F489925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1093 | 468 | 2186 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300025924|Ga0207694_10700043|Ga0207694_107000432 |
| Length | 153 |
| Sequence | MTPIVTVKWGWNSRKNSPGMQGSDISQMNVPRNVLRFEVLLYASLMLDALSVAVQDRTPTSTMSEQTITANTVLAGGMILLLLYFVRLAARQHKNWPRWVLVVALVLSVLSLFPVIGERGLELDSVIEIVSCALTTAGLYYSFTGDAQGWFNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 95 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 96 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 97 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 266 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 267 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 268 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 272 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 273 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 274 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 280 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 386 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 387 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 388 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 389 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 390 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 391 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 392 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 421 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 426 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 428 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 429 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 433 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 434 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 435 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 436 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 437 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 438 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 439 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 440 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 441 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 442 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 443 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 447 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 448 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 449 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 452 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 454 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 456 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 458 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 459 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 460 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 461 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 462 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 463 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 464 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 465 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 466 | 2906610324 | |||
| 467 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 468 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.63 |
| Nodule | 1.74 |
| Rhizoplane | 6.86 |
| Rhizosphere | 73.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207694_10700043 | 3300025924 | Bacteria | 854 |
| 2 | RicEn_C4615 | 2010549000 | Bacteria | 1294 |
| 3 | JGI24739J22299_10011186 | 3300001989 | Bacteria | 3315 |
| 4 | JGI24737J22298_10002064 | 3300001990 | Bacteria | 7183 |
| 5 | JGI24737J22298_10086367 | 3300001990 | Bacteria | 932 |
| 6 | JGI24735J21928_10002565 | 3300002067 | Bacteria | 6284 |
| 7 | JGI25406J46586_10005846 | 3300003203 | Bacteria | 5691 |
| 8 | JGI25153J46596_10007100 | 3300003215 | Bacteria | 5560 |
| 9 | JGI25160J50197_1004681 | 3300003354 | Bacteria | 5864 |
| 10 | JGI25404J52841_10010994 | 3300003659 | Bacteria | 1949 |
| 11 | JGI25404J52841_10023928 | 3300003659 | Bacteria | 1317 |
| 12 | JGI25404J52841_10047589 | 3300003659 | Bacteria | 904 |
| 13 | Ga0055543_1004189 | 3300004625 | Bacteria | 4000 |
| 14 | Ga0065165_1001000 | 3300005262 | Bacteria | 34730 |
| 15 | Ga0065165_1002881 | 3300005262 | Bacteria | 13232 |
| 16 | Ga0065712_10199050 | 3300005290 | Bacteria | 1116 |
| 17 | Ga0070658_11207008 | 3300005327 | Bacteria | 658 |
| 18 | Ga0070676_11309335 | 3300005328 | Bacteria | 554 |
| 19 | Ga0070683_102434131 | 3300005329 | Bacteria | 502 |
| 20 | Ga0070670_100078374 | 3300005331 | Bacteria | 2838 |
| 21 | Ga0070670_100097465 | 3300005331 | Bacteria | 2529 |
| 22 | Ga0068869_100113310 | 3300005334 | Bacteria | 2065 |
| 23 | Ga0068869_100349169 | 3300005334 | Bacteria | 1205 |
| 24 | Ga0068869_100616811 | 3300005334 | Bacteria | 918 |
| 25 | Ga0068869_101897173 | 3300005334 | Bacteria | 534 |
| 26 | Ga0070666_10117710 | 3300005335 | Bacteria | 1841 |
| 27 | Ga0070666_10183673 | 3300005335 | Bacteria | 1468 |
| 28 | Ga0070680_100097309 | 3300005336 | Bacteria | 2440 |
| 29 | Ga0068868_100360667 | 3300005338 | Bacteria | 1247 |
| 30 | Ga0068868_100447024 | 3300005338 | Bacteria | 1123 |
| 31 | Ga0070660_100007203 | 3300005339 | Bacteria | 7738 |
| 32 | Ga0070660_100360253 | 3300005339 | Bacteria | 1199 |
| 33 | Ga0070660_100395897 | 3300005339 | Bacteria | 1141 |
| 34 | Ga0070660_101249082 | 3300005339 | Bacteria | 630 |
| 35 | Ga0070660_101395982 | 3300005339 | Bacteria | 595 |
| 36 | Ga0070689_100168319 | 3300005340 | Bacteria | 1775 |
| 37 | Ga0070687_101040167 | 3300005343 | Bacteria | 596 |
| 38 | Ga0070661_100433428 | 3300005344 | Bacteria | 1044 |
| 39 | Ga0070692_10893448 | 3300005345 | Bacteria | 614 |
| 40 | Ga0070668_100034605 | 3300005347 | Bacteria | 3850 |
| 41 | Ga0070668_100037092 | 3300005347 | Bacteria | 3721 |
| 42 | Ga0070668_100048283 | 3300005347 | Bacteria | 3273 |
| 43 | Ga0070668_100068946 | 3300005347 | Bacteria | 2750 |
| 44 | Ga0070668_100144755 | 3300005347 | Bacteria | 1917 |
| 45 | Ga0070671_100059352 | 3300005355 | Bacteria | 3183 |
| 46 | Ga0070671_100102576 | 3300005355 | Bacteria | 2400 |
| 47 | Ga0070671_101094952 | 3300005355 | Bacteria | 699 |
| 48 | Ga0070673_100518557 | 3300005364 | Bacteria | 1080 |
| 49 | Ga0070673_100776263 | 3300005364 | Bacteria | 884 |
| 50 | Ga0070688_101262148 | 3300005365 | Bacteria | 595 |
| 51 | Ga0070659_100251488 | 3300005366 | Bacteria | 1465 |
| 52 | Ga0070659_100720528 | 3300005366 | Bacteria | 864 |
| 53 | Ga0070659_100832801 | 3300005366 | Bacteria | 804 |
| 54 | Ga0070659_101183258 | 3300005366 | Bacteria | 676 |
| 55 | Ga0070659_101754210 | 3300005366 | Bacteria | 556 |
| 56 | Ga0070667_100323171 | 3300005367 | Bacteria | 1393 |
| 57 | Ga0070667_100373899 | 3300005367 | Bacteria | 1293 |
| 58 | Ga0070667_100547120 | 3300005367 | Bacteria | 1064 |
| 59 | Ga0070709_10014699 | 3300005434 | Bacteria | 4432 |
| 60 | Ga0070709_10071675 | 3300005434 | Bacteria | 2238 |
| 61 | Ga0070709_10536280 | 3300005434 | Bacteria | 894 |
| 62 | Ga0070714_100046876 | 3300005435 | Bacteria | 3669 |
| 63 | Ga0070714_101346255 | 3300005435 | Bacteria | 697 |
| 64 | Ga0070714_101696565 | 3300005435 | Bacteria | 617 |
| 65 | Ga0070713_100021098 | 3300005436 | Bacteria | 5004 |
| 66 | Ga0070713_100443170 | 3300005436 | Bacteria | 1219 |
| 67 | Ga0070713_100890763 | 3300005436 | Bacteria | 856 |
| 68 | Ga0070713_100909299 | 3300005436 | Bacteria | 847 |
| 69 | Ga0070713_100990602 | 3300005436 | Bacteria | 811 |
| 70 | Ga0070710_10011580 | 3300005437 | Bacteria | 4361 |
| 71 | Ga0070710_10017934 | 3300005437 | Bacteria | 3635 |
| 72 | Ga0070711_100082160 | 3300005439 | Bacteria | 2298 |
| 73 | Ga0070711_100089954 | 3300005439 | Bacteria | 2209 |
| 74 | Ga0070711_100359750 | 3300005439 | Bacteria | 1172 |
| 75 | Ga0070711_100498274 | 3300005439 | Bacteria | 1004 |
| 76 | Ga0070705_100550235 | 3300005440 | Bacteria | 885 |
| 77 | Ga0070700_101093221 | 3300005441 | Bacteria | 660 |
| 78 | Ga0070694_100326786 | 3300005444 | Bacteria | 1182 |
| 79 | Ga0070663_100045359 | 3300005455 | Bacteria | 3105 |
| 80 | Ga0070663_100090656 | 3300005455 | Bacteria | 2264 |
| 81 | Ga0070663_100144660 | 3300005455 | Bacteria | 1818 |
| 82 | Ga0070663_100237411 | 3300005455 | Bacteria | 1438 |
| 83 | Ga0070663_100898853 | 3300005455 | Bacteria | 765 |
| 84 | Ga0070663_100932800 | 3300005455 | Bacteria | 751 |
| 85 | Ga0070678_100091264 | 3300005456 | Bacteria | 2337 |
| 86 | Ga0070678_100106088 | 3300005456 | Bacteria | 2189 |
| 87 | Ga0070678_101173743 | 3300005456 | Bacteria | 711 |
| 88 | Ga0070678_101422846 | 3300005456 | Bacteria | 648 |
| 89 | Ga0070662_100044952 | 3300005457 | Bacteria | 3166 |
| 90 | Ga0070662_100185973 | 3300005457 | Bacteria | 1640 |
| 91 | Ga0070681_10017728 | 3300005458 | Bacteria | 7116 |
| 92 | Ga0070681_10241579 | 3300005458 | Bacteria | 1719 |
| 93 | Ga0068867_100552523 | 3300005459 | Bacteria | 998 |
| 94 | Ga0068867_101345730 | 3300005459 | Bacteria | 660 |
| 95 | Ga0070706_101587626 | 3300005467 | Bacteria | 597 |
| 96 | Ga0070679_100127787 | 3300005530 | Bacteria | 2523 |
| 97 | Ga0070679_100189986 | 3300005530 | Bacteria | 2023 |
| 98 | Ga0070679_100477498 | 3300005530 | Bacteria | 1191 |
| 99 | Ga0070679_100503011 | 3300005530 | Bacteria | 1156 |
| 100 | Ga0070679_100978344 | 3300005530 | Bacteria | 790 |
| 101 | Ga0070684_100056215 | 3300005535 | Bacteria | 3433 |
| 102 | Ga0070684_100749437 | 3300005535 | Bacteria | 912 |
| 103 | Ga0070697_100308780 | 3300005536 | Bacteria | 1360 |
| 104 | Ga0068853_100058554 | 3300005539 | Bacteria | 3326 |
| 105 | Ga0068853_100083561 | 3300005539 | Bacteria | 2798 |
| 106 | Ga0068853_100319313 | 3300005539 | Bacteria | 1439 |
| 107 | Ga0068853_100409791 | 3300005539 | Bacteria | 1270 |
| 108 | Ga0068853_100434599 | 3300005539 | Bacteria | 1233 |
| 109 | Ga0068853_100622958 | 3300005539 | Bacteria | 1026 |
| 110 | Ga0068853_101266267 | 3300005539 | Bacteria | 712 |
| 111 | Ga0068853_101375340 | 3300005539 | Bacteria | 683 |
| 112 | Ga0068853_101468293 | 3300005539 | Bacteria | 660 |
| 113 | Ga0070672_100102083 | 3300005543 | Bacteria | 2327 |
| 114 | Ga0070672_101351708 | 3300005543 | Bacteria | 637 |
| 115 | Ga0070696_100185213 | 3300005546 | Bacteria | 1546 |
| 116 | Ga0070693_100981589 | 3300005547 | Bacteria | 638 |
| 117 | Ga0070665_100113812 | 3300005548 | Bacteria | 2708 |
| 118 | Ga0070665_100171671 | 3300005548 | Bacteria | 2169 |
| 119 | Ga0070665_100320013 | 3300005548 | Bacteria | 1555 |
| 120 | Ga0070665_100909636 | 3300005548 | Bacteria | 892 |
| 121 | Ga0068855_100020421 | 3300005563 | Bacteria | 7943 |
| 122 | Ga0068855_100293583 | 3300005563 | Bacteria | 1802 |
| 123 | Ga0068855_100446121 | 3300005563 | Bacteria | 1412 |
| 124 | Ga0068855_100523935 | 3300005563 | Bacteria | 1285 |
| 125 | Ga0068855_101083055 | 3300005563 | Bacteria | 838 |
| 126 | Ga0068855_101139573 | 3300005563 | Bacteria | 814 |
| 127 | Ga0068855_101918285 | 3300005563 | Bacteria | 600 |
| 128 | Ga0070664_100613136 | 3300005564 | Bacteria | 1010 |
| 129 | Ga0070664_100765735 | 3300005564 | Bacteria | 902 |
| 130 | Ga0070664_100931037 | 3300005564 | Bacteria | 815 |
| 131 | Ga0068857_100233474 | 3300005577 | Bacteria | 1683 |
| 132 | Ga0068857_100705789 | 3300005577 | Bacteria | 959 |
| 133 | Ga0068857_101960493 | 3300005577 | Bacteria | 574 |
| 134 | Ga0068854_100013815 | 3300005578 | Bacteria | 5310 |
| 135 | Ga0068854_100298451 | 3300005578 | Bacteria | 1302 |
| 136 | Ga0068854_100386996 | 3300005578 | Bacteria | 1154 |
| 137 | Ga0068854_101041165 | 3300005578 | Bacteria | 726 |
| 138 | Ga0068856_100182720 | 3300005614 | Bacteria | 2111 |
| 139 | Ga0068856_100426337 | 3300005614 | Bacteria | 1346 |
| 140 | Ga0068856_100562291 | 3300005614 | Bacteria | 1162 |
| 141 | Ga0068856_101108969 | 3300005614 | Bacteria | 809 |
| 142 | Ga0070702_100156178 | 3300005615 | Bacteria | 1470 |
