F489935

General Info

Members Datasets Scaffolds Average Seq Length
1094 432 2188 256

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100067503|Ga0068864_1000675032
Length 304
Sequence MAEASPDPRRGRSPRLPGGAKLRSGFLAAQSGELRSPAQTGRLGLRKSRRFMRLQDKVALITGGTSGIGEATAVLFAKEGAKIAITGRNEKRGHAVIEQILNGGGQAIFLRTDVRKAAECRGAVEETVSSFGRLDILFNNAGIFYPHTALDCSEEEWDLQIDVNLKGTFLMSKFVLPGMIEQGSGVIINNSSGWGIVGGDAAIAYCASKGGVVLLTKAMAIDHGRQGIRVNCICPGDVDTPMLPEDARMRGQKWEDYLAGCSNRPLGRIGTSDEIAKAALFLASDDSSFMTGATLVVDGGGTAD

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
144 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
145 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
249 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
254 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
255 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
256 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
297 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
298 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
370 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
371 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
375 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
376 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
377 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
378 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
379 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
380 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
386 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
391 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
392 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
393 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
394 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
395 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
396 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
397 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
398 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
399 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
400 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
401 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
402 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
403 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
404 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
405 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
406 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
407 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
408 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
409 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
410 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
411 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
412 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
413 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
414 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
415 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
416 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
417 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
418 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
419 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
420 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
421 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
422 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
423 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
424 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
425 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
426 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
427 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
428 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
429 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
430 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
431 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
432 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0.27
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 1.19
Rhizoplane 4.48
Rhizosphere 84.55
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100067503 3300005618 Bacteria 3105
2 MRS1b_contig_9110685 2162886011 Bacteria 1241
3 JGI24752J21851_1001338 3300001976 Bacteria 3322
4 JGI24740J21852_10000557 3300001979 Bacteria 15986
5 JGI24737J22298_10051769 3300001990 Bacteria 1246
6 JGI24033J26618_1008754 3300002155 Bacteria 1170
7 JGI24034J26672_10004802 3300002239 Bacteria 1923
8 JGI25155J39150_1000061 3300002704 Bacteria 71144
9 JGI25156J39149_1000122 3300002705 Bacteria 56600
10 JGI25162J39368_1000343 3300002737 Bacteria 40240
11 JGI25162J39368_1001828 3300002737 Bacteria 9959
12 JGI25154J39366_1000132 3300002738 Bacteria 58454
13 JGI25157J39369_1000106 3300002741 Bacteria 71144
14 JGI25151J46595_10000285 3300003187 Bacteria 57259
15 JGI25151J46595_10006958 3300003187 Bacteria 5605
16 JGI25406J46586_10020708 3300003203 Bacteria 2653
17 JGI25165J46597_1000448 3300003214 Bacteria 41488
18 JGI25165J46597_1002332 3300003214 Bacteria 6407
19 rootH1_10075866 3300003316 Bacteria 1205
20 rootH2_10032239 3300003320 Bacteria 32858
21 rootH2_10044892 3300003320 Bacteria 5700
22 rootH2_10142949 3300003320 Unclassified 1720
23 rootH2_10297647 3300003320 Unclassified 1285
24 rootL2_10000825 3300003322 Bacteria 30356
25 rootL2_10028893 3300003322 Bacteria 5663
26 rootL2_10047860 3300003322 Bacteria 3741
27 rootH1_10022429 3300003323 Bacteria 9846
28 rootH1_10024211 3300003323 Bacteria 3005
29 rootH1_10176177 3300003323 Bacteria 1679
30 rootH1_10206279 3300003323 Unclassified 1197
31 Ga0065715_10105165 3300005293 Unclassified 2895
32 Ga0070658_10134759 3300005327 Unclassified 2060
33 Ga0070676_10102310 3300005328 Bacteria 1772
34 Ga0070676_10110021 3300005328 Unclassified 1714
35 Ga0070683_100000835 3300005329 Bacteria 22828
36 Ga0070683_100002634 3300005329 Bacteria 14344
37 Ga0070683_100230084 3300005329 Unclassified 1762
38 Ga0070683_100381057 3300005329 Bacteria 1344
39 Ga0070683_100464131 3300005329 Unclassified 1208
40 Ga0070690_100000456 3300005330 Bacteria 20589
41 Ga0070690_100069261 3300005330 Unclassified 2289
42 Ga0070670_100033767 3300005331 Bacteria 4405
43 Ga0070670_100509783 3300005331 Bacteria 1070
44 Ga0070677_10005282 3300005333 Bacteria 4251
45 Ga0070677_10045508 3300005333 Bacteria 1751
46 Ga0068869_100024527 3300005334 Bacteria 4177
47 Ga0070666_10001743 3300005335 Bacteria 13267
48 Ga0070666_10017198 3300005335 Bacteria 4634
49 Ga0070666_10074125 3300005335 Bacteria 2319
50 Ga0070666_10339811 3300005335 Unclassified 1073
51 Ga0070680_100183000 3300005336 Bacteria 1765
52 Ga0070680_100413974 3300005336 Bacteria 1150
53 Ga0070682_100000102 3300005337 Bacteria 76457
54 Ga0070682_100020786 3300005337 Unclassified 3867
55 Ga0068868_100001806 3300005338 Bacteria 14694
56 Ga0068868_100005079 3300005338 Bacteria 9243
57 Ga0068868_100015998 3300005338 Bacteria 5562
58 Ga0068868_100037089 3300005338 Bacteria 3777
59 Ga0070660_100002663 3300005339 Bacteria 12266
60 Ga0070660_100015316 3300005339 Bacteria 5534
61 Ga0070689_100009333 3300005340 Bacteria 6956
62 Ga0070689_100025654 3300005340 Bacteria 4430
63 Ga0070661_100005786 3300005344 Bacteria 8501
64 Ga0070668_100019735 3300005347 Bacteria 5076
65 Ga0070668_100079760 3300005347 Unclassified 2563
66 Ga0070668_100116547 3300005347 Bacteria 2130
67 Ga0070668_100160023 3300005347 Bacteria 1826
68 Ga0070669_100007505 3300005353 Bacteria 7811
69 Ga0070669_100016363 3300005353 Bacteria 5291
70 Ga0070669_100065518 3300005353 Bacteria 2676
71 Ga0070669_100107548 3300005353 Bacteria 2113
72 Ga0070675_100024719 3300005354 Bacteria 4811
73 Ga0070675_100062372 3300005354 Bacteria 3080
74 Ga0070675_100085408 3300005354 Bacteria 2637
75 Ga0070671_100088123 3300005355 Unclassified 2597
76 Ga0070671_100126410 3300005355 Bacteria 2152
77 Ga0070671_100250484 3300005355 Bacteria 1504
78 Ga0070674_100133925 3300005356 Bacteria 1852
79 Ga0070673_100125075 3300005364 Unclassified 2150
80 Ga0070688_100138167 3300005365 Bacteria 1652
81 Ga0070688_100195274 3300005365 Bacteria 1412
82 Ga0070659_100018980 3300005366 Bacteria 5199
83 Ga0070659_100044681 3300005366 Unclassified 3469
84 Ga0070667_100000282 3300005367 Bacteria 57538
85 Ga0070667_100118369 3300005367 Bacteria 2302
86 Ga0070667_100185199 3300005367 Bacteria 1842
87 Ga0070667_100619029 3300005367 Bacteria 998
88 Ga0070709_10000171 3300005434 Bacteria 40897
89 Ga0070709_10007066 3300005434 Bacteria 6138
90 Ga0070709_10015415 3300005434 Bacteria 4349
91 Ga0070709_10055565 3300005434 Bacteria 2500
92 Ga0070709_10062094 3300005434 Bacteria 2381
93 Ga0070709_10066684 3300005434 Bacteria 2309
94 Ga0070709_10082286 3300005434 Bacteria 2103
95 Ga0070709_10135753 3300005434 Bacteria 1685
96 Ga0070709_10213544 3300005434 Bacteria 1372
97 Ga0070709_10217632 3300005434 Bacteria 1360
98 Ga0070709_10261451 3300005434 Bacteria 1250
99 Ga0070714_100005715 3300005435 Bacteria 9531
100 Ga0070714_100062758 3300005435 Bacteria 3193
101 Ga0070714_100165917 3300005435 Bacteria 2001
102 Ga0070714_100404690 3300005435 Bacteria 1291
103 Ga0070713_100000029 3300005436 Bacteria 90705
104 Ga0070713_100005399 3300005436 Bacteria 8731
105 Ga0070713_100007877 3300005436 Bacteria 7516
106 Ga0070713_100027293 3300005436 Bacteria 4493
107 Ga0070713_100040711 3300005436 Bacteria 3779
108 Ga0070713_100077093 3300005436 Bacteria 2833
109 Ga0070713_100146693 3300005436 Bacteria 2095
110 Ga0070713_100165640 3300005436 Bacteria 1976
111 Ga0070713_100220874 3300005436 Bacteria 1719
112 Ga0070713_100256001 3300005436 Bacteria 1598
113 Ga0070713_100317214 3300005436 Bacteria 1439
114 Ga0070713_100355641 3300005436 Bacteria 1360
115 Ga0070713_100390336 3300005436 Bacteria 1298
116 Ga0070713_100482589 3300005436 Bacteria 1168
117 Ga0070713_100543846 3300005436 Bacteria 1099
118 Ga0070710_10000598 3300005437 Bacteria 17193
119 Ga0070710_10011509 3300005437 Bacteria 4371
120 Ga0070710_10049192 3300005437 Bacteria 2358
121 Ga0070710_10090705 3300005437 Bacteria 1802
122 Ga0070711_100000329 3300005439 Bacteria 24414
123 Ga0070711_100000531 3300005439 Bacteria 19818
124 Ga0070711_100016610 3300005439 Bacteria 4674
125 Ga0070711_100111794 3300005439 Bacteria 2006
126 Ga0070711_100255574 3300005439 Bacteria 1376
127 Ga0070711_100276683 3300005439 Bacteria 1326
128 Ga0070711_100283514 3300005439 Bacteria 1312
129 Ga0070711_100315371 3300005439 Bacteria 1247
130 Ga0070711_100405217 3300005439 Bacteria 1108
131 Ga0070700_100049751 3300005441 Unclassified 2603
132 Ga0070700_100135504 3300005441 Bacteria 1667
