacteria | 9518 |
| 581 | Ga0207665_10008366 | 3300025939 | Bacteria | 6827 |
| 582 | Ga0207665_10011555 | 3300025939 | Bacteria | 5799 |
| 583 | Ga0207665_10012474 | 3300025939 | Bacteria | 5581 |
| 584 | Ga0207665_10017982 | 3300025939 | Bacteria | 4647 |
| 585 | Ga0207665_10029677 | 3300025939 | Bacteria | 3614 |
| 586 | Ga0207665_10038792 | 3300025939 | Bacteria | 3174 |
| 587 | Ga0207665_10039492 | 3300025939 | Bacteria | 3147 |
| 588 | Ga0207665_10135658 | 3300025939 | Bacteria | 1751 |
| 589 | Ga0207665_10318637 | 3300025939 | Bacteria | 1166 |
| 590 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 591 | Ga0207691_10000213 | 3300025940 | Bacteria | 56331 |
| 592 | Ga0207691_10014715 | 3300025940 | Bacteria | 7457 |
| 593 | Ga0207711_10000705 | 3300025941 | Bacteria | 32901 |
| 594 | Ga0207711_10004244 | 3300025941 | Bacteria | 12262 |
| 595 | Ga0207711_10011673 | 3300025941 | Bacteria | 7299 |
| 596 | Ga0207689_10009150 | 3300025942 | Bacteria | 8573 |
| 597 | Ga0207689_10021027 | 3300025942 | Bacteria | 5485 |
| 598 | Ga0207661_10000198 | 3300025944 | Bacteria | 39018 |
| 599 | Ga0207661_10001087 | 3300025944 | Bacteria | 18062 |
| 600 | Ga0207661_10471549 | 3300025944 | Unclassified | 1145 |
| 601 | Ga0207679_10000084 | 3300025945 | Bacteria | 82946 |
| 602 | Ga0207679_10044853 | 3300025945 | Bacteria | 3193 |
| 603 | Ga0207667_10100341 | 3300025949 | Bacteria | 2986 |
| 604 | Ga0207667_10223710 | 3300025949 | Bacteria | 1928 |
| 605 | Ga0207667_10314855 | 3300025949 | Bacteria | 1598 |
| 606 | Ga0207651_10020546 | 3300025960 | Unclassified | 3988 |
| 607 | Ga0207712_10009116 | 3300025961 | Bacteria | 6278 |
| 608 | Ga0207712_10171355 | 3300025961 | Unclassified | 1697 |
| 609 | Ga0207712_10387558 | 3300025961 | Bacteria | 1171 |
| 610 | Ga0207668_10013144 | 3300025972 | Bacteria | 5087 |
| 611 | Ga0207668_10107702 | 3300025972 | Bacteria | 2084 |
| 612 | Ga0207640_10040102 | 3300025981 | Bacteria | 2968 |
| 613 | Ga0207640_10044061 | 3300025981 | Unclassified | 2856 |
| 614 | Ga0207640_10058900 | 3300025981 | Bacteria | 2532 |
| 615 | Ga0207658_10007461 | 3300025986 | Bacteria | 7451 |
| 616 | Ga0207658_10014114 | 3300025986 | Bacteria | 5471 |
| 617 | Ga0207658_10089936 | 3300025986 | Bacteria | 2378 |
| 618 | Ga0207658_10176560 | 3300025986 | Bacteria | 1764 |
| 619 | Ga0207658_10280359 | 3300025986 | Bacteria | 1428 |
| 620 | Ga0207677_10001778 | 3300026023 | Bacteria | 11377 |
| 621 | Ga0207677_10016289 | 3300026023 | Bacteria | 4397 |
| 622 | Ga0207677_10057466 | 3300026023 | Bacteria | 2672 |
| 623 | Ga0207677_10095865 | 3300026023 | Unclassified | 2169 |
| 624 | Ga0207703_10000673 | 3300026035 | Bacteria | 34088 |
| 625 | Ga0207703_10482966 | 3300026035 | Bacteria | 1161 |
| 626 | Ga0207639_10023827 | 3300026041 | Bacteria | 4423 |
| 627 | Ga0207639_10053456 | 3300026041 | Unclassified | 3082 |
| 628 | Ga0207639_10080007 | 3300026041 | Bacteria | 2584 |
| 629 | Ga0207678_10000070 | 3300026067 | Bacteria | 81153 |
| 630 | Ga0207678_10001143 | 3300026067 | Bacteria | 24340 |
| 631 | Ga0207678_10024694 | 3300026067 | Bacteria | 5248 |
| 632 | Ga0207708_10145604 | 3300026075 | Bacteria | 1861 |
| 633 | Ga0207702_10007863 | 3300026078 | Bacteria | 9043 |
| 634 | Ga0207702_10008415 | 3300026078 | Bacteria | 8703 |
| 635 | Ga0207702_10027557 | 3300026078 | Unclassified | 4718 |
| 636 | Ga0207702_10121087 | 3300026078 | Bacteria | 2342 |
| 637 | Ga0207702_10125321 | 3300026078 | Bacteria | 2305 |
| 638 | Ga0207702_10199287 | 3300026078 | Bacteria | 1855 |
| 639 | Ga0207702_10270880 | 3300026078 | Bacteria | 1601 |
| 640 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 641 | Ga0207641_10004604 | 3300026088 | Bacteria | 11905 |
| 642 | Ga0207641_10018783 | 3300026088 | Bacteria | 5669 |
| 643 | Ga0207641_10139177 | 3300026088 | Bacteria | 2188 |
| 644 | Ga0207641_10404557 | 3300026088 | Bacteria | 1311 |
| 645 | Ga0207641_10524620 | 3300026088 | Bacteria | 1152 |
| 646 | Ga0207648_10001425 | 3300026089 | Bacteria | 26347 |
| 647 | Ga0207648_10074073 | 3300026089 | Bacteria | 2967 |
| 648 | Ga0207676_10000132 | 3300026095 | Bacteria | 65936 |
| 649 | Ga0207676_10046818 | 3300026095 | Bacteria | 3349 |
| 650 | Ga0207676_10105299 | 3300026095 | Bacteria | 2348 |
| 651 | Ga0207676_10283814 | 3300026095 | Bacteria | 1504 |
| 652 | Ga0207674_10000556 | 3300026116 | Bacteria | 48859 |
| 653 | Ga0207674_10550022 | 3300026116 | Bacteria | 1115 |
| 654 | Ga0207675_100033172 | 3300026118 | Bacteria | 4811 |
| 655 | Ga0207683_10003539 | 3300026121 | Bacteria | 13622 |
| 656 | Ga0207683_10007717 | 3300026121 | Bacteria | 9215 |
| 657 | Ga0207683_10011590 | 3300026121 | Bacteria | 7527 |
| 658 | Ga0207683_10051234 | 3300026121 | Bacteria | 3617 |
| 659 | Ga0207698_10019763 | 3300026142 | Bacteria | 4619 |
| 660 | Ga0207698_10035942 | 3300026142 | Bacteria | 3630 |
| 661 | Ga0209371_1001781 | 3300027312 | Bacteria | 13501 |
| 662 | Ga0209588_1000010 | 3300027671 | Bacteria | 159025 |
| 663 | Ga0209588_1021776 | 3300027671 | Bacteria | 2015 |
| 664 | Ga0268266_10015405 | 3300028379 | Bacteria | 6561 |
| 665 | Ga0268266_10067760 | 3300028379 | Unclassified | 3089 |
| 666 | Ga0268266_10160624 | 3300028379 | Bacteria | 2032 |
| 667 | Ga0268266_10222368 | 3300028379 | Bacteria | 1736 |
| 668 | Ga0268265_10031603 | 3300028380 | Bacteria | 3824 |
| 669 | Ga0268265_10147477 | 3300028380 | Bacteria | 1979 |
| 670 | Ga0268264_10000961 | 3300028381 | Bacteria | 29616 |
| 671 | Ga0268264_10001110 | 3300028381 | Bacteria | 26593 |
| 672 | Ga0268264_10156513 | 3300028381 | Bacteria | 2048 |
| 673 | Ga0268264_10165507 | 3300028381 | Bacteria | 1996 |
| 674 | Ga0268264_10174366 | 3300028381 | Bacteria | 1948 |
| 675 | Ga0307515_10000430 | 3300028794 | Bacteria | 101168 |
| 676 | Ga0307515_10375211 | 3300028794 | Bacteria | 1057 |
| 677 | Ga0265338_10070465 | 3300028800 | Bacteria | 2997 |
| 678 | Ga0265338_10124129 | 3300028800 | Bacteria | 2052 |
| 679 | Ga0268256_1002627 | 3300030500 | Bacteria | 8929 |
| 680 | Ga0265760_10002364 | 3300031090 | Bacteria | 5521 |
| 681 | Ga0265760_10002577 | 3300031090 | Bacteria | 5296 |
| 682 | Ga0265760_10002948 | 3300031090 | Unclassified | 4976 |
| 683 | Ga0265330_10006773 | 3300031235 | Bacteria | 5649 |
| 684 | Ga0265332_10000461 | 3300031238 | Bacteria | 28375 |
| 685 | Ga0265332_10048021 | 3300031238 | Bacteria | 1837 |
| 686 | Ga0265332_10181220 | 3300031238 | Bacteria | 877 |
| 687 | Ga0265328_10001159 | 3300031239 | Bacteria | 12154 |
| 688 | Ga0265320_10027714 | 3300031240 | Bacteria | 2950 |
| 689 | Ga0265325_10036615 | 3300031241 | Bacteria | 2598 |
| 690 | Ga0265329_10011737 | 3300031242 | Bacteria | 3175 |
| 691 | Ga0265340_10106548 | 3300031247 | Bacteria | 1299 |
| 692 | Ga0265339_10003817 | 3300031249 | Bacteria | 10475 |
| 693 | Ga0265339_10051345 | 3300031249 | Bacteria | 2250 |
| 694 | Ga0265339_10061053 | 3300031249 | Bacteria | 2030 |
| 695 | Ga0265339_10114812 | 3300031249 | Bacteria | 1390 |
| 696 | Ga0265331_10000338 | 3300031250 | Bacteria | 50018 |
| 697 | Ga0265331_10000456 | 3300031250 | Bacteria | 39566 |
| 698 | Ga0265331_10057054 | 3300031250 | Bacteria | 1853 |
| 699 | Ga0265327_10000142 | 3300031251 | Bacteria | 157436 |
| 700 | Ga0265316_10000114 | 3300031344 | Bacteria | 87072 |
| 701 | Ga0265316_10002182 | 3300031344 | Bacteria | 20560 |
| 702 | Ga0265316_10039168 | 3300031344 | Bacteria | 3809 |
| 703 | Ga0265316_10048330 | 3300031344 | Bacteria | 3359 |
| 704 | Ga0265313_10000602 | 3300031595 | Bacteria | 37380 |
| 705 | Ga0316579_10000702 | 3300031691 | Bacteria | 11412 |
| 706 | Ga0316579_10066479 | 3300031691 | Bacteria | 1702 |
| 707 | Ga0265314_10001296 | 3300031711 | Bacteria | 28340 |
| 708 | Ga0265314_10018463 | 3300031711 | Bacteria | 5435 |
| 709 | Ga0265314_10049506 | 3300031711 | Bacteria | 2941 |
| 710 | Ga0265342_10007181 | 3300031712 | Bacteria | 8194 |
| 711 | Ga0265342_10028000 | 3300031712 | Bacteria | 3515 |
| 712 | Ga0265342_10043578 | 3300031712 | Bacteria | 2707 |
| 713 | Ga0316576_10119520 | 3300031727 | Bacteria | 1978 |
| 714 | Ga0316578_10161826 | 3300031728 | Bacteria | 1349 |
| 715 | Ga0307516_10000893 | 3300031730 | Bacteria | 41107 |
| 716 | Ga0307405_10071329 | 3300031731 | Bacteria | 2235 |
| 717 | Ga0316577_10001728 | 3300031733 | Bacteria | 10489 |
| 718 | Ga0316577_10006839 | 3300031733 | Bacteria | 6055 |
| 719 | Ga0316577_10022645 | 3300031733 | Unclassified | 3489 |
| 720 | Ga0307413_10255092 | 3300031824 | Bacteria | 1304 |
| 721 | Ga0307412_10086099 | 3300031911 | Bacteria | 2186 |
| 722 | Ga0307411_10595196 | 3300032005 | Bacteria | 950 |
| 723 | Ga0307415_100001316 | 3300032126 | Bacteria | 11754 |