| 143 | Ga0070702_100571828 | 3300005615 | Bacteria | 842 |
| 144 | Ga0070702_101006503 | 3300005615 | Bacteria | 660 |
| 145 | Ga0068852_100100749 | 3300005616 | Bacteria | 2607 |
| 146 | Ga0068852_100388423 | 3300005616 | Bacteria | 1370 |
| 147 | Ga0068852_100719899 | 3300005616 | Bacteria | 1009 |
| 148 | Ga0068852_101578564 | 3300005616 | Bacteria | 679 |
| 149 | Ga0068859_100175190 | 3300005617 | Bacteria | 2227 |
| 150 | Ga0068859_100391897 | 3300005617 | Bacteria | 1485 |
| 151 | Ga0068866_10101414 | 3300005718 | Bacteria | 1588 |
| 152 | Ga0068866_10223835 | 3300005718 | Bacteria | 1137 |
| 153 | Ga0068861_100255924 | 3300005719 | Bacteria | 1496 |
| 154 | Ga0068861_100273098 | 3300005719 | Bacteria | 1452 |
| 155 | Ga0068861_100606434 | 3300005719 | Bacteria | 1005 |
| 156 | Ga0068851_10466423 | 3300005834 | Bacteria | 753 |
| 157 | Ga0068870_11179688 | 3300005840 | Bacteria | 554 |
| 158 | Ga0068863_101390337 | 3300005841 | Bacteria | 709 |
| 159 | Ga0068858_100091673 | 3300005842 | Bacteria | 2828 |
| 160 | Ga0068858_100308584 | 3300005842 | Bacteria | 1510 |
| 161 | Ga0068858_100328179 | 3300005842 | Bacteria | 1463 |
| 162 | Ga0068858_100526333 | 3300005842 | Bacteria | 1143 |
| 163 | Ga0068860_100443077 | 3300005843 | Bacteria | 1290 |
| 164 | Ga0068860_100771602 | 3300005843 | Bacteria | 974 |
| 165 | Ga0068860_100860696 | 3300005843 | Bacteria | 921 |
| 166 | Ga0068862_100105868 | 3300005844 | Bacteria | 2465 |
| 167 | Ga0068862_100354159 | 3300005844 | Bacteria | 1363 |
| 168 | Ga0068862_100704521 | 3300005844 | Bacteria | 978 |
| 169 | Ga0068862_101871497 | 3300005844 | Bacteria | 610 |
| 170 | Ga0081455_10099030 | 3300005937 | Bacteria | 2346 |
| 171 | Ga0081455_10643714 | 3300005937 | Bacteria | 684 |
| 172 | Ga0081540_1000977 | 3300005983 | Bacteria | 25775 |
| 173 | Ga0081540_1009064 | 3300005983 | Bacteria | 6875 |
| 174 | Ga0081540_1017971 | 3300005983 | Bacteria | 4357 |
| 175 | Ga0081540_1018216 | 3300005983 | Bacteria | 4317 |
| 176 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 177 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 178 | Ga0070717_10047970 | 3300006028 | Bacteria | 3502 |
| 179 | Ga0070717_10214208 | 3300006028 | Bacteria | 1691 |
| 180 | Ga0070717_10280543 | 3300006028 | Bacteria | 1478 |
| 181 | Ga0070717_10359021 | 3300006028 | Bacteria | 1304 |
| 182 | Ga0070717_11283818 | 3300006028 | Bacteria | 666 |
| 183 | Ga0075365_10019762 | 3300006038 | Bacteria | 4164 |
| 184 | Ga0075365_10055481 | 3300006038 | Bacteria | 2630 |
| 185 | Ga0075365_10373704 | 3300006038 | Bacteria | 1005 |
| 186 | Ga0075365_10554274 | 3300006038 | Bacteria | 813 |
| 187 | Ga0075365_10557530 | 3300006038 | Bacteria | 810 |
| 188 | Ga0075365_10680941 | 3300006038 | Bacteria | 727 |
| 189 | Ga0075365_10726372 | 3300006038 | Bacteria | 701 |
| 190 | Ga0075365_10834195 | 3300006038 | Bacteria | 650 |
| 191 | Ga0075365_10990196 | 3300006038 | Bacteria | 592 |
| 192 | Ga0075368_10069099 | 3300006042 | Bacteria | 1424 |
| 193 | Ga0075368_10284713 | 3300006042 | Bacteria | 711 |
| 194 | Ga0075363_100380402 | 3300006048 | Bacteria | 827 |
| 195 | Ga0075364_10046191 | 3300006051 | Bacteria | 2835 |
| 196 | Ga0075364_10103459 | 3300006051 | Bacteria | 1896 |
| 197 | Ga0070715_10361588 | 3300006163 | Bacteria | 796 |
| 198 | Ga0070715_10775380 | 3300006163 | Bacteria | 580 |
| 199 | Ga0070716_100193111 | 3300006173 | Bacteria | 1347 |
| 200 | Ga0070716_100374472 | 3300006173 | Bacteria | 1016 |
| 201 | Ga0070712_100005919 | 3300006175 | Bacteria | 7568 |
| 202 | Ga0070712_100200331 | 3300006175 | Bacteria | 1568 |
| 203 | Ga0070712_100745534 | 3300006175 | Bacteria | 838 |
| 204 | Ga0075362_10026222 | 3300006177 | Bacteria | 2487 |
| 205 | Ga0075362_10553370 | 3300006177 | Bacteria | 592 |
| 206 | Ga0075367_10051935 | 3300006178 | Bacteria | 2425 |
| 207 | Ga0075367_10054914 | 3300006178 | Bacteria | 2362 |
| 208 | Ga0075367_10167079 | 3300006178 | Bacteria | 1370 |
| 209 | Ga0075367_10204320 | 3300006178 | Bacteria | 1234 |
| 210 | Ga0075369_10017098 | 3300006186 | Bacteria | 2935 |
| 211 | Ga0075369_10079868 | 3300006186 | Bacteria | 1449 |
| 212 | Ga0075369_10230835 | 3300006186 | Bacteria | 857 |
| 213 | Ga0075369_10242823 | 3300006186 | Bacteria | 835 |
| 214 | Ga0075369_10586019 | 3300006186 | Bacteria | 533 |
| 215 | Ga0075366_10005347 | 3300006195 | Bacteria | 6960 |
| 216 | Ga0075366_10084551 | 3300006195 | Bacteria | 1897 |
| 217 | Ga0075366_10231565 | 3300006195 | Bacteria | 1126 |
| 218 | Ga0075366_10240330 | 3300006195 | Bacteria | 1104 |
| 219 | Ga0075366_10527636 | 3300006195 | Bacteria | 730 |
| 220 | Ga0075366_10937286 | 3300006195 | Bacteria | 540 |
| 221 | Ga0097621_100325665 | 3300006237 | Bacteria | 1362 |
| 222 | Ga0097621_101065858 | 3300006237 | Bacteria | 758 |
| 223 | Ga0075370_10014257 | 3300006353 | Bacteria | 4238 |
| 224 | Ga0075370_10221730 | 3300006353 | Bacteria | 1118 |
| 225 | Ga0075370_10705089 | 3300006353 | Bacteria | 614 |
| 226 | Ga0068871_100465123 | 3300006358 | Bacteria | 1136 |
| 227 | Ga0068871_101057517 | 3300006358 | Bacteria | 758 |
| 228 | Ga0075428_100013639 | 3300006844 | Bacteria | 9050 |
| 229 | Ga0075433_10982405 | 3300006852 | Bacteria | 736 |
| 230 | Ga0075434_100497792 | 3300006871 | Bacteria | 1240 |
| 231 | Ga0075434_101627576 | 3300006871 | Bacteria | 654 |
| 232 | Ga0068865_100904500 | 3300006881 | Bacteria | 768 |
| 233 | Ga0075436_100235549 | 3300006914 | Bacteria | 1301 |
| 234 | Ga0097620_100175195 | 3300006931 | Bacteria | 2227 |
| 235 | Ga0097620_100391878 | 3300006931 | Bacteria | 1485 |
| 236 | Ga0099825_1024706 | 3300006941 | Bacteria | 3462 |
| 237 | Ga0099824_1011211 | 3300006942 | Bacteria | 10236 |
| 238 | Ga0099822_1004035 | 3300006943 | Bacteria | 19017 |
| 239 | Ga0099822_1063816 | 3300006943 | Bacteria | 1158 |
| 240 | Ga0099823_1040176 | 3300006944 | Bacteria | 3394 |
| 241 | Ga0075435_100838889 | 3300007076 | Bacteria | 801 |
| 242 | Ga0075435_101222116 | 3300007076 | Bacteria | 658 |
| 243 | Ga0099794_10017491 | 3300007265 | Bacteria | 3197 |
| 244 | Ga0099794_10322919 | 3300007265 | Bacteria | 801 |
| 245 | Ga0099795_10036696 | 3300007788 | Bacteria | 1721 |
| 246 | Ga0099795_10149621 | 3300007788 | Bacteria | 955 |
| 247 | Ga0105250_10102880 | 3300009092 | Bacteria | 1166 |
| 248 | Ga0105250_10121596 | 3300009092 | Bacteria | 1074 |
| 249 | Ga0105240_10002409 | 3300009093 | Bacteria | 30057 |
| 250 | Ga0105240_10007230 | 3300009093 | Bacteria | 16167 |
| 251 | Ga0105240_10007574 | 3300009093 | Bacteria | 15726 |
| 252 | Ga0105240_10288383 | 3300009093 | Bacteria | 1883 |
| 253 | Ga0105240_10424121 | 3300009093 | Bacteria | 1494 |
| 254 | Ga0105240_11223257 | 3300009093 | Bacteria | 795 |
| 255 | Ga0111539_12012394 | 3300009094 | Bacteria | 670 |
| 256 | Ga0105245_10121359 | 3300009098 | Bacteria | 2442 |
| 257 | Ga0105245_10284770 | 3300009098 | Bacteria | 1617 |
| 258 | Ga0105245_10304762 | 3300009098 | Bacteria | 1564 |
| 259 | Ga0105245_10529515 | 3300009098 | Bacteria | 1198 |
| 260 | Ga0105245_12243199 | 3300009098 | Bacteria | 600 |
| 261 | Ga0105247_10037154 | 3300009101 | Bacteria | 2971 |
| 262 | Ga0105247_10674626 | 3300009101 | Bacteria | 775 |
| 263 | Ga0114129_10140555 | 3300009147 | Bacteria | 3310 |
| 264 | Ga0105243_10202764 | 3300009148 | Bacteria | 1741 |
| 265 | Ga0105243_10954789 | 3300009148 | Bacteria | 857 |
| 266 | Ga0105243_11316166 | 3300009148 | Bacteria | 740 |
| 267 | Ga0105243_12413950 | 3300009148 | Bacteria | 564 |
| 268 | Ga0105241_10128663 | 3300009174 | Bacteria | 2047 |
| 269 | Ga0105241_10376609 | 3300009174 | Bacteria | 1239 |
| 270 | Ga0105241_10764691 | 3300009174 | Bacteria | 887 |
| 271 | Ga0105241_12523866 | 3300009174 | Bacteria | 515 |
| 272 | Ga0105242_10600419 | 3300009176 | Bacteria | 1063 |
| 273 | Ga0105242_10637775 | 3300009176 | Bacteria | 1034 |
| 274 | Ga0105242_11157295 | 3300009176 | Bacteria | 791 |
| 275 | Ga0105248_10140529 | 3300009177 | Bacteria | 2724 |
| 276 | Ga0105248_10219879 | 3300009177 | Bacteria | 2138 |
| 277 | Ga0105248_10462966 | 3300009177 | Bacteria | 1429 |
| 278 | Ga0105248_11065624 | 3300009177 | Bacteria | 913 |
| 279 | Ga0105248_11093892 | 3300009177 | Bacteria | 901 |
| 280 | Ga0105248_11789788 | 3300009177 | Bacteria | 697 |
| 281 | Ga0105248_11794819 | 3300009177 | Bacteria | 696 |
| 282 | Ga0105237_10028752 | 3300009545 | Bacteria | 5657 |
| 283 | Ga0105237_10043519 | 3300009545 | Bacteria | 4523 |
| 284 | Ga0105237_10048634 | 3300009545 | Bacteria | 4262 |
| 285 | Ga0105237_10126526 | 3300009545 | Bacteria | 2550 |
| 286 | Ga0105237_10418547 | 3300009545 | Bacteria | 1345 |
| 287 | Ga0105237_10482242 | 3300009545 | Bacteria | 1246 |
| 288 | Ga0105237_10534824 | 3300009545 | Bacteria | 1179 |
| 289 | Ga0105237_10936625 | 3300009545 | Bacteria | 873 |
| 290 | Ga0105237_11276033 | 3300009545 | Bacteria | 741 |
| 291 | Ga0105238_10017182 | 3300009551 | Bacteria | 7348 |
| 292 | Ga0105238_10144870 | 3300009551 | Bacteria | 2352 |
| 293 | Ga0105238_10663820 | 3300009551 | Bacteria | 1053 |
| 294 | Ga0105238_10713475 | 3300009551 | Bacteria | 1015 |
| 295 | Ga0105238_10755481 | 3300009551 | Bacteria | 986 |
| 296 | Ga0105238_12337352 | 3300009551 | Bacteria | 570 |
| 297 | Ga0105249_10259641 | 3300009553 | Bacteria | 1726 |
| 298 | Ga0105249_10416355 | 3300009553 | Bacteria | 1377 |
| 299 | Ga0105249_10478055 | 3300009553 | Bacteria | 1288 |
| 300 | Ga0105249_10545959 | 3300009553 | Bacteria | 1209 |
| 301 | Ga0105249_11670720 | 3300009553 | Bacteria | 709 |
| 302 | Ga0105239_10006100 | 3300010375 | Bacteria | 14036 |
| 303 | Ga0105239_10059849 | 3300010375 | Bacteria | 4180 |
| 304 | Ga0105239_10139872 | 3300010375 | Bacteria | 2697 |
| 305 | Ga0105239_10152837 | 3300010375 | Bacteria | 2576 |
| 306 | Ga0105239_10515953 | 3300010375 | Bacteria | 1359 |
| 307 | Ga0105239_10774516 | 3300010375 | Bacteria | 1099 |
| 308 | Ga0105239_10802634 | 3300010375 | Bacteria | 1078 |
| 309 | Ga0105239_10843157 | 3300010375 | Bacteria | 1051 |
| 310 | Ga0105239_10914444 | 3300010375 | Bacteria | 1007 |
| 311 | Ga0105239_11241957 | 3300010375 | Bacteria | 859 |
| 312 | Ga0105239_11791851 | 3300010375 | Bacteria | 711 |
| 313 | Ga0105246_10044764 | 3300011119 | Bacteria | 3009 |
| 314 | Ga0105246_10161530 | 3300011119 | Bacteria | 1707 |
| 315 | Ga0105246_10413704 | 3300011119 | Bacteria | 1123 |
| 316 | Ga0157326_1063352 | 3300012513 | Bacteria | 570 |
| 317 | Ga0157373_10876288 | 3300013100 | Bacteria | 665 |
| 318 | Ga0157370_10052380 | 3300013104 | Bacteria | 3897 |
| 319 | Ga0157370_10186917 | 3300013104 | Bacteria | 1923 |
| 320 | Ga0157370_11832283 | 3300013104 | Bacteria | 544 |
| 321 | Ga0157369_10023864 | 3300013105 | Bacteria | 6808 |
| 322 | Ga0157369_10032287 | 3300013105 | Bacteria | 5760 |
| 323 | Ga0157369_12234431 | 3300013105 | Bacteria | 555 |
| 324 | Ga0157378_10107999 | 3300013297 | Bacteria | 2547 |
| 325 | Ga0157378_10253135 | 3300013297 | Bacteria | 1687 |
| 326 | Ga0163162_10230636 | 3300013306 | Bacteria | 1982 |
| 327 | Ga0163162_11714275 | 3300013306 | Bacteria | 718 |
| 328 | Ga0157372_10205924 | 3300013307 | Bacteria | 2279 |
| 329 | Ga0157372_11036045 | 3300013307 | Bacteria | 950 |
| 330 | Ga0157372_12087590 | 3300013307 | Bacteria | 651 |
| 331 | Ga0157375_10769960 | 3300013308 | Bacteria | 1113 |
| 332 | Ga0157375_10973558 | 3300013308 | Bacteria | 989 |
| 333 | Ga0163163_10001936 | 3300014325 | Bacteria | 17537 |
| 334 | Ga0163163_10068609 | 3300014325 | Bacteria | 3528 |
| 335 | Ga0163163_10490569 | 3300014325 | Bacteria | 1290 |
| 336 | Ga0163163_11181065 | 3300014325 | Bacteria | 828 |
| 337 | Ga0157380_10554047 | 3300014326 | Bacteria | 1128 |
| 338 | Ga0182008_10305235 | 3300014497 | Bacteria | 834 |
| 339 | Ga0157377_10524980 | 3300014745 | Bacteria | 832 |