133 Ga0070708_100000137 3300005445 Bacteria 50233
134 Ga0070708_100026379 3300005445 Unclassified 4972
135 Ga0070708_100031260 3300005445 Bacteria 4608
136 Ga0070708_100044277 3300005445 Bacteria 3913
137 Ga0070708_100055157 3300005445 Bacteria 3533
138 Ga0070708_100088023 3300005445 Bacteria 2823
139 Ga0070708_100184144 3300005445 Bacteria 1953
140 Ga0070708_100209516 3300005445 Bacteria 1826
141 Ga0070708_100209983 3300005445 Bacteria 1824
142 Ga0070708_100331605 3300005445 Unclassified 1434
143 Ga0070663_100227315 3300005455 Bacteria 1468
144 Ga0070663_100276609 3300005455 Unclassified 1336
145 Ga0070678_100036353 3300005456 Bacteria 3447
146 Ga0070662_100001639 3300005457 Bacteria 13806
147 Ga0070662_100094574 3300005457 Bacteria 2250
148 Ga0070662_100166757 3300005457 Unclassified 1726
149 Ga0070681_10072329 3300005458 Bacteria 3411
150 Ga0070681_10105458 3300005458 Bacteria 2760
151 Ga0070681_10194820 3300005458 Bacteria 1946
152 Ga0070681_10259038 3300005458 Unclassified 1651
153 Ga0068867_100027614 3300005459 Bacteria 4081
154 Ga0070685_10001550 3300005466 Bacteria 12120
155 Ga0070706_100001270 3300005467 Bacteria 26946
156 Ga0070706_100003237 3300005467 Bacteria 16080
157 Ga0070706_100004092 3300005467 Bacteria 14183
158 Ga0070706_100016580 3300005467 Bacteria 6805
159 Ga0070706_100046278 3300005467 Bacteria 4017
160 Ga0070706_100395620 3300005467 Bacteria 1286
161 Ga0070707_100000651 3300005468 Bacteria 34704
162 Ga0070707_100084062 3300005468 Bacteria 3075
163 Ga0070707_100102607 3300005468 Bacteria 2771
164 Ga0070707_100118639 3300005468 Bacteria 2568
165 Ga0070707_100143024 3300005468 Bacteria 2328
166 Ga0070707_100197424 3300005468 Bacteria 1961
167 Ga0070707_100208746 3300005468 Unclassified 1904
168 Ga0070707_100399460 3300005468 Bacteria 1334
169 Ga0070698_100000902 3300005471 Bacteria 32626
170 Ga0070698_100269082 3300005471 Bacteria 1636
171 Ga0070699_100000439 3300005518 Bacteria 39981
172 Ga0070699_100033576 3300005518 Bacteria 4433
173 Ga0070699_100035250 3300005518 Bacteria 4325
174 Ga0070699_100111319 3300005518 Bacteria 2404
175 Ga0070699_100243814 3300005518 Bacteria 1605
176 Ga0070679_100006873 3300005530 Bacteria 10610
177 Ga0070679_100041877 3300005530 Bacteria 4559
178 Ga0070679_100574765 3300005530 Bacteria 1070
179 Ga0070684_100001425 3300005535 Bacteria 17223
180 Ga0070684_100013041 3300005535 Bacteria 6687
181 Ga0070684_100013231 3300005535 Bacteria 6646
182 Ga0070697_100000031 3300005536 Bacteria 110959
183 Ga0070697_100000265 3300005536 Bacteria 42493
184 Ga0070697_100006312 3300005536 Bacteria 9175
185 Ga0070697_100016810 3300005536 Bacteria 5754
186 Ga0070697_100037929 3300005536 Bacteria 3892
187 Ga0070697_100053398 3300005536 Bacteria 3284
188 Ga0070697_100053953 3300005536 Bacteria 3267
189 Ga0070697_100372830 3300005536 Bacteria 1235
190 Ga0068853_100043468 3300005539 Bacteria 3843
191 Ga0068853_100172173 3300005539 Bacteria 1959
192 Ga0068853_100261110 3300005539 Bacteria 1592
193 Ga0068853_100362457 3300005539 Bacteria 1350
194 Ga0070672_100000001 3300005543 Bacteria 204624
195 Ga0070672_100003522 3300005543 Bacteria 10146
196 Ga0070672_100058900 3300005543 Bacteria 3020
197 Ga0070686_100120705 3300005544 Bacteria 1799
198 Ga0070686_100128115 3300005544 Bacteria 1752
199 Ga0070686_100185767 3300005544 Bacteria 1480
200 Ga0070696_100107624 3300005546 Bacteria 2005
201 Ga0070696_100159704 3300005546 Bacteria 1660
202 Ga0070696_100389163 3300005546 Bacteria 1088
203 Ga0070665_100038334 3300005548 Bacteria 4818
204 Ga0070665_100132617 3300005548 Bacteria 2493
205 Ga0070665_100379245 3300005548 Unclassified 1421
206 Ga0070704_100321264 3300005549 Bacteria 1297
207 Ga0070704_100601639 3300005549 Bacteria 966
208 Ga0068855_100021308 3300005563 Bacteria 7772
209 Ga0068855_100022936 3300005563 Bacteria 7481
210 Ga0068855_100056535 3300005563 Bacteria 4604
211 Ga0068855_100297149 3300005563 Bacteria 1789
212 Ga0070664_100009088 3300005564 Bacteria 8065
213 Ga0070664_100619004 3300005564 Bacteria 1005
214 Ga0068857_100576830 3300005577 Bacteria 1061
215 Ga0068854_100093534 3300005578 Bacteria 2241
216 Ga0068854_100147591 3300005578 Bacteria 1811
217 Ga0068854_100185212 3300005578 Bacteria 1628
218 Ga0068856_100001651 3300005614 Bacteria 23387
219 Ga0068856_100006407 3300005614 Bacteria 11549
220 Ga0068856_100009226 3300005614 Bacteria 9593
221 Ga0068856_100066743 3300005614 Bacteria 3555
222 Ga0068856_100080518 3300005614 Bacteria 3230
223 Ga0068856_100097010 3300005614 Unclassified 2937
224 Ga0068856_100232394 3300005614 Bacteria 1859
225 Ga0068856_100678746 3300005614 Bacteria 1051
226 Ga0068856_100979569 3300005614 Bacteria 864
227 Ga0070702_100015282 3300005615 Bacteria 3917
228 Ga0070702_100334723 3300005615 Bacteria 1060
229 Ga0068852_100003785 3300005616 Bacteria 10607
230 Ga0068852_100007483 3300005616 Bacteria 7971
231 Ga0068852_100417196 3300005616 Bacteria 1323
232 Ga0068859_100002112 3300005617 Bacteria 20238
233 Ga0068859_100125511 3300005617 Bacteria 2635
234 Ga0068864_100048826 3300005618 Unclassified 3639
235 Ga0068864_100160340 3300005618 Bacteria 2044
236 Ga0068864_100214480 3300005618 Bacteria 1774
237 Ga0068866_10054809 3300005718 Bacteria 2045
238 Ga0068861_100054860 3300005719 Bacteria 3037
239 Ga0068861_100713501 3300005719 Bacteria 933
240 Ga0068851_10036662 3300005834 Bacteria 2456
241 Ga0068851_10113968 3300005834 Bacteria 1446
242 Ga0068870_10088609 3300005840 Bacteria 1725
243 Ga0068863_100022945 3300005841 Bacteria 5964
244 Ga0068863_100060590 3300005841 Bacteria 3579
245 Ga0068863_100076218 3300005841 Bacteria 3173
246 Ga0068863_100154139 3300005841 Bacteria 2199
247 Ga0068863_100403994 3300005841 Unclassified 1336
248 Ga0068858_100000871 3300005842 Bacteria 31216
249 Ga0068858_100065088 3300005842 Bacteria 3373
250 Ga0068858_100543497 3300005842 Bacteria 1124
251 Ga0068860_100000830 3300005843 Bacteria 34607
252 Ga0068860_100001349 3300005843 Bacteria 26682
253 Ga0068860_100198774 3300005843 Bacteria 1942
254 Ga0068860_100249569 3300005843 Bacteria 1728
255 Ga0068860_100502358 3300005843 Bacteria 1211
256 Ga0068860_100652223 3300005843 Bacteria 1060
257 Ga0068862_100021739 3300005844 Bacteria 5365
258 Ga0068862_100030172 3300005844 Bacteria 4569
259 Ga0068862_100078041 3300005844 Bacteria 2869
260 Ga0081455_10008262 3300005937 Bacteria 10853
261 Ga0081540_1024855 3300005983 Bacteria 3465
262 Ga0081539_10000233 3300005985 Bacteria 130647
263 Ga0070717_10003539 3300006028 Bacteria 11199
264 Ga0070717_10003613 3300006028 Bacteria 11088
265 Ga0070717_10007234 3300006028 Bacteria 8233
266 Ga0070717_10010660 3300006028 Bacteria 6948
267 Ga0070717_10021483 3300006028 Bacteria 5086
268 Ga0070717_10034270 3300006028 Unclassified 4103
269 Ga0070717_10040703 3300006028 Bacteria 3786
270 Ga0070717_10051701 3300006028 Bacteria 3383
271 Ga0070717_10080812 3300006028 Bacteria 2728
272 Ga0070717_10106609 3300006028 Bacteria 2386
273 Ga0070717_10120276 3300006028 Bacteria 2249
274 Ga0070717_10256065 3300006028 Bacteria 1547
275 Ga0070717_10580210 3300006028 Bacteria 1017
276 Ga0075365_10011855 3300006038 Bacteria 5145
277 Ga0070715_10051016 3300006163 Bacteria 1778
278 Ga0070715_10053810 3300006163 Bacteria 1741
279 Ga0070715_10103544 3300006163 Bacteria 1332
280 Ga0070716_100000682 3300006173 Bacteria 14524
281 Ga0070716_100004580 3300006173 Bacteria 6625
282 Ga0070716_100012268 3300006173 Bacteria 4340
283 Ga0070716_100017366 3300006173 Unclassified 3729
284 Ga0070716_100025229 3300006173 Bacteria 3170
285 Ga0070716_100188029 3300006173 Bacteria 1362
286 Ga0070716_100197545 3300006173 Bacteria 1334
287 Ga0070716_100249545 3300006173 Bacteria 1208
288 Ga0070716_100296467 3300006173 Bacteria 1123
289 Ga0070712_100000542 3300006175 Bacteria 21816
290 Ga0070712_100002276 3300006175 Bacteria 11821
291 Ga0070712_100008763 3300006175 Bacteria 6368
292 Ga0070712_100013608 3300006175 Bacteria 5202
293 Ga0070712_100015048 3300006175 Bacteria 4974
294 Ga0070712_100021048 3300006175 Bacteria 4277
295 Ga0070712_100024315 3300006175 Unclassified 4013
296 Ga0070712_100192763 3300006175 Bacteria 1596
297 Ga0070712_100470080 3300006175 Bacteria 1050
298 Ga0075369_10008398 3300006186 Bacteria 3970
299 Ga0075366_10001905 3300006195 Bacteria 10544
300 Ga0097621_100093431 3300006237 Bacteria 2521
301 Ga0097621_100641226 3300006237 Bacteria 974
302 Ga0068871_100038979 3300006358 Bacteria 3799
303 Ga0068871_100435399 3300006358 Bacteria 1173
304 Ga0075430_100001163 3300006846 Bacteria 21045
305 Ga0075430_100098606 3300006846 Unclassified 2441
306 Ga0075431_100004149 3300006847 Bacteria 14151
307 Ga0075431_100127579 3300006847 Bacteria 2625
308 Ga0075433_10002861 3300006852 Bacteria 13223
309 Ga0075433_10014138 3300006852 Bacteria 6512
310 Ga0075433_10029132 3300006852 Bacteria 4701
311 Ga0075433_10053371 3300006852 Bacteria 3524
312 Ga0075433_10451889 3300006852 Bacteria 1133
313 Ga0075434_100000195 3300006871 Bacteria 40479
314 Ga0075434_100000895 3300006871 Bacteria 23884
315 Ga0075434_100013552 3300006871 Bacteria 7765
316 Ga0075434_100098424 3300006871 Bacteria 2930
317 Ga0075434_100102473 3300006871 Bacteria 2870
318 Ga0075434_100151150 3300006871 Bacteria 2342
319 Ga0075434_100382916 3300006871 Bacteria 1427
320 Ga0075434_100450425 3300006871 Bacteria 1308
321 Ga0068865_100014673 3300006881 Bacteria 4984
322 Ga0075436_100001331 3300006914 Bacteria 16801
323 Ga0075436_100008675 3300006914 Bacteria 6947
324 Ga0075436_100020426 3300006914 Bacteria 4546
325 Ga0075436_100020921 3300006914 Bacteria 4487
326 Ga0075436_100032955 3300006914 Bacteria 3569
327 Ga0075436_100074720 3300006914 Bacteria 2346
328 Ga0075436_100298156 3300006914 Bacteria 1155
329 Ga0097620_100002112 3300006931 Bacteria 20238
330 Ga0097620_100125518 3300006931 Bacteria 2635
331 Ga0075435_100000065 3300007076 Bacteria 54666
332 Ga0075435_100006798 3300007076 Bacteria 8116
333 Ga0075435_100020039 3300007076 Bacteria 5115
334 Ga0075435_100027951 3300007076 Bacteria 4418
335 Ga0075435_100059868 3300007076 Bacteria 3087
336 Ga0075435_100118493 3300007076 Bacteria 2207
337 Ga0075435_100233540 3300007076 Bacteria 1563
338 Ga0099794_10000092 3300007265 Bacteria 33008
339 Ga0099794_10001902 3300007265 Bacteria 7487
340 Ga0099794_10011947 3300007265 Bacteria 3732
341 Ga0099794_10012750 3300007265 Bacteria 3639
342 Ga0099794_10096956 3300007265 Bacteria 1468
343 Ga0099795_10059480 3300007788 Unclassified 1414
344 Ga0105251_10035508 3300009011 Bacteria 2459
345 Ga0105240_10000005 3300009093 Bacteria 702630
346 Ga0105240_10138314 3300009093 Bacteria 2914