| 724 | Ga0373930_0003776 | 3300034816 | Bacteria | 2428 |
| 725 | Ga0373926_0005579 | 3300035083 | Bacteria | 4152 |
| 726 | Ga0373934_0030979 | 3300035086 | Bacteria | 2093 |
| 727 | Ga0373923_0034729 | 3300035111 | Bacteria | 2048 |
| 728 | Ga0373923_0060878 | 3300035111 | Bacteria | 1603 |
| 729 | Ga0373936_0014811 | 3300035113 | Bacteria | 2985 |
| 730 | Ga0373936_0014899 | 3300035113 | Bacteria | 2976 |
| 731 | Ga0373936_0120598 | 3300035113 | Unclassified | 1120 |
| 732 | Ga0373953_0019557 | 3300035117 | Bacteria | 2521 |
| 733 | Ga0373954_0000068 | 3300035118 | Bacteria | 37051 |
| 734 | Ga0373954_0008040 | 3300035118 | Bacteria | 4622 |
| 735 | Ga0373954_0123591 | 3300035118 | Bacteria | 1257 |
| 736 | Ga0373954_0136517 | 3300035118 | Unclassified | 1195 |
| 737 | Ga0373956_0053699 | 3300035119 | Bacteria | 1814 |
| 738 | Ga0373956_0068385 | 3300035119 | Bacteria | 1618 |
| 739 | Ga0373956_0165607 | 3300035119 | Unclassified | 1042 |
| 740 | Ga0373957_0101465 | 3300035120 | Bacteria | 1152 |
| 741 | Ga0373960_0003207 | 3300035121 | Bacteria | 3700 |
| 742 | Ga0373943_0010746 | 3300035170 | Bacteria | 4108 |
| 743 | Ga0373943_0013170 | 3300035170 | Bacteria | 3732 |
| 744 | Ga0373943_0244993 | 3300035170 | Bacteria | 1005 |
| 745 | Ga0373955_0033114 | 3300035172 | Bacteria | 2719 |
| 746 | Ga0373955_0094000 | 3300035172 | Bacteria | 1712 |
| 747 | Ga0373955_0243057 | 3300035172 | Bacteria | 1078 |
| 748 | Ga0373961_0027507 | 3300035241 | Bacteria | 1562 |
| 749 | Ga0373924_0023281 | 3300035410 | Bacteria | 2428 |
| 750 | Ga0373924_0041818 | 3300035410 | Unclassified | 1879 |
| 751 | Ga0373935_0006013 | 3300035692 | Bacteria | 7207 |
| 752 | Ga0373935_0008252 | 3300035692 | Bacteria | 6234 |
| 753 | Ga0373935_0041406 | 3300035692 | Bacteria | 2893 |
| 754 | Ga0373935_0112949 | 3300035692 | Bacteria | 1805 |
| 755 | Ga0373935_0123056 | 3300035692 | Bacteria | 1735 |
| 756 | Ga0373935_0173506 | 3300035692 | Bacteria | 1476 |
| 757 | Ga0373935_0350778 | 3300035692 | Bacteria | 1052 |
| 758 | Ga0373927_0000292 | 3300035695 | Bacteria | 39594 |
| 759 | Ga0373927_0005421 | 3300035695 | Bacteria | 8803 |
| 760 | Ga0373927_0006347 | 3300035695 | Bacteria | 8055 |
| 761 | Ga0373927_0067243 | 3300035695 | Bacteria | 2319 |
| 762 | Ga0373927_0200475 | 3300035695 | Bacteria | 1310 |
| 763 | Ga0373927_0214835 | 3300035695 | Bacteria | 1263 |
| 764 | Ga0373933_0007750 | 3300035724 | Bacteria | 5866 |
| 765 | Ga0373933_0025679 | 3300035724 | Bacteria | 3379 |
| 766 | Ga0373933_0081545 | 3300035724 | Bacteria | 1985 |
| 767 | Ga0373933_0088049 | 3300035724 | Bacteria | 1913 |
| 768 | Ga0373933_0280927 | 3300035724 | Bacteria | 1076 |
| 769 | Ga0373947_0013313 | 3300035725 | Bacteria | 4712 |
| 770 | Ga0373947_0025848 | 3300035725 | Bacteria | 3425 |
| 771 | Ga0373947_0027705 | 3300035725 | Bacteria | 3317 |
| 772 | Ga0373947_0066989 | 3300035725 | Bacteria | 2192 |
| 773 | Ga0373947_0073371 | 3300035725 | Bacteria | 2103 |
| 774 | Ga0373947_0174412 | 3300035725 | Bacteria | 1397 |
| 775 | Ga0373947_0305377 | 3300035725 | Bacteria | 1062 |
| 776 | Ga0373937_0002051 | 3300036401 | Bacteria | 16843 |
| 777 | Ga0373937_0040546 | 3300036401 | Bacteria | 4244 |
| 778 | Ga0373937_0055834 | 3300036401 | Bacteria | 3626 |
| 779 | Ga0373937_0103447 | 3300036401 | Bacteria | 2645 |
| 780 | Ga0373937_0135416 | 3300036401 | Bacteria | 2303 |
| 781 | Ga0373937_0145489 | 3300036401 | Bacteria | 2218 |
| 782 | Ga0373937_0197589 | 3300036401 | Bacteria | 1890 |
| 783 | Ga0373937_0252619 | 3300036401 | Bacteria | 1662 |
| 784 | Ga0373937_0346995 | 3300036401 | Bacteria | 1406 |
| 785 | Ga0316582_0018427 | 3300036647 | Bacteria | 4064 |
| 786 | Ga0316582_0019518 | 3300036647 | Unclassified | 3970 |
| 787 | Ga0373925_0001535 | 3300037068 | Bacteria | 19685 |
| 788 | Ga0373925_0003786 | 3300037068 | Bacteria | 11630 |
| 789 | Ga0373925_0003912 | 3300037068 | Bacteria | 11377 |
| 790 | Ga0373925_0049902 | 3300037068 | Bacteria | 3120 |
| 791 | Ga0373925_0320473 | 3300037068 | Bacteria | 1254 |
| 792 | Ga0395899_0058084 | 3300037312 | Bacteria | 2854 |
| 793 | Ga0316581_0006450 | 3300037588 | Bacteria | 3108 |
| 794 | Ga0436364_0156979 | 3300037853 | Bacteria | 2970 |
| 795 | Ga0436365_1169174 | 3300039437 | Unclassified | 1985 |
| 796 | Ga0436360_0441910 | 3300039438 | Unclassified | 1184 |
| 797 | Ga0436360_0649865 | 3300039438 | Bacteria | 1383 |
| 798 | Ga0436361_0036310 | 3300039447 | Bacteria | 1185 |
| 799 | Ga0436361_0152072 | 3300039447 | Bacteria | 8122 |
| 800 | Ga0436361_0547921 | 3300039447 | Bacteria | 2139 |
| 801 | Ga0436361_0670591 | 3300039447 | Bacteria | 2327 |
| 802 | Ga0436361_0941307 | 3300039447 | Bacteria | 3289 |
| 803 | Ga0436361_1133747 | 3300039447 | Bacteria | 1456 |
| 804 | Ga0436363_0557136 | 3300039450 | Bacteria | 4864 |
| 805 | Ga0436362_0062315 | 3300039453 | Bacteria | 2682 |
| 806 | Ga0436362_0519918 | 3300039453 | Unclassified | 2462 |
| 807 | Ga0451577_0321239 | 3300042876 | Bacteria | 1404 |
| 808 | Ga0466972_0060701 | 3300044658 | Unclassified | 1814 |
| 809 | Ga0466964_0027812 | 3300044706 | Bacteria | 2223 |
| 810 | Ga0466970_0014364 | 3300044765 | Bacteria | 4065 |
| 811 | Ga0466957_0052745 | 3300044842 | Bacteria | 2477 |
| 812 | Ga0466957_0184227 | 3300044842 | Bacteria | 1365 |
| 813 | Ga0466959_0302525 | 3300045049 | Bacteria | 1095 |
| 814 | Ga0466967_0664403 | 3300045976 | Bacteria | 1031 |
| 815 | Ga0466967_0693613 | 3300045976 | Bacteria | 1008 |
| 816 | Ga0495592_0091627 | 3300046454 | Bacteria | 2180 |
| 817 | Ga0495603_0149529 | 3300046455 | Bacteria | 1357 |
| 818 | Ga0495629_0000003 | 3300046459 | Bacteria | 529162 |
| 819 | Ga0495629_0018758 | 3300046459 | Bacteria | 4945 |
| 820 | Ga0495638_0092475 | 3300046460 | Bacteria | 1820 |
| 821 | Ga0495653_0102841 | 3300046463 | Bacteria | 2067 |
| 822 | Ga0495580_0000019 | 3300046472 | Bacteria | 91862 |
| 823 | Ga0495580_0000340 | 3300046472 | Bacteria | 38108 |
| 824 | Ga0495580_0000509 | 3300046472 | Bacteria | 32716 |
| 825 | Ga0495580_0004340 | 3300046472 | Bacteria | 11903 |
| 826 | Ga0495580_0004560 | 3300046472 | Bacteria | 11632 |
| 827 | Ga0495580_0004756 | 3300046472 | Bacteria | 11361 |
| 828 | Ga0495580_0007064 | 3300046472 | Bacteria | 9049 |
| 829 | Ga0495580_0008423 | 3300046472 | Bacteria | 8203 |
| 830 | Ga0495580_0010728 | 3300046472 | Bacteria | 7115 |
| 831 | Ga0495580_0011550 | 3300046472 | Bacteria | 6831 |
| 832 | Ga0495580_0055636 | 3300046472 | Unclassified | 2787 |
| 833 | Ga0495580_0062262 | 3300046472 | Bacteria | 2618 |
| 834 | Ga0495580_0070283 | 3300046472 | Bacteria | 2446 |
| 835 | Ga0495580_0078997 | 3300046472 | Bacteria | 2295 |
| 836 | Ga0495580_0115601 | 3300046472 | Bacteria | 1864 |
| 837 | Ga0495580_0137972 | 3300046472 | Bacteria | 1691 |
| 838 | Ga0495580_0164902 | 3300046472 | Bacteria | 1533 |
| 839 | Ga0495580_0197046 | 3300046472 | Bacteria | 1388 |
| 840 | Ga0495582_0000266 | 3300046473 | Bacteria | 29128 |
| 841 | Ga0495582_0000351 | 3300046473 | Bacteria | 25199 |
| 842 | Ga0495582_0038669 | 3300046473 | Bacteria | 2626 |
| 843 | Ga0495582_0050416 | 3300046473 | Bacteria | 2294 |
| 844 | Ga0495664_0157726 | 3300046477 | Bacteria | 1377 |
| 845 | Ga0495584_0202099 | 3300046491 | Bacteria | 1010 |
| 846 | Ga0495584_0210178 | 3300046491 | Bacteria | 989 |
| 847 | Ga0495583_0000829 | 3300046506 | Bacteria | 37824 |
| 848 | Ga0495606_0022376 | 3300046507 | Bacteria | 4607 |
| 849 | Ga0495606_0028738 | 3300046507 | Bacteria | 3916 |
| 850 | Ga0495606_0061181 | 3300046507 | Bacteria | 2409 |
| 851 | Ga0495606_0115209 | 3300046507 | Bacteria | 1616 |
| 852 | Ga0495608_0006140 | 3300046511 | Bacteria | 8528 |
| 853 | Ga0495608_0310167 | 3300046511 | Unclassified | 976 |
| 854 | Ga0495628_0010012 | 3300046516 | Bacteria | 8066 |
| 855 | Ga0495628_0031515 | 3300046516 | Bacteria | 4288 |
| 856 | Ga0495628_0323798 | 3300046516 | Bacteria | 1137 |
| 857 | Ga0495630_0150873 | 3300046517 | Bacteria | 1768 |
| 858 | Ga0495630_0203065 | 3300046517 | Unclassified | 1512 |
| 859 | Ga0495637_0122889 | 3300046520 | Bacteria | 997 |
| 860 | Ga0495666_0110366 | 3300046526 | Bacteria | 1292 |
| 861 | Ga0495665_0002327 | 3300046531 | Bacteria | 10265 |
| 862 | Ga0495665_0019641 | 3300046531 | Bacteria | 3634 |
| 863 | Ga0495665_0040453 | 3300046531 | Bacteria | 2482 |
| 864 | Ga0495665_0121083 | 3300046531 | Bacteria | 1370 |
| 865 | Ga0495665_0126419 | 3300046531 | Bacteria | 1339 |
| 866 | Ga0495587_0027758 | 3300046536 | Bacteria | 3446 |
| 867 | Ga0495621_0056373 | 3300046539 | Bacteria | 1417 |
| 868 | Ga0495645_0143568 | 3300046543 | Bacteria | 1664 |
| 869 | Ga0495622_0028573 | 3300046557 | Bacteria | 2604 |