| 340 | Ga0157379_10071814 | 3300014968 | Bacteria | 3096 |
| 341 | Ga0157379_10317024 | 3300014968 | Bacteria | 1423 |
| 342 | Ga0157379_10468013 | 3300014968 | Bacteria | 1165 |
| 343 | Ga0157376_10656490 | 3300014969 | Bacteria | 1050 |
| 344 | Ga0157376_10709084 | 3300014969 | Bacteria | 1012 |
| 345 | Ga0157376_11813272 | 3300014969 | Bacteria | 646 |
| 346 | Ga0157376_12225699 | 3300014969 | Bacteria | 587 |
| 347 | Ga0163161_11417401 | 3300017792 | Bacteria | 607 |
| 348 | Ga0154015_1407110 | 3300020610 | Bacteria | 762 |
| 349 | Ga0209563_101473 | 3300025230 | Bacteria | 6213 |
| 350 | Ga0209677_105226 | 3300025253 | Bacteria | 3454 |
| 351 | Ga0209148_1000779 | 3300025254 | Bacteria | 23713 |
| 352 | Ga0209233_1005191 | 3300025261 | Bacteria | 4347 |
| 353 | Ga0209233_1028193 | 3300025261 | Bacteria | 1350 |
| 354 | Ga0209233_1032525 | 3300025261 | Bacteria | 1205 |
| 355 | Ga0209233_1051074 | 3300025261 | Bacteria | 840 |
| 356 | Ga0209455_1003881 | 3300025272 | Bacteria | 5100 |
| 357 | Ga0209673_1027776 | 3300025273 | Bacteria | 1835 |
| 358 | Ga0209564_1003985 | 3300025295 | Bacteria | 9373 |
| 359 | Ga0209758_1001023 | 3300025297 | Bacteria | 36896 |
| 360 | Ga0209758_1003040 | 3300025297 | Bacteria | 15973 |
| 361 | Ga0209758_1014568 | 3300025297 | Bacteria | 4168 |
| 362 | Ga0209758_1028731 | 3300025297 | Bacteria | 2344 |
| 363 | Ga0207426_1000596 | 3300025302 | Bacteria | 47621 |
| 364 | Ga0207426_1001063 | 3300025302 | Bacteria | 25997 |
| 365 | Ga0207426_1036686 | 3300025302 | Bacteria | 1556 |
| 366 | Ga0207697_10345109 | 3300025315 | Bacteria | 661 |
| 367 | Ga0207656_10024424 | 3300025321 | Bacteria | 2444 |
| 368 | Ga0207656_10204750 | 3300025321 | Bacteria | 954 |
| 369 | Ga0207692_10017386 | 3300025898 | Bacteria | 3207 |
| 370 | Ga0207692_10139762 | 3300025898 | Bacteria | 1377 |
| 371 | Ga0207692_10663733 | 3300025898 | Bacteria | 674 |
| 372 | Ga0207642_10095980 | 3300025899 | Bacteria | 1477 |
| 373 | Ga0207710_10164935 | 3300025900 | Bacteria | 1081 |
| 374 | Ga0207688_10175813 | 3300025901 | Bacteria | 1275 |
| 375 | Ga0207680_10162733 | 3300025903 | Bacteria | 1498 |
| 376 | Ga0207647_10017488 | 3300025904 | Bacteria | 4874 |
| 377 | Ga0207647_10018334 | 3300025904 | Bacteria | 4737 |
| 378 | Ga0207647_10176581 | 3300025904 | Bacteria | 1242 |
| 379 | Ga0207647_10180635 | 3300025904 | Bacteria | 1226 |
| 380 | Ga0207647_10258149 | 3300025904 | Bacteria | 998 |
| 381 | Ga0207647_10293453 | 3300025904 | Bacteria | 927 |
| 382 | Ga0207685_10211488 | 3300025905 | Bacteria | 917 |
| 383 | Ga0207685_10288519 | 3300025905 | Bacteria | 808 |
| 384 | Ga0207685_10548058 | 3300025905 | Bacteria | 615 |
| 385 | Ga0207699_10159997 | 3300025906 | Bacteria | 1498 |
| 386 | Ga0207699_10179653 | 3300025906 | Bacteria | 1422 |
| 387 | Ga0207699_10391758 | 3300025906 | Bacteria | 988 |
| 388 | Ga0207699_11405174 | 3300025906 | Bacteria | 516 |
| 389 | Ga0207645_10207023 | 3300025907 | Bacteria | 1291 |
| 390 | Ga0207645_10402686 | 3300025907 | Bacteria | 920 |
| 391 | Ga0207643_10504597 | 3300025908 | Bacteria | 773 |
| 392 | Ga0207705_11092401 | 3300025909 | Bacteria | 615 |
| 393 | Ga0207684_10573166 | 3300025910 | Bacteria | 965 |
| 394 | Ga0207654_10015401 | 3300025911 | Bacteria | 3969 |
| 395 | Ga0207654_10077268 | 3300025911 | Bacteria | 1995 |
| 396 | Ga0207654_10104552 | 3300025911 | Bacteria | 1751 |
| 397 | Ga0207654_10211228 | 3300025911 | Bacteria | 1283 |
| 398 | Ga0207707_10003454 | 3300025912 | Bacteria | 14012 |
| 399 | Ga0207707_10008660 | 3300025912 | Bacteria | 8827 |
| 400 | Ga0207707_10236723 | 3300025912 | Bacteria | 1588 |
| 401 | Ga0207695_10001107 | 3300025913 | Bacteria | 46846 |
| 402 | Ga0207695_10024535 | 3300025913 | Bacteria | 6779 |
| 403 | Ga0207695_10046985 | 3300025913 | Bacteria | 4572 |
| 404 | Ga0207695_10067350 | 3300025913 | Bacteria | 3673 |
| 405 | Ga0207695_10202711 | 3300025913 | Bacteria | 1897 |
| 406 | Ga0207695_10430785 | 3300025913 | Bacteria | 1203 |
| 407 | Ga0207671_10006466 | 3300025914 | Bacteria | 10430 |
| 408 | Ga0207671_10065787 | 3300025914 | Bacteria | 2697 |
| 409 | Ga0207671_10071594 | 3300025914 | Bacteria | 2586 |
| 410 | Ga0207671_10083724 | 3300025914 | Bacteria | 2395 |
| 411 | Ga0207671_10838842 | 3300025914 | Bacteria | 728 |
| 412 | Ga0207693_10010745 | 3300025915 | Bacteria | 7433 |
| 413 | Ga0207693_10115846 | 3300025915 | Bacteria | 2104 |
| 414 | Ga0207693_10328165 | 3300025915 | Bacteria | 1198 |
| 415 | Ga0207693_11256778 | 3300025915 | Bacteria | 556 |
| 416 | Ga0207663_10005229 | 3300025916 | Bacteria | 6532 |
| 417 | Ga0207663_10027896 | 3300025916 | Bacteria | 3297 |
| 418 | Ga0207663_11120731 | 3300025916 | Bacteria | 633 |
| 419 | Ga0207663_11482667 | 3300025916 | Bacteria | 546 |
| 420 | Ga0207660_10127082 | 3300025917 | Bacteria | 1937 |
| 421 | Ga0207660_10715261 | 3300025917 | Bacteria | 817 |
| 422 | Ga0207660_11240073 | 3300025917 | Bacteria | 606 |
| 423 | Ga0207662_10147710 | 3300025918 | Bacteria | 1493 |
| 424 | Ga0207662_10884643 | 3300025918 | Bacteria | 632 |
| 425 | Ga0207657_10013306 | 3300025919 | Bacteria | 8071 |
| 426 | Ga0207657_10614074 | 3300025919 | Bacteria | 848 |
| 427 | Ga0207649_10219441 | 3300025920 | Bacteria | 1353 |
| 428 | Ga0207649_10669363 | 3300025920 | Bacteria | 803 |
| 429 | Ga0207652_10151116 | 3300025921 | Bacteria | 2079 |
| 430 | Ga0207652_10821484 | 3300025921 | Bacteria | 824 |
| 431 | Ga0207652_11247085 | 3300025921 | Bacteria | 646 |
| 432 | Ga0207681_10342327 | 3300025923 | Bacteria | 1195 |
| 433 | Ga0207694_10094672 | 3300025924 | Bacteria | 2360 |
| 434 | Ga0207694_10102706 | 3300025924 | Bacteria | 2267 |
| 435 | Ga0207694_10112395 | 3300025924 | Bacteria | 2168 |
| 436 | Ga0207694_11746429 | 3300025924 | Bacteria | 523 |
| 437 | Ga0207650_10054601 | 3300025925 | Bacteria | 2964 |
| 438 | Ga0207650_10450491 | 3300025925 | Bacteria | 1071 |
| 439 | Ga0207687_10080834 | 3300025927 | Bacteria | 2347 |
| 440 | Ga0207687_10112631 | 3300025927 | Bacteria | 2022 |
| 441 | Ga0207700_10011770 | 3300025928 | Bacteria | 5599 |
| 442 | Ga0207700_10104400 | 3300025928 | Bacteria | 2267 |
| 443 | Ga0207700_10558448 | 3300025928 | Bacteria | 1017 |
| 444 | Ga0207700_11005589 | 3300025928 | Bacteria | 746 |
| 445 | Ga0207664_10022677 | 3300025929 | Bacteria | 4693 |
| 446 | Ga0207664_10150097 | 3300025929 | Bacteria | 1979 |
| 447 | Ga0207664_10170277 | 3300025929 | Bacteria | 1864 |
| 448 | Ga0207644_10149785 | 3300025931 | Bacteria | 1805 |
| 449 | Ga0207644_10372708 | 3300025931 | Bacteria | 1163 |
| 450 | Ga0207644_10436833 | 3300025931 | Bacteria | 1074 |
| 451 | Ga0207690_10271092 | 3300025932 | Bacteria | 1318 |
| 452 | Ga0207690_10597790 | 3300025932 | Bacteria | 900 |
| 453 | Ga0207690_11079388 | 3300025932 | Bacteria | 669 |
| 454 | Ga0207690_11452344 | 3300025932 | Bacteria | 573 |
| 455 | Ga0207706_10076918 | 3300025933 | Bacteria | 2935 |
| 456 | Ga0207706_10226877 | 3300025933 | Bacteria | 1635 |
| 457 | Ga0207706_10397935 | 3300025933 | Bacteria | 1194 |
| 458 | Ga0207686_10086380 | 3300025934 | Bacteria | 2060 |
| 459 | Ga0207709_10045551 | 3300025935 | Bacteria | 2657 |
| 460 | Ga0207709_10508692 | 3300025935 | Bacteria | 941 |
| 461 | Ga0207709_10651697 | 3300025935 | Bacteria | 838 |
| 462 | Ga0207670_11912688 | 3300025936 | Bacteria | 504 |
| 463 | Ga0207704_10053071 | 3300025938 | Bacteria | 2461 |
| 464 | Ga0207665_10060799 | 3300025939 | Bacteria | 2559 |
| 465 | Ga0207665_10291676 | 3300025939 | Bacteria | 1217 |
| 466 | Ga0207665_10935261 | 3300025939 | Bacteria | 688 |
| 467 | Ga0207691_10070757 | 3300025940 | Bacteria | 3150 |
| 468 | Ga0207691_10717625 | 3300025940 | Bacteria | 843 |
| 469 | Ga0207691_11145066 | 3300025940 | Bacteria | 646 |
| 470 | Ga0207711_10097824 | 3300025941 | Bacteria | 2592 |
| 471 | Ga0207711_10347091 | 3300025941 | Bacteria | 1374 |
| 472 | Ga0207711_10394322 | 3300025941 | Bacteria | 1285 |
| 473 | Ga0207711_10634220 | 3300025941 | Bacteria | 997 |
| 474 | Ga0207711_10803565 | 3300025941 | Bacteria | 876 |
| 475 | Ga0207689_10177305 | 3300025942 | Bacteria | 1757 |
| 476 | Ga0207689_10323960 | 3300025942 | Bacteria | 1279 |
| 477 | Ga0207679_10832385 | 3300025945 | Bacteria | 842 |
| 478 | Ga0207679_10866107 | 3300025945 | Bacteria | 825 |
| 479 | Ga0207679_11091876 | 3300025945 | Bacteria | 732 |
| 480 | Ga0207667_10014502 | 3300025949 | Bacteria | 8982 |
| 481 | Ga0207667_10018032 | 3300025949 | Bacteria | 7928 |
| 482 | Ga0207667_10029597 | 3300025949 | Bacteria | 5937 |
| 483 | Ga0207667_10172989 | 3300025949 | Bacteria | 2219 |
| 484 | Ga0207667_10492627 | 3300025949 | Bacteria | 1243 |
| 485 | Ga0207667_11404221 | 3300025949 | Bacteria | 672 |
| 486 | Ga0207651_10358408 | 3300025960 | Bacteria | 1230 |
| 487 | Ga0207712_10113984 | 3300025961 | Bacteria | 2033 |
| 488 | Ga0207712_10540974 | 3300025961 | Bacteria | 1001 |
| 489 | Ga0207668_10055592 | 3300025972 | Bacteria | 2752 |
| 490 | Ga0207668_10087437 | 3300025972 | Bacteria | 2279 |
| 491 | Ga0207668_10232051 | 3300025972 | Bacteria | 1488 |
| 492 | Ga0207668_10261055 | 3300025972 | Bacteria | 1411 |
| 493 | Ga0207640_10013094 | 3300025981 | Bacteria | 4744 |
| 494 | Ga0207640_10335827 | 3300025981 | Bacteria | 1208 |
| 495 | Ga0207658_10536095 | 3300025986 | Bacteria | 1046 |
| 496 | Ga0207658_11875362 | 3300025986 | Bacteria | 546 |
| 497 | Ga0207658_11876657 | 3300025986 | Bacteria | 546 |
| 498 | Ga0207677_10044422 | 3300026023 | Bacteria | 2960 |
| 499 | Ga0207677_10315756 | 3300026023 | Bacteria | 1297 |
| 500 | Ga0207677_11296302 | 3300026023 | Bacteria | 669 |
| 501 | Ga0207703_10133830 | 3300026035 | Bacteria | 2144 |
| 502 | Ga0207703_10325210 | 3300026035 | Bacteria | 1409 |
| 503 | Ga0207703_11489295 | 3300026035 | Bacteria | 651 |
| 504 | Ga0207703_11645954 | 3300026035 | Bacteria | 617 |
| 505 | Ga0207639_10036729 | 3300026041 | Bacteria | 3633 |
| 506 | Ga0207639_10110958 | 3300026041 | Bacteria | 2235 |
| 507 | Ga0207639_10153997 | 3300026041 | Bacteria | 1929 |
| 508 | Ga0207639_10270415 | 3300026041 | Bacteria | 1490 |
| 509 | Ga0207639_10300762 | 3300026041 | Bacteria | 1418 |
| 510 | Ga0207639_10681735 | 3300026041 | Bacteria | 952 |
| 511 | Ga0207639_10887596 | 3300026041 | Bacteria | 833 |
| 512 | Ga0207639_11793201 | 3300026041 | Bacteria | 574 |
| 513 | Ga0207678_10104065 | 3300026067 | Bacteria | 2422 |
| 514 | Ga0207678_10233586 | 3300026067 | Bacteria | 1575 |
| 515 | Ga0207678_10609310 | 3300026067 | Bacteria | 957 |
| 516 | Ga0207678_10682024 | 3300026067 | Bacteria | 904 |
| 517 | Ga0207678_10702958 | 3300026067 | Bacteria | 890 |
| 518 | Ga0207678_10909348 | 3300026067 | Bacteria | 778 |
| 519 | Ga0207678_11360819 | 3300026067 | Bacteria | 628 |
| 520 | Ga0207708_10053369 | 3300026075 | Bacteria | 3080 |
| 521 | Ga0207702_10029932 | 3300026078 | Bacteria | 4533 |
| 522 | Ga0207702_10055150 | 3300026078 | Bacteria | 3370 |
| 523 | Ga0207702_10080823 | 3300026078 | Bacteria | 2821 |
| 524 | Ga0207702_10146894 | 3300026078 | Bacteria | 2141 |
| 525 | Ga0207702_11284238 | 3300026078 | Bacteria | 726 |
| 526 | Ga0207641_10835299 | 3300026088 | Bacteria | 912 |
| 527 | Ga0207641_11654154 | 3300026088 | Bacteria | 642 |
| 528 | Ga0207648_10040201 | 3300026089 | Bacteria | 4110 |
| 529 | Ga0207648_10451827 | 3300026089 | Bacteria | 1170 |
| 530 | Ga0207648_10886273 | 3300026089 | Bacteria | 833 |
| 531 | Ga0207676_11026102 | 3300026095 | Bacteria | 813 |
| 532 | Ga0207676_11254655 | 3300026095 | Bacteria | 735 |
| 533 | Ga0207674_10003961 | 3300026116 | Bacteria | 18004 |
| 534 | Ga0207674_10346396 | 3300026116 | Bacteria | 1436 |
| 535 | Ga0207675_100099826 | 3300026118 | Bacteria | 2734 |
| 536 | Ga0207675_100280190 | 3300026118 | Bacteria | 1620 |
| 537 | Ga0207675_100795440 | 3300026118 | Bacteria | 959 |
| 538 | Ga0207683_10208925 | 3300026121 | Bacteria | 1776 |