347 Ga0105240_10243353 3300009093 Bacteria 2084
348 Ga0105240_10583120 3300009093 Bacteria 1233
349 Ga0105240_10807754 3300009093 Bacteria 1015
350 Ga0105240_10860192 3300009093 Bacteria 978
351 Ga0111539_10510630 3300009094 Bacteria 1400
352 Ga0105247_10007660 3300009101 Bacteria 6608
353 Ga0105247_10286033 3300009101 Bacteria 1139
354 Ga0114129_10006586 3300009147 Bacteria 16490
355 Ga0114129_10036391 3300009147 Bacteria 6952
356 Ga0114129_10084537 3300009147 Bacteria 4405
357 Ga0114129_10124086 3300009147 Bacteria 3552
358 Ga0114129_10238217 3300009147 Bacteria 2447
359 Ga0105243_10089358 3300009148 Bacteria 2532
360 Ga0105241_10027728 3300009174 Bacteria 4217
361 Ga0105241_10031153 3300009174 Bacteria 3992
362 Ga0105241_10176339 3300009174 Bacteria 1769
363 Ga0105241_10212839 3300009174 Bacteria 1620
364 Ga0105241_10303268 3300009174 Bacteria 1371
365 Ga0105241_10443124 3300009174 Bacteria 1147
366 Ga0105242_10052001 3300009176 Bacteria 3341
367 Ga0105248_10001890 3300009177 Bacteria 23227
368 Ga0105248_10045188 3300009177 Bacteria 4939
369 Ga0105248_10136773 3300009177 Bacteria 2764
370 Ga0105248_10226466 3300009177 Bacteria 2104
371 Ga0105248_10686222 3300009177 Bacteria 1155
372 Ga0105237_10006938 3300009545 Bacteria 12485
373 Ga0105237_10064347 3300009545 Bacteria 3664
374 Ga0105237_10084099 3300009545 Bacteria 3173
375 Ga0105237_10152615 3300009545 Bacteria 2306
376 Ga0105237_10339311 3300009545 Bacteria 1507
377 Ga0105238_10018247 3300009551 Bacteria 7136
378 Ga0105238_10052374 3300009551 Bacteria 4103
379 Ga0105249_10018692 3300009553 Bacteria 6173
380 Ga0105249_10027986 3300009553 Bacteria 5088
381 Ga0105249_10151312 3300009553 Bacteria 2234
382 Ga0105239_10031532 3300010375 Bacteria 5828
383 Ga0105239_10566828 3300010375 Bacteria 1294
384 Ga0105239_11255413 3300010375 Bacteria 854
385 Ga0105246_10004331 3300011119 Bacteria 8633
386 Ga0105246_10120475 3300011119 Bacteria 1943
387 Ga0157373_10005392 3300013100 Bacteria 9605
388 Ga0157373_10150939 3300013100 Bacteria 1634
389 Ga0157373_10508049 3300013100 Unclassified 871
390 Ga0157373_10522060 3300013100 Bacteria 859
391 Ga0157371_10012541 3300013102 Bacteria 6473
392 Ga0157370_10063658 3300013104 Bacteria 3493
393 Ga0157369_10019476 3300013105 Bacteria 7592
394 Ga0157369_10031551 3300013105 Bacteria 5834
395 Ga0157369_10088555 3300013105 Bacteria 3304
396 Ga0157369_10119503 3300013105 Bacteria 2797
397 Ga0157369_10281269 3300013105 Bacteria 1733
398 Ga0157374_10032515 3300013296 Bacteria 4751
399 Ga0157374_10122109 3300013296 Bacteria 2515
400 Ga0157374_10122928 3300013296 Bacteria 2507
401 Ga0157374_10132304 3300013296 Bacteria 2415
402 Ga0157374_10235467 3300013296 Bacteria 1799
403 Ga0157374_10242479 3300013296 Bacteria 1772
404 Ga0157378_10060322 3300013297 Bacteria 3385
405 Ga0157378_10499318 3300013297 Bacteria 1215
406 Ga0163162_10001058 3300013306 Bacteria 25595
407 Ga0163162_10062073 3300013306 Bacteria 3777
408 Ga0163162_10079760 3300013306 Bacteria 3340
409 Ga0163162_10083112 3300013306 Bacteria 3275
410 Ga0157372_10020581 3300013307 Bacteria 7121
411 Ga0157372_10023668 3300013307 Bacteria 6663
412 Ga0157372_10081819 3300013307 Bacteria 3655
413 Ga0157372_10190156 3300013307 Bacteria 2378
414 Ga0157372_10197800 3300013307 Bacteria 2328
415 Ga0157375_10004658 3300013308 Bacteria 11925
416 Ga0157375_10019511 3300013308 Bacteria 6168
417 Ga0157375_10244236 3300013308 Bacteria 1955
418 Ga0157375_10964237 3300013308 Bacteria 994
419 Ga0163163_10065182 3300014325 Bacteria 3615
420 Ga0163163_10106923 3300014325 Bacteria 2824
421 Ga0157380_10021711 3300014326 Bacteria 4819
422 Ga0157380_10531954 3300014326 Bacteria 1149
423 Ga0182008_10096120 3300014497 Unclassified 1462
424 Ga0157377_10118034 3300014745 Bacteria 1604
425 Ga0157379_10004276 3300014968 Bacteria 12196
426 Ga0157379_10009361 3300014968 Bacteria 8535
427 Ga0157376_10108440 3300014969 Bacteria 2439
428 Ga0157376_10163450 3300014969 Bacteria 2020
429 Ga0182006_1026090 3300015261 Bacteria 2395
430 Ga0182007_10008105 3300015262 Bacteria 4337
431 Ga0182007_10009986 3300015262 Unclassified 3781
432 Ga0182007_10010012 3300015262 Bacteria 3775
433 Ga0163161_10159673 3300017792 Unclassified 1719
434 Ga0163161_10469336 3300017792 Bacteria 1020
435 Ga0213872_10005572 3300021361 Bacteria 6437
436 Ga0213872_10136821 3300021361 Bacteria 1076
437 Ga0213874_10003840 3300021377 Bacteria 3376
438 Ga0213875_10164406 3300021388 Bacteria 1041
439 Ga0228598_1005430 3300024227 Unclassified 2664
440 Ga0209435_100081 3300025206 Bacteria 47006
441 Ga0209760_104944 3300025207 Bacteria 1119
442 Ga0209563_103575 3300025230 Bacteria 3174
443 Ga0209437_100153 3300025233 Bacteria 154068
444 Ga0209437_100201 3300025233 Bacteria 119080
445 Ga0209646_1000064 3300025246 Bacteria 246524
446 Ga0209646_1008468 3300025246 Bacteria 1652
447 Ga0209026_1000053 3300025250 Bacteria 246524
448 Ga0209677_100466 3300025253 Bacteria 23292
449 Ga0209677_101561 3300025253 Bacteria 9747
450 Ga0209759_1000042 3300025256 Bacteria 246524
451 Ga0209233_1000175 3300025261 Bacteria 144221
452 Ga0209233_1000226 3300025261 Bacteria 103045
453 Ga0209233_1000338 3300025261 Bacteria 46030
454 Ga0209025_1000114 3300025294 Bacteria 218921
455 Ga0209025_1000584 3300025294 Bacteria 66147
456 Ga0209758_1005459 3300025297 Bacteria 9774
457 Ga0207697_10010855 3300025315 Unclassified 3876
458 Ga0207656_10088770 3300025321 Bacteria 1400
459 Ga0207682_10010502 3300025893 Bacteria 3629
460 Ga0207682_10036606 3300025893 Bacteria 1986
461 Ga0207692_10036401 3300025898 Bacteria 2399
462 Ga0207692_10246345 3300025898 Bacteria 1069
463 Ga0207692_10339026 3300025898 Unclassified 924
464 Ga0207642_10013339 3300025899 Bacteria 2997
465 Ga0207710_10127902 3300025900 Bacteria 1218
466 Ga0207688_10005078 3300025901 Bacteria 7158
467 Ga0207680_10000344 3300025903 Bacteria 22220
468 Ga0207680_10049190 3300025903 Unclassified 2508
469 Ga0207647_10021795 3300025904 Bacteria 4268
470 Ga0207685_10008371 3300025905 Bacteria 2942
471 Ga0207699_10000491 3300025906 Bacteria 19853
472 Ga0207699_10009842 3300025906 Bacteria 4777
473 Ga0207699_10015899 3300025906 Bacteria 3923
474 Ga0207699_10035151 3300025906 Bacteria 2849
475 Ga0207699_10069024 3300025906 Bacteria 2153
476 Ga0207699_10089842 3300025906 Bacteria 1926
477 Ga0207699_10148203 3300025906 Bacteria 1549
478 Ga0207699_10178003 3300025906 Bacteria 1428
479 Ga0207699_10226216 3300025906 Bacteria 1279
480 Ga0207645_10005119 3300025907 Bacteria 9591
481 Ga0207645_10009704 3300025907 Bacteria 6651
482 Ga0207643_10000133 3300025908 Bacteria 50506
483 Ga0207705_10294393 3300025909 Unclassified 1244
484 Ga0207705_10465892 3300025909 Bacteria 980
485 Ga0207684_10000705 3300025910 Bacteria 39440
486 Ga0207684_10000811 3300025910 Bacteria 36097
487 Ga0207684_10002252 3300025910 Bacteria 19648
488 Ga0207684_10037395 3300025910 Bacteria 4119
489 Ga0207684_10095761 3300025910 Bacteria 2533
490 Ga0207684_10282362 3300025910 Bacteria 1432
491 Ga0207654_10001902 3300025911 Bacteria 10835
492 Ga0207654_10002085 3300025911 Bacteria 10239
493 Ga0207654_10161255 3300025911 Bacteria 1449
494 Ga0207654_10172944 3300025911 Bacteria 1404
495 Ga0207707_10006740 3300025912 Bacteria 10028
496 Ga0207707_10020123 3300025912 Bacteria 5825
497 Ga0207707_10028403 3300025912 Unclassified 4890
498 Ga0207707_10094171 3300025912 Bacteria 2617
499 Ga0207695_10000011 3300025913 Bacteria 910221
500 Ga0207695_10006005 3300025913 Bacteria 15875
501 Ga0207695_10340107 3300025913 Bacteria 1388
502 Ga0207671_10001611 3300025914 Bacteria 25670
503 Ga0207693_10000031 3300025915 Bacteria 117500
504 Ga0207693_10001029 3300025915 Bacteria 24949
505 Ga0207693_10002423 3300025915 Bacteria 16201
506 Ga0207693_10010541 3300025915 Bacteria 7501
507 Ga0207693_10013900 3300025915 Bacteria 6483
508 Ga0207693_10014377 3300025915 Bacteria 6366
509 Ga0207693_10017024 3300025915 Bacteria 5804
510 Ga0207693_10050827 3300025915 Bacteria 3254
511 Ga0207693_10055443 3300025915 Bacteria 3110
512 Ga0207693_10136756 3300025915 Bacteria 1927
513 Ga0207693_10291916 3300025915 Unclassified 1278
514 Ga0207663_10001507 3300025916 Bacteria 10874
515 Ga0207663_10003723 3300025916 Bacteria 7510
516 Ga0207663_10017716 3300025916 Unclassified 3976
517 Ga0207663_10034816 3300025916 Bacteria 3015
518 Ga0207663_10235305 3300025916 Bacteria 1340
519 Ga0207663_10238573 3300025916 Bacteria 1332
520 Ga0207663_10372323 3300025916 Bacteria 1086
521 Ga0207660_10216404 3300025917 Bacteria 1502
522 Ga0207662_10436054 3300025918 Bacteria 894
523 Ga0207657_10001503 3300025919 Bacteria 24928
524 Ga0207657_10001593 3300025919 Bacteria 24379
525 Ga0207657_10021527 3300025919 Bacteria 6063
526 Ga0207649_10000241 3300025920 Bacteria 44222
527 Ga0207652_10004952 3300025921 Bacteria 10786
528 Ga0207652_10289070 3300025921 Bacteria 1479
529 Ga0207652_10298619 3300025921 Bacteria 1454
530 Ga0207646_10000494 3300025922 Bacteria 52791
531 Ga0207646_10119073 3300025922 Bacteria 2372
532 Ga0207646_10121366 3300025922 Bacteria 2348
533 Ga0207646_10168304 3300025922 Unclassified 1979
534 Ga0207646_10178522 3300025922 Bacteria 1918
535 Ga0207646_10255306 3300025922 Bacteria 1584
536 Ga0207646_10443792 3300025922 Bacteria 1171
537 Ga0207681_10023821 3300025923 Bacteria 3921
538 Ga0207681_10059437 3300025923 Bacteria 2620
539 Ga0207681_10326180 3300025923 Bacteria 1222
540 Ga0207694_10039331 3300025924 Bacteria 3640
541 Ga0207650_10000124 3300025925 Bacteria 97031
542 Ga0207650_10011152 3300025925 Bacteria 6181
543 Ga0207650_10162216 3300025925 Bacteria 1772
544 Ga0207659_10050339 3300025926 Bacteria 2959
545 Ga0207659_10053620 3300025926 Bacteria 2877
546 Ga0207659_10205892 3300025926 Bacteria 1574
547 Ga0207687_10008822 3300025927 Bacteria 6591
548 Ga0207687_10474328 3300025927 Bacteria 1041
549 Ga0207700_10000160 3300025928 Bacteria 40173
550 Ga0207700_10006581 3300025928 Bacteria 7036
551 Ga0207700_10067821 3300025928 Bacteria 2732
552 Ga0207700_10087124 3300025928 Bacteria 2455
553 Ga0207700_10193770 3300025928 Bacteria 1709
554 Ga0207700_10249664 3300025928 Bacteria 1515
555 Ga0207700_10357839 3300025928 Bacteria 1272
556 Ga0207700_10395686 3300025928 Bacteria 1210
557 Ga0207700_10588055 3300025928 Bacteria 990
558 Ga0207664_10000582 3300025929 Bacteria 25512
559 Ga0207664_10004389 3300025929 Bacteria 9553
560 Ga0207664_10027352 3300025929 Bacteria 4322
561 Ga0207664_10035543 3300025929 Bacteria 3845
562 Ga0207664_10057057 3300025929 Bacteria 3103
563 Ga0207664_10374547 3300025929 Bacteria 1263
564 Ga0207644_10044710 3300025931 Bacteria 3147
565 Ga0207644_10389227 3300025931 Bacteria 1138