| 870 | Ga0495667_0000813 | 3300046559 | Bacteria | 20057 |
| 871 | Ga0495667_0070872 | 3300046559 | Unclassified | 2274 |
| 872 | Ga0495667_0139227 | 3300046559 | Bacteria | 1564 |
| 873 | Ga0495668_0058971 | 3300046616 | Bacteria | 2118 |
| 874 | Ga0495588_0000338 | 3300046674 | Bacteria | 30480 |
| 875 | Ga0495657_0079415 | 3300046675 | Bacteria | 2125 |
| 876 | Ga0495657_0270548 | 3300046675 | Bacteria | 1019 |
| 877 | Ga0495623_0041908 | 3300046679 | Bacteria | 2918 |
| 878 | Ga0495623_0195036 | 3300046679 | Bacteria | 1168 |
| 879 | Ga0495646_0146940 | 3300046680 | Bacteria | 1314 |
| 880 | Ga0495658_0051576 | 3300046683 | Bacteria | 2331 |
| 881 | Ga0495658_0064388 | 3300046683 | Bacteria | 2112 |
| 882 | Ga0495624_0038046 | 3300046690 | Bacteria | 3093 |
| 883 | Ga0495670_0004091 | 3300046691 | Bacteria | 7154 |
| 884 | Ga0495589_0043648 | 3300046794 | Bacteria | 2231 |
| 885 | Ga0495600_0059594 | 3300046809 | Bacteria | 2493 |
| 886 | Ga0495600_0185586 | 3300046809 | Bacteria | 1339 |
| 887 | Ga0495660_0002852 | 3300046810 | Bacteria | 10868 |
| 888 | Ga0495660_0238781 | 3300046810 | Bacteria | 848 |
| 889 | Ga0495581_0049805 | 3300047315 | Bacteria | 2419 |
| 890 | Ga0495604_0033033 | 3300047317 | Bacteria | 4097 |
| 891 | Ga0495604_0153279 | 3300047317 | Bacteria | 1635 |
| 892 | Ga0495604_0226427 | 3300047317 | Bacteria | 1285 |
| 893 | Ga0495674_0089191 | 3300047319 | Bacteria | 2636 |
| 894 | Ga0495674_0207714 | 3300047319 | Bacteria | 1623 |
| 895 | Ga0495674_0409117 | 3300047319 | Bacteria | 1094 |
| 896 | Ga0495672_0050211 | 3300047320 | Bacteria | 2464 |
| 897 | Ga0495680_0257224 | 3300047322 | Bacteria | 1236 |
| 898 | Ga0495675_0062390 | 3300047444 | Bacteria | 2360 |
| 899 | Ga0495673_0085119 | 3300047469 | Bacteria | 1302 |
| 900 | Ga0495684_0019408 | 3300047471 | Bacteria | 5234 |
| 901 | Ga0495686_0000012 | 3300047472 | Bacteria | 508428 |
| 902 | Ga0495686_0000112 | 3300047472 | Bacteria | 168354 |
| 903 | Ga0495686_0000561 | 3300047472 | Bacteria | 52984 |
| 904 | Ga0495686_0082839 | 3300047472 | Bacteria | 1957 |
| 905 | Ga0495686_0123442 | 3300047472 | Bacteria | 1541 |
| 906 | Ga0495686_0221817 | 3300047472 | Bacteria | 1075 |
| 907 | Ga0495602_0024804 | 3300048088 | Bacteria | 5814 |
| 908 | Ga0495602_0108905 | 3300048088 | Bacteria | 2255 |
| 909 | Ga0495602_0355276 | 3300048088 | Bacteria | 1057 |
| 910 | Ga0495602_0511616 | 3300048088 | Bacteria | 838 |
| 911 | Ga0496100_0034546 | 3300048903 | Bacteria | 3174 |
| 912 | Ga0496100_0266137 | 3300048903 | Bacteria | 1273 |
| 913 | Ga0496100_0649764 | 3300048903 | Bacteria | 821 |
| 914 | Ga0496101_0051018 | 3300048904 | Bacteria | 2980 |
| 915 | Ga0496101_0067480 | 3300048904 | Bacteria | 2612 |
| 916 | Ga0496101_0130976 | 3300048904 | Bacteria | 1905 |
| 917 | Ga0496101_0290443 | 3300048904 | Bacteria | 1279 |
| 918 | Ga0496102_0007981 | 3300048905 | Bacteria | 9045 |
| 919 | Ga0496102_0016545 | 3300048905 | Bacteria | 6445 |
| 920 | Ga0496102_0038103 | 3300048905 | Bacteria | 4337 |
| 921 | Ga0496102_0038789 | 3300048905 | Bacteria | 4302 |
| 922 | Ga0496102_0056758 | 3300048905 | Unclassified | 3573 |
| 923 | Ga0496102_0769419 | 3300048905 | Bacteria | 885 |
| 924 | Ga0496103_0003579 | 3300048906 | Bacteria | 9479 |
| 925 | Ga0496103_0021242 | 3300048906 | Bacteria | 3905 |
| 926 | Ga0496103_0062879 | 3300048906 | Bacteria | 2311 |
| 927 | Ga0496103_0160846 | 3300048906 | Bacteria | 1440 |
| 928 | Ga0496104_0054868 | 3300048907 | Bacteria | 3767 |
| 929 | Ga0496104_0208837 | 3300048907 | Bacteria | 1864 |
| 930 | Ga0496105_0083333 | 3300048908 | Bacteria | 2641 |
| 931 | Ga0496105_0172295 | 3300048908 | Bacteria | 1774 |
| 932 | Ga0496106_0000937 | 3300048909 | Bacteria | 21256 |
| 933 | Ga0496106_0020771 | 3300048909 | Bacteria | 4873 |
| 934 | Ga0496107_0002505 | 3300048910 | Bacteria | 11942 |
| 935 | Ga0496107_0196122 | 3300048910 | Bacteria | 1501 |
| 936 | Ga0496107_0383747 | 3300048910 | Bacteria | 1045 |
| 937 | Ga0496107_0544476 | 3300048910 | Bacteria | 860 |
| 938 | Ga0496108_0000495 | 3300048911 | Bacteria | 31371 |
| 939 | Ga0496108_0112698 | 3300048911 | Bacteria | 2327 |
| 940 | Ga0496109_0000149 | 3300048912 | Bacteria | 68979 |
| 941 | Ga0496109_0017460 | 3300048912 | Bacteria | 6292 |
| 942 | Ga0496109_0029983 | 3300048912 | Bacteria | 4875 |
| 943 | Ga0496110_0133522 | 3300048913 | Bacteria | 2242 |
| 944 | Ga0496110_0152944 | 3300048913 | Bacteria | 2089 |
| 945 | Ga0496111_0008923 | 3300048914 | Bacteria | 6667 |
| 946 | Ga0496111_0059720 | 3300048914 | Bacteria | 2763 |
| 947 | Ga0496112_0000070 | 3300048915 | Bacteria | 67934 |
| 948 | Ga0496112_0171594 | 3300048915 | Bacteria | 2134 |
| 949 | Ga0496112_0420609 | 3300048915 | Bacteria | 1275 |
| 950 | Ga0496112_0426615 | 3300048915 | Bacteria | 1264 |
| 951 | Ga0496113_0000078 | 3300048916 | Bacteria | 42516 |
| 952 | Ga0496113_0216058 | 3300048916 | Bacteria | 1527 |
| 953 | Ga0496115_0001172 | 3300048918 | Bacteria | 18793 |
| 954 | Ga0496115_0007315 | 3300048918 | Bacteria | 8120 |
| 955 | Ga0496115_0086179 | 3300048918 | Bacteria | 2563 |
| 956 | Ga0496115_0242392 | 3300048918 | Bacteria | 1486 |
| 957 | Ga0496115_0330812 | 3300048918 | Bacteria | 1245 |
| 958 | Ga0496118_0004879 | 3300048921 | Bacteria | 15610 |
| 959 | Ga0496118_0119561 | 3300048921 | Bacteria | 1722 |
| 960 | Ga0496119_0005427 | 3300048922 | Bacteria | 12226 |
| 961 | Ga0496119_0103792 | 3300048922 | Bacteria | 1591 |
| 962 | Ga0496120_0071023 | 3300048923 | Bacteria | 1913 |
| 963 | Ga0496120_0088363 | 3300048923 | Bacteria | 1661 |
| 964 | Ga0496120_0207547 | 3300048923 | Bacteria | 944 |
| 965 | Ga0496121_0000664 | 3300048924 | Bacteria | 64277 |
| 966 | Ga0496121_0151387 | 3300048924 | Bacteria | 1707 |
| 967 | Ga0496122_0026316 | 3300048925 | Bacteria | 5019 |
| 968 | Ga0496122_0028105 | 3300048925 | Bacteria | 4786 |
| 969 | Ga0496122_0175286 | 3300048925 | Bacteria | 1286 |
| 970 | Ga0496123_0026747 | 3300048926 | Bacteria | 4314 |
| 971 | Ga0496123_0036401 | 3300048926 | Bacteria | 3491 |
| 972 | Ga0496124_0110487 | 3300048927 | Bacteria | 2213 |
| 973 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 974 | Ga0496125_0046957 | 3300048928 | Bacteria | 3617 |
| 975 | Ga0496126_0026293 | 3300048929 | Bacteria | 5582 |
| 976 | Ga0496126_0029296 | 3300048929 | Bacteria | 5231 |
| 977 | Ga0496126_0223952 | 3300048929 | Bacteria | 1578 |
| 978 | Ga0496126_0556283 | 3300048929 | Bacteria | 910 |
| 979 | Ga0501036_0459819 | 3300049572 | Bacteria | 1060 |
| 980 | Ga0501067_0239934 | 3300049583 | Bacteria | 1009 |
| 981 | Ga0501076_0209116 | 3300049592 | Bacteria | 1594 |
| 982 | Ga0501077_0156986 | 3300049593 | Bacteria | 1444 |
| 983 | Ga0501079_0042275 | 3300049741 | Bacteria | 3520 |
| 984 | Ga0501081_0008663 | 3300049743 | Bacteria | 6609 |
| 985 | Ga0501045_0129951 | 3300049824 | Bacteria | 1872 |
| 986 | nmdc:mga0k408_1293_c2 | 3300050493 | Bacteria | 9902 |
| 987 | nmdc:mga05p37_28230_c1 | 3300050507 | Bacteria | 6841 |
| 988 | nmdc:mga05p37_381086_c1 | 3300050507 | Bacteria | 1652 |
| 989 | nmdc:mga05p37_45428_c1 | 3300050507 | Bacteria | 5402 |
| 990 | nmdc:mga05p37_514213_c1 | 3300050507 | Bacteria | 1371 |
| 991 | nmdc:mga09592_12397_c1 | 3300050508 | Bacteria | 6943 |
| 992 | nmdc:mga0qj67_285979_c1 | 3300050509 | Bacteria | 1336 |
| 993 | nmdc:mga0qj67_720_c1 | 3300050509 | Bacteria | 22534 |
| 994 | nmdc:mga0qj67_94091_c1 | 3300050509 | Unclassified | 2410 |
| 995 | nmdc:mga06r32_4338_c1 | 3300050510 | Bacteria | 12703 |
| 996 | nmdc:mga06r32_92397_c1 | 3300050510 | Bacteria | 2958 |
| 997 | nmdc:mga0n895_14321_c1 | 3300050512 | Bacteria | 7198 |
| 998 | nmdc:mga0n895_149746_c1 | 3300050512 | Bacteria | 2363 |
| 999 | nmdc:mga0n895_188314_c1 | 3300050512 | Bacteria | 2095 |
| 1000 | nmdc:mga0n895_261_c1 | 3300050512 | Bacteria | 34185 |
| 1001 | nmdc:mga0n895_2822_c1 | 3300050512 | Bacteria | 13752 |
| 1002 | nmdc:mga0n895_443555_c1 | 3300050512 | Bacteria | 1311 |
| 1003 | nmdc:mga0n895_488614_c1 | 3300050512 | Bacteria | 1241 |
| 1004 | nmdc:mga0n895_570_c1 | 3300050512 | Bacteria | 25297 |
| 1005 | nmdc:mga0n895_620744_c1 | 3300050512 | Bacteria | 1082 |
| 1006 | nmdc:mga0rr50_108006_c1 | 3300050513 | Bacteria | 2198 |
| 1007 | nmdc:mga0rr50_120434_c1 | 3300050513 | Bacteria | 2088 |
| 1008 | nmdc:mga0rr50_140978_c1 | 3300050513 | Bacteria | 1939 |
| 1009 | nmdc:mga0rr50_148255_c2 | 3300050513 | Bacteria | 991 |
| 1010 | nmdc:mga0rr50_169952_c1 | 3300050513 | Bacteria | 1776 |
| 1011 | nmdc:mga0rr50_213_c1 | 3300050513 | Bacteria | 31258 |
| 1012 | nmdc:mga0rr50_279253_c1 | 3300050513 | Bacteria | 1393 |