| 539 | Ga0207683_10212430 | 3300026121 | Bacteria | 1761 |
| 540 | Ga0207683_10825021 | 3300026121 | Bacteria | 861 |
| 541 | Ga0207698_10167642 | 3300026142 | Bacteria | 1930 |
| 542 | Ga0207698_10879072 | 3300026142 | Bacteria | 902 |
| 543 | Ga0207698_11221784 | 3300026142 | Bacteria | 766 |
| 544 | Ga0207698_11577883 | 3300026142 | Bacteria | 672 |
| 545 | Ga0207698_11607434 | 3300026142 | Bacteria | 665 |
| 546 | Ga0209389_1000068 | 3300027296 | Bacteria | 98954 |
| 547 | Ga0209389_1000084 | 3300027296 | Bacteria | 85267 |
| 548 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 549 | Ga0209589_1000041 | 3300027357 | Bacteria | 125191 |
| 550 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 551 | Ga0209489_100070 | 3300027361 | Bacteria | 138580 |
| 552 | Ga0209489_126518 | 3300027361 | Bacteria | 814 |
| 553 | Ga0209489_126519 | 3300027361 | Bacteria | 814 |
| 554 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 555 | Ga0209700_100117 | 3300027363 | Bacteria | 115595 |
| 556 | Ga0209588_1113340 | 3300027671 | Bacteria | 870 |
| 557 | Ga0209813_10024452 | 3300027866 | Bacteria | 1728 |
| 558 | Ga0209813_10129339 | 3300027866 | Bacteria | 887 |
| 559 | Ga0268266_10179991 | 3300028379 | Bacteria | 1924 |
| 560 | Ga0268266_10226203 | 3300028379 | Bacteria | 1721 |
| 561 | Ga0268266_10311862 | 3300028379 | Bacteria | 1470 |
| 562 | Ga0268266_11277080 | 3300028379 | Bacteria | 709 |
| 563 | Ga0268265_10552275 | 3300028380 | Bacteria | 1093 |
| 564 | Ga0268265_11093543 | 3300028380 | Bacteria | 791 |
| 565 | Ga0268264_10291245 | 3300028381 | Bacteria | 1533 |
| 566 | Ga0268264_11072380 | 3300028381 | Bacteria | 813 |
| 567 | Ga0265334_10252012 | 3300028573 | Bacteria | 607 |
| 568 | Ga0307517_10002371 | 3300028786 | Bacteria | 30326 |
| 569 | Ga0307517_10475190 | 3300028786 | Bacteria | 642 |
| 570 | Ga0265330_10036375 | 3300031235 | Bacteria | 2195 |
| 571 | Ga0265330_10040331 | 3300031235 | Bacteria | 2074 |
| 572 | Ga0265330_10287949 | 3300031235 | Bacteria | 692 |
| 573 | Ga0265332_10010212 | 3300031238 | Bacteria | 4179 |
| 574 | Ga0265332_10027117 | 3300031238 | Bacteria | 2510 |
| 575 | Ga0265332_10260161 | 3300031238 | Bacteria | 718 |
| 576 | Ga0265328_10212550 | 3300031239 | Bacteria | 736 |
| 577 | Ga0265325_10028245 | 3300031241 | Bacteria | 3025 |
| 578 | Ga0265340_10000375 | 3300031247 | Bacteria | 23722 |
| 579 | Ga0265340_10252895 | 3300031247 | Bacteria | 785 |
| 580 | Ga0265339_10016283 | 3300031249 | Bacteria | 4436 |
| 581 | Ga0265339_10141743 | 3300031249 | Bacteria | 1222 |
| 582 | Ga0265339_10341154 | 3300031249 | Bacteria | 708 |
| 583 | Ga0265331_10171693 | 3300031250 | Bacteria | 981 |
| 584 | Ga0265331_10191472 | 3300031250 | Bacteria | 922 |
| 585 | Ga0307408_100195724 | 3300031548 | Bacteria | 1632 |
| 586 | Ga0265313_10087630 | 3300031595 | Bacteria | 1403 |
| 587 | Ga0265314_10054570 | 3300031711 | Bacteria | 2766 |
| 588 | Ga0265314_10274783 | 3300031711 | Bacteria | 956 |
| 589 | Ga0265342_10040689 | 3300031712 | Bacteria | 2818 |
| 590 | Ga0307516_10147886 | 3300031730 | Bacteria | 2113 |
| 591 | Ga0307405_10315417 | 3300031731 | Bacteria | 1192 |
| 592 | Ga0307412_11302013 | 3300031911 | Bacteria | 654 |
| 593 | Ga0307412_11303951 | 3300031911 | Bacteria | 654 |
| 594 | Ga0307409_100834587 | 3300031995 | Bacteria | 931 |
| 595 | Ga0307416_100305850 | 3300032002 | Bacteria | 1583 |
| 596 | Ga0307416_100442412 | 3300032002 | Bacteria | 1350 |
| 597 | Ga0307411_11046880 | 3300032005 | Bacteria | 733 |
| 598 | Ga0307510_10206466 | 3300033180 | Bacteria | 1492 |
| 599 | Ga0307510_10273830 | 3300033180 | Bacteria | 1162 |
| 600 | Ga0316215_1000403 | 3300033544 | Bacteria | 5173 |
| 601 | Ga0373958_0211203 | 3300034819 | Bacteria | 512 |
| 602 | Ga0373959_0090084 | 3300034820 | Bacteria | 718 |
| 603 | Ga0373938_0090091 | 3300034957 | Bacteria | 758 |
| 604 | Ga0373926_0126259 | 3300035083 | Bacteria | 967 |
| 605 | Ga0373934_0002259 | 3300035086 | Bacteria | 7082 |
| 606 | Ga0373944_0261169 | 3300035089 | Bacteria | 642 |
| 607 | Ga0373944_0312345 | 3300035089 | Bacteria | 592 |
| 608 | Ga0373923_0000561 | 3300035111 | Bacteria | 9120 |
| 609 | Ga0373936_0021847 | 3300035113 | Bacteria | 2490 |
| 610 | Ga0373941_0029854 | 3300035115 | Bacteria | 1612 |
| 611 | Ga0373953_0052617 | 3300035117 | Bacteria | 1648 |
| 612 | Ga0373953_0311020 | 3300035117 | Bacteria | 688 |
| 613 | Ga0373954_0000273 | 3300035118 | Bacteria | 18782 |
| 614 | Ga0373956_0004613 | 3300035119 | Bacteria | 5507 |
| 615 | Ga0373957_0000313 | 3300035120 | Bacteria | 12192 |
| 616 | Ga0373957_0007058 | 3300035120 | Bacteria | 3573 |
| 617 | Ga0373957_0100244 | 3300035120 | Bacteria | 1159 |
| 618 | Ga0373943_0011786 | 3300035170 | Bacteria | 3935 |
| 619 | Ga0373946_0052659 | 3300035171 | Bacteria | 1708 |
| 620 | Ga0373946_0254019 | 3300035171 | Bacteria | 858 |
| 621 | Ga0373946_0763743 | 3300035171 | Bacteria | 508 |
| 622 | Ga0373955_0004906 | 3300035172 | Bacteria | 5968 |
| 623 | Ga0373961_0137836 | 3300035241 | Bacteria | 822 |
| 624 | Ga0373962_0126922 | 3300035242 | Bacteria | 818 |
| 625 | Ga0373924_0001394 | 3300035410 | Bacteria | 7816 |
| 626 | Ga0373931_0048749 | 3300035691 | Bacteria | 2246 |
| 627 | Ga0373931_0228047 | 3300035691 | Bacteria | 1124 |
| 628 | Ga0373935_0032089 | 3300035692 | Bacteria | 3263 |
| 629 | Ga0373935_0111462 | 3300035692 | Bacteria | 1817 |
| 630 | Ga0373935_0116880 | 3300035692 | Bacteria | 1777 |
| 631 | Ga0373935_0445569 | 3300035692 | Bacteria | 935 |
| 632 | Ga0373927_0002786 | 3300035695 | Bacteria | 12762 |
| 633 | Ga0373927_0048423 | 3300035695 | Bacteria | 2749 |
| 634 | Ga0373927_0094557 | 3300035695 | Bacteria | 1942 |
| 635 | Ga0373927_0116391 | 3300035695 | Bacteria | 1743 |
| 636 | Ga0373933_0001950 | 3300035724 | Bacteria | 11904 |
| 637 | Ga0373947_0004007 | 3300035725 | Bacteria | 8651 |
| 638 | Ga0373937_0011586 | 3300036401 | Bacteria | 7741 |
| 639 | Ga0373937_0072826 | 3300036401 | Bacteria | 3169 |
| 640 | Ga0372808_036262 | 3300036459 | Bacteria | 708 |
| 641 | Ga0373925_0001317 | 3300037068 | Bacteria | 21738 |
| 642 | Ga0373925_0494488 | 3300037068 | Bacteria | 1004 |
| 643 | Ga0373925_1241306 | 3300037068 | Bacteria | 612 |
| 644 | Ga0395899_0325946 | 3300037312 | Bacteria | 1033 |
| 645 | Ga0395899_0427478 | 3300037312 | Bacteria | 871 |
| 646 | Ga0395900_0004063 | 3300037418 | Bacteria | 15603 |
| 647 | Ga0395900_0078805 | 3300037418 | Bacteria | 3385 |
| 648 | Ga0395898_0005719 | 3300037466 | Bacteria | 13397 |
| 649 | Ga0395898_0116452 | 3300037466 | Bacteria | 2561 |
| 650 | Ga0395898_1767960 | 3300037466 | Bacteria | 540 |
| 651 | Ga0395905_1227613 | 3300037471 | Bacteria | 653 |
| 652 | Ga0436364_0159664 | 3300037853 | Bacteria | 1088 |
| 653 | Ga0436364_0899798 | 3300037853 | Bacteria | 1758 |
| 654 | Ga0395901_0268694 | 3300038443 | Bacteria | 1774 |
| 655 | Ga0395901_0292119 | 3300038443 | Bacteria | 1691 |
| 656 | Ga0395901_0694699 | 3300038443 | Bacteria | 1016 |
| 657 | Ga0436365_0388356 | 3300039437 | Bacteria | 551 |
| 658 | Ga0436361_0111464 | 3300039447 | Bacteria | 1515 |
| 659 | Ga0436363_0689938 | 3300039450 | Bacteria | 578 |
| 660 | Ga0451793_0059355 | 3300041452 | Bacteria | 2314 |
| 661 | Ga0451793_0690763 | 3300041452 | Bacteria | 580 |
| 662 | Ga0451797_0198863 | 3300041453 | Bacteria | 1200 |
| 663 | Ga0451795_0747937 | 3300041456 | Bacteria | 504 |
| 664 | Ga0451835_1266689 | 3300041492 | Bacteria | 816 |
| 665 | Ga0451847_0967965 | 3300041503 | Bacteria | 858 |
| 666 | Ga0451853_2604563 | 3300041512 | Bacteria | 577 |
| 667 | Ga0466969_0269529 | 3300044656 | Bacteria | 771 |
| 668 | Ga0466965_0154127 | 3300044683 | Bacteria | 1202 |
| 669 | Ga0466966_0001701 | 3300044684 | Bacteria | 14207 |
| 670 | Ga0466961_0000064 | 3300044693 | Bacteria | 63553 |
| 671 | Ga0466961_0822756 | 3300044693 | Bacteria | 554 |
| 672 | Ga0466963_0023676 | 3300044694 | Bacteria | 3902 |
| 673 | Ga0466963_0270068 | 3300044694 | Bacteria | 1195 |
| 674 | Ga0466968_0019847 | 3300044735 | Bacteria | 2709 |
| 675 | Ga0466968_0033041 | 3300044735 | Bacteria | 2155 |
| 676 | Ga0466968_0104300 | 3300044735 | Bacteria | 1269 |
| 677 | Ga0466970_0131370 | 3300044765 | Bacteria | 1376 |
| 678 | Ga0466957_0097815 | 3300044842 | Bacteria | 1846 |
| 679 | Ga0466957_1209508 | 3300044842 | Bacteria | 547 |
| 680 | Ga0466960_0092264 | 3300044901 | Bacteria | 1546 |
| 681 | Ga0466959_0004743 | 3300045049 | Bacteria | 9159 |
| 682 | Ga0466967_0019942 | 3300045976 | Bacteria | 5405 |
| 683 | Ga0466967_0103843 | 3300045976 | Bacteria | 2601 |
| 684 | Ga0466967_0545088 | 3300045976 | Bacteria | 1141 |
| 685 | Ga0495592_0003384 | 3300046454 | Bacteria | 11438 |
| 686 | Ga0495592_0075234 | 3300046454 | Bacteria | 2452 |
| 687 | Ga0495592_0308956 | 3300046454 | Bacteria | 1025 |
| 688 | Ga0495603_0005350 | 3300046455 | Bacteria | 7655 |
| 689 | Ga0495603_0243677 | 3300046455 | Bacteria | 1035 |
| 690 | Ga0495590_0103762 | 3300046457 | Bacteria | 1011 |
| 691 | Ga0495590_0145587 | 3300046457 | Bacteria | 857 |
| 692 | Ga0495590_0306525 | 3300046457 | Bacteria | 598 |
| 693 | Ga0495629_0000581 | 3300046459 | Bacteria | 29697 |
| 694 | Ga0495629_0004536 | 3300046459 | Bacteria | 10393 |
| 695 | Ga0495629_0084445 | 3300046459 | Bacteria | 2215 |
| 696 | Ga0495638_0161042 | 3300046460 | Bacteria | 1294 |
| 697 | Ga0495641_0013094 | 3300046461 | Bacteria | 4584 |
| 698 | Ga0495651_0004932 | 3300046462 | Bacteria | 10203 |
| 699 | Ga0495651_0011399 | 3300046462 | Bacteria | 6830 |
| 700 | Ga0495651_0106525 | 3300046462 | Bacteria | 2078 |
| 701 | Ga0495651_0402526 | 3300046462 | Bacteria | 893 |
| 702 | Ga0495653_0002259 | 3300046463 | Bacteria | 15242 |
| 703 | Ga0495653_0472606 | 3300046463 | Bacteria | 785 |
| 704 | Ga0495580_0065208 | 3300046472 | Bacteria | 2551 |
| 705 | Ga0495582_0000528 | 3300046473 | Bacteria | 21108 |
| 706 | Ga0495582_0567799 | 3300046473 | Bacteria | 656 |
| 707 | Ga0495605_0090501 | 3300046474 | Bacteria | 1419 |
| 708 | Ga0495605_0108498 | 3300046474 | Bacteria | 1269 |
| 709 | Ga0495639_0000044 | 3300046475 | Bacteria | 55019 |
| 710 | Ga0495639_0203577 | 3300046475 | Bacteria | 969 |
| 711 | Ga0495662_0001271 | 3300046476 | Bacteria | 12462 |
| 712 | Ga0495664_0015612 | 3300046477 | Bacteria | 4319 |
| 713 | Ga0495664_0287814 | 3300046477 | Bacteria | 992 |
| 714 | Ga0495584_0408608 | 3300046491 | Bacteria | 690 |
| 715 | Ga0495585_0104343 | 3300046492 | Bacteria | 1513 |
| 716 | Ga0495585_0399262 | 3300046492 | Bacteria | 662 |
| 717 | Ga0495594_0000351 | 3300046499 | Bacteria | 23112 |
| 718 | Ga0495594_0061151 | 3300046499 | Bacteria | 2084 |
| 719 | Ga0495594_0089094 | 3300046499 | Bacteria | 1728 |
| 720 | Ga0495594_0344380 | 3300046499 | Bacteria | 849 |
| 721 | Ga0495596_0209539 | 3300046500 | Bacteria | 757 |
| 722 | Ga0495596_0254674 | 3300046500 | Bacteria | 681 |
| 723 | Ga0495583_0305329 | 3300046506 | Bacteria | 632 |
| 724 | Ga0495606_0030295 | 3300046507 | Bacteria | 3782 |
| 725 | Ga0495606_0568819 | 3300046507 | Bacteria | 561 |
| 726 | Ga0495608_0002317 | 3300046511 | Bacteria | 13740 |
| 727 | Ga0495608_0015452 | 3300046511 | Bacteria | 5294 |
| 728 | Ga0495610_0289571 | 3300046512 | Bacteria | 635 |
| 729 | Ga0495618_0078803 | 3300046514 | Bacteria | 2100 |
| 730 | Ga0495618_0217737 | 3300046514 | Bacteria | 1205 |
| 731 | Ga0495618_0430717 | 3300046514 | Bacteria | 803 |
| 732 | Ga0495618_0645519 | 3300046514 | Bacteria | 626 |
| 733 | Ga0495628_0041294 | 3300046516 | Bacteria | 3682 |
| 734 | Ga0495628_0272250 | 3300046516 | Bacteria | 1259 |
| 735 | Ga0495628_0606531 | 3300046516 | Bacteria | 781 |
| 736 | Ga0495628_0959312 | 3300046516 | Bacteria | 590 |
| 737 | Ga0495630_0129606 | 3300046517 | Bacteria | 1915 |
| 738 | Ga0495630_0426812 | 3300046517 | Bacteria | 1016 |