566 Ga0207690_10121152 3300025932 Bacteria 1900
567 Ga0207690_10244583 3300025932 Bacteria 1383
568 Ga0207706_10000389 3300025933 Bacteria 47573
569 Ga0207706_10006249 3300025933 Bacteria 11073
570 Ga0207706_10056596 3300025933 Bacteria 3457
571 Ga0207706_10084594 3300025933 Bacteria 2789
572 Ga0207686_10208872 3300025934 Bacteria 1402
573 Ga0207686_10356082 3300025934 Bacteria 1103
574 Ga0207670_10005533 3300025936 Bacteria 6943
575 Ga0207704_10127658 3300025938 Unclassified 1754
576 Ga0207704_10226491 3300025938 Bacteria 1387
577 Ga0207704_10271717 3300025938 Bacteria 1284
578 Ga0207665_10000147 3300025939 Bacteria 47628
579 Ga0207665_10002765 3300025939 Bacteria 11758
580 Ga0207665_10004252 3300025939 Bacteria 9518
581 Ga0207665_10008366 3300025939 Bacteria 6827
582 Ga0207665_10011555 3300025939 Bacteria 5799
583 Ga0207665_10012474 3300025939 Bacteria 5581
584 Ga0207665_10017982 3300025939 Bacteria 4647
585 Ga0207665_10029677 3300025939 Bacteria 3614
586 Ga0207665_10038792 3300025939 Bacteria 3174
587 Ga0207665_10039492 3300025939 Bacteria 3147
588 Ga0207665_10135658 3300025939 Bacteria 1751
589 Ga0207665_10318637 3300025939 Bacteria 1166
590 Ga0207691_10000017 3300025940 Bacteria 134441
591 Ga0207691_10000213 3300025940 Bacteria 56331
592 Ga0207691_10014715 3300025940 Bacteria 7457
593 Ga0207711_10000705 3300025941 Bacteria 32901
594 Ga0207711_10004244 3300025941 Bacteria 12262
595 Ga0207711_10011673 3300025941 Bacteria 7299
596 Ga0207689_10009150 3300025942 Bacteria 8573
597 Ga0207689_10021027 3300025942 Bacteria 5485
598 Ga0207661_10000198 3300025944 Bacteria 39018
599 Ga0207661_10001087 3300025944 Bacteria 18062
600 Ga0207661_10471549 3300025944 Unclassified 1145
601 Ga0207679_10000084 3300025945 Bacteria 82946
602 Ga0207679_10044853 3300025945 Bacteria 3193
603 Ga0207667_10100341 3300025949 Bacteria 2986
604 Ga0207667_10223710 3300025949 Bacteria 1928
605 Ga0207667_10314855 3300025949 Bacteria 1598
606 Ga0207651_10020546 3300025960 Unclassified 3988
607 Ga0207712_10009116 3300025961 Bacteria 6278
608 Ga0207712_10171355 3300025961 Unclassified 1697
609 Ga0207712_10387558 3300025961 Bacteria 1171
610 Ga0207668_10013144 3300025972 Bacteria 5087
611 Ga0207668_10107702 3300025972 Bacteria 2084
612 Ga0207640_10040102 3300025981 Bacteria 2968
613 Ga0207640_10044061 3300025981 Unclassified 2856
614 Ga0207640_10058900 3300025981 Bacteria 2532
615 Ga0207658_10007461 3300025986 Bacteria 7451
616 Ga0207658_10014114 3300025986 Bacteria 5471
617 Ga0207658_10089936 3300025986 Bacteria 2378
618 Ga0207658_10176560 3300025986 Bacteria 1764
619 Ga0207658_10280359 3300025986 Bacteria 1428
620 Ga0207677_10001778 3300026023 Bacteria 11377
621 Ga0207677_10016289 3300026023 Bacteria 4397
622 Ga0207677_10057466 3300026023 Bacteria 2672
623 Ga0207677_10095865 3300026023 Unclassified 2169
624 Ga0207703_10000673 3300026035 Bacteria 34088
625 Ga0207703_10482966 3300026035 Bacteria 1161
626 Ga0207639_10023827 3300026041 Bacteria 4423
627 Ga0207639_10053456 3300026041 Unclassified 3082
628 Ga0207639_10080007 3300026041 Bacteria 2584
629 Ga0207678_10000070 3300026067 Bacteria 81153
630 Ga0207678_10001143 3300026067 Bacteria 24340
631 Ga0207678_10024694 3300026067 Bacteria 5248
632 Ga0207708_10145604 3300026075 Bacteria 1861
633 Ga0207702_10007863 3300026078 Bacteria 9043
634 Ga0207702_10008415 3300026078 Bacteria 8703
635 Ga0207702_10027557 3300026078 Unclassified 4718
636 Ga0207702_10121087 3300026078 Bacteria 2342
637 Ga0207702_10125321 3300026078 Bacteria 2305
638 Ga0207702_10199287 3300026078 Bacteria 1855
639 Ga0207702_10270880 3300026078 Bacteria 1601
640 Ga0207641_10000006 3300026088 Bacteria 442569
641 Ga0207641_10004604 3300026088 Bacteria 11905
642 Ga0207641_10018783 3300026088 Bacteria 5669
643 Ga0207641_10139177 3300026088 Bacteria 2188
644 Ga0207641_10404557 3300026088 Bacteria 1311
645 Ga0207641_10524620 3300026088 Bacteria 1152
646 Ga0207648_10001425 3300026089 Bacteria 26347
647 Ga0207648_10074073 3300026089 Bacteria 2967
648 Ga0207676_10000132 3300026095 Bacteria 65936
649 Ga0207676_10046818 3300026095 Bacteria 3349
650 Ga0207676_10105299 3300026095 Bacteria 2348
651 Ga0207676_10283814 3300026095 Bacteria 1504
652 Ga0207674_10000556 3300026116 Bacteria 48859
653 Ga0207674_10550022 3300026116 Bacteria 1115
654 Ga0207675_100033172 3300026118 Bacteria 4811
655 Ga0207683_10003539 3300026121 Bacteria 13622
656 Ga0207683_10007717 3300026121 Bacteria 9215
657 Ga0207683_10011590 3300026121 Bacteria 7527
658 Ga0207683_10051234 3300026121 Bacteria 3617
659 Ga0207698_10019763 3300026142 Bacteria 4619
660 Ga0207698_10035942 3300026142 Bacteria 3630
661 Ga0209371_1001781 3300027312 Bacteria 13501
662 Ga0209588_1000010 3300027671 Bacteria 159025
663 Ga0209588_1021776 3300027671 Bacteria 2015
664 Ga0268266_10015405 3300028379 Bacteria 6561
665 Ga0268266_10067760 3300028379 Unclassified 3089
666 Ga0268266_10160624 3300028379 Bacteria 2032
667 Ga0268266_10222368 3300028379 Bacteria 1736
668 Ga0268265_10031603 3300028380 Bacteria 3824
669 Ga0268265_10147477 3300028380 Bacteria 1979
670 Ga0268264_10000961 3300028381 Bacteria 29616
671 Ga0268264_10001110 3300028381 Bacteria 26593
672 Ga0268264_10156513 3300028381 Bacteria 2048
673 Ga0268264_10165507 3300028381 Bacteria 1996
674 Ga0268264_10174366 3300028381 Bacteria 1948
675 Ga0307515_10000430 3300028794 Bacteria 101168
676 Ga0307515_10375211 3300028794 Bacteria 1057
677 Ga0265338_10070465 3300028800 Bacteria 2997
678 Ga0265338_10124129 3300028800 Bacteria 2052
679 Ga0268256_1002627 3300030500 Bacteria 8929
680 Ga0265760_10002364 3300031090 Bacteria 5521
681 Ga0265760_10002577 3300031090 Bacteria 5296
682 Ga0265760_10002948 3300031090 Unclassified 4976
683 Ga0265330_10006773 3300031235 Bacteria 5649
684 Ga0265332_10000461 3300031238 Bacteria 28375
685 Ga0265332_10048021 3300031238 Bacteria 1837
686 Ga0265332_10181220 3300031238 Bacteria 877
687 Ga0265328_10001159 3300031239 Bacteria 12154
688 Ga0265320_10027714 3300031240 Bacteria 2950
689 Ga0265325_10036615 3300031241 Bacteria 2598
690 Ga0265329_10011737 3300031242 Bacteria 3175
691 Ga0265340_10106548 3300031247 Bacteria 1299
692 Ga0265339_10003817 3300031249 Bacteria 10475
693 Ga0265339_10051345 3300031249 Bacteria 2250
694 Ga0265339_10061053 3300031249 Bacteria 2030
695 Ga0265339_10114812 3300031249 Bacteria 1390
696 Ga0265331_10000338 3300031250 Bacteria 50018
697 Ga0265331_10000456 3300031250 Bacteria 39566
698 Ga0265331_10057054 3300031250 Bacteria 1853
699 Ga0265327_10000142 3300031251 Bacteria 157436
700 Ga0265316_10000114 3300031344 Bacteria 87072
701 Ga0265316_10002182 3300031344 Bacteria 20560
702 Ga0265316_10039168 3300031344 Bacteria 3809
703 Ga0265316_10048330 3300031344 Bacteria 3359
704 Ga0265313_10000602 3300031595 Bacteria 37380
705 Ga0316579_10000702 3300031691 Bacteria 11412
706 Ga0316579_10066479 3300031691 Bacteria 1702
707 Ga0265314_10001296 3300031711 Bacteria 28340
708 Ga0265314_10018463 3300031711 Bacteria 5435
709 Ga0265314_10049506 3300031711 Bacteria 2941
710 Ga0265342_10007181 3300031712 Bacteria 8194
711 Ga0265342_10028000 3300031712 Bacteria 3515
712 Ga0265342_10043578 3300031712 Bacteria 2707
713 Ga0316576_10119520 3300031727 Bacteria 1978
714 Ga0316578_10161826 3300031728 Bacteria 1349
715 Ga0307516_10000893 3300031730 Bacteria 41107
716 Ga0307405_10071329 3300031731 Bacteria 2235
717 Ga0316577_10001728 3300031733 Bacteria 10489
718 Ga0316577_10006839 3300031733 Bacteria 6055
719 Ga0316577_10022645 3300031733 Unclassified 3489
720 Ga0307413_10255092 3300031824 Bacteria 1304
721 Ga0307412_10086099 3300031911 Bacteria 2186
722 Ga0307411_10595196 3300032005 Bacteria 950
723 Ga0307415_100001316 3300032126 Bacteria 11754
724 Ga0373930_0003776 3300034816 Bacteria 2428
725 Ga0373926_0005579 3300035083 Bacteria 4152
726 Ga0373934_0030979 3300035086 Bacteria 2093
727 Ga0373923_0034729 3300035111 Bacteria 2048
728 Ga0373923_0060878 3300035111 Bacteria 1603
729 Ga0373936_0014811 3300035113 Bacteria 2985
730 Ga0373936_0014899 3300035113 Bacteria 2976
731 Ga0373936_0120598 3300035113 Unclassified 1120
732 Ga0373953_0019557 3300035117 Bacteria 2521
733 Ga0373954_0000068 3300035118 Bacteria 37051
734 Ga0373954_0008040 3300035118 Bacteria 4622
735 Ga0373954_0123591 3300035118 Bacteria 1257
736 Ga0373954_0136517 3300035118 Unclassified 1195
737 Ga0373956_0053699 3300035119 Bacteria 1814
738 Ga0373956_0068385 3300035119 Bacteria 1618
739 Ga0373956_0165607 3300035119 Unclassified 1042
740 Ga0373957_0101465 3300035120 Bacteria 1152
741 Ga0373960_0003207 3300035121 Bacteria 3700
742 Ga0373943_0010746 3300035170 Bacteria 4108
743 Ga0373943_0013170 3300035170 Bacteria 3732
744 Ga0373943_0244993 3300035170 Bacteria 1005
745 Ga0373955_0033114 3300035172 Bacteria 2719
746 Ga0373955_0094000 3300035172 Bacteria 1712
747 Ga0373955_0243057 3300035172 Bacteria 1078
748 Ga0373961_0027507 3300035241 Bacteria 1562
749 Ga0373924_0023281 3300035410 Bacteria 2428
750 Ga0373924_0041818 3300035410 Unclassified 1879
751 Ga0373935_0006013 3300035692 Bacteria 7207
752 Ga0373935_0008252 3300035692 Bacteria 6234
753 Ga0373935_0041406 3300035692 Bacteria 2893
754 Ga0373935_0112949 3300035692 Bacteria 1805
755 Ga0373935_0123056 3300035692 Bacteria 1735
756 Ga0373935_0173506 3300035692 Bacteria 1476
757 Ga0373935_0350778 3300035692 Bacteria 1052
758 Ga0373927_0000292 3300035695 Bacteria 39594
759 Ga0373927_0005421 3300035695 Bacteria 8803
760 Ga0373927_0006347 3300035695 Bacteria 8055
761 Ga0373927_0067243 3300035695 Bacteria 2319
762 Ga0373927_0200475 3300035695 Bacteria 1310
763 Ga0373927_0214835 3300035695 Bacteria 1263
764 Ga0373933_0007750 3300035724 Bacteria 5866
765 Ga0373933_0025679 3300035724 Bacteria 3379
766 Ga0373933_0081545 3300035724 Bacteria 1985
767 Ga0373933_0088049 3300035724 Bacteria 1913
768 Ga0373933_0280927 3300035724 Bacteria 1076
769 Ga0373947_0013313 3300035725 Bacteria 4712
770 Ga0373947_0025848 3300035725 Bacteria 3425
771 Ga0373947_0027705 3300035725 Bacteria 3317
772 Ga0373947_0066989 3300035725 Bacteria 2192
773 Ga0373947_0073371 3300035725 Bacteria 2103
774 Ga0373947_0174412 3300035725 Bacteria 1397
775 Ga0373947_0305377 3300035725 Bacteria 1062
776 Ga0373937_0002051 3300036401 Bacteria 16843
777 Ga0373937_0040546 3300036401 Bacteria 4244
778 Ga0373937_0055834 3300036401 Bacteria 3626
779 Ga0373937_0103447 3300036401 Bacteria 2645
780 Ga0373937_0135416 3300036401 Bacteria 2303
781 Ga0373937_0145489 3300036401 Bacteria 2218
782 Ga0373937_0197589 3300036401 Bacteria 1890
783 Ga0373937_0252619 3300036401 Bacteria 1662
784 Ga0373937_0346995 3300036401 Bacteria 1406