| 1013 | nmdc:mga0rr50_305355_c1 | 3300050513 | Bacteria | 1332 |
| 1014 | nmdc:mga0rr50_6166_c1 | 3300050513 | Bacteria | 7260 |
| 1015 | nmdc:mga08x19_11024_c1 | 3300050514 | Bacteria | 5439 |
| 1016 | nmdc:mga08x19_11675_c1 | 3300050514 | Bacteria | 5289 |
| 1017 | nmdc:mga08x19_189064_c1 | 3300050514 | Bacteria | 1408 |
| 1018 | nmdc:mga08x19_2681_c1 | 3300050514 | Bacteria | 10756 |
| 1019 | nmdc:mga08x19_27112_c1 | 3300050514 | Bacteria | 3582 |
| 1020 | nmdc:mga08x19_420426_c1 | 3300050514 | Bacteria | 939 |
| 1021 | nmdc:mga08x19_43104_c1 | 3300050514 | Bacteria | 2878 |
| 1022 | nmdc:mga08x19_5095_c1 | 3300050514 | Bacteria | 7770 |
| 1023 | nmdc:mga0a205_258711_c1 | 3300050515 | Bacteria | 1618 |
| 1024 | nmdc:mga0a205_34413_c1 | 3300050515 | Bacteria | 4860 |
| 1025 | nmdc:mga0a205_56253_c1 | 3300050515 | Bacteria | 3798 |
| 1026 | nmdc:mga0a205_6765_c1 | 3300050515 | Bacteria | 10368 |
| 1027 | nmdc:mga0a205_8611_c1 | 3300050515 | Bacteria | 9284 |
| 1028 | nmdc:mga0a205_91055_c1 | 3300050515 | Bacteria | 2947 |
| 1029 | Ga0495601_0054373 | 3300053077 | Bacteria | 2533 |
| 1030 | Ga0495619_0102840 | 3300053085 | Bacteria | 1946 |
| 1031 | Ga0495619_0307972 | 3300053085 | Bacteria | 1097 |
| 1032 | Ga0500578_0000012 | 3300053086 | Bacteria | 188658 |
| 1033 | Ga0500647_0074052 | 3300053091 | Bacteria | 1634 |
| 1034 | Ga0500566_0013648 | 3300053094 | Bacteria | 4778 |
| 1035 | Ga0500566_0151253 | 3300053094 | Unclassified | 1220 |
| 1036 | Ga0500650_0139853 | 3300053098 | Bacteria | 1122 |
| 1037 | Ga0500554_018284 | 3300053102 | Bacteria | 1889 |
| 1038 | Ga0500562_043714 | 3300053108 | Bacteria | 1192 |
| 1039 | Ga0500592_000451 | 3300053116 | Bacteria | 6869 |
| 1040 | Ga0500595_000159 | 3300053119 | Bacteria | 44312 |
| 1041 | Ga0500618_005025 | 3300053125 | Bacteria | 4085 |
| 1042 | Ga0500618_006961 | 3300053125 | Bacteria | 3269 |
| 1043 | Ga0500658_0130478 | 3300053134 | Bacteria | 1120 |
| 1044 | Ga0500559_0071841 | 3300053136 | Bacteria | 1559 |
| 1045 | Ga0500590_010303 | 3300053148 | Bacteria | 4719 |
| 1046 | Ga0500603_003488 | 3300053150 | Bacteria | 3376 |
| 1047 | Ga0500616_0000139 | 3300053153 | Bacteria | 123841 |
| 1048 | Ga0500616_0097892 | 3300053153 | Unclassified | 1440 |
| 1049 | Ga0500638_001268 | 3300053162 | Bacteria | 7729 |
| 1050 | Ga0500636_0062938 | 3300053177 | Bacteria | 2163 |
| 1051 | Ga0500636_0218954 | 3300053177 | Bacteria | 993 |
| 1052 | Ga0500637_0000349 | 3300053178 | Bacteria | 17523 |
| 1053 | Ga0500661_000413 | 3300055283 | Bacteria | 7898 |
| 1054 | 2509153257 | 2508501128 | Bacteria | 8613869 |
| 1055 | 2513889383 | 2513237141 | Bacteria | 8496279 |
| 1056 | 2524469899 | 2524023210 | Bacteria | 9029266 |
| 1057 | 2585232549 | 2582581299 | Bacteria | 6518058 |
| 1058 | 2585282809 | 2582581308 | Bacteria | 7413247 |
| 1059 | 2585324195 | 2582581315 | Bacteria | 7318924 |
| 1060 | 2585333407 | 2582581316 | Bacteria | 7774528 |
| 1061 | 2585534891 | 2585427527 | Bacteria | 7273426 |
| 1062 | 2585551662 | 2585427530 | Bacteria | 7383882 |
| 1063 | 2585897544 | 2585427608 | Bacteria | 6544331 |
| 1064 | 2603859768 | 2602042107 | Bacteria | 6226103 |
| 1065 | 2616308178 | 2615840626 | Bacteria | 7921970 |
| 1066 | 2616556801 | 2615840698 | Bacteria | 7319877 |
| 1067 | 2617381532 | 2617270742 | Bacteria | 6808054 |
| 1068 | 2644238154 | 2643221643 | Bacteria | 5749658 |
| 1069 | 2671114711 | 2667528174 | Bacteria | 6435400 |
| 1070 | 2740059572 | 2739367874 | Bacteria | 4872888 |
| 1071 | 2778176323 | 2775507266 | Bacteria | 7392367 |
| 1072 | 2819610659 | 2818991448 | Bacteria | 6772224 |
| 1073 | 2819638309 | 2818991453 | Bacteria | 7181617 |
| 1074 | 2821450529 | 2821443989 | Bacteria | 7658172 |
| 1075 | 2838032336 | 2838029111 | Bacteria | 6603031 |
| 1076 | 2842479035 | 2842475841 | Bacteria | 6603183 |
| 1077 | 2842483167 | 2842482326 | Bacteria | 7212537 |
| 1078 | 2842506245 | 2842502639 | Bacteria | 6604161 |
| 1079 | 2857530626 | 2857524615 | Bacteria | 6615449 |
| 1080 | 2885386628 | 2885383462 | Bacteria | 9473874 |
| 1081 | 2891637522 | 2891633521 | Bacteria | 4602265 |
| 1082 | 2893070271 | 2893066018 | Bacteria | 6158120 |
| 1083 | 2909399119 | 2909399089 | Bacteria | 3922598 |
| 1084 | 2919076222 | 2919073203 | Bacteria | 6531949 |
| 1085 | 2919409623 | 2919408235 | Bacteria | 6149349 |
| 1086 | 2929924044 | 2929921140 | Bacteria | 8649150 |
| 1087 | 2954017689 | 2954016120 | Bacteria | 6446024 |
| 1088 | 3001897286 | 3001892409 | Bacteria | 6328293 |
| 1089 | 3005420516 | 3005416602 | Bacteria | 7064308 |
| 1090 | 8005317467 | 8005314921 | Bacteria | 7072929 |
| 1091 | 8005487159 | 8005484373 | Bacteria | 6297373 |
| 1092 | 8005646454 | 8005645114 | Bacteria | 6950293 |
| 1093 | 8005686518 | 8005682033 | Bacteria | 6726518 |
| 1094 | 8024492387 | 8024486573 | Bacteria | 6540512 |
| 1095 | Ga0068864_100067503 | |||
| 1096 | MRS1b_contig_9110685 | |||
| 1097 | JGI24752J21851_1001338 | |||
| 1098 | JGI24740J21852_10000557 | |||
| 1099 | JGI24737J22298_10051769 | |||
| 1100 | JGI24033J26618_1008754 | |||
| 1101 | JGI24034J26672_10004802 | |||
| 1102 | JGI25155J39150_1000061 | |||
| 1103 | JGI25156J39149_1000122 | |||
| 1104 | JGI25162J39368_1000343 | |||
| 1105 | JGI25162J39368_1001828 | |||
| 1106 | JGI25154J39366_1000132 | |||
| 1107 | JGI25157J39369_1000106 | |||
| 1108 | JGI25151J46595_10000285 | |||
| 1109 | JGI25151J46595_10006958 | |||
| 1110 | JGI25406J46586_10020708 | |||
| 1111 | JGI25165J46597_1000448 | |||
| 1112 | JGI25165J46597_1002332 | |||
| 1113 | rootH1_10075866 | |||
| 1114 | rootH2_10032239 | |||
| 1115 | rootH2_10044892 | |||
| 1116 | rootH2_10142949 | |||
| 1117 | rootH2_10297647 | |||
| 1118 | rootL2_10000825 | |||
| 1119 | rootL2_10028893 | |||
| 1120 | rootL2_10047860 | |||
| 1121 | rootH1_10022429 | |||
| 1122 | rootH1_10024211 | |||
| 1123 | rootH1_10176177 | |||
| 1124 | rootH1_10206279 | |||
| 1125 | Ga0065715_10105165 | |||
| 1126 | Ga0070658_10134759 | |||
| 1127 | Ga0070676_10102310 | |||
| 1128 | Ga0070676_10110021 | |||
| 1129 | Ga0070683_100000835 | |||
| 1130 | Ga0070683_100002634 | |||
| 1131 | Ga0070683_100230084 | |||
| 1132 | Ga0070683_100381057 | |||
| 1133 | Ga0070683_100464131 | |||
| 1134 | Ga0070690_100000456 | |||
| 1135 | Ga0070690_100069261 | |||
| 1136 | Ga0070670_100033767 | |||
| 1137 | Ga0070670_100509783 | |||
| 1138 | Ga0070677_10005282 | |||
| 1139 | Ga0070677_10045508 | |||
| 1140 | Ga0068869_100024527 | |||
| 1141 | Ga0070666_10001743 | |||
| 1142 | Ga0070666_10017198 | |||
| 1143 | Ga0070666_10074125 | |||
| 1144 | Ga0070666_10339811 | |||
| 1145 | Ga0070680_100183000 | |||
| 1146 | Ga0070680_100413974 | |||
| 1147 | Ga0070682_100000102 | |||
| 1148 | Ga0070682_100020786 | |||
| 1149 | Ga0068868_100001806 | |||
| 1150 | Ga0068868_100005079 | |||
| 1151 | Ga0068868_100015998 | |||
| 1152 | Ga0068868_100037089 | |||
| 1153 | Ga0070660_100002663 | |||
| 1154 | Ga0070660_100015316 | |||
| 1155 | Ga0070689_100009333 | |||
| 1156 | Ga0070689_100025654 | |||
| 1157 | Ga0070661_100005786 | |||
| 1158 | Ga0070668_100019735 | |||
| 1159 | Ga0070668_100079760 | |||
| 1160 | Ga0070668_100116547 | |||
| 1161 | Ga0070668_100160023 | |||
| 1162 | Ga0070669_100007505 | |||
| 1163 | Ga0070669_100016363 | |||
| 1164 | Ga0070669_100065518 | |||
| 1165 | Ga0070669_100107548 | |||
| 1166 | Ga0070675_100024719 | |||
| 1167 | Ga0070675_100062372 | |||
| 1168 | Ga0070675_100085408 | |||
| 1169 | Ga0070671_100088123 | |||
| 1170 | Ga0070671_100126410 | |||
| 1171 | Ga0070671_100250484 | |||
| 1172 | Ga0070674_100133925 | |||
| 1173 | Ga0070673_100125075 | |||
| 1174 | Ga0070688_100138167 | |||
| 1175 | Ga0070688_100195274 | |||
| 1176 | Ga0070659_100018980 | |||
| 1177 | Ga0070659_100044681 | |||
| 1178 | Ga0070667_100000282 | |||
| 1179 | Ga0070667_100118369 | |||
| 1180 | Ga0070667_100185199 | |||
| 1181 | Ga0070667_100619029 | |||
| 1182 | Ga0070709_10000171 | |||
| 1183 | Ga0070709_10007066 | |||
| 1184 | Ga0070709_10015415 | |||
| 1185 | Ga0070709_10055565 | |||
| 1186 | Ga0070709_10062094 | |||
| 1187 | Ga0070709_10066684 | |||
| 1188 | Ga0070709_10082286 | |||
| 1189 | Ga0070709_10135753 | |||
| 1190 | Ga0070709_10213544 | |||
| 1191 | Ga0070709_10217632 | |||
| 1192 | Ga0070709_10261451 | |||
| 1193 | Ga0070714_100005715 | |||
| 1194 | Ga0070714_100062758 | |||
| 1195 | Ga0070714_100165917 | |||
| 1196 | Ga0070714_100404690 | |||
| 1197 | Ga0070713_100000029 | |||
| 1198 | Ga0070713_100005399 | |||
| 1199 | Ga0070713_100007877 | |||
| 1200 | Ga0070713_100027293 | |||
| 1201 | Ga0070713_100040711 | |||
| 1202 | Ga0070713_100077093 | |||
| 1203 | Ga0070713_100146693 | |||
| 1204 | Ga0070713_100165640 | |||