| 739 | Ga0495630_0612377 | 3300046517 | Bacteria | 835 |
| 740 | Ga0495630_1363484 | 3300046517 | Bacteria | 534 |
| 741 | Ga0495631_0131348 | 3300046518 | Bacteria | 1076 |
| 742 | Ga0495632_0066789 | 3300046519 | Bacteria | 1735 |
| 743 | Ga0495632_0296362 | 3300046519 | Bacteria | 718 |
| 744 | Ga0495643_0021099 | 3300046522 | Bacteria | 3743 |
| 745 | Ga0495644_0022030 | 3300046523 | Bacteria | 2429 |
| 746 | Ga0495648_0005365 | 3300046524 | Bacteria | 10672 |
| 747 | Ga0495648_0201345 | 3300046524 | Bacteria | 996 |
| 748 | Ga0495648_0242298 | 3300046524 | Bacteria | 875 |
| 749 | Ga0495648_0371214 | 3300046524 | Bacteria | 647 |
| 750 | Ga0495666_0234677 | 3300046526 | Bacteria | 838 |
| 751 | Ga0495642_0403396 | 3300046528 | Bacteria | 603 |
| 752 | Ga0495652_0044737 | 3300046529 | Bacteria | 3811 |
| 753 | Ga0495652_0046914 | 3300046529 | Bacteria | 3707 |
| 754 | Ga0495652_0059768 | 3300046529 | Bacteria | 3224 |
| 755 | Ga0495654_0345832 | 3300046530 | Bacteria | 599 |
| 756 | Ga0495665_0000397 | 3300046531 | Bacteria | 22124 |
| 757 | Ga0495640_0006961 | 3300046533 | Bacteria | 8903 |
| 758 | Ga0495640_0028817 | 3300046533 | Bacteria | 3993 |
| 759 | Ga0495640_0081266 | 3300046533 | Bacteria | 2154 |
| 760 | Ga0495640_0126000 | 3300046533 | Bacteria | 1661 |
| 761 | Ga0495586_0078554 | 3300046535 | Bacteria | 1811 |
| 762 | Ga0495587_0024998 | 3300046536 | Bacteria | 3654 |
| 763 | Ga0495587_0269695 | 3300046536 | Bacteria | 955 |
| 764 | Ga0495598_0016689 | 3300046537 | Bacteria | 1879 |
| 765 | Ga0495609_0148382 | 3300046538 | Bacteria | 998 |
| 766 | Ga0495609_0163201 | 3300046538 | Bacteria | 943 |
| 767 | Ga0495609_0256532 | 3300046538 | Bacteria | 719 |
| 768 | Ga0495621_0016641 | 3300046539 | Bacteria | 2363 |
| 769 | Ga0495645_0087030 | 3300046543 | Bacteria | 2235 |
| 770 | Ga0495645_0914633 | 3300046543 | Bacteria | 520 |
| 771 | Ga0495622_0002861 | 3300046557 | Bacteria | 8237 |
| 772 | Ga0495622_0028361 | 3300046557 | Bacteria | 2614 |
| 773 | Ga0495633_0018819 | 3300046558 | Bacteria | 3500 |
| 774 | Ga0495633_0040307 | 3300046558 | Bacteria | 2225 |
| 775 | Ga0495667_0000359 | 3300046559 | Bacteria | 28998 |
| 776 | Ga0495667_0012846 | 3300046559 | Bacteria | 5673 |
| 777 | Ga0495667_0121591 | 3300046559 | Bacteria | 1685 |
| 778 | Ga0495667_0653687 | 3300046559 | Bacteria | 653 |
| 779 | Ga0495656_0040458 | 3300046615 | Bacteria | 1943 |
| 780 | Ga0495668_0079760 | 3300046616 | Bacteria | 1796 |
| 781 | Ga0495668_0270182 | 3300046616 | Bacteria | 931 |
| 782 | Ga0495634_0000252 | 3300046642 | Bacteria | 50709 |
| 783 | Ga0495634_0012038 | 3300046642 | Bacteria | 6271 |
| 784 | Ga0495634_0115615 | 3300046642 | Bacteria | 1722 |
| 785 | Ga0495634_0163912 | 3300046642 | Bacteria | 1400 |
| 786 | Ga0495611_0362112 | 3300046648 | Bacteria | 665 |
| 787 | Ga0495611_0456807 | 3300046648 | Bacteria | 582 |
| 788 | Ga0495625_0286459 | 3300046660 | Bacteria | 1058 |
| 789 | Ga0495625_0388348 | 3300046660 | Bacteria | 874 |
| 790 | Ga0495635_0000251 | 3300046663 | Bacteria | 34185 |
| 791 | Ga0495635_0004777 | 3300046663 | Bacteria | 9417 |
| 792 | Ga0495635_0008104 | 3300046663 | Bacteria | 7341 |
| 793 | Ga0495635_0293417 | 3300046663 | Bacteria | 1091 |
| 794 | Ga0495635_0746670 | 3300046663 | Bacteria | 633 |
| 795 | Ga0495659_0037018 | 3300046664 | Bacteria | 1727 |
| 796 | Ga0495661_0272002 | 3300046665 | Bacteria | 857 |
| 797 | Ga0495661_0370201 | 3300046665 | Bacteria | 702 |
| 798 | Ga0495588_0006813 | 3300046674 | Bacteria | 5173 |
| 799 | Ga0495588_0118258 | 3300046674 | Bacteria | 1397 |
| 800 | Ga0495657_0005246 | 3300046675 | Bacteria | 10258 |
| 801 | Ga0495657_0042021 | 3300046675 | Bacteria | 3124 |
| 802 | Ga0495657_0053434 | 3300046675 | Bacteria | 2703 |
| 803 | Ga0495657_0800501 | 3300046675 | Bacteria | 539 |
| 804 | Ga0495599_0000305 | 3300046678 | Bacteria | 29662 |
| 805 | Ga0495599_0610490 | 3300046678 | Bacteria | 634 |
| 806 | Ga0495623_0001012 | 3300046679 | Bacteria | 18985 |
| 807 | Ga0495623_0208049 | 3300046679 | Bacteria | 1121 |
| 808 | Ga0495623_0541637 | 3300046679 | Bacteria | 610 |
| 809 | Ga0495646_0055175 | 3300046680 | Bacteria | 2387 |
| 810 | Ga0495647_0003477 | 3300046681 | Bacteria | 5038 |
| 811 | Ga0495658_0009797 | 3300046683 | Bacteria | 4776 |
| 812 | Ga0495658_0823973 | 3300046683 | Bacteria | 594 |
| 813 | Ga0495669_0053388 | 3300046684 | Bacteria | 1817 |
| 814 | Ga0495669_0055937 | 3300046684 | Bacteria | 1778 |
| 815 | Ga0495613_0013328 | 3300046689 | Bacteria | 6107 |
| 816 | Ga0495613_0055277 | 3300046689 | Bacteria | 2917 |
| 817 | Ga0495613_0132640 | 3300046689 | Bacteria | 1783 |
| 818 | Ga0495624_0000832 | 3300046690 | Bacteria | 24417 |
| 819 | Ga0495624_0144788 | 3300046690 | Bacteria | 1454 |
| 820 | Ga0495624_0449920 | 3300046690 | Bacteria | 772 |
| 821 | Ga0495670_0172201 | 3300046691 | Bacteria | 1140 |
| 822 | Ga0495670_0506459 | 3300046691 | Bacteria | 656 |
| 823 | Ga0495649_0188463 | 3300046694 | Bacteria | 1074 |
| 824 | Ga0495649_0428360 | 3300046694 | Bacteria | 662 |
| 825 | Ga0495589_0331526 | 3300046794 | Bacteria | 702 |
| 826 | Ga0495600_0001567 | 3300046809 | Bacteria | 12723 |
| 827 | Ga0495600_0046355 | 3300046809 | Bacteria | 2836 |
| 828 | Ga0495581_0004430 | 3300047315 | Bacteria | 8116 |
| 829 | Ga0495581_0160997 | 3300047315 | Bacteria | 1312 |
| 830 | Ga0495604_0013917 | 3300047317 | Bacteria | 6416 |
| 831 | Ga0495604_0095991 | 3300047317 | Bacteria | 2189 |
| 832 | Ga0495604_0097526 | 3300047317 | Bacteria | 2167 |
| 833 | Ga0495604_0181603 | 3300047317 | Bacteria | 1471 |
| 834 | Ga0495636_0488091 | 3300047318 | Bacteria | 595 |
| 835 | Ga0495674_0012961 | 3300047319 | Bacteria | 7848 |
| 836 | Ga0495674_0020357 | 3300047319 | Bacteria | 6143 |
| 837 | Ga0495674_0095708 | 3300047319 | Bacteria | 2531 |
| 838 | Ga0495674_0373305 | 3300047319 | Bacteria | 1155 |
| 839 | Ga0495674_0994739 | 3300047319 | Bacteria | 643 |
| 840 | Ga0495672_0026351 | 3300047320 | Bacteria | 3710 |
| 841 | Ga0495672_0198189 | 3300047320 | Bacteria | 1006 |
| 842 | Ga0495676_0025127 | 3300047321 | Bacteria | 5146 |
| 843 | Ga0495676_0042368 | 3300047321 | Bacteria | 3738 |
| 844 | Ga0495676_0130134 | 3300047321 | Bacteria | 1818 |
| 845 | Ga0495676_0663042 | 3300047321 | Bacteria | 676 |
| 846 | Ga0495680_0004040 | 3300047322 | Bacteria | 14143 |
| 847 | Ga0495680_0019046 | 3300047322 | Bacteria | 5809 |
| 848 | Ga0495680_0070812 | 3300047322 | Bacteria | 2657 |
| 849 | Ga0495683_0016620 | 3300047323 | Bacteria | 3820 |
| 850 | Ga0495683_0018489 | 3300047323 | Bacteria | 3603 |
| 851 | Ga0495683_0289283 | 3300047323 | Bacteria | 707 |
| 852 | Ga0495675_0012888 | 3300047444 | Bacteria | 5267 |
| 853 | Ga0495675_0023093 | 3300047444 | Bacteria | 3963 |
| 854 | Ga0495685_135450 | 3300047447 | Bacteria | 804 |
| 855 | Ga0495673_0095006 | 3300047469 | Bacteria | 1213 |
| 856 | Ga0495673_0134010 | 3300047469 | Bacteria | 971 |
| 857 | Ga0495673_0284528 | 3300047469 | Bacteria | 596 |
| 858 | Ga0495681_0097243 | 3300047470 | Bacteria | 1292 |
| 859 | Ga0495681_0213557 | 3300047470 | Bacteria | 777 |
| 860 | Ga0495684_0000297 | 3300047471 | Bacteria | 40486 |
| 861 | Ga0495684_0065459 | 3300047471 | Bacteria | 2763 |
| 862 | Ga0495684_0617417 | 3300047471 | Bacteria | 729 |
| 863 | Ga0495686_0064501 | 3300047472 | Bacteria | 2267 |
| 864 | Ga0495686_0652492 | 3300047472 | Bacteria | 540 |
| 865 | Ga0495593_0000353 | 3300047673 | Bacteria | 25428 |
| 866 | Ga0495593_0000354 | 3300047673 | Bacteria | 25361 |
| 867 | Ga0495593_0295441 | 3300047673 | Bacteria | 810 |
| 868 | Ga0495602_0034391 | 3300048088 | Bacteria | 4741 |
| 869 | Ga0495602_0043460 | 3300048088 | Bacteria | 4084 |
| 870 | Ga0495602_0116200 | 3300048088 | Bacteria | 2162 |
| 871 | Ga0495602_0364883 | 3300048088 | Bacteria | 1039 |
| 872 | Ga0495614_0029542 | 3300048089 | Bacteria | 2360 |
| 873 | Ga0495626_0072272 | 3300048091 | Bacteria | 1548 |
| 874 | Ga0496100_0194276 | 3300048903 | Bacteria | 1475 |
| 875 | Ga0496100_0204377 | 3300048903 | Bacteria | 1441 |
| 876 | Ga0496100_0331885 | 3300048903 | Bacteria | 1145 |
| 877 | Ga0496100_0748634 | 3300048903 | Bacteria | 764 |
| 878 | Ga0496101_0040852 | 3300048904 | Bacteria | 3304 |
| 879 | Ga0496101_0065283 | 3300048904 | Bacteria | 2653 |
| 880 | Ga0496101_0275948 | 3300048904 | Bacteria | 1313 |
| 881 | Ga0496101_0301976 | 3300048904 | Bacteria | 1254 |
| 882 | Ga0496101_1082444 | 3300048904 | Bacteria | 630 |
| 883 | Ga0496102_0018941 | 3300048905 | Bacteria | 6056 |
| 884 | Ga0496102_0220536 | 3300048905 | Bacteria | 1788 |
| 885 | Ga0496102_0284506 | 3300048905 | Bacteria | 1558 |
| 886 | Ga0496102_0297898 | 3300048905 | Bacteria | 1520 |
| 887 | Ga0496102_0349357 | 3300048905 | Bacteria | 1392 |
| 888 | Ga0496102_0404688 | 3300048905 | Bacteria | 1283 |
| 889 | Ga0496102_0477994 | 3300048905 | Bacteria | 1167 |
| 890 | Ga0496103_0032398 | 3300048906 | Bacteria | 3190 |
| 891 | Ga0496103_0047180 | 3300048906 | Bacteria | 2661 |
| 892 | Ga0496104_0003628 | 3300048907 | Bacteria | 13337 |
| 893 | Ga0496104_0006867 | 3300048907 | Bacteria | 10035 |
| 894 | Ga0496104_0028291 | 3300048907 | Bacteria | 5195 |
| 895 | Ga0496104_0098535 | 3300048907 | Bacteria | 2798 |
| 896 | Ga0496105_0005048 | 3300048908 | Bacteria | 9996 |
| 897 | Ga0496105_0030914 | 3300048908 | Bacteria | 4389 |
| 898 | Ga0496105_0035621 | 3300048908 | Bacteria | 4096 |
| 899 | Ga0496105_0124790 | 3300048908 | Bacteria | 2122 |
| 900 | Ga0496106_0032366 | 3300048909 | Bacteria | 3899 |
| 901 | Ga0496106_0085320 | 3300048909 | Bacteria | 2431 |
| 902 | Ga0496106_0087123 | 3300048909 | Bacteria | 2406 |
| 903 | Ga0496106_0705097 | 3300048909 | Bacteria | 804 |
| 904 | Ga0496106_0950907 | 3300048909 | Bacteria | 677 |
| 905 | Ga0496106_1361958 | 3300048909 | Bacteria | 549 |
| 906 | Ga0496107_0011454 | 3300048910 | Bacteria | 6178 |
| 907 | Ga0496107_0014705 | 3300048910 | Bacteria | 5479 |
| 908 | Ga0496107_0140329 | 3300048910 | Bacteria | 1786 |
| 909 | Ga0496107_0207012 | 3300048910 | Bacteria | 1458 |
| 910 | Ga0496107_0209897 | 3300048910 | Bacteria | 1448 |
| 911 | Ga0496107_0284408 | 3300048910 | Bacteria | 1231 |
| 912 | Ga0496108_0029559 | 3300048911 | Bacteria | 4540 |
| 913 | Ga0496108_0125044 | 3300048911 | Bacteria | 2207 |
| 914 | Ga0496108_0138973 | 3300048911 | Bacteria | 2092 |
| 915 | Ga0496108_0423084 | 3300048911 | Bacteria | 1163 |
| 916 | Ga0496108_1108959 | 3300048911 | Bacteria | 672 |
| 917 | Ga0496109_0227289 | 3300048912 | Bacteria | 1755 |
| 918 | Ga0496109_0284667 | 3300048912 | Bacteria | 1558 |
| 919 | Ga0496110_0058995 | 3300048913 | Bacteria | 3381 |
| 920 | Ga0496110_0074927 | 3300048913 | Bacteria | 3006 |
| 921 | Ga0496110_0125698 | 3300048913 | Bacteria | 2313 |
| 922 | Ga0496111_0026206 | 3300048914 | Bacteria | 4116 |
| 923 | Ga0496111_0115837 | 3300048914 | Bacteria | 1976 |
| 924 | Ga0496111_0259109 | 3300048914 | Bacteria | 1290 |
| 925 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 926 | Ga0496112_0000992 | 3300048915 | Bacteria | 20760 |
| 927 | Ga0496112_0023912 | 3300048915 | Bacteria | 5845 |
| 928 | Ga0496112_0080896 | 3300048915 | Bacteria | 3212 |
| 929 | Ga0496112_0270245 | 3300048915 | Bacteria | 1648 |
| 930 | Ga0496113_0101567 | 3300048916 | Bacteria | 2229 |
| 931 | Ga0496113_0267807 | 3300048916 | Bacteria | 1365 |
| 932 | Ga0496113_0326550 | 3300048916 | Bacteria | 1230 |
| 933 | Ga0496113_0352388 | 3300048916 | Bacteria | 1181 |
| 934 | Ga0496114_0079724 | 3300048917 | Bacteria | 2764 |
| 935 | Ga0496114_0119923 | 3300048917 | Bacteria | 2262 |
| 936 | Ga0496114_0366075 | 3300048917 | Bacteria | 1275 |
| 937 | Ga0496114_0404332 | 3300048917 | Bacteria | 1209 |
| 938 | Ga0496115_0015081 | 3300048918 | Bacteria | 5857 |
| 939 | Ga0496115_0024858 | 3300048918 | Bacteria | 4659 |