785 Ga0316582_0018427 3300036647 Bacteria 4064
786 Ga0316582_0019518 3300036647 Unclassified 3970
787 Ga0373925_0001535 3300037068 Bacteria 19685
788 Ga0373925_0003786 3300037068 Bacteria 11630
789 Ga0373925_0003912 3300037068 Bacteria 11377
790 Ga0373925_0049902 3300037068 Bacteria 3120
791 Ga0373925_0320473 3300037068 Bacteria 1254
792 Ga0395899_0058084 3300037312 Bacteria 2854
793 Ga0316581_0006450 3300037588 Bacteria 3108
794 Ga0436364_0156979 3300037853 Bacteria 2970
795 Ga0436365_1169174 3300039437 Unclassified 1985
796 Ga0436360_0441910 3300039438 Unclassified 1184
797 Ga0436360_0649865 3300039438 Bacteria 1383
798 Ga0436361_0036310 3300039447 Bacteria 1185
799 Ga0436361_0152072 3300039447 Bacteria 8122
800 Ga0436361_0547921 3300039447 Bacteria 2139
801 Ga0436361_0670591 3300039447 Bacteria 2327
802 Ga0436361_0941307 3300039447 Bacteria 3289
803 Ga0436361_1133747 3300039447 Bacteria 1456
804 Ga0436363_0557136 3300039450 Bacteria 4864
805 Ga0436362_0062315 3300039453 Bacteria 2682
806 Ga0436362_0519918 3300039453 Unclassified 2462
807 Ga0451577_0321239 3300042876 Bacteria 1404
808 Ga0466972_0060701 3300044658 Unclassified 1814
809 Ga0466964_0027812 3300044706 Bacteria 2223
810 Ga0466970_0014364 3300044765 Bacteria 4065
811 Ga0466957_0052745 3300044842 Bacteria 2477
812 Ga0466957_0184227 3300044842 Bacteria 1365
813 Ga0466959_0302525 3300045049 Bacteria 1095
814 Ga0466967_0664403 3300045976 Bacteria 1031
815 Ga0466967_0693613 3300045976 Bacteria 1008
816 Ga0495592_0091627 3300046454 Bacteria 2180
817 Ga0495603_0149529 3300046455 Bacteria 1357
818 Ga0495629_0000003 3300046459 Bacteria 529162
819 Ga0495629_0018758 3300046459 Bacteria 4945
820 Ga0495638_0092475 3300046460 Bacteria 1820
821 Ga0495653_0102841 3300046463 Bacteria 2067
822 Ga0495580_0000019 3300046472 Bacteria 91862
823 Ga0495580_0000340 3300046472 Bacteria 38108
824 Ga0495580_0000509 3300046472 Bacteria 32716
825 Ga0495580_0004340 3300046472 Bacteria 11903
826 Ga0495580_0004560 3300046472 Bacteria 11632
827 Ga0495580_0004756 3300046472 Bacteria 11361
828 Ga0495580_0007064 3300046472 Bacteria 9049
829 Ga0495580_0008423 3300046472 Bacteria 8203
830 Ga0495580_0010728 3300046472 Bacteria 7115
831 Ga0495580_0011550 3300046472 Bacteria 6831
832 Ga0495580_0055636 3300046472 Unclassified 2787
833 Ga0495580_0062262 3300046472 Bacteria 2618
834 Ga0495580_0070283 3300046472 Bacteria 2446
835 Ga0495580_0078997 3300046472 Bacteria 2295
836 Ga0495580_0115601 3300046472 Bacteria 1864
837 Ga0495580_0137972 3300046472 Bacteria 1691
838 Ga0495580_0164902 3300046472 Bacteria 1533
839 Ga0495580_0197046 3300046472 Bacteria 1388
840 Ga0495582_0000266 3300046473 Bacteria 29128
841 Ga0495582_0000351 3300046473 Bacteria 25199
842 Ga0495582_0038669 3300046473 Bacteria 2626
843 Ga0495582_0050416 3300046473 Bacteria 2294
844 Ga0495664_0157726 3300046477 Bacteria 1377
845 Ga0495584_0202099 3300046491 Bacteria 1010
846 Ga0495584_0210178 3300046491 Bacteria 989
847 Ga0495583_0000829 3300046506 Bacteria 37824
848 Ga0495606_0022376 3300046507 Bacteria 4607
849 Ga0495606_0028738 3300046507 Bacteria 3916
850 Ga0495606_0061181 3300046507 Bacteria 2409
851 Ga0495606_0115209 3300046507 Bacteria 1616
852 Ga0495608_0006140 3300046511 Bacteria 8528
853 Ga0495608_0310167 3300046511 Unclassified 976
854 Ga0495628_0010012 3300046516 Bacteria 8066
855 Ga0495628_0031515 3300046516 Bacteria 4288
856 Ga0495628_0323798 3300046516 Bacteria 1137
857 Ga0495630_0150873 3300046517 Bacteria 1768
858 Ga0495630_0203065 3300046517 Unclassified 1512
859 Ga0495637_0122889 3300046520 Bacteria 997
860 Ga0495666_0110366 3300046526 Bacteria 1292
861 Ga0495665_0002327 3300046531 Bacteria 10265
862 Ga0495665_0019641 3300046531 Bacteria 3634
863 Ga0495665_0040453 3300046531 Bacteria 2482
864 Ga0495665_0121083 3300046531 Bacteria 1370
865 Ga0495665_0126419 3300046531 Bacteria 1339
866 Ga0495587_0027758 3300046536 Bacteria 3446
867 Ga0495621_0056373 3300046539 Bacteria 1417
868 Ga0495645_0143568 3300046543 Bacteria 1664
869 Ga0495622_0028573 3300046557 Bacteria 2604
870 Ga0495667_0000813 3300046559 Bacteria 20057
871 Ga0495667_0070872 3300046559 Unclassified 2274
872 Ga0495667_0139227 3300046559 Bacteria 1564
873 Ga0495668_0058971 3300046616 Bacteria 2118
874 Ga0495588_0000338 3300046674 Bacteria 30480
875 Ga0495657_0079415 3300046675 Bacteria 2125
876 Ga0495657_0270548 3300046675 Bacteria 1019
877 Ga0495623_0041908 3300046679 Bacteria 2918
878 Ga0495623_0195036 3300046679 Bacteria 1168
879 Ga0495646_0146940 3300046680 Bacteria 1314
880 Ga0495658_0051576 3300046683 Bacteria 2331
881 Ga0495658_0064388 3300046683 Bacteria 2112
882 Ga0495624_0038046 3300046690 Bacteria 3093
883 Ga0495670_0004091 3300046691 Bacteria 7154
884 Ga0495589_0043648 3300046794 Bacteria 2231
885 Ga0495600_0059594 3300046809 Bacteria 2493
886 Ga0495600_0185586 3300046809 Bacteria 1339
887 Ga0495660_0002852 3300046810 Bacteria 10868
888 Ga0495660_0238781 3300046810 Bacteria 848
889 Ga0495581_0049805 3300047315 Bacteria 2419
890 Ga0495604_0033033 3300047317 Bacteria 4097
891 Ga0495604_0153279 3300047317 Bacteria 1635
892 Ga0495604_0226427 3300047317 Bacteria 1285
893 Ga0495674_0089191 3300047319 Bacteria 2636
894 Ga0495674_0207714 3300047319 Bacteria 1623
895 Ga0495674_0409117 3300047319 Bacteria 1094
896 Ga0495672_0050211 3300047320 Bacteria 2464
897 Ga0495680_0257224 3300047322 Bacteria 1236
898 Ga0495675_0062390 3300047444 Bacteria 2360
899 Ga0495673_0085119 3300047469 Bacteria 1302
900 Ga0495684_0019408 3300047471 Bacteria 5234
901 Ga0495686_0000012 3300047472 Bacteria 508428
902 Ga0495686_0000112 3300047472 Bacteria 168354
903 Ga0495686_0000561 3300047472 Bacteria 52984
904 Ga0495686_0082839 3300047472 Bacteria 1957
905 Ga0495686_0123442 3300047472 Bacteria 1541
906 Ga0495686_0221817 3300047472 Bacteria 1075
907 Ga0495602_0024804 3300048088 Bacteria 5814
908 Ga0495602_0108905 3300048088 Bacteria 2255
909 Ga0495602_0355276 3300048088 Bacteria 1057
910 Ga0495602_0511616 3300048088 Bacteria 838
911 Ga0496100_0034546 3300048903 Bacteria 3174
912 Ga0496100_0266137 3300048903 Bacteria 1273
913 Ga0496100_0649764 3300048903 Bacteria 821
914 Ga0496101_0051018 3300048904 Bacteria 2980
915 Ga0496101_0067480 3300048904 Bacteria 2612
916 Ga0496101_0130976 3300048904 Bacteria 1905
917 Ga0496101_0290443 3300048904 Bacteria 1279
918 Ga0496102_0007981 3300048905 Bacteria 9045
919 Ga0496102_0016545 3300048905 Bacteria 6445
920 Ga0496102_0038103 3300048905 Bacteria 4337
921 Ga0496102_0038789 3300048905 Bacteria 4302
922 Ga0496102_0056758 3300048905 Unclassified 3573
923 Ga0496102_0769419 3300048905 Bacteria 885
924 Ga0496103_0003579 3300048906 Bacteria 9479
925 Ga0496103_0021242 3300048906 Bacteria 3905
926 Ga0496103_0062879 3300048906 Bacteria 2311
927 Ga0496103_0160846 3300048906 Bacteria 1440
928 Ga0496104_0054868 3300048907 Bacteria 3767
929 Ga0496104_0208837 3300048907 Bacteria 1864
930 Ga0496105_0083333 3300048908 Bacteria 2641
931 Ga0496105_0172295 3300048908 Bacteria 1774
932 Ga0496106_0000937 3300048909 Bacteria 21256
933 Ga0496106_0020771 3300048909 Bacteria 4873
934 Ga0496107_0002505 3300048910 Bacteria 11942
935 Ga0496107_0196122 3300048910 Bacteria 1501
936 Ga0496107_0383747 3300048910 Bacteria 1045
937 Ga0496107_0544476 3300048910 Bacteria 860
938 Ga0496108_0000495 3300048911 Bacteria 31371
939 Ga0496108_0112698 3300048911 Bacteria 2327
940 Ga0496109_0000149 3300048912 Bacteria 68979
941 Ga0496109_0017460 3300048912 Bacteria 6292
942 Ga0496109_0029983 3300048912 Bacteria 4875
943 Ga0496110_0133522 3300048913 Bacteria 2242
944 Ga0496110_0152944 3300048913 Bacteria 2089
945 Ga0496111_0008923 3300048914 Bacteria 6667
946 Ga0496111_0059720 3300048914 Bacteria 2763
947 Ga0496112_0000070 3300048915 Bacteria 67934
948 Ga0496112_0171594 3300048915 Bacteria 2134
949 Ga0496112_0420609 3300048915 Bacteria 1275
950 Ga0496112_0426615 3300048915 Bacteria 1264
951 Ga0496113_0000078 3300048916 Bacteria 42516
952 Ga0496113_0216058 3300048916 Bacteria 1527
953 Ga0496115_0001172 3300048918 Bacteria 18793
954 Ga0496115_0007315 3300048918 Bacteria 8120
955 Ga0496115_0086179 3300048918 Bacteria 2563
956 Ga0496115_0242392 3300048918 Bacteria 1486
957 Ga0496115_0330812 3300048918 Bacteria 1245
958 Ga0496118_0004879 3300048921 Bacteria 15610
959 Ga0496118_0119561 3300048921 Bacteria 1722
960 Ga0496119_0005427 3300048922 Bacteria 12226
961 Ga0496119_0103792 3300048922 Bacteria 1591
962 Ga0496120_0071023 3300048923 Bacteria 1913
963 Ga0496120_0088363 3300048923 Bacteria 1661
964 Ga0496120_0207547 3300048923 Bacteria 944
965 Ga0496121_0000664 3300048924 Bacteria 64277
966 Ga0496121_0151387 3300048924 Bacteria 1707
967 Ga0496122_0026316 3300048925 Bacteria 5019
968 Ga0496122_0028105 3300048925 Bacteria 4786
969 Ga0496122_0175286 3300048925 Bacteria 1286
970 Ga0496123_0026747 3300048926 Bacteria 4314
971 Ga0496123_0036401 3300048926 Bacteria 3491
972 Ga0496124_0110487 3300048927 Bacteria 2213
973 Ga0496125_0000125 3300048928 Bacteria 169979
974 Ga0496125_0046957 3300048928 Bacteria 3617
975 Ga0496126_0026293 3300048929 Bacteria 5582
976 Ga0496126_0029296 3300048929 Bacteria 5231
977 Ga0496126_0223952 3300048929 Bacteria 1578
978 Ga0496126_0556283 3300048929 Bacteria 910
979 Ga0501036_0459819 3300049572 Bacteria 1060
980 Ga0501067_0239934 3300049583 Bacteria 1009
981 Ga0501076_0209116 3300049592 Bacteria 1594
982 Ga0501077_0156986 3300049593 Bacteria 1444
983 Ga0501079_0042275 3300049741 Bacteria 3520
984 Ga0501081_0008663 3300049743 Bacteria 6609
985 Ga0501045_0129951 3300049824 Bacteria 1872
986 nmdc:mga0k408_1293_c2 3300050493 Bacteria 9902
987 nmdc:mga05p37_28230_c1 3300050507 Bacteria 6841
988 nmdc:mga05p37_381086_c1 3300050507 Bacteria 1652
989 nmdc:mga05p37_45428_c1 3300050507 Bacteria 5402
990 nmdc:mga05p37_514213_c1 3300050507 Bacteria 1371
991 nmdc:mga09592_12397_c1 3300050508 Bacteria 6943
992 nmdc:mga0qj67_285979_c1 3300050509 Bacteria 1336
993 nmdc:mga0qj67_720_c1 3300050509 Bacteria 22534
994 nmdc:mga0qj67_94091_c1 3300050509 Unclassified 2410
995 nmdc:mga06r32_4338_c1 3300050510 Bacteria 12703
996 nmdc:mga06r32_92397_c1 3300050510 Bacteria 2958
997 nmdc:mga0n895_14321_c1 3300050512 Bacteria 7198
998 nmdc:mga0n895_149746_c1 3300050512 Bacteria 2363
999 nmdc:mga0n895_188314_c1 3300050512 Bacteria 2095
1000 nmdc:mga0n895_261_c1 3300050512 Bacteria 34185
1001 nmdc:mga0n895_2822_c1 3300050512 Bacteria 13752
1002 nmdc:mga0n895_443555_c1 3300050512 Bacteria 1311
1003 nmdc:mga0n895_488614_c1 3300050512 Bacteria 1241
1004 nmdc:mga0n895_570_c1 3300050512 Bacteria 25297