| 1205 | Ga0070713_100220874 | |||
| 1206 | Ga0070713_100256001 | |||
| 1207 | Ga0070713_100317214 | |||
| 1208 | Ga0070713_100355641 | |||
| 1209 | Ga0070713_100390336 | |||
| 1210 | Ga0070713_100482589 | |||
| 1211 | Ga0070713_100543846 | |||
| 1212 | Ga0070710_10000598 | |||
| 1213 | Ga0070710_10011509 | |||
| 1214 | Ga0070710_10049192 | |||
| 1215 | Ga0070710_10090705 | |||
| 1216 | Ga0070711_100000329 | |||
| 1217 | Ga0070711_100000531 | |||
| 1218 | Ga0070711_100016610 | |||
| 1219 | Ga0070711_100111794 | |||
| 1220 | Ga0070711_100255574 | |||
| 1221 | Ga0070711_100276683 | |||
| 1222 | Ga0070711_100283514 | |||
| 1223 | Ga0070711_100315371 | |||
| 1224 | Ga0070711_100405217 | |||
| 1225 | Ga0070700_100049751 | |||
| 1226 | Ga0070700_100135504 | |||
| 1227 | Ga0070708_100000137 | |||
| 1228 | Ga0070708_100026379 | |||
| 1229 | Ga0070708_100031260 | |||
| 1230 | Ga0070708_100044277 | |||
| 1231 | Ga0070708_100055157 | |||
| 1232 | Ga0070708_100088023 | |||
| 1233 | Ga0070708_100184144 | |||
| 1234 | Ga0070708_100209516 | |||
| 1235 | Ga0070708_100209983 | |||
| 1236 | Ga0070708_100331605 | |||
| 1237 | Ga0070663_100227315 | |||
| 1238 | Ga0070663_100276609 | |||
| 1239 | Ga0070678_100036353 | |||
| 1240 | Ga0070662_100001639 | |||
| 1241 | Ga0070662_100094574 | |||
| 1242 | Ga0070662_100166757 | |||
| 1243 | Ga0070681_10072329 | |||
| 1244 | Ga0070681_10105458 | |||
| 1245 | Ga0070681_10194820 | |||
| 1246 | Ga0070681_10259038 | |||
| 1247 | Ga0068867_100027614 | |||
| 1248 | Ga0070685_10001550 | |||
| 1249 | Ga0070706_100001270 | |||
| 1250 | Ga0070706_100003237 | |||
| 1251 | Ga0070706_100004092 | |||
| 1252 | Ga0070706_100016580 | |||
| 1253 | Ga0070706_100046278 | |||
| 1254 | Ga0070706_100395620 | |||
| 1255 | Ga0070707_100000651 | |||
| 1256 | Ga0070707_100084062 | |||
| 1257 | Ga0070707_100102607 | |||
| 1258 | Ga0070707_100118639 | |||
| 1259 | Ga0070707_100143024 | |||
| 1260 | Ga0070707_100197424 | |||
| 1261 | Ga0070707_100208746 | |||
| 1262 | Ga0070707_100399460 | |||
| 1263 | Ga0070698_100000902 | |||
| 1264 | Ga0070698_100269082 | |||
| 1265 | Ga0070699_100000439 | |||
| 1266 | Ga0070699_100033576 | |||
| 1267 | Ga0070699_100035250 | |||
| 1268 | Ga0070699_100111319 | |||
| 1269 | Ga0070699_100243814 | |||
| 1270 | Ga0070679_100006873 | |||
| 1271 | Ga0070679_100041877 | |||
| 1272 | Ga0070679_100574765 | |||
| 1273 | Ga0070684_100001425 | |||
| 1274 | Ga0070684_100013041 | |||
| 1275 | Ga0070684_100013231 | |||
| 1276 | Ga0070697_100000031 | |||
| 1277 | Ga0070697_100000265 | |||
| 1278 | Ga0070697_100006312 | |||
| 1279 | Ga0070697_100016810 | |||
| 1280 | Ga0070697_100037929 | |||
| 1281 | Ga0070697_100053398 | |||
| 1282 | Ga0070697_100053953 | |||
| 1283 | Ga0070697_100372830 | |||
| 1284 | Ga0068853_100043468 | |||
| 1285 | Ga0068853_100172173 | |||
| 1286 | Ga0068853_100261110 | |||
| 1287 | Ga0068853_100362457 | |||
| 1288 | Ga0070672_100000001 | |||
| 1289 | Ga0070672_100003522 | |||
| 1290 | Ga0070672_100058900 | |||
| 1291 | Ga0070686_100120705 | |||
| 1292 | Ga0070686_100128115 | |||
| 1293 | Ga0070686_100185767 | |||
| 1294 | Ga0070696_100107624 | |||
| 1295 | Ga0070696_100159704 | |||
| 1296 | Ga0070696_100389163 | |||
| 1297 | Ga0070665_100038334 | |||
| 1298 | Ga0070665_100132617 | |||
| 1299 | Ga0070665_100379245 | |||
| 1300 | Ga0070704_100321264 | |||
| 1301 | Ga0070704_100601639 | |||
| 1302 | Ga0068855_100021308 | |||
| 1303 | Ga0068855_100022936 | |||
| 1304 | Ga0068855_100056535 | |||
| 1305 | Ga0068855_100297149 | |||
| 1306 | Ga0070664_100009088 | |||
| 1307 | Ga0070664_100619004 | |||
| 1308 | Ga0068857_100576830 | |||
| 1309 | Ga0068854_100093534 | |||
| 1310 | Ga0068854_100147591 | |||
| 1311 | Ga0068854_100185212 | |||
| 1312 | Ga0068856_100001651 | |||
| 1313 | Ga0068856_100006407 | |||
| 1314 | Ga0068856_100009226 | |||
| 1315 | Ga0068856_100066743 | |||
| 1316 | Ga0068856_100080518 | |||
| 1317 | Ga0068856_100097010 | |||
| 1318 | Ga0068856_100232394 | |||
| 1319 | Ga0068856_100678746 | |||
| 1320 | Ga0068856_100979569 | |||
| 1321 | Ga0070702_100015282 | |||
| 1322 | Ga0070702_100334723 | |||
| 1323 | Ga0068852_100003785 | |||
| 1324 | Ga0068852_100007483 | |||
| 1325 | Ga0068852_100417196 | |||
| 1326 | Ga0068859_100002112 | |||
| 1327 | Ga0068859_100125511 | |||
| 1328 | Ga0068864_100048826 | |||
| 1329 | Ga0068864_100160340 | |||
| 1330 | Ga0068864_100214480 | |||
| 1331 | Ga0068866_10054809 | |||
| 1332 | Ga0068861_100054860 | |||
| 1333 | Ga0068861_100713501 | |||
| 1334 | Ga0068851_10036662 | |||
| 1335 | Ga0068851_10113968 | |||
| 1336 | Ga0068870_10088609 | |||
| 1337 | Ga0068863_100022945 | |||
| 1338 | Ga0068863_100060590 | |||
| 1339 | Ga0068863_100076218 | |||
| 1340 | Ga0068863_100154139 | |||
| 1341 | Ga0068863_100403994 | |||
| 1342 | Ga0068858_100000871 | |||
| 1343 | Ga0068858_100065088 | |||
| 1344 | Ga0068858_100543497 | |||
| 1345 | Ga0068860_100000830 | |||
| 1346 | Ga0068860_100001349 | |||
| 1347 | Ga0068860_100198774 | |||
| 1348 | Ga0068860_100249569 | |||
| 1349 | Ga0068860_100502358 | |||
| 1350 | Ga0068860_100652223 | |||
| 1351 | Ga0068862_100021739 | |||
| 1352 | Ga0068862_100030172 | |||
| 1353 | Ga0068862_100078041 | |||
| 1354 | Ga0081455_10008262 | |||
| 1355 | Ga0081540_1024855 | |||
| 1356 | Ga0081539_10000233 | |||
| 1357 | Ga0070717_10003539 | |||
| 1358 | Ga0070717_10003613 | |||
| 1359 | Ga0070717_10007234 | |||
| 1360 | Ga0070717_10010660 | |||
| 1361 | Ga0070717_10021483 | |||
| 1362 | Ga0070717_10034270 | |||
| 1363 | Ga0070717_10040703 | |||
| 1364 | Ga0070717_10051701 | |||
| 1365 | Ga0070717_10080812 | |||
| 1366 | Ga0070717_10106609 | |||
| 1367 | Ga0070717_10120276 | |||
| 1368 | Ga0070717_10256065 | |||
| 1369 | Ga0070717_10580210 | |||
| 1370 | Ga0075365_10011855 | |||
| 1371 | Ga0070715_10051016 | |||
| 1372 | Ga0070715_10053810 | |||
| 1373 | Ga0070715_10103544 | |||
| 1374 | Ga0070716_100000682 | |||
| 1375 | Ga0070716_100004580 | |||
| 1376 | Ga0070716_100012268 | |||
| 1377 | Ga0070716_100017366 | |||
| 1378 | Ga0070716_100025229 | |||
| 1379 | Ga0070716_100188029 | |||
| 1380 | Ga0070716_100197545 | |||
| 1381 | Ga0070716_100249545 | |||
| 1382 | Ga0070716_100296467 | |||
| 1383 | Ga0070712_100000542 | |||
| 1384 | Ga0070712_100002276 | |||
| 1385 | Ga0070712_100008763 | |||
| 1386 | Ga0070712_100013608 | |||
| 1387 | Ga0070712_100015048 | |||
| 1388 | Ga0070712_100021048 | |||
| 1389 | Ga0070712_100024315 | |||
| 1390 | Ga0070712_100192763 | |||
| 1391 | Ga0070712_100470080 | |||
| 1392 | Ga0075369_10008398 | |||
| 1393 | Ga0075366_10001905 | |||
| 1394 | Ga0097621_100093431 | |||
| 1395 | Ga0097621_100641226 | |||
| 1396 | Ga0068871_100038979 | |||
| 1397 | Ga0068871_100435399 | |||
| 1398 | Ga0075430_100001163 | |||
| 1399 | Ga0075430_100098606 | |||
| 1400 | Ga0075431_100004149 | |||
| 1401 | Ga0075431_100127579 | |||
| 1402 | Ga0075433_10002861 | |||
| 1403 | Ga0075433_10014138 | |||
| 1404 | Ga0075433_10029132 | |||
| 1405 | Ga0075433_10053371 | |||
| 1406 | Ga0075433_10451889 | |||
| 1407 | Ga0075434_100000195 | |||
| 1408 | Ga0075434_100000895 | |||
| 1409 | Ga0075434_100013552 | |||
| 1410 | Ga0075434_100098424 | |||
| 1411 | Ga0075434_100102473 | |||
| 1412 | Ga0075434_100151150 | |||
| 1413 | Ga0075434_100382916 | |||
| 1414 | Ga0075434_100450425 | |||
| 1415 | Ga0068865_100014673 | |||
| 1416 | Ga0075436_100001331 | |||
| 1417 | Ga0075436_100008675 | |||
| 1418 | Ga0075436_100020426 | |||
| 1419 | Ga0075436_100020921 | |||
| 1420 | Ga0075436_100032955 | |||
| 1421 | Ga0075436_100074720 | |||
| 1422 | Ga0075436_100298156 | |||
| 1423 | Ga0097620_100002112 | |||
| 1424 | Ga0097620_100125518 | |||
| 1425 | Ga0075435_100000065 | |||
| 1426 | Ga0075435_100006798 | |||
| 1427 | Ga0075435_100020039 | |||
| 1428 | Ga0075435_100027951 | |||
| 1429 | Ga0075435_100059868 | |||
| 1430 | Ga0075435_100118493 | |||
| 1431 | Ga0075435_100233540 | |||
| 1432 | Ga0099794_10000092 | |||
| 1433 | Ga0099794_10001902 | |||
| 1434 | Ga0099794_10011947 | |||
| 1435 | Ga0099794_10012750 | |||
| 1436 | Ga0099794_10096956 | |||
| 1437 | Ga0099795_10059480 | |||
| 1438 | Ga0105251_10035508 | |||
| 1439 | Ga0105240_10000005 | |||
| 1440 | Ga0105240_10138314 | |||
| 1441 | Ga0105240_10243353 | |||
| 1442 | Ga0105240_10583120 | |||
| 1443 | Ga0105240_10807754 | |||
| 1444 | Ga0105240_10860192 | |||
| 1445 | Ga0111539_10510630 | |||
| 1446 | Ga0105247_10007660 | |||
| 1447 | Ga0105247_10286033 | |||
| 1448 | Ga0114129_10006586 | |||
| 1449 | Ga0114129_10036391 | |||
| 1450 | Ga0114129_10084537 | |||
| 1451 | Ga0114129_10124086 | |||
| 1452 | Ga0114129_10238217 | |||
| 1453 | Ga0105243_10089358 | |||