| 940 | Ga0496115_0129789 | 3300048918 | Bacteria | 2077 |
| 941 | Ga0496115_0143029 | 3300048918 | Bacteria | 1973 |
| 942 | Ga0496115_0182940 | 3300048918 | Bacteria | 1732 |
| 943 | Ga0496115_0242538 | 3300048918 | Bacteria | 1485 |
| 944 | Ga0496116_0032971 | 3300048919 | Bacteria | 3683 |
| 945 | Ga0496116_0138010 | 3300048919 | Bacteria | 1377 |
| 946 | Ga0496117_0043874 | 3300048920 | Bacteria | 3245 |
| 947 | Ga0496117_0058877 | 3300048920 | Bacteria | 2658 |
| 948 | Ga0496118_0051558 | 3300048921 | Bacteria | 3147 |
| 949 | Ga0496118_0093767 | 3300048921 | Bacteria | 2055 |
| 950 | Ga0496118_0105830 | 3300048921 | Bacteria | 1884 |
| 951 | Ga0496119_0015494 | 3300048922 | Bacteria | 5863 |
| 952 | Ga0496119_0046477 | 3300048922 | Bacteria | 2710 |
| 953 | Ga0496119_0190509 | 3300048922 | Bacteria | 1069 |
| 954 | Ga0496120_0017309 | 3300048923 | Bacteria | 4679 |
| 955 | Ga0496121_0009741 | 3300048924 | Bacteria | 10988 |
| 956 | Ga0496121_0080061 | 3300048924 | Bacteria | 2591 |
| 957 | Ga0496121_0251104 | 3300048924 | Bacteria | 1227 |
| 958 | Ga0496121_0348964 | 3300048924 | Bacteria | 986 |
| 959 | Ga0496122_0096470 | 3300048925 | Bacteria | 1994 |
| 960 | Ga0496124_0165086 | 3300048927 | Bacteria | 1722 |
| 961 | Ga0496124_0174939 | 3300048927 | Bacteria | 1658 |
| 962 | Ga0496124_0212824 | 3300048927 | Bacteria | 1461 |
| 963 | Ga0496124_0473024 | 3300048927 | Bacteria | 848 |
| 964 | Ga0496124_0666093 | 3300048927 | Bacteria | 665 |
| 965 | Ga0496125_0025883 | 3300048928 | Bacteria | 5362 |
| 966 | Ga0496125_0075151 | 3300048928 | Bacteria | 2616 |
| 967 | Ga0496125_0087691 | 3300048928 | Bacteria | 2349 |
| 968 | Ga0496125_0105915 | 3300048928 | Bacteria | 2054 |
| 969 | Ga0496125_0300709 | 3300048928 | Bacteria | 983 |
| 970 | Ga0496126_0006093 | 3300048929 | Bacteria | 13526 |
| 971 | Ga0496126_0021321 | 3300048929 | Bacteria | 6329 |
| 972 | Ga0496126_0023638 | 3300048929 | Bacteria | 5954 |
| 973 | Ga0496126_0176252 | 3300048929 | Bacteria | 1818 |
| 974 | Ga0496126_0272766 | 3300048929 | Bacteria | 1403 |
| 975 | Ga0496126_0300590 | 3300048929 | Bacteria | 1324 |
| 976 | Ga0496126_0508734 | 3300048929 | Bacteria | 961 |
| 977 | Ga0496126_0534418 | 3300048929 | Bacteria | 933 |
| 978 | Ga0496126_0623967 | 3300048929 | Bacteria | 847 |
| 979 | Ga0496126_0736643 | 3300048929 | Bacteria | 762 |
| 980 | Ga0496126_0876925 | 3300048929 | Bacteria | 682 |
| 981 | Ga0496126_1002157 | 3300048929 | Bacteria | 627 |
| 982 | Ga0495678_187774 | 3300049459 | Bacteria | 644 |
| 983 | Ga0501032_0311861 | 3300049569 | Bacteria | 1016 |
| 984 | Ga0501047_0063880 | 3300049581 | Bacteria | 3551 |
| 985 | Ga0501070_0017157 | 3300049586 | Bacteria | 6077 |
| 986 | Ga0501074_0013275 | 3300049590 | Bacteria | 5989 |
| 987 | Ga0501079_0940544 | 3300049741 | Bacteria | 681 |
| 988 | Ga0501080_0018387 | 3300049742 | Bacteria | 6469 |
| 989 | Ga0501044_0058485 | 3300049823 | Bacteria | 3953 |
| 990 | nmdc:mga03683_118285_c2 | 3300050489 | Bacteria | 721 |
| 991 | nmdc:mga03683_130443_c1 | 3300050489 | Bacteria | 1124 |
| 992 | nmdc:mga03n38_363681_c1 | 3300050490 | Bacteria | 790 |
| 993 | nmdc:mga00v17_115026_c1 | 3300050491 | Bacteria | 1709 |
| 994 | nmdc:mga00v17_259613_c1 | 3300050491 | Bacteria | 1127 |
| 995 | nmdc:mga00v17_468493_c1 | 3300050491 | Bacteria | 817 |
| 996 | nmdc:mga0yw44_10663_c1 | 3300050492 | Bacteria | 4705 |
| 997 | nmdc:mga0yw44_185119_c1 | 3300050492 | Bacteria | 1372 |
| 998 | nmdc:mga0yw44_351928_c1 | 3300050492 | Bacteria | 992 |
| 999 | nmdc:mga0yw44_46808_c1 | 3300050492 | Bacteria | 2600 |
| 1000 | nmdc:mga0yw44_633414_c1 | 3300050492 | Bacteria | 727 |
| 1001 | nmdc:mga0yw44_75034_c1 | 3300050492 | Bacteria | 2108 |
| 1002 | nmdc:mga0k408_125733_c1 | 3300050493 | Bacteria | 1521 |
| 1003 | nmdc:mga0k408_294680_c1 | 3300050493 | Bacteria | 968 |
| 1004 | nmdc:mga0k408_404199_c1 | 3300050493 | Bacteria | 813 |
| 1005 | nmdc:mga0k408_98906_c2 | 3300050493 | Bacteria | 689 |
| 1006 | nmdc:mga06z11_110149_c1 | 3300050494 | Bacteria | 1523 |
| 1007 | nmdc:mga06z11_123298_c1 | 3300050494 | Bacteria | 1448 |
| 1008 | nmdc:mga04h51_227627_c1 | 3300050495 | Bacteria | 741 |
| 1009 | nmdc:mga04h51_33249_c1 | 3300050495 | Bacteria | 1641 |
| 1010 | nmdc:mga07m45_136166_c1 | 3300050496 | Bacteria | 1422 |
| 1011 | nmdc:mga07m45_349009_c1 | 3300050496 | Bacteria | 860 |
| 1012 | nmdc:mga07m45_86850_c1 | 3300050496 | Bacteria | 1789 |
| 1013 | nmdc:mga05p37_223714_c1 | 3300050507 | Bacteria | 2270 |
| 1014 | nmdc:mga0n895_292136_c1 | 3300050512 | Bacteria | 1652 |
| 1015 | nmdc:mga0n895_843011_c1 | 3300050512 | Bacteria | 905 |
| 1016 | nmdc:mga0rr50_1568498_c1 | 3300050513 | Bacteria | 556 |
| 1017 | nmdc:mga08x19_274042_c1 | 3300050514 | Bacteria | 1168 |
| 1018 | nmdc:mga0a205_1308477_c1 | 3300050515 | Bacteria | 572 |
| 1019 | nmdc:mga0sz30_15675_c1 | 3300050516 | Bacteria | 2997 |
| 1020 | nmdc:mga0sz30_238319_c1 | 3300050516 | Bacteria | 810 |
| 1021 | nmdc:mga0sz30_422440_c1 | 3300050516 | Bacteria | 598 |
| 1022 | nmdc:mga0sz30_47091_c1 | 3300050516 | Bacteria | 1822 |
| 1023 | nmdc:mga0sz30_47659_c1 | 3300050516 | Bacteria | 1811 |
| 1024 | Ga0495601_0055289 | 3300053077 | Bacteria | 2513 |
| 1025 | Ga0495601_0524500 | 3300053077 | Bacteria | 763 |
| 1026 | Ga0495601_0642899 | 3300053077 | Bacteria | 679 |
| 1027 | Ga0500610_0143868 | 3300053079 | Bacteria | 1201 |
| 1028 | Ga0500635_0098504 | 3300053080 | Bacteria | 1072 |
| 1029 | Ga0495655_0002827 | 3300053083 | Bacteria | 2794 |
| 1030 | Ga0495655_0003704 | 3300053083 | Bacteria | 2547 |
| 1031 | Ga0495655_0058175 | 3300053083 | Bacteria | 1046 |
| 1032 | Ga0495655_0066522 | 3300053083 | Bacteria | 997 |
| 1033 | Ga0495595_0001211 | 3300053084 | Bacteria | 10032 |
| 1034 | Ga0495595_0007545 | 3300053084 | Bacteria | 4453 |
| 1035 | Ga0495619_0001922 | 3300053085 | Bacteria | 13848 |
| 1036 | Ga0495619_0026539 | 3300053085 | Bacteria | 3727 |
| 1037 | Ga0495619_0948117 | 3300053085 | Bacteria | 577 |
| 1038 | Ga0495619_1061202 | 3300053085 | Bacteria | 540 |
| 1039 | Ga0500578_0538260 | 3300053086 | Bacteria | 651 |
| 1040 | Ga0500578_0591572 | 3300053086 | Bacteria | 611 |
| 1041 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 1042 | Ga0500644_0042470 | 3300053088 | Bacteria | 1516 |
| 1043 | Ga0500583_0221286 | 3300053092 | Bacteria | 938 |
| 1044 | Ga0500566_0000171 | 3300053094 | Bacteria | 32979 |
| 1045 | Ga0500566_0454023 | 3300053094 | Bacteria | 561 |
| 1046 | Ga0500640_017219 | 3300053095 | Bacteria | 3062 |
| 1047 | Ga0500641_0078870 | 3300053096 | Bacteria | 1395 |
| 1048 | Ga0500650_0391966 | 3300053098 | Bacteria | 602 |
| 1049 | Ga0500557_000001 | 3300053105 | Bacteria | 241298 |
| 1050 | Ga0500562_007899 | 3300053108 | Bacteria | 2687 |
| 1051 | Ga0500569_001417 | 3300053109 | Bacteria | 4512 |
| 1052 | Ga0500572_014491 | 3300053111 | Bacteria | 1971 |
| 1053 | Ga0500592_006946 | 3300053116 | Bacteria | 1801 |
| 1054 | Ga0500594_0007738 | 3300053118 | Bacteria | 2437 |
| 1055 | Ga0500595_067485 | 3300053119 | Bacteria | 1067 |
| 1056 | Ga0500595_104134 | 3300053119 | Bacteria | 811 |
| 1057 | Ga0500597_213422 | 3300053120 | Bacteria | 805 |
| 1058 | Ga0500597_297190 | 3300053120 | Bacteria | 646 |
| 1059 | Ga0500607_132854 | 3300053121 | Bacteria | 1183 |
| 1060 | Ga0500614_160671 | 3300053123 | Bacteria | 680 |
| 1061 | Ga0500642_0000170 | 3300053130 | Bacteria | 26891 |
| 1062 | Ga0500642_0050484 | 3300053130 | Bacteria | 1834 |
| 1063 | Ga0500642_0191998 | 3300053130 | Bacteria | 952 |
| 1064 | Ga0500559_0380230 | 3300053136 | Bacteria | 658 |
| 1065 | Ga0500564_175782 | 3300053138 | Bacteria | 896 |
| 1066 | Ga0500568_0025821 | 3300053139 | Bacteria | 2472 |
| 1067 | Ga0500568_0182519 | 3300053139 | Bacteria | 771 |
| 1068 | Ga0500577_0373662 | 3300053142 | Bacteria | 623 |
| 1069 | Ga0500588_0262793 | 3300053146 | Bacteria | 649 |
| 1070 | Ga0500590_123882 | 3300053148 | Bacteria | 1206 |
| 1071 | Ga0500590_191676 | 3300053148 | Bacteria | 875 |
| 1072 | Ga0500604_0105908 | 3300053151 | Bacteria | 930 |
| 1073 | Ga0500616_0012430 | 3300053153 | Bacteria | 4980 |
| 1074 | Ga0500620_011573 | 3300053155 | Bacteria | 2371 |
| 1075 | Ga0500633_0261987 | 3300053160 | Bacteria | 641 |
| 1076 | Ga0500634_0364387 | 3300053161 | Bacteria | 546 |
| 1077 | Ga0500638_323092 | 3300053162 | Bacteria | 585 |
| 1078 | Ga0500639_249736 | 3300053163 | Bacteria | 712 |
| 1079 | Ga0500636_0003830 | 3300053177 | Bacteria | 8501 |
| 1080 | Ga0500636_0315192 | 3300053177 | Bacteria | 763 |
| 1081 | Ga0500636_0381408 | 3300053177 | Bacteria | 661 |
| 1082 | Ga0500637_0443933 | 3300053178 | Bacteria | 660 |
| 1083 | Ga0500611_033434 | 3300053727 | Bacteria | 1082 |
| 1084 | Ga0500625_004711 | 3300053729 | Bacteria | 5613 |
| 1085 | Ga0500656_020084 | 3300053732 | Bacteria | 821 |
| 1086 | Ga0500601_000994 | 3300053737 | Bacteria | 3295 |
| 1087 | Ga0500661_019684 | 3300055283 | Bacteria | 1201 |
| 1088 | 2671117845 | 2667528175 | Bacteria | 7532676 |
| 1089 | 2793069924 | 2791355197 | Bacteria | 8420563 |
| 1090 | 2903755673 | 2903748898 | Bacteria | 9972761 |
| 1091 | 2906617587 | |||
| 1092 | 8019557616 | 8019555841 | Bacteria | 9642137 |
| 1093 | 8019567682 | 8019565922 | Bacteria | 9639779 |
| 1094 | Ga0207694_10700043 | |||
| 1095 | RicEn_C4615 | |||
| 1096 | JGI24739J22299_10011186 | |||
| 1097 | JGI24737J22298_10002064 | |||
| 1098 | JGI24737J22298_10086367 | |||
| 1099 | JGI24735J21928_10002565 | |||
| 1100 | JGI25406J46586_10005846 | |||
| 1101 | JGI25153J46596_10007100 | |||
| 1102 | JGI25160J50197_1004681 | |||
| 1103 | JGI25404J52841_10010994 | |||
| 1104 | JGI25404J52841_10023928 | |||
| 1105 | JGI25404J52841_10047589 | |||
| 1106 | Ga0055543_1004189 | |||
| 1107 | Ga0065165_1001000 | |||
| 1108 | Ga0065165_1002881 | |||
| 1109 | Ga0065712_10199050 | |||
| 1110 | Ga0070658_11207008 | |||
| 1111 | Ga0070676_11309335 | |||
| 1112 | Ga0070683_102434131 | |||
| 1113 | Ga0070670_100078374 | |||
| 1114 | Ga0070670_100097465 | |||
| 1115 | Ga0068869_100113310 | |||
| 1116 | Ga0068869_100349169 | |||
| 1117 | Ga0068869_100616811 | |||
| 1118 | Ga0068869_101897173 | |||
| 1119 | Ga0070666_10117710 | |||
| 1120 | Ga0070666_10183673 | |||
| 1121 | Ga0070680_100097309 | |||
| 1122 | Ga0068868_100360667 | |||
| 1123 | Ga0068868_100447024 | |||
| 1124 | Ga0070660_100007203 | |||
| 1125 | Ga0070660_100360253 | |||
| 1126 | Ga0070660_100395897 | |||
| 1127 | Ga0070660_101249082 | |||
| 1128 | Ga0070660_101395982 | |||
| 1129 | Ga0070689_100168319 | |||
| 1130 | Ga0070687_101040167 | |||
| 1131 | Ga0070661_100433428 | |||
| 1132 | Ga0070692_10893448 | |||
| 1133 | Ga0070668_100034605 | |||
| 1134 | Ga0070668_100037092 | |||
| 1135 | Ga0070668_100048283 | |||
| 1136 | Ga0070668_100068946 | |||
| 1137 | Ga0070668_100144755 | |||
| 1138 | Ga0070671_100059352 | |||
| 1139 | Ga0070671_100102576 | |||
| 1140 | Ga0070671_101094952 | |||
| 1141 | Ga0070673_100518557 | |||
| 1142 | Ga0070673_100776263 | |||
| 1143 | Ga0070688_101262148 | |||
| 1144 | Ga0070659_100251488 | |||
| 1145 | Ga0070659_100720528 | |||
| 1146 | Ga0070659_100832801 | |||
| 1147 | Ga0070659_101183258 | |||
| 1148 | Ga0070659_101754210 | |||
| 1149 | Ga0070667_100323171 | |||
| 1150 | Ga0070667_100373899 | |||
| 1151 | Ga0070667_100547120 | |||
| 1152 | Ga0070709_10014699 | |||
| 1153 | Ga0070709_10071675 | |||
| 1154 | Ga0070709_10536280 | |||
| 1155 | Ga0070714_100046876 | |||
| 1156 | Ga0070714_101346255 | |||
| 1157 | Ga0070714_101696565 | |||
| 1158 | Ga0070713_100021098 | |||
| 1159 | Ga0070713_100443170 | |||
| 1160 | Ga0070713_100890763 | |||
| 1161 | Ga0070713_100909299 | |||
| 1162 | Ga0070713_100990602 | |||
| 1163 | Ga0070710_10011580 | |||
| 1164 | Ga0070710_10017934 | |||
| 1165 | Ga0070711_100082160 | |||
| 1166 | Ga0070711_100089954 | |||
| 1167 | Ga0070711_100359750 | |||