1005 nmdc:mga0n895_620744_c1 3300050512 Bacteria 1082
1006 nmdc:mga0rr50_108006_c1 3300050513 Bacteria 2198
1007 nmdc:mga0rr50_120434_c1 3300050513 Bacteria 2088
1008 nmdc:mga0rr50_140978_c1 3300050513 Bacteria 1939
1009 nmdc:mga0rr50_148255_c2 3300050513 Bacteria 991
1010 nmdc:mga0rr50_169952_c1 3300050513 Bacteria 1776
1011 nmdc:mga0rr50_213_c1 3300050513 Bacteria 31258
1012 nmdc:mga0rr50_279253_c1 3300050513 Bacteria 1393
1013 nmdc:mga0rr50_305355_c1 3300050513 Bacteria 1332
1014 nmdc:mga0rr50_6166_c1 3300050513 Bacteria 7260
1015 nmdc:mga08x19_11024_c1 3300050514 Bacteria 5439
1016 nmdc:mga08x19_11675_c1 3300050514 Bacteria 5289
1017 nmdc:mga08x19_189064_c1 3300050514 Bacteria 1408
1018 nmdc:mga08x19_2681_c1 3300050514 Bacteria 10756
1019 nmdc:mga08x19_27112_c1 3300050514 Bacteria 3582
1020 nmdc:mga08x19_420426_c1 3300050514 Bacteria 939
1021 nmdc:mga08x19_43104_c1 3300050514 Bacteria 2878
1022 nmdc:mga08x19_5095_c1 3300050514 Bacteria 7770
1023 nmdc:mga0a205_258711_c1 3300050515 Bacteria 1618
1024 nmdc:mga0a205_34413_c1 3300050515 Bacteria 4860
1025 nmdc:mga0a205_56253_c1 3300050515 Bacteria 3798
1026 nmdc:mga0a205_6765_c1 3300050515 Bacteria 10368
1027 nmdc:mga0a205_8611_c1 3300050515 Bacteria 9284
1028 nmdc:mga0a205_91055_c1 3300050515 Bacteria 2947
1029 Ga0495601_0054373 3300053077 Bacteria 2533
1030 Ga0495619_0102840 3300053085 Bacteria 1946
1031 Ga0495619_0307972 3300053085 Bacteria 1097
1032 Ga0500578_0000012 3300053086 Bacteria 188658
1033 Ga0500647_0074052 3300053091 Bacteria 1634
1034 Ga0500566_0013648 3300053094 Bacteria 4778
1035 Ga0500566_0151253 3300053094 Unclassified 1220
1036 Ga0500650_0139853 3300053098 Bacteria 1122
1037 Ga0500554_018284 3300053102 Bacteria 1889
1038 Ga0500562_043714 3300053108 Bacteria 1192
1039 Ga0500592_000451 3300053116 Bacteria 6869
1040 Ga0500595_000159 3300053119 Bacteria 44312
1041 Ga0500618_005025 3300053125 Bacteria 4085
1042 Ga0500618_006961 3300053125 Bacteria 3269
1043 Ga0500658_0130478 3300053134 Bacteria 1120
1044 Ga0500559_0071841 3300053136 Bacteria 1559
1045 Ga0500590_010303 3300053148 Bacteria 4719
1046 Ga0500603_003488 3300053150 Bacteria 3376
1047 Ga0500616_0000139 3300053153 Bacteria 123841
1048 Ga0500616_0097892 3300053153 Unclassified 1440
1049 Ga0500638_001268 3300053162 Bacteria 7729
1050 Ga0500636_0062938 3300053177 Bacteria 2163
1051 Ga0500636_0218954 3300053177 Bacteria 993
1052 Ga0500637_0000349 3300053178 Bacteria 17523
1053 Ga0500661_000413 3300055283 Bacteria 7898
1054 2509153257 2508501128 Bacteria 8613869
1055 2513889383 2513237141 Bacteria 8496279
1056 2524469899 2524023210 Bacteria 9029266
1057 2585232549 2582581299 Bacteria 6518058
1058 2585282809 2582581308 Bacteria 7413247
1059 2585324195 2582581315 Bacteria 7318924
1060 2585333407 2582581316 Bacteria 7774528
1061 2585534891 2585427527 Bacteria 7273426
1062 2585551662 2585427530 Bacteria 7383882
1063 2585897544 2585427608 Bacteria 6544331
1064 2603859768 2602042107 Bacteria 6226103
1065 2616308178 2615840626 Bacteria 7921970
1066 2616556801 2615840698 Bacteria 7319877
1067 2617381532 2617270742 Bacteria 6808054
1068 2644238154 2643221643 Bacteria 5749658
1069 2671114711 2667528174 Bacteria 6435400
1070 2740059572 2739367874 Bacteria 4872888
1071 2778176323 2775507266 Bacteria 7392367
1072 2819610659 2818991448 Bacteria 6772224
1073 2819638309 2818991453 Bacteria 7181617
1074 2821450529 2821443989 Bacteria 7658172
1075 2838032336 2838029111 Bacteria 6603031
1076 2842479035 2842475841 Bacteria 6603183
1077 2842483167 2842482326 Bacteria 7212537
1078 2842506245 2842502639 Bacteria 6604161
1079 2857530626 2857524615 Bacteria 6615449
1080 2885386628 2885383462 Bacteria 9473874
1081 2891637522 2891633521 Bacteria 4602265
1082 2893070271 2893066018 Bacteria 6158120
1083 2909399119 2909399089 Bacteria 3922598
1084 2919076222 2919073203 Bacteria 6531949
1085 2919409623 2919408235 Bacteria 6149349
1086 2929924044 2929921140 Bacteria 8649150
1087 2954017689 2954016120 Bacteria 6446024
1088 3001897286 3001892409 Bacteria 6328293
1089 3005420516 3005416602 Bacteria 7064308
1090 8005317467 8005314921 Bacteria 7072929
1091 8005487159 8005484373 Bacteria 6297373
1092 8005646454 8005645114 Bacteria 6950293
1093 8005686518 8005682033 Bacteria 6726518
1094 8024492387 8024486573 Bacteria 6540512
1095 Ga0068864_100067503
1096 MRS1b_contig_9110685
1097 JGI24752J21851_1001338
1098 JGI24740J21852_10000557
1099 JGI24737J22298_10051769
1100 JGI24033J26618_1008754
1101 JGI24034J26672_10004802
1102 JGI25155J39150_1000061
1103 JGI25156J39149_1000122
1104 JGI25162J39368_1000343
1105 JGI25162J39368_1001828
1106 JGI25154J39366_1000132
1107 JGI25157J39369_1000106
1108 JGI25151J46595_10000285
1109 JGI25151J46595_10006958
1110 JGI25406J46586_10020708
1111 JGI25165J46597_1000448
1112 JGI25165J46597_1002332
1113 rootH1_10075866
1114 rootH2_10032239
1115 rootH2_10044892
1116 rootH2_10142949
1117 rootH2_10297647
1118 rootL2_10000825
1119 rootL2_10028893
1120 rootL2_10047860
1121 rootH1_10022429
1122 rootH1_10024211
1123 rootH1_10176177
1124 rootH1_10206279
1125 Ga0065715_10105165
1126 Ga0070658_10134759
1127 Ga0070676_10102310
1128 Ga0070676_10110021
1129 Ga0070683_100000835
1130 Ga0070683_100002634
1131 Ga0070683_100230084
1132 Ga0070683_100381057
1133 Ga0070683_100464131
1134 Ga0070690_100000456
1135 Ga0070690_100069261
1136 Ga0070670_100033767
1137 Ga0070670_100509783
1138 Ga0070677_10005282
1139 Ga0070677_10045508
1140 Ga0068869_100024527
1141 Ga0070666_10001743
1142 Ga0070666_10017198
1143 Ga0070666_10074125
1144 Ga0070666_10339811
1145 Ga0070680_100183000
1146 Ga0070680_100413974
1147 Ga0070682_100000102
1148 Ga0070682_100020786
1149 Ga0068868_100001806
1150 Ga0068868_100005079
1151 Ga0068868_100015998
1152 Ga0068868_100037089
1153 Ga0070660_100002663
1154 Ga0070660_100015316
1155 Ga0070689_100009333
1156 Ga0070689_100025654
1157 Ga0070661_100005786
1158 Ga0070668_100019735
1159 Ga0070668_100079760
1160 Ga0070668_100116547
1161 Ga0070668_100160023
1162 Ga0070669_100007505
1163 Ga0070669_100016363
1164 Ga0070669_100065518
1165 Ga0070669_100107548
1166 Ga0070675_100024719
1167 Ga0070675_100062372
1168 Ga0070675_100085408
1169 Ga0070671_100088123
1170 Ga0070671_100126410
1171 Ga0070671_100250484
1172 Ga0070674_100133925
1173 Ga0070673_100125075
1174 Ga0070688_100138167
1175 Ga0070688_100195274
1176 Ga0070659_100018980
1177 Ga0070659_100044681
1178 Ga0070667_100000282
1179 Ga0070667_100118369
1180 Ga0070667_100185199
1181 Ga0070667_100619029
1182 Ga0070709_10000171
1183 Ga0070709_10007066
1184 Ga0070709_10015415
1185 Ga0070709_10055565
1186 Ga0070709_10062094
1187 Ga0070709_10066684
1188 Ga0070709_10082286
1189 Ga0070709_10135753
1190 Ga0070709_10213544
1191 Ga0070709_10217632
1192 Ga0070709_10261451
1193 Ga0070714_100005715
1194 Ga0070714_100062758
1195 Ga0070714_100165917
1196 Ga0070714_100404690
1197 Ga0070713_100000029
1198 Ga0070713_100005399
1199 Ga0070713_100007877
1200 Ga0070713_100027293
1201 Ga0070713_100040711
1202 Ga0070713_100077093
1203 Ga0070713_100146693
1204 Ga0070713_100165640
1205 Ga0070713_100220874
1206 Ga0070713_100256001
1207 Ga0070713_100317214
1208 Ga0070713_100355641
1209 Ga0070713_100390336
1210 Ga0070713_100482589
1211 Ga0070713_100543846
1212 Ga0070710_10000598
1213 Ga0070710_10011509
1214 Ga0070710_10049192
1215 Ga0070710_10090705
1216 Ga0070711_100000329
1217 Ga0070711_100000531
1218 Ga0070711_100016610
1219 Ga0070711_100111794
1220 Ga0070711_100255574
1221 Ga0070711_100276683
1222 Ga0070711_100283514
1223 Ga0070711_100315371
1224 Ga0070711_100405217
1225 Ga0070700_100049751
1226 Ga0070700_100135504
1227 Ga0070708_100000137
1228 Ga0070708_100026379
1229 Ga0070708_100031260
1230 Ga0070708_100044277
1231 Ga0070708_100055157
1232 Ga0070708_100088023
1233 Ga0070708_100184144
1234 Ga0070708_100209516
1235 Ga0070708_100209983
1236 Ga0070708_100331605
1237 Ga0070663_100227315
1238 Ga0070663_100276609
1239 Ga0070678_100036353
1240 Ga0070662_100001639
1241 Ga0070662_100094574
1242 Ga0070662_100166757
1243 Ga0070681_10072329
1244 Ga0070681_10105458
1245 Ga0070681_10194820
1246 Ga0070681_10259038
1247 Ga0068867_100027614
1248 Ga0070685_10001550
1249 Ga0070706_100001270
1250 Ga0070706_100003237
1251 Ga0070706_100004092
1252 Ga0070706_100016580
1253 Ga0070706_100046278
1254 Ga0070706_100395620
1255 Ga0070707_100000651
1256 Ga0070707_100084062
1257 Ga0070707_100102607
1258 Ga0070707_100118639
1259 Ga0070707_100143024
1260 Ga0070707_100197424
1261 Ga0070707_100208746
1262 Ga0070707_100399460
1263 Ga0070698_100000902
1264 Ga0070698_100269082
1265 Ga0070699_100000439
1266 Ga0070699_100033576
1267 Ga0070699_100035250
1268 Ga0070699_100111319
1269 Ga0070699_100243814
1270 Ga0070679_100006873
1271 Ga0070679_100041877
1272 Ga0070679_100574765
1273 Ga0070684_100001425
1274 Ga0070684_100013041
1275 Ga0070684_100013231
1276 Ga0070697_100000031
1277 Ga0070697_100000265
1278 Ga0070697_100006312
1279 Ga0070697_100016810
1280 Ga0070697_100037929
1281 Ga0070697_100053398
1282 Ga0070697_100053953
1283 Ga0070697_100372830
1284 Ga0068853_100043468
1285 Ga0068853_100172173
1286 Ga0068853_100261110
1287 Ga0068853_100362457
1288 Ga0070672_100000001
1289 Ga0070672_100003522
1290 Ga0070672_100058900
1291 Ga0070686_100120705
1292 Ga0070686_100128115
1293 Ga0070686_100185767
1294 Ga0070696_100107624
1295 Ga0070696_100159704
1296 Ga0070696_100389163
1297 Ga0070665_100038334
1298 Ga0070665_100132617
1299 Ga0070665_100379245
1300 Ga0070704_100321264
1301 Ga0070704_100601639
1302 Ga0068855_100021308
1303 Ga0068855_100022936
1304 Ga0068855_100056535
1305 Ga0068855_100297149
1306 Ga0070664_100009088
1307 Ga0070664_100619004
1308 Ga0068857_100576830
1309 Ga0068854_100093534
1310 Ga0068854_100147591
1311 Ga0068854_100185212
1312 Ga0068856_100001651
1313 Ga0068856_100006407
1314 Ga0068856_100009226
1315 Ga0068856_100066743
1316 Ga0068856_100080518
1317 Ga0068856_100097010
1318 Ga0068856_100232394
1319 Ga0068856_100678746
1320 Ga0068856_100979569
1321 Ga0070702_100015282
1322 Ga0070702_100334723
1323 Ga0068852_100003785
1324 Ga0068852_100007483
1325 Ga0068852_100417196
1326 Ga0068859_100002112
1327 Ga0068859_100125511
1328 Ga0068864_100048826
1329 Ga0068864_100160340
1330 Ga0068864_100214480
1331 Ga0068866_10054809
1332 Ga0068861_100054860
1333 Ga0068861_100713501
1334 Ga0068851_10036662
1335 Ga0068851_10113968
1336 Ga0068870_10088609
1337 Ga0068863_100022945
1338 Ga0068863_100060590
1339 Ga0068863_100076218
1340 Ga0068863_100154139
1341 Ga0068863_100403994
1342 Ga0068858_100000871
1343 Ga0068858_100065088
1344 Ga0068858_100543497
1345 Ga0068860_100000830
1346 Ga0068860_100001349