| 1454 | Ga0105241_10027728 | |||
| 1455 | Ga0105241_10031153 | |||
| 1456 | Ga0105241_10176339 | |||
| 1457 | Ga0105241_10212839 | |||
| 1458 | Ga0105241_10303268 | |||
| 1459 | Ga0105241_10443124 | |||
| 1460 | Ga0105242_10052001 | |||
| 1461 | Ga0105248_10001890 | |||
| 1462 | Ga0105248_10045188 | |||
| 1463 | Ga0105248_10136773 | |||
| 1464 | Ga0105248_10226466 | |||
| 1465 | Ga0105248_10686222 | |||
| 1466 | Ga0105237_10006938 | |||
| 1467 | Ga0105237_10064347 | |||
| 1468 | Ga0105237_10084099 | |||
| 1469 | Ga0105237_10152615 | |||
| 1470 | Ga0105237_10339311 | |||
| 1471 | Ga0105238_10018247 | |||
| 1472 | Ga0105238_10052374 | |||
| 1473 | Ga0105249_10018692 | |||
| 1474 | Ga0105249_10027986 | |||
| 1475 | Ga0105249_10151312 | |||
| 1476 | Ga0105239_10031532 | |||
| 1477 | Ga0105239_10566828 | |||
| 1478 | Ga0105239_11255413 | |||
| 1479 | Ga0105246_10004331 | |||
| 1480 | Ga0105246_10120475 | |||
| 1481 | Ga0157373_10005392 | |||
| 1482 | Ga0157373_10150939 | |||
| 1483 | Ga0157373_10508049 | |||
| 1484 | Ga0157373_10522060 | |||
| 1485 | Ga0157371_10012541 | |||
| 1486 | Ga0157370_10063658 | |||
| 1487 | Ga0157369_10019476 | |||
| 1488 | Ga0157369_10031551 | |||
| 1489 | Ga0157369_10088555 | |||
| 1490 | Ga0157369_10119503 | |||
| 1491 | Ga0157369_10281269 | |||
| 1492 | Ga0157374_10032515 | |||
| 1493 | Ga0157374_10122109 | |||
| 1494 | Ga0157374_10122928 | |||
| 1495 | Ga0157374_10132304 | |||
| 1496 | Ga0157374_10235467 | |||
| 1497 | Ga0157374_10242479 | |||
| 1498 | Ga0157378_10060322 | |||
| 1499 | Ga0157378_10499318 | |||
| 1500 | Ga0163162_10001058 | |||
| 1501 | Ga0163162_10062073 | |||
| 1502 | Ga0163162_10079760 | |||
| 1503 | Ga0163162_10083112 | |||
| 1504 | Ga0157372_10020581 | |||
| 1505 | Ga0157372_10023668 | |||
| 1506 | Ga0157372_10081819 | |||
| 1507 | Ga0157372_10190156 | |||
| 1508 | Ga0157372_10197800 | |||
| 1509 | Ga0157375_10004658 | |||
| 1510 | Ga0157375_10019511 | |||
| 1511 | Ga0157375_10244236 | |||
| 1512 | Ga0157375_10964237 | |||
| 1513 | Ga0163163_10065182 | |||
| 1514 | Ga0163163_10106923 | |||
| 1515 | Ga0157380_10021711 | |||
| 1516 | Ga0157380_10531954 | |||
| 1517 | Ga0182008_10096120 | |||
| 1518 | Ga0157377_10118034 | |||
| 1519 | Ga0157379_10004276 | |||
| 1520 | Ga0157379_10009361 | |||
| 1521 | Ga0157376_10108440 | |||
| 1522 | Ga0157376_10163450 | |||
| 1523 | Ga0182006_1026090 | |||
| 1524 | Ga0182007_10008105 | |||
| 1525 | Ga0182007_10009986 | |||
| 1526 | Ga0182007_10010012 | |||
| 1527 | Ga0163161_10159673 | |||
| 1528 | Ga0163161_10469336 | |||
| 1529 | Ga0213872_10005572 | |||
| 1530 | Ga0213872_10136821 | |||
| 1531 | Ga0213874_10003840 | |||
| 1532 | Ga0213875_10164406 | |||
| 1533 | Ga0228598_1005430 | |||
| 1534 | Ga0209435_100081 | |||
| 1535 | Ga0209760_104944 | |||
| 1536 | Ga0209563_103575 | |||
| 1537 | Ga0209437_100153 | |||
| 1538 | Ga0209437_100201 | |||
| 1539 | Ga0209646_1000064 | |||
| 1540 | Ga0209646_1008468 | |||
| 1541 | Ga0209026_1000053 | |||
| 1542 | Ga0209677_100466 | |||
| 1543 | Ga0209677_101561 | |||
| 1544 | Ga0209759_1000042 | |||
| 1545 | Ga0209233_1000175 | |||
| 1546 | Ga0209233_1000226 | |||
| 1547 | Ga0209233_1000338 | |||
| 1548 | Ga0209025_1000114 | |||
| 1549 | Ga0209025_1000584 | |||
| 1550 | Ga0209758_1005459 | |||
| 1551 | Ga0207697_10010855 | |||
| 1552 | Ga0207656_10088770 | |||
| 1553 | Ga0207682_10010502 | |||
| 1554 | Ga0207682_10036606 | |||
| 1555 | Ga0207692_10036401 | |||
| 1556 | Ga0207692_10246345 | |||
| 1557 | Ga0207692_10339026 | |||
| 1558 | Ga0207642_10013339 | |||
| 1559 | Ga0207710_10127902 | |||
| 1560 | Ga0207688_10005078 | |||
| 1561 | Ga0207680_10000344 | |||
| 1562 | Ga0207680_10049190 | |||
| 1563 | Ga0207647_10021795 | |||
| 1564 | Ga0207685_10008371 | |||
| 1565 | Ga0207699_10000491 | |||
| 1566 | Ga0207699_10009842 | |||
| 1567 | Ga0207699_10015899 | |||
| 1568 | Ga0207699_10035151 | |||
| 1569 | Ga0207699_10069024 | |||
| 1570 | Ga0207699_10089842 | |||
| 1571 | Ga0207699_10148203 | |||
| 1572 | Ga0207699_10178003 | |||
| 1573 | Ga0207699_10226216 | |||
| 1574 | Ga0207645_10005119 | |||
| 1575 | Ga0207645_10009704 | |||
| 1576 | Ga0207643_10000133 | |||
| 1577 | Ga0207705_10294393 | |||
| 1578 | Ga0207705_10465892 | |||
| 1579 | Ga0207684_10000705 | |||
| 1580 | Ga0207684_10000811 | |||
| 1581 | Ga0207684_10002252 | |||
| 1582 | Ga0207684_10037395 | |||
| 1583 | Ga0207684_10095761 | |||
| 1584 | Ga0207684_10282362 | |||
| 1585 | Ga0207654_10001902 | |||
| 1586 | Ga0207654_10002085 | |||
| 1587 | Ga0207654_10161255 | |||
| 1588 | Ga0207654_10172944 | |||
| 1589 | Ga0207707_10006740 | |||
| 1590 | Ga0207707_10020123 | |||
| 1591 | Ga0207707_10028403 | |||
| 1592 | Ga0207707_10094171 | |||
| 1593 | Ga0207695_10000011 | |||
| 1594 | Ga0207695_10006005 | |||
| 1595 | Ga0207695_10340107 | |||
| 1596 | Ga0207671_10001611 | |||
| 1597 | Ga0207693_10000031 | |||
| 1598 | Ga0207693_10001029 | |||
| 1599 | Ga0207693_10002423 | |||
| 1600 | Ga0207693_10010541 | |||
| 1601 | Ga0207693_10013900 | |||
| 1602 | Ga0207693_10014377 | |||
| 1603 | Ga0207693_10017024 | |||
| 1604 | Ga0207693_10050827 | |||
| 1605 | Ga0207693_10055443 | |||
| 1606 | Ga0207693_10136756 | |||
| 1607 | Ga0207693_10291916 | |||
| 1608 | Ga0207663_10001507 | |||
| 1609 | Ga0207663_10003723 | |||
| 1610 | Ga0207663_10017716 | |||
| 1611 | Ga0207663_10034816 | |||
| 1612 | Ga0207663_10235305 | |||
| 1613 | Ga0207663_10238573 | |||
| 1614 | Ga0207663_10372323 | |||
| 1615 | Ga0207660_10216404 | |||
| 1616 | Ga0207662_10436054 | |||
| 1617 | Ga0207657_10001503 | |||
| 1618 | Ga0207657_10001593 | |||
| 1619 | Ga0207657_10021527 | |||
| 1620 | Ga0207649_10000241 | |||
| 1621 | Ga0207652_10004952 | |||
| 1622 | Ga0207652_10289070 | |||
| 1623 | Ga0207652_10298619 | |||
| 1624 | Ga0207646_10000494 | |||
| 1625 | Ga0207646_10119073 | |||
| 1626 | Ga0207646_10121366 | |||
| 1627 | Ga0207646_10168304 | |||
| 1628 | Ga0207646_10178522 | |||
| 1629 | Ga0207646_10255306 | |||
| 1630 | Ga0207646_10443792 | |||
| 1631 | Ga0207681_10023821 | |||
| 1632 | Ga0207681_10059437 | |||
| 1633 | Ga0207681_10326180 | |||
| 1634 | Ga0207694_10039331 | |||
| 1635 | Ga0207650_10000124 | |||
| 1636 | Ga0207650_10011152 | |||
| 1637 | Ga0207650_10162216 | |||
| 1638 | Ga0207659_10050339 | |||
| 1639 | Ga0207659_10053620 | |||
| 1640 | Ga0207659_10205892 | |||
| 1641 | Ga0207687_10008822 | |||
| 1642 | Ga0207687_10474328 | |||
| 1643 | Ga0207700_10000160 | |||
| 1644 | Ga0207700_10006581 | |||
| 1645 | Ga0207700_10067821 | |||
| 1646 | Ga0207700_10087124 | |||
| 1647 | Ga0207700_10193770 | |||
| 1648 | Ga0207700_10249664 | |||
| 1649 | Ga0207700_10357839 | |||
| 1650 | Ga0207700_10395686 | |||
| 1651 | Ga0207700_10588055 | |||
| 1652 | Ga0207664_10000582 | |||
| 1653 | Ga0207664_10004389 | |||
| 1654 | Ga0207664_10027352 | |||
| 1655 | Ga0207664_10035543 | |||
| 1656 | Ga0207664_10057057 | |||
| 1657 | Ga0207664_10374547 | |||
| 1658 | Ga0207644_10044710 | |||
| 1659 | Ga0207644_10389227 | |||
| 1660 | Ga0207690_10121152 | |||
| 1661 | Ga0207690_10244583 | |||
| 1662 | Ga0207706_10000389 | |||
| 1663 | Ga0207706_10006249 | |||
| 1664 | Ga0207706_10056596 | |||
| 1665 | Ga0207706_10084594 | |||
| 1666 | Ga0207686_10208872 | |||
| 1667 | Ga0207686_10356082 | |||
| 1668 | Ga0207670_10005533 | |||
| 1669 | Ga0207704_10127658 | |||
| 1670 | Ga0207704_10226491 | |||
| 1671 | Ga0207704_10271717 | |||
| 1672 | Ga0207665_10000147 | |||
| 1673 | Ga0207665_10002765 | |||
| 1674 | Ga0207665_10004252 | |||
| 1675 | Ga0207665_10008366 | |||
| 1676 | Ga0207665_10011555 | |||
| 1677 | Ga0207665_10012474 | |||
| 1678 | Ga0207665_10017982 | |||
| 1679 | Ga0207665_10029677 | |||
| 1680 | Ga0207665_10038792 | |||
| 1681 | Ga0207665_10039492 | |||
| 1682 | Ga0207665_10135658 | |||
| 1683 | Ga0207665_10318637 | |||
| 1684 | Ga0207691_10000017 | |||
| 1685 | Ga0207691_10000213 | |||
| 1686 | Ga0207691_10014715 | |||
| 1687 | Ga0207711_10000705 | |||
| 1688 | Ga0207711_10004244 | |||
| 1689 | Ga0207711_10011673 | |||
| 1690 | Ga0207689_10009150 | |||
| 1691 | Ga0207689_10021027 | |||
| 1692 | Ga0207661_10000198 | |||
| 1693 | Ga0207661_10001087 | |||
| 1694 | Ga0207661_10471549 | |||
| 1695 | Ga0207679_10000084 | |||
| 1696 | Ga0207679_10044853 | |||
| 1697 | Ga0207667_10100341 | |||
| 1698 | Ga0207667_10223710 | |||
| 1699 | Ga0207667_10314855 | |||
| 1700 | Ga0207651_10020546 | |||
| 1701 | Ga0207712_10009116 | |||
| 1702 | Ga0207712_10171355 | |||
| 1703 | Ga0207712_10387558 | |||
| 1704 | Ga0207668_10013144 | |||
| 1705 | Ga0207668_10107702 | |||
| 1706 | Ga0207640_10040102 | |||
| 1707 | Ga0207640_10044061 | |||
| 1708 | Ga0207640_10058900 | |||