| 1168 | Ga0070711_100498274 | |||
| 1169 | Ga0070705_100550235 | |||
| 1170 | Ga0070700_101093221 | |||
| 1171 | Ga0070694_100326786 | |||
| 1172 | Ga0070663_100045359 | |||
| 1173 | Ga0070663_100090656 | |||
| 1174 | Ga0070663_100144660 | |||
| 1175 | Ga0070663_100237411 | |||
| 1176 | Ga0070663_100898853 | |||
| 1177 | Ga0070663_100932800 | |||
| 1178 | Ga0070678_100091264 | |||
| 1179 | Ga0070678_100106088 | |||
| 1180 | Ga0070678_101173743 | |||
| 1181 | Ga0070678_101422846 | |||
| 1182 | Ga0070662_100044952 | |||
| 1183 | Ga0070662_100185973 | |||
| 1184 | Ga0070681_10017728 | |||
| 1185 | Ga0070681_10241579 | |||
| 1186 | Ga0068867_100552523 | |||
| 1187 | Ga0068867_101345730 | |||
| 1188 | Ga0070706_101587626 | |||
| 1189 | Ga0070679_100127787 | |||
| 1190 | Ga0070679_100189986 | |||
| 1191 | Ga0070679_100477498 | |||
| 1192 | Ga0070679_100503011 | |||
| 1193 | Ga0070679_100978344 | |||
| 1194 | Ga0070684_100056215 | |||
| 1195 | Ga0070684_100749437 | |||
| 1196 | Ga0070697_100308780 | |||
| 1197 | Ga0068853_100058554 | |||
| 1198 | Ga0068853_100083561 | |||
| 1199 | Ga0068853_100319313 | |||
| 1200 | Ga0068853_100409791 | |||
| 1201 | Ga0068853_100434599 | |||
| 1202 | Ga0068853_100622958 | |||
| 1203 | Ga0068853_101266267 | |||
| 1204 | Ga0068853_101375340 | |||
| 1205 | Ga0068853_101468293 | |||
| 1206 | Ga0070672_100102083 | |||
| 1207 | Ga0070672_101351708 | |||
| 1208 | Ga0070696_100185213 | |||
| 1209 | Ga0070693_100981589 | |||
| 1210 | Ga0070665_100113812 | |||
| 1211 | Ga0070665_100171671 | |||
| 1212 | Ga0070665_100320013 | |||
| 1213 | Ga0070665_100909636 | |||
| 1214 | Ga0068855_100020421 | |||
| 1215 | Ga0068855_100293583 | |||
| 1216 | Ga0068855_100446121 | |||
| 1217 | Ga0068855_100523935 | |||
| 1218 | Ga0068855_101083055 | |||
| 1219 | Ga0068855_101139573 | |||
| 1220 | Ga0068855_101918285 | |||
| 1221 | Ga0070664_100613136 | |||
| 1222 | Ga0070664_100765735 | |||
| 1223 | Ga0070664_100931037 | |||
| 1224 | Ga0068857_100233474 | |||
| 1225 | Ga0068857_100705789 | |||
| 1226 | Ga0068857_101960493 | |||
| 1227 | Ga0068854_100013815 | |||
| 1228 | Ga0068854_100298451 | |||
| 1229 | Ga0068854_100386996 | |||
| 1230 | Ga0068854_101041165 | |||
| 1231 | Ga0068856_100182720 | |||
| 1232 | Ga0068856_100426337 | |||
| 1233 | Ga0068856_100562291 | |||
| 1234 | Ga0068856_101108969 | |||
| 1235 | Ga0070702_100156178 | |||
| 1236 | Ga0070702_100571828 | |||
| 1237 | Ga0070702_101006503 | |||
| 1238 | Ga0068852_100100749 | |||
| 1239 | Ga0068852_100388423 | |||
| 1240 | Ga0068852_100719899 | |||
| 1241 | Ga0068852_101578564 | |||
| 1242 | Ga0068859_100175190 | |||
| 1243 | Ga0068859_100391897 | |||
| 1244 | Ga0068866_10101414 | |||
| 1245 | Ga0068866_10223835 | |||
| 1246 | Ga0068861_100255924 | |||
| 1247 | Ga0068861_100273098 | |||
| 1248 | Ga0068861_100606434 | |||
| 1249 | Ga0068851_10466423 | |||
| 1250 | Ga0068870_11179688 | |||
| 1251 | Ga0068863_101390337 | |||
| 1252 | Ga0068858_100091673 | |||
| 1253 | Ga0068858_100308584 | |||
| 1254 | Ga0068858_100328179 | |||
| 1255 | Ga0068858_100526333 | |||
| 1256 | Ga0068860_100443077 | |||
| 1257 | Ga0068860_100771602 | |||
| 1258 | Ga0068860_100860696 | |||
| 1259 | Ga0068862_100105868 | |||
| 1260 | Ga0068862_100354159 | |||
| 1261 | Ga0068862_100704521 | |||
| 1262 | Ga0068862_101871497 | |||
| 1263 | Ga0081455_10099030 | |||
| 1264 | Ga0081455_10643714 | |||
| 1265 | Ga0081540_1000977 | |||
| 1266 | Ga0081540_1009064 | |||
| 1267 | Ga0081540_1017971 | |||
| 1268 | Ga0081540_1018216 | |||
| 1269 | Ga0081539_10000176 | |||
| 1270 | Ga0081539_10000231 | |||
| 1271 | Ga0070717_10047970 | |||
| 1272 | Ga0070717_10214208 | |||
| 1273 | Ga0070717_10280543 | |||
| 1274 | Ga0070717_10359021 | |||
| 1275 | Ga0070717_11283818 | |||
| 1276 | Ga0075365_10019762 | |||
| 1277 | Ga0075365_10055481 | |||
| 1278 | Ga0075365_10373704 | |||
| 1279 | Ga0075365_10554274 | |||
| 1280 | Ga0075365_10557530 | |||
| 1281 | Ga0075365_10680941 | |||
| 1282 | Ga0075365_10726372 | |||
| 1283 | Ga0075365_10834195 | |||
| 1284 | Ga0075365_10990196 | |||
| 1285 | Ga0075368_10069099 | |||
| 1286 | Ga0075368_10284713 | |||
| 1287 | Ga0075363_100380402 | |||
| 1288 | Ga0075364_10046191 | |||
| 1289 | Ga0075364_10103459 | |||
| 1290 | Ga0070715_10361588 | |||
| 1291 | Ga0070715_10775380 | |||
| 1292 | Ga0070716_100193111 | |||
| 1293 | Ga0070716_100374472 | |||
| 1294 | Ga0070712_100005919 | |||
| 1295 | Ga0070712_100200331 | |||
| 1296 | Ga0070712_100745534 | |||
| 1297 | Ga0075362_10026222 | |||
| 1298 | Ga0075362_10553370 | |||
| 1299 | Ga0075367_10051935 | |||
| 1300 | Ga0075367_10054914 | |||
| 1301 | Ga0075367_10167079 | |||
| 1302 | Ga0075367_10204320 | |||
| 1303 | Ga0075369_10017098 | |||
| 1304 | Ga0075369_10079868 | |||
| 1305 | Ga0075369_10230835 | |||
| 1306 | Ga0075369_10242823 | |||
| 1307 | Ga0075369_10586019 | |||
| 1308 | Ga0075366_10005347 | |||
| 1309 | Ga0075366_10084551 | |||
| 1310 | Ga0075366_10231565 | |||
| 1311 | Ga0075366_10240330 | |||
| 1312 | Ga0075366_10527636 | |||
| 1313 | Ga0075366_10937286 | |||
| 1314 | Ga0097621_100325665 | |||
| 1315 | Ga0097621_101065858 | |||
| 1316 | Ga0075370_10014257 | |||
| 1317 | Ga0075370_10221730 | |||
| 1318 | Ga0075370_10705089 | |||
| 1319 | Ga0068871_100465123 | |||
| 1320 | Ga0068871_101057517 | |||
| 1321 | Ga0075428_100013639 | |||
| 1322 | Ga0075433_10982405 | |||
| 1323 | Ga0075434_100497792 | |||
| 1324 | Ga0075434_101627576 | |||
| 1325 | Ga0068865_100904500 | |||
| 1326 | Ga0075436_100235549 | |||
| 1327 | Ga0097620_100175195 | |||
| 1328 | Ga0097620_100391878 | |||
| 1329 | Ga0099825_1024706 | |||
| 1330 | Ga0099824_1011211 | |||
| 1331 | Ga0099822_1004035 | |||
| 1332 | Ga0099822_1063816 | |||
| 1333 | Ga0099823_1040176 | |||
| 1334 | Ga0075435_100838889 | |||
| 1335 | Ga0075435_101222116 | |||
| 1336 | Ga0099794_10017491 | |||
| 1337 | Ga0099794_10322919 | |||
| 1338 | Ga0099795_10036696 | |||
| 1339 | Ga0099795_10149621 | |||
| 1340 | Ga0105250_10102880 | |||
| 1341 | Ga0105250_10121596 | |||
| 1342 | Ga0105240_10002409 | |||
| 1343 | Ga0105240_10007230 | |||
| 1344 | Ga0105240_10007574 | |||
| 1345 | Ga0105240_10288383 | |||
| 1346 | Ga0105240_10424121 | |||
| 1347 | Ga0105240_11223257 | |||
| 1348 | Ga0111539_12012394 | |||
| 1349 | Ga0105245_10121359 | |||
| 1350 | Ga0105245_10284770 | |||
| 1351 | Ga0105245_10304762 | |||
| 1352 | Ga0105245_10529515 | |||
| 1353 | Ga0105245_12243199 | |||
| 1354 | Ga0105247_10037154 | |||
| 1355 | Ga0105247_10674626 | |||
| 1356 | Ga0114129_10140555 | |||
| 1357 | Ga0105243_10202764 | |||
| 1358 | Ga0105243_10954789 | |||
| 1359 | Ga0105243_11316166 | |||
| 1360 | Ga0105243_12413950 | |||
| 1361 | Ga0105241_10128663 | |||
| 1362 | Ga0105241_10376609 | |||
| 1363 | Ga0105241_10764691 | |||
| 1364 | Ga0105241_12523866 | |||
| 1365 | Ga0105242_10600419 | |||
| 1366 | Ga0105242_10637775 | |||
| 1367 | Ga0105242_11157295 | |||
| 1368 | Ga0105248_10140529 | |||
| 1369 | Ga0105248_10219879 | |||
| 1370 | Ga0105248_10462966 | |||
| 1371 | Ga0105248_11065624 | |||
| 1372 | Ga0105248_11093892 | |||
| 1373 | Ga0105248_11789788 | |||
| 1374 | Ga0105248_11794819 | |||
| 1375 | Ga0105237_10028752 | |||
| 1376 | Ga0105237_10043519 | |||
| 1377 | Ga0105237_10048634 | |||
| 1378 | Ga0105237_10126526 | |||
| 1379 | Ga0105237_10418547 | |||
| 1380 | Ga0105237_10482242 | |||
| 1381 | Ga0105237_10534824 | |||
| 1382 | Ga0105237_10936625 | |||
| 1383 | Ga0105237_11276033 | |||
| 1384 | Ga0105238_10017182 | |||
| 1385 | Ga0105238_10144870 | |||
| 1386 | Ga0105238_10663820 | |||
| 1387 | Ga0105238_10713475 | |||
| 1388 | Ga0105238_10755481 | |||
| 1389 | Ga0105238_12337352 | |||
| 1390 | Ga0105249_10259641 | |||
| 1391 | Ga0105249_10416355 | |||
| 1392 | Ga0105249_10478055 | |||
| 1393 | Ga0105249_10545959 | |||
| 1394 | Ga0105249_11670720 | |||
| 1395 | Ga0105239_10006100 | |||
| 1396 | Ga0105239_10059849 | |||
| 1397 | Ga0105239_10139872 | |||
| 1398 | Ga0105239_10152837 | |||
| 1399 | Ga0105239_10515953 | |||
| 1400 | Ga0105239_10774516 | |||
| 1401 | Ga0105239_10802634 | |||
| 1402 | Ga0105239_10843157 | |||
| 1403 | Ga0105239_10914444 | |||
| 1404 | Ga0105239_11241957 | |||
| 1405 | Ga0105239_11791851 | |||
| 1406 | Ga0105246_10044764 | |||
| 1407 | Ga0105246_10161530 | |||
| 1408 | Ga0105246_10413704 | |||
| 1409 | Ga0157326_1063352 | |||
| 1410 | Ga0157373_10876288 | |||
| 1411 | Ga0157370_10052380 | |||
| 1412 | Ga0157370_10186917 | |||
| 1413 | Ga0157370_11832283 | |||
| 1414 | Ga0157369_10023864 | |||
| 1415 | Ga0157369_10032287 | |||
| 1416 | Ga0157369_12234431 | |||
| 1417 | Ga0157378_10107999 | |||
| 1418 | Ga0157378_10253135 | |||
| 1419 | Ga0163162_10230636 | |||
| 1420 | Ga0163162_11714275 | |||
| 1421 | Ga0157372_10205924 | |||
| 1422 | Ga0157372_11036045 | |||
| 1423 | Ga0157372_12087590 | |||
| 1424 | Ga0157375_10769960 | |||
| 1425 | Ga0157375_10973558 | |||
| 1426 | Ga0163163_10001936 | |||
| 1427 | Ga0163163_10068609 | |||
| 1428 | Ga0163163_10490569 | |||
| 1429 | Ga0163163_11181065 | |||
| 1430 | Ga0157380_10554047 | |||
| 1431 | Ga0182008_10305235 | |||
| 1432 | Ga0157377_10524980 | |||
| 1433 | Ga0157379_10071814 | |||
| 1434 | Ga0157379_10317024 | |||
| 1435 | Ga0157379_10468013 | |||
| 1436 | Ga0157376_10656490 | |||
| 1437 | Ga0157376_10709084 | |||
| 1438 | Ga0157376_11813272 | |||
| 1439 | Ga0157376_12225699 | |||
| 1440 | Ga0163161_11417401 | |||
| 1441 | Ga0154015_1407110 | |||
| 1442 | Ga0209563_101473 | |||
| 1443 | Ga0209677_105226 | |||
| 1444 | Ga0209148_1000779 | |||
| 1445 | Ga0209233_1005191 | |||
| 1446 | Ga0209233_1028193 | |||
| 1447 | Ga0209233_1032525 | |||
| 1448 | Ga0209233_1051074 | |||
| 1449 | Ga0209455_1003881 | |||
| 1450 | Ga0209673_1027776 | |||
| 1451 | Ga0209564_1003985 | |||
| 1452 | Ga0209758_1001023 | |||
| 1453 | Ga0209758_1003040 | |||
| 1454 | Ga0209758_1014568 | |||
| 1455 | Ga0209758_1028731 | |||
| 1456 | Ga0207426_1000596 | |||
| 1457 | Ga0207426_1001063 | |||
| 1458 | Ga0207426_1036686 | |||
| 1459 | Ga0207697_10345109 | |||
| 1460 | Ga0207656_10024424 | |||
| 1461 | Ga0207656_10204750 | |||
| 1462 | Ga0207692_10017386 | |||
| 1463 | Ga0207692_10139762 | |||
| 1464 | Ga0207692_10663733 | |||
| 1465 | Ga0207642_10095980 | |||
| 1466 | Ga0207710_10164935 | |||
| 1467 | Ga0207688_10175813 | |||
| 1468 | Ga0207680_10162733 | |||
| 1469 | Ga0207647_10017488 | |||
| 1470 | Ga0207647_10018334 | |||
| 1471 | Ga0207647_10176581 | |||
| 1472 | Ga0207647_10180635 | |||
| 1473 | Ga0207647_10258149 | |||
| 1474 | Ga0207647_10293453 | |||
| 1475 | Ga0207685_10211488 | |||
| 1476 | Ga0207685_10288519 | |||
| 1477 | Ga0207685_10548058 | |||
| 1478 | Ga0207699_10159997 | |||
| 1479 | Ga0207699_10179653 | |||
| 1480 | Ga0207699_10391758 | |||
| 1481 | Ga0207699_11405174 | |||
| 1482 | Ga0207645_10207023 | |||
| 1483 | Ga0207645_10402686 | |||
| 1484 | Ga0207643_10504597 | |||
| 1485 | Ga0207705_11092401 | |||
| 1486 | Ga0207684_10573166 | |||
| 1487 | Ga0207654_10015401 | |||
| 1488 | Ga0207654_10077268 | |||
| 1489 | Ga0207654_10104552 | |||
| 1490 | Ga0207654_10211228 | |||
| 1491 | Ga0207707_10003454 | |||
| 1492 | Ga0207707_10008660 | |||
| 1493 | Ga0207707_10236723 | |||
| 1494 | Ga0207695_10001107 | |||
| 1495 | Ga0207695_10024535 | |||
| 1496 | Ga0207695_10046985 | |||
| 1497 | Ga0207695_10067350 | |||
| 1498 | Ga0207695_10202711 | |||
| 1499 | Ga0207695_10430785 | |||
| 1500 | Ga0207671_10006466 | |||
| 1501 | Ga0207671_10065787 | |||
| 1502 | Ga0207671_10071594 | |||
| 1503 | Ga0207671_10083724 | |||
| 1504 | Ga0207671_10838842 | |||
| 1505 | Ga0207693_10010745 | |||
| 1506 | Ga0207693_10115846 | |||
| 1507 | Ga0207693_10328165 | |||
| 1508 | Ga0207693_11256778 | |||
| 1509 | Ga0207663_10005229 | |||
| 1510 | Ga0207663_10027896 | |||
| 1511 | Ga0207663_11120731 | |||
| 1512 | Ga0207663_11482667 | |||