1347 Ga0068860_100198774
1348 Ga0068860_100249569
1349 Ga0068860_100502358
1350 Ga0068860_100652223
1351 Ga0068862_100021739
1352 Ga0068862_100030172
1353 Ga0068862_100078041
1354 Ga0081455_10008262
1355 Ga0081540_1024855
1356 Ga0081539_10000233
1357 Ga0070717_10003539
1358 Ga0070717_10003613
1359 Ga0070717_10007234
1360 Ga0070717_10010660
1361 Ga0070717_10021483
1362 Ga0070717_10034270
1363 Ga0070717_10040703
1364 Ga0070717_10051701
1365 Ga0070717_10080812
1366 Ga0070717_10106609
1367 Ga0070717_10120276
1368 Ga0070717_10256065
1369 Ga0070717_10580210
1370 Ga0075365_10011855
1371 Ga0070715_10051016
1372 Ga0070715_10053810
1373 Ga0070715_10103544
1374 Ga0070716_100000682
1375 Ga0070716_100004580
1376 Ga0070716_100012268
1377 Ga0070716_100017366
1378 Ga0070716_100025229
1379 Ga0070716_100188029
1380 Ga0070716_100197545
1381 Ga0070716_100249545
1382 Ga0070716_100296467
1383 Ga0070712_100000542
1384 Ga0070712_100002276
1385 Ga0070712_100008763
1386 Ga0070712_100013608
1387 Ga0070712_100015048
1388 Ga0070712_100021048
1389 Ga0070712_100024315
1390 Ga0070712_100192763
1391 Ga0070712_100470080
1392 Ga0075369_10008398
1393 Ga0075366_10001905
1394 Ga0097621_100093431
1395 Ga0097621_100641226
1396 Ga0068871_100038979
1397 Ga0068871_100435399
1398 Ga0075430_100001163
1399 Ga0075430_100098606
1400 Ga0075431_100004149
1401 Ga0075431_100127579
1402 Ga0075433_10002861
1403 Ga0075433_10014138
1404 Ga0075433_10029132
1405 Ga0075433_10053371
1406 Ga0075433_10451889
1407 Ga0075434_100000195
1408 Ga0075434_100000895
1409 Ga0075434_100013552
1410 Ga0075434_100098424
1411 Ga0075434_100102473
1412 Ga0075434_100151150
1413 Ga0075434_100382916
1414 Ga0075434_100450425
1415 Ga0068865_100014673
1416 Ga0075436_100001331
1417 Ga0075436_100008675
1418 Ga0075436_100020426
1419 Ga0075436_100020921
1420 Ga0075436_100032955
1421 Ga0075436_100074720
1422 Ga0075436_100298156
1423 Ga0097620_100002112
1424 Ga0097620_100125518
1425 Ga0075435_100000065
1426 Ga0075435_100006798
1427 Ga0075435_100020039
1428 Ga0075435_100027951
1429 Ga0075435_100059868
1430 Ga0075435_100118493
1431 Ga0075435_100233540
1432 Ga0099794_10000092
1433 Ga0099794_10001902
1434 Ga0099794_10011947
1435 Ga0099794_10012750
1436 Ga0099794_10096956
1437 Ga0099795_10059480
1438 Ga0105251_10035508
1439 Ga0105240_10000005
1440 Ga0105240_10138314
1441 Ga0105240_10243353
1442 Ga0105240_10583120
1443 Ga0105240_10807754
1444 Ga0105240_10860192
1445 Ga0111539_10510630
1446 Ga0105247_10007660
1447 Ga0105247_10286033
1448 Ga0114129_10006586
1449 Ga0114129_10036391
1450 Ga0114129_10084537
1451 Ga0114129_10124086
1452 Ga0114129_10238217
1453 Ga0105243_10089358
1454 Ga0105241_10027728
1455 Ga0105241_10031153
1456 Ga0105241_10176339
1457 Ga0105241_10212839
1458 Ga0105241_10303268
1459 Ga0105241_10443124
1460 Ga0105242_10052001
1461 Ga0105248_10001890
1462 Ga0105248_10045188
1463 Ga0105248_10136773
1464 Ga0105248_10226466
1465 Ga0105248_10686222
1466 Ga0105237_10006938
1467 Ga0105237_10064347
1468 Ga0105237_10084099
1469 Ga0105237_10152615
1470 Ga0105237_10339311
1471 Ga0105238_10018247
1472 Ga0105238_10052374
1473 Ga0105249_10018692
1474 Ga0105249_10027986
1475 Ga0105249_10151312
1476 Ga0105239_10031532
1477 Ga0105239_10566828
1478 Ga0105239_11255413
1479 Ga0105246_10004331
1480 Ga0105246_10120475
1481 Ga0157373_10005392
1482 Ga0157373_10150939
1483 Ga0157373_10508049
1484 Ga0157373_10522060
1485 Ga0157371_10012541
1486 Ga0157370_10063658
1487 Ga0157369_10019476
1488 Ga0157369_10031551
1489 Ga0157369_10088555
1490 Ga0157369_10119503
1491 Ga0157369_10281269
1492 Ga0157374_10032515
1493 Ga0157374_10122109
1494 Ga0157374_10122928
1495 Ga0157374_10132304
1496 Ga0157374_10235467
1497 Ga0157374_10242479
1498 Ga0157378_10060322
1499 Ga0157378_10499318
1500 Ga0163162_10001058
1501 Ga0163162_10062073
1502 Ga0163162_10079760
1503 Ga0163162_10083112
1504 Ga0157372_10020581
1505 Ga0157372_10023668
1506 Ga0157372_10081819
1507 Ga0157372_10190156
1508 Ga0157372_10197800
1509 Ga0157375_10004658
1510 Ga0157375_10019511
1511 Ga0157375_10244236
1512 Ga0157375_10964237
1513 Ga0163163_10065182
1514 Ga0163163_10106923
1515 Ga0157380_10021711
1516 Ga0157380_10531954
1517 Ga0182008_10096120
1518 Ga0157377_10118034
1519 Ga0157379_10004276
1520 Ga0157379_10009361
1521 Ga0157376_10108440
1522 Ga0157376_10163450
1523 Ga0182006_1026090
1524 Ga0182007_10008105
1525 Ga0182007_10009986
1526 Ga0182007_10010012
1527 Ga0163161_10159673
1528 Ga0163161_10469336
1529 Ga0213872_10005572
1530 Ga0213872_10136821
1531 Ga0213874_10003840
1532 Ga0213875_10164406
1533 Ga0228598_1005430
1534 Ga0209435_100081
1535 Ga0209760_104944
1536 Ga0209563_103575
1537 Ga0209437_100153
1538 Ga0209437_100201
1539 Ga0209646_1000064
1540 Ga0209646_1008468
1541 Ga0209026_1000053
1542 Ga0209677_100466
1543 Ga0209677_101561
1544 Ga0209759_1000042
1545 Ga0209233_1000175
1546 Ga0209233_1000226
1547 Ga0209233_1000338
1548 Ga0209025_1000114
1549 Ga0209025_1000584
1550 Ga0209758_1005459
1551 Ga0207697_10010855
1552 Ga0207656_10088770
1553 Ga0207682_10010502
1554 Ga0207682_10036606
1555 Ga0207692_10036401
1556 Ga0207692_10246345
1557 Ga0207692_10339026
1558 Ga0207642_10013339
1559 Ga0207710_10127902
1560 Ga0207688_10005078
1561 Ga0207680_10000344
1562 Ga0207680_10049190
1563 Ga0207647_10021795
1564 Ga0207685_10008371
1565 Ga0207699_10000491
1566 Ga0207699_10009842
1567 Ga0207699_10015899
1568 Ga0207699_10035151
1569 Ga0207699_10069024
1570 Ga0207699_10089842
1571 Ga0207699_10148203
1572 Ga0207699_10178003
1573 Ga0207699_10226216
1574 Ga0207645_10005119
1575 Ga0207645_10009704
1576 Ga0207643_10000133
1577 Ga0207705_10294393
1578 Ga0207705_10465892
1579 Ga0207684_10000705
1580 Ga0207684_10000811
1581 Ga0207684_10002252
1582 Ga0207684_10037395
1583 Ga0207684_10095761
1584 Ga0207684_10282362
1585 Ga0207654_10001902
1586 Ga0207654_10002085
1587 Ga0207654_10161255
1588 Ga0207654_10172944
1589 Ga0207707_10006740
1590 Ga0207707_10020123
1591 Ga0207707_10028403
1592 Ga0207707_10094171
1593 Ga0207695_10000011
1594 Ga0207695_10006005
1595 Ga0207695_10340107
1596 Ga0207671_10001611
1597 Ga0207693_10000031
1598 Ga0207693_10001029
1599 Ga0207693_10002423
1600 Ga0207693_10010541
1601 Ga0207693_10013900
1602 Ga0207693_10014377
1603 Ga0207693_10017024
1604 Ga0207693_10050827
1605 Ga0207693_10055443
1606 Ga0207693_10136756
1607 Ga0207693_10291916
1608 Ga0207663_10001507
1609 Ga0207663_10003723
1610 Ga0207663_10017716
1611 Ga0207663_10034816
1612 Ga0207663_10235305
1613 Ga0207663_10238573
1614 Ga0207663_10372323
1615 Ga0207660_10216404
1616 Ga0207662_10436054
1617 Ga0207657_10001503
1618 Ga0207657_10001593
1619 Ga0207657_10021527
1620 Ga0207649_10000241
1621 Ga0207652_10004952
1622 Ga0207652_10289070
1623 Ga0207652_10298619
1624 Ga0207646_10000494
1625 Ga0207646_10119073
1626 Ga0207646_10121366
1627 Ga0207646_10168304
1628 Ga0207646_10178522
1629 Ga0207646_10255306
1630 Ga0207646_10443792
1631 Ga0207681_10023821
1632 Ga0207681_10059437
1633 Ga0207681_10326180
1634 Ga0207694_10039331
1635 Ga0207650_10000124
1636 Ga0207650_10011152
1637 Ga0207650_10162216
1638 Ga0207659_10050339
1639 Ga0207659_10053620
1640 Ga0207659_10205892
1641 Ga0207687_10008822
1642 Ga0207687_10474328
1643 Ga0207700_10000160
1644 Ga0207700_10006581
1645 Ga0207700_10067821
1646 Ga0207700_10087124
1647 Ga0207700_10193770
1648 Ga0207700_10249664
1649 Ga0207700_10357839
1650 Ga0207700_10395686
1651 Ga0207700_10588055
1652 Ga0207664_10000582
1653 Ga0207664_10004389
1654 Ga0207664_10027352
1655 Ga0207664_10035543
1656 Ga0207664_10057057
1657 Ga0207664_10374547
1658 Ga0207644_10044710
1659 Ga0207644_10389227
1660 Ga0207690_10121152
1661 Ga0207690_10244583
1662 Ga0207706_10000389
1663 Ga0207706_10006249
1664 Ga0207706_10056596
1665 Ga0207706_10084594
1666 Ga0207686_10208872
1667 Ga0207686_10356082
1668 Ga0207670_10005533
1669 Ga0207704_10127658
1670 Ga0207704_10226491
1671 Ga0207704_10271717
1672 Ga0207665_10000147
1673 Ga0207665_10002765
1674 Ga0207665_10004252
1675 Ga0207665_10008366
1676 Ga0207665_10011555
1677 Ga0207665_10012474
1678 Ga0207665_10017982
1679 Ga0207665_10029677
1680 Ga0207665_10038792
1681 Ga0207665_10039492
1682 Ga0207665_10135658
1683 Ga0207665_10318637
1684 Ga0207691_10000017
1685 Ga0207691_10000213
1686 Ga0207691_10014715
1687 Ga0207711_10000705
1688 Ga0207711_10004244
1689 Ga0207711_10011673
1690 Ga0207689_10009150
1691 Ga0207689_10021027
1692 Ga0207661_10000198
1693 Ga0207661_10001087
1694 Ga0207661_10471549
1695 Ga0207679_10000084
1696 Ga0207679_10044853
1697 Ga0207667_10100341
1698 Ga0207667_10223710
1699 Ga0207667_10314855
1700 Ga0207651_10020546
1701 Ga0207712_10009116
1702 Ga0207712_10171355
1703 Ga0207712_10387558
1704 Ga0207668_10013144
1705 Ga0207668_10107702
1706 Ga0207640_10040102
1707 Ga0207640_10044061
1708 Ga0207640_10058900
1709 Ga0207658_10007461
1710 Ga0207658_10014114
1711 Ga0207658_10089936
1712 Ga0207658_10176560
1713 Ga0207658_10280359
1714 Ga0207677_10001778
1715 Ga0207677_10016289
1716 Ga0207677_10057466
1717 Ga0207677_10095865
1718 Ga0207703_10000673
1719 Ga0207703_10482966
1720 Ga0207639_10023827
1721 Ga0207639_10053456
1722 Ga0207639_10080007
1723 Ga0207678_10000070
1724 Ga0207678_10001143
1725 Ga0207678_10024694
1726 Ga0207708_10145604
1727 Ga0207702_10007863
1728 Ga0207702_10008415
1729 Ga0207702_10027557
1730 Ga0207702_10121087
1731 Ga0207702_10125321
1732 Ga0207702_10199287
1733 Ga0207702_10270880
1734 Ga0207641_10000006
1735 Ga0207641_10004604
1736 Ga0207641_10018783
1737 Ga0207641_10139177
1738 Ga0207641_10404557
1739 Ga0207641_10524620
1740 Ga0207648_10001425
1741 Ga0207648_10074073
1742 Ga0207676_10000132
1743 Ga0207676_10046818
1744 Ga0207676_10105299
1745 Ga0207676_10283814
1746 Ga0207674_10000556
1747 Ga0207674_10550022
1748 Ga0207675_100033172
1749 Ga0207683_10003539
1750 Ga0207683_10007717
1751 Ga0207683_10011590
1752 Ga0207683_10051234
1753 Ga0207698_10019763
1754 Ga0207698_10035942
1755 Ga0209371_1001781
1756 Ga0209588_1000010
1757 Ga0209588_1021776
1758 Ga0268266_10015405
1759 Ga0268266_10067760
1760 Ga0268266_10160624
1761 Ga0268266_10222368
1762 Ga0268265_10031603
1763 Ga0268265_10147477
1764 Ga0268264_10000961
1765 Ga0268264_10001110
1766 Ga0268264_10156513
1767 Ga0268264_10165507
1768 Ga0268264_10174366
1769 Ga0307515_10000430
1770 Ga0307515_10375211
1771 Ga0265338_10070465
1772 Ga0265338_10124129
1773 Ga0268256_1002627
1774 Ga0265760_10002364
1775 Ga0265760_10002577
1776 Ga0265760_10002948
1777 Ga0265330_10006773
1778 Ga0265332_10000461
1779 Ga0265332_10048021
1780 Ga0265332_10181220
1781 Ga0265328_10001159
1782 Ga0265320_10027714
1783 Ga0265325_10036615
1784 Ga0265329_10011737
1785 Ga0265340_10106548