| 1709 | Ga0207658_10007461 | |||
| 1710 | Ga0207658_10014114 | |||
| 1711 | Ga0207658_10089936 | |||
| 1712 | Ga0207658_10176560 | |||
| 1713 | Ga0207658_10280359 | |||
| 1714 | Ga0207677_10001778 | |||
| 1715 | Ga0207677_10016289 | |||
| 1716 | Ga0207677_10057466 | |||
| 1717 | Ga0207677_10095865 | |||
| 1718 | Ga0207703_10000673 | |||
| 1719 | Ga0207703_10482966 | |||
| 1720 | Ga0207639_10023827 | |||
| 1721 | Ga0207639_10053456 | |||
| 1722 | Ga0207639_10080007 | |||
| 1723 | Ga0207678_10000070 | |||
| 1724 | Ga0207678_10001143 | |||
| 1725 | Ga0207678_10024694 | |||
| 1726 | Ga0207708_10145604 | |||
| 1727 | Ga0207702_10007863 | |||
| 1728 | Ga0207702_10008415 | |||
| 1729 | Ga0207702_10027557 | |||
| 1730 | Ga0207702_10121087 | |||
| 1731 | Ga0207702_10125321 | |||
| 1732 | Ga0207702_10199287 | |||
| 1733 | Ga0207702_10270880 | |||
| 1734 | Ga0207641_10000006 | |||
| 1735 | Ga0207641_10004604 | |||
| 1736 | Ga0207641_10018783 | |||
| 1737 | Ga0207641_10139177 | |||
| 1738 | Ga0207641_10404557 | |||
| 1739 | Ga0207641_10524620 | |||
| 1740 | Ga0207648_10001425 | |||
| 1741 | Ga0207648_10074073 | |||
| 1742 | Ga0207676_10000132 | |||
| 1743 | Ga0207676_10046818 | |||
| 1744 | Ga0207676_10105299 | |||
| 1745 | Ga0207676_10283814 | |||
| 1746 | Ga0207674_10000556 | |||
| 1747 | Ga0207674_10550022 | |||
| 1748 | Ga0207675_100033172 | |||
| 1749 | Ga0207683_10003539 | |||
| 1750 | Ga0207683_10007717 | |||
| 1751 | Ga0207683_10011590 | |||
| 1752 | Ga0207683_10051234 | |||
| 1753 | Ga0207698_10019763 | |||
| 1754 | Ga0207698_10035942 | |||
| 1755 | Ga0209371_1001781 | |||
| 1756 | Ga0209588_1000010 | |||
| 1757 | Ga0209588_1021776 | |||
| 1758 | Ga0268266_10015405 | |||
| 1759 | Ga0268266_10067760 | |||
| 1760 | Ga0268266_10160624 | |||
| 1761 | Ga0268266_10222368 | |||
| 1762 | Ga0268265_10031603 | |||
| 1763 | Ga0268265_10147477 | |||
| 1764 | Ga0268264_10000961 | |||
| 1765 | Ga0268264_10001110 | |||
| 1766 | Ga0268264_10156513 | |||
| 1767 | Ga0268264_10165507 | |||
| 1768 | Ga0268264_10174366 | |||
| 1769 | Ga0307515_10000430 | |||
| 1770 | Ga0307515_10375211 | |||
| 1771 | Ga0265338_10070465 | |||
| 1772 | Ga0265338_10124129 | |||
| 1773 | Ga0268256_1002627 | |||
| 1774 | Ga0265760_10002364 | |||
| 1775 | Ga0265760_10002577 | |||
| 1776 | Ga0265760_10002948 | |||
| 1777 | Ga0265330_10006773 | |||
| 1778 | Ga0265332_10000461 | |||
| 1779 | Ga0265332_10048021 | |||
| 1780 | Ga0265332_10181220 | |||
| 1781 | Ga0265328_10001159 | |||
| 1782 | Ga0265320_10027714 | |||
| 1783 | Ga0265325_10036615 | |||
| 1784 | Ga0265329_10011737 | |||
| 1785 | Ga0265340_10106548 | |||
| 1786 | Ga0265339_10003817 | |||
| 1787 | Ga0265339_10051345 | |||
| 1788 | Ga0265339_10061053 | |||
| 1789 | Ga0265339_10114812 | |||
| 1790 | Ga0265331_10000338 | |||
| 1791 | Ga0265331_10000456 | |||
| 1792 | Ga0265331_10057054 | |||
| 1793 | Ga0265327_10000142 | |||
| 1794 | Ga0265316_10000114 | |||
| 1795 | Ga0265316_10002182 | |||
| 1796 | Ga0265316_10039168 | |||
| 1797 | Ga0265316_10048330 | |||
| 1798 | Ga0265313_10000602 | |||
| 1799 | Ga0316579_10000702 | |||
| 1800 | Ga0316579_10066479 | |||
| 1801 | Ga0265314_10001296 | |||
| 1802 | Ga0265314_10018463 | |||
| 1803 | Ga0265314_10049506 | |||
| 1804 | Ga0265342_10007181 | |||
| 1805 | Ga0265342_10028000 | |||
| 1806 | Ga0265342_10043578 | |||
| 1807 | Ga0316576_10119520 | |||
| 1808 | Ga0316578_10161826 | |||
| 1809 | Ga0307516_10000893 | |||
| 1810 | Ga0307405_10071329 | |||
| 1811 | Ga0316577_10001728 | |||
| 1812 | Ga0316577_10006839 | |||
| 1813 | Ga0316577_10022645 | |||
| 1814 | Ga0307413_10255092 | |||
| 1815 | Ga0307412_10086099 | |||
| 1816 | Ga0307411_10595196 | |||
| 1817 | Ga0307415_100001316 | |||
| 1818 | Ga0373930_0003776 | |||
| 1819 | Ga0373926_0005579 | |||
| 1820 | Ga0373934_0030979 | |||
| 1821 | Ga0373923_0034729 | |||
| 1822 | Ga0373923_0060878 | |||
| 1823 | Ga0373936_0014811 | |||
| 1824 | Ga0373936_0014899 | |||
| 1825 | Ga0373936_0120598 | |||
| 1826 | Ga0373953_0019557 | |||
| 1827 | Ga0373954_0000068 | |||
| 1828 | Ga0373954_0008040 | |||
| 1829 | Ga0373954_0123591 | |||
| 1830 | Ga0373954_0136517 | |||
| 1831 | Ga0373956_0053699 | |||
| 1832 | Ga0373956_0068385 | |||
| 1833 | Ga0373956_0165607 | |||
| 1834 | Ga0373957_0101465 | |||
| 1835 | Ga0373960_0003207 | |||
| 1836 | Ga0373943_0010746 | |||
| 1837 | Ga0373943_0013170 | |||
| 1838 | Ga0373943_0244993 | |||
| 1839 | Ga0373955_0033114 | |||
| 1840 | Ga0373955_0094000 | |||
| 1841 | Ga0373955_0243057 | |||
| 1842 | Ga0373961_0027507 | |||
| 1843 | Ga0373924_0023281 | |||
| 1844 | Ga0373924_0041818 | |||
| 1845 | Ga0373935_0006013 | |||
| 1846 | Ga0373935_0008252 | |||
| 1847 | Ga0373935_0041406 | |||
| 1848 | Ga0373935_0112949 | |||
| 1849 | Ga0373935_0123056 | |||
| 1850 | Ga0373935_0173506 | |||
| 1851 | Ga0373935_0350778 | |||
| 1852 | Ga0373927_0000292 | |||
| 1853 | Ga0373927_0005421 | |||
| 1854 | Ga0373927_0006347 | |||
| 1855 | Ga0373927_0067243 | |||
| 1856 | Ga0373927_0200475 | |||
| 1857 | Ga0373927_0214835 | |||
| 1858 | Ga0373933_0007750 | |||
| 1859 | Ga0373933_0025679 | |||
| 1860 | Ga0373933_0081545 | |||
| 1861 | Ga0373933_0088049 | |||
| 1862 | Ga0373933_0280927 | |||
| 1863 | Ga0373947_0013313 | |||
| 1864 | Ga0373947_0025848 | |||
| 1865 | Ga0373947_0027705 | |||
| 1866 | Ga0373947_0066989 | |||
| 1867 | Ga0373947_0073371 | |||
| 1868 | Ga0373947_0174412 | |||
| 1869 | Ga0373947_0305377 | |||
| 1870 | Ga0373937_0002051 | |||
| 1871 | Ga0373937_0040546 | |||
| 1872 | Ga0373937_0055834 | |||
| 1873 | Ga0373937_0103447 | |||
| 1874 | Ga0373937_0135416 | |||
| 1875 | Ga0373937_0145489 | |||
| 1876 | Ga0373937_0197589 | |||
| 1877 | Ga0373937_0252619 | |||
| 1878 | Ga0373937_0346995 | |||
| 1879 | Ga0316582_0018427 | |||
| 1880 | Ga0316582_0019518 | |||
| 1881 | Ga0373925_0001535 | |||
| 1882 | Ga0373925_0003786 | |||
| 1883 | Ga0373925_0003912 | |||
| 1884 | Ga0373925_0049902 | |||
| 1885 | Ga0373925_0320473 | |||
| 1886 | Ga0395899_0058084 | |||
| 1887 | Ga0316581_0006450 | |||
| 1888 | Ga0436364_0156979 | |||
| 1889 | Ga0436365_1169174 | |||
| 1890 | Ga0436360_0441910 | |||
| 1891 | Ga0436360_0649865 | |||
| 1892 | Ga0436361_0036310 | |||
| 1893 | Ga0436361_0152072 | |||
| 1894 | Ga0436361_0547921 | |||
| 1895 | Ga0436361_0670591 | |||
| 1896 | Ga0436361_0941307 | |||
| 1897 | Ga0436361_1133747 | |||
| 1898 | Ga0436363_0557136 | |||
| 1899 | Ga0436362_0062315 | |||
| 1900 | Ga0436362_0519918 | |||
| 1901 | Ga0451577_0321239 | |||
| 1902 | Ga0466972_0060701 | |||
| 1903 | Ga0466964_0027812 | |||
| 1904 | Ga0466970_0014364 | |||
| 1905 | Ga0466957_0052745 | |||
| 1906 | Ga0466957_0184227 | |||
| 1907 | Ga0466959_0302525 | |||
| 1908 | Ga0466967_0664403 | |||
| 1909 | Ga0466967_0693613 | |||
| 1910 | Ga0495592_0091627 | |||
| 1911 | Ga0495603_0149529 | |||
| 1912 | Ga0495629_0000003 | |||
| 1913 | Ga0495629_0018758 | |||
| 1914 | Ga0495638_0092475 | |||
| 1915 | Ga0495653_0102841 | |||
| 1916 | Ga0495580_0000019 | |||
| 1917 | Ga0495580_0000340 | |||
| 1918 | Ga0495580_0000509 | |||
| 1919 | Ga0495580_0004340 | |||
| 1920 | Ga0495580_0004560 | |||
| 1921 | Ga0495580_0004756 | |||
| 1922 | Ga0495580_0007064 | |||
| 1923 | Ga0495580_0008423 | |||
| 1924 | Ga0495580_0010728 | |||
| 1925 | Ga0495580_0011550 | |||
| 1926 | Ga0495580_0055636 | |||
| 1927 | Ga0495580_0062262 | |||
| 1928 | Ga0495580_0070283 | |||
| 1929 | Ga0495580_0078997 | |||
| 1930 | Ga0495580_0115601 | |||
| 1931 | Ga0495580_0137972 | |||
| 1932 | Ga0495580_0164902 | |||
| 1933 | Ga0495580_0197046 | |||
| 1934 | Ga0495582_0000266 | |||
| 1935 | Ga0495582_0000351 | |||
| 1936 | Ga0495582_0038669 | |||
| 1937 | Ga0495582_0050416 | |||
| 1938 | Ga0495664_0157726 | |||
| 1939 | Ga0495584_0202099 | |||
| 1940 | Ga0495584_0210178 | |||
| 1941 | Ga0495583_0000829 | |||
| 1942 | Ga0495606_0022376 | |||
| 1943 | Ga0495606_0028738 | |||
| 1944 | Ga0495606_0061181 | |||
| 1945 | Ga0495606_0115209 | |||
| 1946 | Ga0495608_0006140 | |||
| 1947 | Ga0495608_0310167 | |||
| 1948 | Ga0495628_0010012 | |||
| 1949 | Ga0495628_0031515 | |||
| 1950 | Ga0495628_0323798 | |||
| 1951 | Ga0495630_0150873 | |||
| 1952 | Ga0495630_0203065 | |||
| 1953 | Ga0495637_0122889 | |||
| 1954 | Ga0495666_0110366 | |||
| 1955 | Ga0495665_0002327 | |||
| 1956 | Ga0495665_0019641 | |||
| 1957 | Ga0495665_0040453 | |||
| 1958 | Ga0495665_0121083 | |||
| 1959 | Ga0495665_0126419 | |||
| 1960 | Ga0495587_0027758 | |||
| 1961 | Ga0495621_0056373 | |||
| 1962 | Ga0495645_0143568 | |||
| 1963 | Ga0495622_0028573 | |||
| 1964 | Ga0495667_0000813 | |||
| 1965 | Ga0495667_0070872 | |||
| 1966 | Ga0495667_0139227 | |||
| 1967 | Ga0495668_0058971 | |||
| 1968 | Ga0495588_0000338 | |||
| 1969 | Ga0495657_0079415 | |||
| 1970 | Ga0495657_0270548 | |||
| 1971 | Ga0495623_0041908 | |||
| 1972 | Ga0495623_0195036 | |||
| 1973 | Ga0495646_0146940 | |||
| 1974 | Ga0495658_0051576 | |||
| 1975 | Ga0495658_0064388 | |||
| 1976 | Ga0495624_0038046 | |||
| 1977 | Ga0495670_0004091 | |||
| 1978 | Ga0495589_0043648 | |||
| 1979 | Ga0495600_0059594 | |||
| 1980 | Ga0495600_0185586 | |||
| 1981 | Ga0495660_0002852 | |||
| 1982 | Ga0495660_0238781 | |||
| 1983 | Ga0495581_0049805 | |||
| 1984 | Ga0495604_0033033 | |||
| 1985 | Ga0495604_0153279 | |||
| 1986 | Ga0495604_0226427 | |||
| 1987 | Ga0495674_0089191 | |||
| 1988 | Ga0495674_0207714 | |||
| 1989 | Ga0495674_0409117 | |||
| 1990 | Ga0495672_0050211 | |||
| 1991 | Ga0495680_0257224 | |||
| 1992 | Ga0495675_0062390 | |||
| 1993 | Ga0495673_0085119 | |||
| 1994 | Ga0495684_0019408 | |||
| 1995 | Ga0495686_0000012 | |||
| 1996 | Ga0495686_0000112 | |||
| 1997 | Ga0495686_0000561 | |||
| 1998 | Ga0495686_0082839 | |||
| 1999 | Ga0495686_0123442 | |||
| 2000 | Ga0495686_0221817 | |||
| 2001 | Ga0495602_0024804 | |||
| 2002 | Ga0495602_0108905 | |||
| 2003 | Ga0495602_0355276 | |||
| 2004 | Ga0495602_0511616 | |||
| 2005 | Ga0496100_0034546 | |||
| 2006 | Ga0496100_0266137 | |||
| 2007 | Ga0496100_0649764 | |||
| 2008 | Ga0496101_0051018 | |||
| 2009 | Ga0496101_0067480 | |||
| 2010 | Ga0496101_0130976 | |||
| 2011 | Ga0496101_0290443 | |||
| 2012 | Ga0496102_0007981 | |||
| 2013 | Ga0496102_0016545 | |||
| 2014 | Ga0496102_0038103 | |||
| 2015 | Ga0496102_0038789 | |||
| 2016 | Ga0496102_0056758 | |||
| 2017 | Ga0496102_0769419 | |||
| 2018 | Ga0496103_0003579 | |||
| 2019 | Ga0496103_0021242 | |||
| 2020 | Ga0496103_0062879 | |||
| 2021 | Ga0496103_0160846 | |||
| 2022 | Ga0496104_0054868 | |||
| 2023 | Ga0496104_0208837 | |||
| 2024 | Ga0496105_0083333 | |||
| 2025 | Ga0496105_0172295 | |||
| 2026 | Ga0496106_0000937 | |||
| 2027 | Ga0496106_0020771 | |||
| 2028 | Ga0496107_0002505 | |||
| 2029 | Ga0496107_0196122 | |||
| 2030 | Ga0496107_0383747 | |||
| 2031 | Ga0496107_0544476 | |||
| 2032 | Ga0496108_0000495 | |||
| 2033 | Ga0496108_0112698 | |||
| 2034 | Ga0496109_0000149 | |||
| 2035 | Ga0496109_0017460 | |||
| 2036 | Ga0496109_0029983 | |||
| 2037 | Ga0496110_0133522 | |||
| 2038 | Ga0496110_0152944 | |||
| 2039 | Ga0496111_0008923 | |||
| 2040 | Ga0496111_0059720 | |||
| 2041 | Ga0496112_0000070 | |||
| 2042 | Ga0496112_0171594 | |||
| 2043 | Ga0496112_0420609 | |||
| 2044 | Ga0496112_0426615 | |||
| 2045 | Ga0496113_0000078 | |||
| 2046 | Ga0496113_0216058 | |||
| 2047 | Ga0496115_0001172 | |||
| 2048 | Ga0496115_0007315 | |||
| 2049 | Ga0496115_0086179 | |||
| 2050 | Ga0496115_0242392 | |||
| 2051 | Ga0496115_0330812 | |||
| 2052 | Ga0496118_0004879 | |||
| 2053 | Ga0496118_0119561 | |||
| 2054 | Ga0496119_0005427 | |||
| 2055 | Ga0496119_0103792 | |||
| 2056 | Ga0496120_0071023 | |||
| 2057 | Ga0496120_0088363 | |||
| 2058 | Ga0496120_0207547 | |||
| 2059 | Ga0496121_0000664 | |||
| 2060 | Ga0496121_0151387 | |||
| 2061 | Ga0496122_0026316 | |||
| 2062 | Ga0496122_0028105 | |||
| 2063 | Ga0496122_0175286 | |||
| 2064 | Ga0496123_0026747 | |||
| 2065 | Ga0496123_0036401 | |||
| 2066 | Ga0496124_0110487 | |||
| 2067 | Ga0496125_0000125 | |||
| 2068 | Ga0496125_0046957 | |||
| 2069 | Ga0496126_0026293 | |||
| 2070 | Ga0496126_0029296 | |||
| 2071 | Ga0496126_0223952 | |||
| 2072 | Ga0496126_0556283 | |||
| 2073 | Ga0501036_0459819 | |||
| 2074 | Ga0501067_0239934 | |||
| 2075 | Ga0501076_0209116 | |||
| 2076 | Ga0501077_0156986 | |||
| 2077 | Ga0501079_0042275 | |||
| 2078 | Ga0501081_0008663 | |||
| 2079 | Ga0501045_0129951 | |||
| 2080 | nmdc:mga0k408_1293_c2 | |||
| 2081 | nmdc:mga05p37_28230_c1 | |||
| 2082 | nmdc:mga05p37_381086_c1 | |||
| 2083 | nmdc:mga05p37_45428_c1 | |||
| 2084 | nmdc:mga05p37_514213_c1 | |||
| 2085 | nmdc:mga09592_12397_c1 | |||
| 2086 | nmdc:mga0qj67_285979_c1 | |||
| 2087 | nmdc:mga0qj67_720_c1 | |||
| 2088 | nmdc:mga0qj67_94091_c1 | |||
| 2089 | nmdc:mga06r32_4338_c1 | |||
| 2090 | nmdc:mga06r32_92397_c1 | |||
| 2091 | nmdc:mga0n895_14321_c1 | |||
| 2092 | nmdc:mga0n895_149746_c1 | |||
| 2093 | nmdc:mga0n895_188314_c1 | |||
| 2094 | nmdc:mga0n895_261_c1 | |||
| 2095 | nmdc:mga0n895_2822_c1 | |||
| 2096 | nmdc:mga0n895_443555_c1 | |||
| 2097 | nmdc:mga0n895_488614_c1 | |||
| 2098 | nmdc:mga0n895_570_c1 | |||
| 2099 | nmdc:mga0n895_620744_c1 | |||
| 2100 | nmdc:mga0rr50_108006_c1 | |||
| 2101 | nmdc:mga0rr50_120434_c1 | |||
| 2102 | nmdc:mga0rr50_140978_c1 | |||
| 2103 | nmdc:mga0rr50_148255_c2 | |||
| 2104 | nmdc:mga0rr50_169952_c1 | |||
| 2105 | nmdc:mga0rr50_213_c1 | |||
| 2106 | nmdc:mga0rr50_279253_c1 | |||
| 2107 | nmdc:mga0rr50_305355_c1 | |||
| 2108 | nmdc:mga0rr50_6166_c1 | |||
| 2109 | nmdc:mga08x19_11024_c1 | |||
| 2110 | nmdc:mga08x19_11675_c1 | |||
| 2111 | nmdc:mga08x19_189064_c1 | |||
| 2112 | nmdc:mga08x19_2681_c1 | |||
| 2113 | nmdc:mga08x19_27112_c1 | |||
| 2114 | nmdc:mga08x19_420426_c1 | |||
| 2115 | nmdc:mga08x19_43104_c1 | |||
| 2116 | nmdc:mga08x19_5095_c1 | |||
| 2117 | nmdc:mga0a205_258711_c1 | |||
| 2118 | nmdc:mga0a205_34413_c1 | |||
| 2119 | nmdc:mga0a205_56253_c1 | |||
| 2120 | nmdc:mga0a205_6765_c1 | |||
| 2121 | nmdc:mga0a205_8611_c1 | |||
| 2122 | nmdc:mga0a205_91055_c1 | |||
| 2123 | Ga0495601_0054373 | |||
| 2124 | Ga0495619_0102840 | |||
| 2125 | Ga0495619_0307972 | |||
| 2126 | Ga0500578_0000012 | |||
| 2127 | Ga0500647_0074052 | |||
| 2128 | Ga0500566_0013648 | |||
| 2129 | Ga0500566_0151253 | |||
| 2130 | Ga0500650_0139853 | |||
| 2131 | Ga0500554_018284 | |||
| 2132 | Ga0500562_043714 | |||
| 2133 | Ga0500592_000451 | |||
| 2134 | Ga0500595_000159 | |||
| 2135 | Ga0500618_005025 | |||
| 2136 | Ga0500618_006961 | |||
| 2137 | Ga0500658_0130478 | |||
| 2138 | Ga0500559_0071841 | |||
| 2139 | Ga0500590_010303 | |||
| 2140 | Ga0500603_003488 | |||
| 2141 | Ga0500616_0000139 | |||
| 2142 | Ga0500616_0097892 | |||
| 2143 | Ga0500638_001268 | |||
| 2144 | Ga0500636_0062938 | |||
| 2145 | Ga0500636_0218954 | |||
| 2146 | Ga0500637_0000349 | |||
| 2147 | Ga0500661_000413 | |||
| 2148 | 2509153257 | |||
| 2149 | 2513889383 | |||
| 2150 | 2524469899 | |||
| 2151 | 2585232549 | |||
| 2152 | 2585282809 | |||
| 2153 | 2585324195 | |||
| 2154 | 2585333407 | |||
| 2155 | 2585534891 | |||
| 2156 | 2585551662 | |||
| 2157 | 2585897544 | |||
| 2158 | 2603859768 | |||
| 2159 | 2616308178 | |||
| 2160 | 2616556801 | |||
| 2161 | 2617381532 | |||
| 2162 | 2644238154 | |||
| 2163 | 2671114711 | |||
| 2164 | 2740059572 | |||
| 2165 | 2778176323 | |||
| 2166 | 2819610659 | |||
| 2167 | 2819638309 | |||
| 2168 | 2821450529 | |||
| 2169 | 2838032336 | |||
| 2170 | 2842479035 | |||
| 2171 | 2842483167 | |||
| 2172 | 2842506245 | |||
| 2173 | 2857530626 | |||
| 2174 | 2885386628 | |||
| 2175 | 2891637522 | |||
| 2176 | 2893070271 | |||
| 2177 | 2909399119 | |||
| 2178 | 2919076222 | |||
| 2179 | 2919409623 | |||
| 2180 | 2929924044 | |||
| 2181 | 2954017689 | |||
| 2182 | 3001897286 | |||
| 2183 | 3005420516 | |||
| 2184 | 8005317467 | |||
| 2185 | 8005487159 | |||
| 2186 | 8005646454 | |||
| 2187 | 8005686518 | |||
| 2188 | 8024492387 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7djs-assembly1.cif.gz_C | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9815 | 6 | 253 |
| 7djs-assembly1.cif.gz_A | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9754 | 6 | 253 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.9748 | 1 | 253 |
| 1iy8-assembly1.cif.gz_B | crystal structure of levodione reductase | 0.9745 | 2 | 252 |
| 4cql-assembly2.cif.gz_B | crystal structure of heterotetrameric human ketoacyl reductase complexed with nad | 0.9724 | 6 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9748 | 1 | 253 | 3.40.50.720 |
| 1iy8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9719 | 2 | 252 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9715 | 3 | 194 | 3.40.50.720 |
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9708 | 1 | 253 | 3.40.50.720 |
| 4iinB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9707 | 6 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q5M1B2-F1-model_v4 | Short-chain dehydrogenase | 0.995 | 1 | 250 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A532U331-F1-model_v4 | Short-chain dehydrogenase | 0.9948 | 1 | 253 |
GO:0016491
|
| AF-A0A382RC41-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9939 | 25 | 249 |
GO:0016491
|
| AF-A0A524AU47-F1-model_v4 | Glucose 1-dehydrogenase (EC 1.1.1.47) | 0.9937 | 1 | 253 |
GO:0047936
|
| AF-A0A6B2T3R4-F1-model_v4 | SDR family oxidoreductase | 0.9906 | 26 | 251 |
GO:0016491
|