1786 Ga0265339_10003817
1787 Ga0265339_10051345
1788 Ga0265339_10061053
1789 Ga0265339_10114812
1790 Ga0265331_10000338
1791 Ga0265331_10000456
1792 Ga0265331_10057054
1793 Ga0265327_10000142
1794 Ga0265316_10000114
1795 Ga0265316_10002182
1796 Ga0265316_10039168
1797 Ga0265316_10048330
1798 Ga0265313_10000602
1799 Ga0316579_10000702
1800 Ga0316579_10066479
1801 Ga0265314_10001296
1802 Ga0265314_10018463
1803 Ga0265314_10049506
1804 Ga0265342_10007181
1805 Ga0265342_10028000
1806 Ga0265342_10043578
1807 Ga0316576_10119520
1808 Ga0316578_10161826
1809 Ga0307516_10000893
1810 Ga0307405_10071329
1811 Ga0316577_10001728
1812 Ga0316577_10006839
1813 Ga0316577_10022645
1814 Ga0307413_10255092
1815 Ga0307412_10086099
1816 Ga0307411_10595196
1817 Ga0307415_100001316
1818 Ga0373930_0003776
1819 Ga0373926_0005579
1820 Ga0373934_0030979
1821 Ga0373923_0034729
1822 Ga0373923_0060878
1823 Ga0373936_0014811
1824 Ga0373936_0014899
1825 Ga0373936_0120598
1826 Ga0373953_0019557
1827 Ga0373954_0000068
1828 Ga0373954_0008040
1829 Ga0373954_0123591
1830 Ga0373954_0136517
1831 Ga0373956_0053699
1832 Ga0373956_0068385
1833 Ga0373956_0165607
1834 Ga0373957_0101465
1835 Ga0373960_0003207
1836 Ga0373943_0010746
1837 Ga0373943_0013170
1838 Ga0373943_0244993
1839 Ga0373955_0033114
1840 Ga0373955_0094000
1841 Ga0373955_0243057
1842 Ga0373961_0027507
1843 Ga0373924_0023281
1844 Ga0373924_0041818
1845 Ga0373935_0006013
1846 Ga0373935_0008252
1847 Ga0373935_0041406
1848 Ga0373935_0112949
1849 Ga0373935_0123056
1850 Ga0373935_0173506
1851 Ga0373935_0350778
1852 Ga0373927_0000292
1853 Ga0373927_0005421
1854 Ga0373927_0006347
1855 Ga0373927_0067243
1856 Ga0373927_0200475
1857 Ga0373927_0214835
1858 Ga0373933_0007750
1859 Ga0373933_0025679
1860 Ga0373933_0081545
1861 Ga0373933_0088049
1862 Ga0373933_0280927
1863 Ga0373947_0013313
1864 Ga0373947_0025848
1865 Ga0373947_0027705
1866 Ga0373947_0066989
1867 Ga0373947_0073371
1868 Ga0373947_0174412
1869 Ga0373947_0305377
1870 Ga0373937_0002051
1871 Ga0373937_0040546
1872 Ga0373937_0055834
1873 Ga0373937_0103447
1874 Ga0373937_0135416
1875 Ga0373937_0145489
1876 Ga0373937_0197589
1877 Ga0373937_0252619
1878 Ga0373937_0346995
1879 Ga0316582_0018427
1880 Ga0316582_0019518
1881 Ga0373925_0001535
1882 Ga0373925_0003786
1883 Ga0373925_0003912
1884 Ga0373925_0049902
1885 Ga0373925_0320473
1886 Ga0395899_0058084
1887 Ga0316581_0006450
1888 Ga0436364_0156979
1889 Ga0436365_1169174
1890 Ga0436360_0441910
1891 Ga0436360_0649865
1892 Ga0436361_0036310
1893 Ga0436361_0152072
1894 Ga0436361_0547921
1895 Ga0436361_0670591
1896 Ga0436361_0941307
1897 Ga0436361_1133747
1898 Ga0436363_0557136
1899 Ga0436362_0062315
1900 Ga0436362_0519918
1901 Ga0451577_0321239
1902 Ga0466972_0060701
1903 Ga0466964_0027812
1904 Ga0466970_0014364
1905 Ga0466957_0052745
1906 Ga0466957_0184227
1907 Ga0466959_0302525
1908 Ga0466967_0664403
1909 Ga0466967_0693613
1910 Ga0495592_0091627
1911 Ga0495603_0149529
1912 Ga0495629_0000003
1913 Ga0495629_0018758
1914 Ga0495638_0092475
1915 Ga0495653_0102841
1916 Ga0495580_0000019
1917 Ga0495580_0000340
1918 Ga0495580_0000509
1919 Ga0495580_0004340
1920 Ga0495580_0004560
1921 Ga0495580_0004756
1922 Ga0495580_0007064
1923 Ga0495580_0008423
1924 Ga0495580_0010728
1925 Ga0495580_0011550
1926 Ga0495580_0055636
1927 Ga0495580_0062262
1928 Ga0495580_0070283
1929 Ga0495580_0078997
1930 Ga0495580_0115601
1931 Ga0495580_0137972
1932 Ga0495580_0164902
1933 Ga0495580_0197046
1934 Ga0495582_0000266
1935 Ga0495582_0000351
1936 Ga0495582_0038669
1937 Ga0495582_0050416
1938 Ga0495664_0157726
1939 Ga0495584_0202099
1940 Ga0495584_0210178
1941 Ga0495583_0000829
1942 Ga0495606_0022376
1943 Ga0495606_0028738
1944 Ga0495606_0061181
1945 Ga0495606_0115209
1946 Ga0495608_0006140
1947 Ga0495608_0310167
1948 Ga0495628_0010012
1949 Ga0495628_0031515
1950 Ga0495628_0323798
1951 Ga0495630_0150873
1952 Ga0495630_0203065
1953 Ga0495637_0122889
1954 Ga0495666_0110366
1955 Ga0495665_0002327
1956 Ga0495665_0019641
1957 Ga0495665_0040453
1958 Ga0495665_0121083
1959 Ga0495665_0126419
1960 Ga0495587_0027758
1961 Ga0495621_0056373
1962 Ga0495645_0143568
1963 Ga0495622_0028573
1964 Ga0495667_0000813
1965 Ga0495667_0070872
1966 Ga0495667_0139227
1967 Ga0495668_0058971
1968 Ga0495588_0000338
1969 Ga0495657_0079415
1970 Ga0495657_0270548
1971 Ga0495623_0041908
1972 Ga0495623_0195036
1973 Ga0495646_0146940
1974 Ga0495658_0051576
1975 Ga0495658_0064388
1976 Ga0495624_0038046
1977 Ga0495670_0004091
1978 Ga0495589_0043648
1979 Ga0495600_0059594
1980 Ga0495600_0185586
1981 Ga0495660_0002852
1982 Ga0495660_0238781
1983 Ga0495581_0049805
1984 Ga0495604_0033033
1985 Ga0495604_0153279
1986 Ga0495604_0226427
1987 Ga0495674_0089191
1988 Ga0495674_0207714
1989 Ga0495674_0409117
1990 Ga0495672_0050211
1991 Ga0495680_0257224
1992 Ga0495675_0062390
1993 Ga0495673_0085119
1994 Ga0495684_0019408
1995 Ga0495686_0000012
1996 Ga0495686_0000112
1997 Ga0495686_0000561
1998 Ga0495686_0082839
1999 Ga0495686_0123442
2000 Ga0495686_0221817
2001 Ga0495602_0024804
2002 Ga0495602_0108905
2003 Ga0495602_0355276
2004 Ga0495602_0511616
2005 Ga0496100_0034546
2006 Ga0496100_0266137
2007 Ga0496100_0649764
2008 Ga0496101_0051018
2009 Ga0496101_0067480
2010 Ga0496101_0130976
2011 Ga0496101_0290443
2012 Ga0496102_0007981
2013 Ga0496102_0016545
2014 Ga0496102_0038103
2015 Ga0496102_0038789
2016 Ga0496102_0056758
2017 Ga0496102_0769419
2018 Ga0496103_0003579
2019 Ga0496103_0021242
2020 Ga0496103_0062879
2021 Ga0496103_0160846
2022 Ga0496104_0054868
2023 Ga0496104_0208837
2024 Ga0496105_0083333
2025 Ga0496105_0172295
2026 Ga0496106_0000937
2027 Ga0496106_0020771
2028 Ga0496107_0002505
2029 Ga0496107_0196122
2030 Ga0496107_0383747
2031 Ga0496107_0544476
2032 Ga0496108_0000495
2033 Ga0496108_0112698
2034 Ga0496109_0000149
2035 Ga0496109_0017460
2036 Ga0496109_0029983
2037 Ga0496110_0133522
2038 Ga0496110_0152944
2039 Ga0496111_0008923
2040 Ga0496111_0059720
2041 Ga0496112_0000070
2042 Ga0496112_0171594
2043 Ga0496112_0420609
2044 Ga0496112_0426615
2045 Ga0496113_0000078
2046 Ga0496113_0216058
2047 Ga0496115_0001172
2048 Ga0496115_0007315
2049 Ga0496115_0086179
2050 Ga0496115_0242392
2051 Ga0496115_0330812
2052 Ga0496118_0004879
2053 Ga0496118_0119561
2054 Ga0496119_0005427
2055 Ga0496119_0103792
2056 Ga0496120_0071023
2057 Ga0496120_0088363
2058 Ga0496120_0207547
2059 Ga0496121_0000664
2060 Ga0496121_0151387
2061 Ga0496122_0026316
2062 Ga0496122_0028105
2063 Ga0496122_0175286
2064 Ga0496123_0026747
2065 Ga0496123_0036401
2066 Ga0496124_0110487
2067 Ga0496125_0000125
2068 Ga0496125_0046957
2069 Ga0496126_0026293
2070 Ga0496126_0029296
2071 Ga0496126_0223952
2072 Ga0496126_0556283
2073 Ga0501036_0459819
2074 Ga0501067_0239934
2075 Ga0501076_0209116
2076 Ga0501077_0156986
2077 Ga0501079_0042275
2078 Ga0501081_0008663
2079 Ga0501045_0129951
2080 nmdc:mga0k408_1293_c2
2081 nmdc:mga05p37_28230_c1
2082 nmdc:mga05p37_381086_c1
2083 nmdc:mga05p37_45428_c1
2084 nmdc:mga05p37_514213_c1
2085 nmdc:mga09592_12397_c1
2086 nmdc:mga0qj67_285979_c1
2087 nmdc:mga0qj67_720_c1
2088 nmdc:mga0qj67_94091_c1
2089 nmdc:mga06r32_4338_c1
2090 nmdc:mga06r32_92397_c1
2091 nmdc:mga0n895_14321_c1
2092 nmdc:mga0n895_149746_c1
2093 nmdc:mga0n895_188314_c1
2094 nmdc:mga0n895_261_c1
2095 nmdc:mga0n895_2822_c1
2096 nmdc:mga0n895_443555_c1
2097 nmdc:mga0n895_488614_c1
2098 nmdc:mga0n895_570_c1
2099 nmdc:mga0n895_620744_c1
2100 nmdc:mga0rr50_108006_c1
2101 nmdc:mga0rr50_120434_c1
2102 nmdc:mga0rr50_140978_c1
2103 nmdc:mga0rr50_148255_c2
2104 nmdc:mga0rr50_169952_c1
2105 nmdc:mga0rr50_213_c1
2106 nmdc:mga0rr50_279253_c1
2107 nmdc:mga0rr50_305355_c1
2108 nmdc:mga0rr50_6166_c1
2109 nmdc:mga08x19_11024_c1
2110 nmdc:mga08x19_11675_c1
2111 nmdc:mga08x19_189064_c1
2112 nmdc:mga08x19_2681_c1
2113 nmdc:mga08x19_27112_c1
2114 nmdc:mga08x19_420426_c1
2115 nmdc:mga08x19_43104_c1
2116 nmdc:mga08x19_5095_c1
2117 nmdc:mga0a205_258711_c1
2118 nmdc:mga0a205_34413_c1
2119 nmdc:mga0a205_56253_c1
2120 nmdc:mga0a205_6765_c1
2121 nmdc:mga0a205_8611_c1
2122 nmdc:mga0a205_91055_c1
2123 Ga0495601_0054373
2124 Ga0495619_0102840
2125 Ga0495619_0307972
2126 Ga0500578_0000012
2127 Ga0500647_0074052
2128 Ga0500566_0013648
2129 Ga0500566_0151253
2130 Ga0500650_0139853
2131 Ga0500554_018284
2132 Ga0500562_043714
2133 Ga0500592_000451
2134 Ga0500595_000159
2135 Ga0500618_005025
2136 Ga0500618_006961
2137 Ga0500658_0130478
2138 Ga0500559_0071841
2139 Ga0500590_010303
2140 Ga0500603_003488
2141 Ga0500616_0000139
2142 Ga0500616_0097892
2143 Ga0500638_001268
2144 Ga0500636_0062938
2145 Ga0500636_0218954
2146 Ga0500637_0000349
2147 Ga0500661_000413
2148 2509153257
2149 2513889383
2150 2524469899
2151 2585232549
2152 2585282809
2153 2585324195
2154 2585333407
2155 2585534891
2156 2585551662
2157 2585897544
2158 2603859768
2159 2616308178
2160 2616556801
2161 2617381532
2162 2644238154
2163 2671114711
2164 2740059572
2165 2778176323
2166 2819610659
2167 2819638309
2168 2821450529
2169 2838032336
2170 2842479035
2171 2842483167
2172 2842506245
2173 2857530626
2174 2885386628
2175 2891637522
2176 2893070271
2177 2909399119
2178 2919076222
2179 2919409623
2180 2929924044
2181 2954017689
2182 3001897286
2183 3005420516
2184 8005317467
2185 8005487159
2186 8005646454
2187 8005686518
2188 8024492387

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

57

251

0.98

PF08659

KR

KR domain

58

233

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

63

302

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9815 6 253
7djs-assembly1.cif.gz_A crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9754 6 253
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9748 1 253
1iy8-assembly1.cif.gz_B crystal structure of levodione reductase 0.9745 2 252
4cql-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9724 6 252
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9748 1 253 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 2 252 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9715 3 194 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9708 1 253 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 6 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0Q5M1B2-F1-model_v4 Short-chain dehydrogenase 0.995 1 250 GO:0006633
GO:0016616
GO:0048038
AF-A0A532U331-F1-model_v4 Short-chain dehydrogenase 0.9948 1 253 GO:0016491
AF-A0A382RC41-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9939 25 249 GO:0016491
AF-A0A524AU47-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9937 1 253 GO:0047936
AF-A0A6B2T3R4-F1-model_v4 SDR family oxidoreductase 0.9906 26 251 GO:0016491

Map