| 1513 | Ga0207660_10127082 | |||
| 1514 | Ga0207660_10715261 | |||
| 1515 | Ga0207660_11240073 | |||
| 1516 | Ga0207662_10147710 | |||
| 1517 | Ga0207662_10884643 | |||
| 1518 | Ga0207657_10013306 | |||
| 1519 | Ga0207657_10614074 | |||
| 1520 | Ga0207649_10219441 | |||
| 1521 | Ga0207649_10669363 | |||
| 1522 | Ga0207652_10151116 | |||
| 1523 | Ga0207652_10821484 | |||
| 1524 | Ga0207652_11247085 | |||
| 1525 | Ga0207681_10342327 | |||
| 1526 | Ga0207694_10094672 | |||
| 1527 | Ga0207694_10102706 | |||
| 1528 | Ga0207694_10112395 | |||
| 1529 | Ga0207694_11746429 | |||
| 1530 | Ga0207650_10054601 | |||
| 1531 | Ga0207650_10450491 | |||
| 1532 | Ga0207687_10080834 | |||
| 1533 | Ga0207687_10112631 | |||
| 1534 | Ga0207700_10011770 | |||
| 1535 | Ga0207700_10104400 | |||
| 1536 | Ga0207700_10558448 | |||
| 1537 | Ga0207700_11005589 | |||
| 1538 | Ga0207664_10022677 | |||
| 1539 | Ga0207664_10150097 | |||
| 1540 | Ga0207664_10170277 | |||
| 1541 | Ga0207644_10149785 | |||
| 1542 | Ga0207644_10372708 | |||
| 1543 | Ga0207644_10436833 | |||
| 1544 | Ga0207690_10271092 | |||
| 1545 | Ga0207690_10597790 | |||
| 1546 | Ga0207690_11079388 | |||
| 1547 | Ga0207690_11452344 | |||
| 1548 | Ga0207706_10076918 | |||
| 1549 | Ga0207706_10226877 | |||
| 1550 | Ga0207706_10397935 | |||
| 1551 | Ga0207686_10086380 | |||
| 1552 | Ga0207709_10045551 | |||
| 1553 | Ga0207709_10508692 | |||
| 1554 | Ga0207709_10651697 | |||
| 1555 | Ga0207670_11912688 | |||
| 1556 | Ga0207704_10053071 | |||
| 1557 | Ga0207665_10060799 | |||
| 1558 | Ga0207665_10291676 | |||
| 1559 | Ga0207665_10935261 | |||
| 1560 | Ga0207691_10070757 | |||
| 1561 | Ga0207691_10717625 | |||
| 1562 | Ga0207691_11145066 | |||
| 1563 | Ga0207711_10097824 | |||
| 1564 | Ga0207711_10347091 | |||
| 1565 | Ga0207711_10394322 | |||
| 1566 | Ga0207711_10634220 | |||
| 1567 | Ga0207711_10803565 | |||
| 1568 | Ga0207689_10177305 | |||
| 1569 | Ga0207689_10323960 | |||
| 1570 | Ga0207679_10832385 | |||
| 1571 | Ga0207679_10866107 | |||
| 1572 | Ga0207679_11091876 | |||
| 1573 | Ga0207667_10014502 | |||
| 1574 | Ga0207667_10018032 | |||
| 1575 | Ga0207667_10029597 | |||
| 1576 | Ga0207667_10172989 | |||
| 1577 | Ga0207667_10492627 | |||
| 1578 | Ga0207667_11404221 | |||
| 1579 | Ga0207651_10358408 | |||
| 1580 | Ga0207712_10113984 | |||
| 1581 | Ga0207712_10540974 | |||
| 1582 | Ga0207668_10055592 | |||
| 1583 | Ga0207668_10087437 | |||
| 1584 | Ga0207668_10232051 | |||
| 1585 | Ga0207668_10261055 | |||
| 1586 | Ga0207640_10013094 | |||
| 1587 | Ga0207640_10335827 | |||
| 1588 | Ga0207658_10536095 | |||
| 1589 | Ga0207658_11875362 | |||
| 1590 | Ga0207658_11876657 | |||
| 1591 | Ga0207677_10044422 | |||
| 1592 | Ga0207677_10315756 | |||
| 1593 | Ga0207677_11296302 | |||
| 1594 | Ga0207703_10133830 | |||
| 1595 | Ga0207703_10325210 | |||
| 1596 | Ga0207703_11489295 | |||
| 1597 | Ga0207703_11645954 | |||
| 1598 | Ga0207639_10036729 | |||
| 1599 | Ga0207639_10110958 | |||
| 1600 | Ga0207639_10153997 | |||
| 1601 | Ga0207639_10270415 | |||
| 1602 | Ga0207639_10300762 | |||
| 1603 | Ga0207639_10681735 | |||
| 1604 | Ga0207639_10887596 | |||
| 1605 | Ga0207639_11793201 | |||
| 1606 | Ga0207678_10104065 | |||
| 1607 | Ga0207678_10233586 | |||
| 1608 | Ga0207678_10609310 | |||
| 1609 | Ga0207678_10682024 | |||
| 1610 | Ga0207678_10702958 | |||
| 1611 | Ga0207678_10909348 | |||
| 1612 | Ga0207678_11360819 | |||
| 1613 | Ga0207708_10053369 | |||
| 1614 | Ga0207702_10029932 | |||
| 1615 | Ga0207702_10055150 | |||
| 1616 | Ga0207702_10080823 | |||
| 1617 | Ga0207702_10146894 | |||
| 1618 | Ga0207702_11284238 | |||
| 1619 | Ga0207641_10835299 | |||
| 1620 | Ga0207641_11654154 | |||
| 1621 | Ga0207648_10040201 | |||
| 1622 | Ga0207648_10451827 | |||
| 1623 | Ga0207648_10886273 | |||
| 1624 | Ga0207676_11026102 | |||
| 1625 | Ga0207676_11254655 | |||
| 1626 | Ga0207674_10003961 | |||
| 1627 | Ga0207674_10346396 | |||
| 1628 | Ga0207675_100099826 | |||
| 1629 | Ga0207675_100280190 | |||
| 1630 | Ga0207675_100795440 | |||
| 1631 | Ga0207683_10208925 | |||
| 1632 | Ga0207683_10212430 | |||
| 1633 | Ga0207683_10825021 | |||
| 1634 | Ga0207698_10167642 | |||
| 1635 | Ga0207698_10879072 | |||
| 1636 | Ga0207698_11221784 | |||
| 1637 | Ga0207698_11577883 | |||
| 1638 | Ga0207698_11607434 | |||
| 1639 | Ga0209389_1000068 | |||
| 1640 | Ga0209389_1000084 | |||
| 1641 | Ga0209589_1000023 | |||
| 1642 | Ga0209589_1000041 | |||
| 1643 | Ga0209489_100032 | |||
| 1644 | Ga0209489_100070 | |||
| 1645 | Ga0209489_126518 | |||
| 1646 | Ga0209489_126519 | |||
| 1647 | Ga0209700_100040 | |||
| 1648 | Ga0209700_100117 | |||
| 1649 | Ga0209588_1113340 | |||
| 1650 | Ga0209813_10024452 | |||
| 1651 | Ga0209813_10129339 | |||
| 1652 | Ga0268266_10179991 | |||
| 1653 | Ga0268266_10226203 | |||
| 1654 | Ga0268266_10311862 | |||
| 1655 | Ga0268266_11277080 | |||
| 1656 | Ga0268265_10552275 | |||
| 1657 | Ga0268265_11093543 | |||
| 1658 | Ga0268264_10291245 | |||
| 1659 | Ga0268264_11072380 | |||
| 1660 | Ga0265334_10252012 | |||
| 1661 | Ga0307517_10002371 | |||
| 1662 | Ga0307517_10475190 | |||
| 1663 | Ga0265330_10036375 | |||
| 1664 | Ga0265330_10040331 | |||
| 1665 | Ga0265330_10287949 | |||
| 1666 | Ga0265332_10010212 | |||
| 1667 | Ga0265332_10027117 | |||
| 1668 | Ga0265332_10260161 | |||
| 1669 | Ga0265328_10212550 | |||
| 1670 | Ga0265325_10028245 | |||
| 1671 | Ga0265340_10000375 | |||
| 1672 | Ga0265340_10252895 | |||
| 1673 | Ga0265339_10016283 | |||
| 1674 | Ga0265339_10141743 | |||
| 1675 | Ga0265339_10341154 | |||
| 1676 | Ga0265331_10171693 | |||
| 1677 | Ga0265331_10191472 | |||
| 1678 | Ga0307408_100195724 | |||
| 1679 | Ga0265313_10087630 | |||
| 1680 | Ga0265314_10054570 | |||
| 1681 | Ga0265314_10274783 | |||
| 1682 | Ga0265342_10040689 | |||
| 1683 | Ga0307516_10147886 | |||
| 1684 | Ga0307405_10315417 | |||
| 1685 | Ga0307412_11302013 | |||
| 1686 | Ga0307412_11303951 | |||
| 1687 | Ga0307409_100834587 | |||
| 1688 | Ga0307416_100305850 | |||
| 1689 | Ga0307416_100442412 | |||
| 1690 | Ga0307411_11046880 | |||
| 1691 | Ga0307510_10206466 | |||
| 1692 | Ga0307510_10273830 | |||
| 1693 | Ga0316215_1000403 | |||
| 1694 | Ga0373958_0211203 | |||
| 1695 | Ga0373959_0090084 | |||
| 1696 | Ga0373938_0090091 | |||
| 1697 | Ga0373926_0126259 | |||
| 1698 | Ga0373934_0002259 | |||
| 1699 | Ga0373944_0261169 | |||
| 1700 | Ga0373944_0312345 | |||
| 1701 | Ga0373923_0000561 | |||
| 1702 | Ga0373936_0021847 | |||
| 1703 | Ga0373941_0029854 | |||
| 1704 | Ga0373953_0052617 | |||
| 1705 | Ga0373953_0311020 | |||
| 1706 | Ga0373954_0000273 | |||
| 1707 | Ga0373956_0004613 | |||
| 1708 | Ga0373957_0000313 | |||
| 1709 | Ga0373957_0007058 | |||
| 1710 | Ga0373957_0100244 | |||
| 1711 | Ga0373943_0011786 | |||
| 1712 | Ga0373946_0052659 | |||
| 1713 | Ga0373946_0254019 | |||
| 1714 | Ga0373946_0763743 | |||
| 1715 | Ga0373955_0004906 | |||
| 1716 | Ga0373961_0137836 | |||
| 1717 | Ga0373962_0126922 | |||
| 1718 | Ga0373924_0001394 | |||
| 1719 | Ga0373931_0048749 | |||
| 1720 | Ga0373931_0228047 | |||
| 1721 | Ga0373935_0032089 | |||
| 1722 | Ga0373935_0111462 | |||
| 1723 | Ga0373935_0116880 | |||
| 1724 | Ga0373935_0445569 | |||
| 1725 | Ga0373927_0002786 | |||
| 1726 | Ga0373927_0048423 | |||
| 1727 | Ga0373927_0094557 | |||
| 1728 | Ga0373927_0116391 | |||
| 1729 | Ga0373933_0001950 | |||
| 1730 | Ga0373947_0004007 | |||
| 1731 | Ga0373937_0011586 | |||
| 1732 | Ga0373937_0072826 | |||
| 1733 | Ga0372808_036262 | |||
| 1734 | Ga0373925_0001317 | |||
| 1735 | Ga0373925_0494488 | |||
| 1736 | Ga0373925_1241306 | |||
| 1737 | Ga0395899_0325946 | |||
| 1738 | Ga0395899_0427478 | |||
| 1739 | Ga0395900_0004063 | |||
| 1740 | Ga0395900_0078805 | |||
| 1741 | Ga0395898_0005719 | |||
| 1742 | Ga0395898_0116452 | |||
| 1743 | Ga0395898_1767960 | |||
| 1744 | Ga0395905_1227613 | |||
| 1745 | Ga0436364_0159664 | |||
| 1746 | Ga0436364_0899798 | |||
| 1747 | Ga0395901_0268694 | |||
| 1748 | Ga0395901_0292119 | |||
| 1749 | Ga0395901_0694699 | |||
| 1750 | Ga0436365_0388356 | |||
| 1751 | Ga0436361_0111464 | |||
| 1752 | Ga0436363_0689938 | |||
| 1753 | Ga0451793_0059355 | |||
| 1754 | Ga0451793_0690763 | |||
| 1755 | Ga0451797_0198863 | |||
| 1756 | Ga0451795_0747937 | |||
| 1757 | Ga0451835_1266689 | |||
| 1758 | Ga0451847_0967965 | |||
| 1759 | Ga0451853_2604563 | |||
| 1760 | Ga0466969_0269529 | |||
| 1761 | Ga0466965_0154127 | |||
| 1762 | Ga0466966_0001701 | |||
| 1763 | Ga0466961_0000064 | |||
| 1764 | Ga0466961_0822756 | |||
| 1765 | Ga0466963_0023676 | |||
| 1766 | Ga0466963_0270068 | |||
| 1767 | Ga0466968_0019847 | |||
| 1768 | Ga0466968_0033041 | |||
| 1769 | Ga0466968_0104300 | |||
| 1770 | Ga0466970_0131370 | |||
| 1771 | Ga0466957_0097815 | |||
| 1772 | Ga0466957_1209508 | |||
| 1773 | Ga0466960_0092264 | |||
| 1774 | Ga0466959_0004743 | |||
| 1775 | Ga0466967_0019942 | |||
| 1776 | Ga0466967_0103843 | |||
| 1777 | Ga0466967_0545088 | |||
| 1778 | Ga0495592_0003384 | |||
| 1779 | Ga0495592_0075234 | |||
| 1780 | Ga0495592_0308956 | |||
| 1781 | Ga0495603_0005350 | |||
| 1782 | Ga0495603_0243677 | |||
| 1783 | Ga0495590_0103762 | |||
| 1784 | Ga0495590_0145587 | |||
| 1785 | Ga0495590_0306525 | |||
| 1786 | Ga0495629_0000581 | |||
| 1787 | Ga0495629_0004536 | |||
| 1788 | Ga0495629_0084445 | |||
| 1789 | Ga0495638_0161042 | |||
| 1790 | Ga0495641_0013094 | |||
| 1791 | Ga0495651_0004932 | |||
| 1792 | Ga0495651_0011399 | |||
| 1793 | Ga0495651_0106525 | |||
| 1794 | Ga0495651_0402526 | |||
| 1795 | Ga0495653_0002259 | |||
| 1796 | Ga0495653_0472606 | |||
| 1797 | Ga0495580_0065208 | |||
| 1798 | Ga0495582_0000528 | |||
| 1799 | Ga0495582_0567799 | |||
| 1800 | Ga0495605_0090501 | |||
| 1801 | Ga0495605_0108498 | |||
| 1802 | Ga0495639_0000044 | |||
| 1803 | Ga0495639_0203577 | |||
| 1804 | Ga0495662_0001271 | |||
| 1805 | Ga0495664_0015612 | |||
| 1806 | Ga0495664_0287814 | |||
| 1807 | Ga0495584_0408608 | |||
| 1808 | Ga0495585_0104343 | |||
| 1809 | Ga0495585_0399262 | |||
| 1810 | Ga0495594_0000351 | |||
| 1811 | Ga0495594_0061151 | |||
| 1812 | Ga0495594_0089094 | |||
| 1813 | Ga0495594_0344380 | |||
| 1814 | Ga0495596_0209539 | |||
| 1815 | Ga0495596_0254674 | |||
| 1816 | Ga0495583_0305329 | |||
| 1817 | Ga0495606_0030295 | |||
| 1818 | Ga0495606_0568819 | |||
| 1819 | Ga0495608_0002317 | |||
| 1820 | Ga0495608_0015452 | |||
| 1821 | Ga0495610_0289571 | |||
| 1822 | Ga0495618_0078803 | |||
| 1823 | Ga0495618_0217737 | |||
| 1824 | Ga0495618_0430717 | |||
| 1825 | Ga0495618_0645519 | |||
| 1826 | Ga0495628_0041294 | |||
| 1827 | Ga0495628_0272250 | |||
| 1828 | Ga0495628_0606531 | |||
| 1829 | Ga0495628_0959312 | |||
| 1830 | Ga0495630_0129606 | |||
| 1831 | Ga0495630_0426812 | |||
| 1832 | Ga0495630_0612377 | |||
| 1833 | Ga0495630_1363484 | |||
| 1834 | Ga0495631_0131348 | |||
| 1835 | Ga0495632_0066789 | |||
| 1836 | Ga0495632_0296362 | |||
| 1837 | Ga0495643_0021099 | |||
| 1838 | Ga0495644_0022030 | |||
| 1839 | Ga0495648_0005365 | |||
| 1840 | Ga0495648_0201345 | |||
| 1841 | Ga0495648_0242298 | |||
| 1842 | Ga0495648_0371214 | |||
| 1843 | Ga0495666_0234677 | |||
| 1844 | Ga0495642_0403396 | |||
| 1845 | Ga0495652_0044737 | |||
| 1846 | Ga0495652_0046914 | |||
| 1847 | Ga0495652_0059768 | |||
| 1848 | Ga0495654_0345832 | |||
| 1849 | Ga0495665_0000397 | |||
| 1850 | Ga0495640_0006961 | |||
| 1851 | Ga0495640_0028817 | |||
| 1852 | Ga0495640_0081266 | |||
| 1853 | Ga0495640_0126000 | |||
| 1854 | Ga0495586_0078554 | |||
| 1855 | Ga0495587_0024998 | |||
| 1856 | Ga0495587_0269695 | |||
| 1857 | Ga0495598_0016689 | |||
| 1858 | Ga0495609_0148382 | |||
| 1859 | Ga0495609_0163201 | |||
| 1860 | Ga0495609_0256532 | |||
| 1861 | Ga0495621_0016641 | |||
| 1862 | Ga0495645_0087030 | |||
| 1863 | Ga0495645_0914633 | |||
| 1864 | Ga0495622_0002861 | |||
| 1865 | Ga0495622_0028361 | |||
| 1866 | Ga0495633_0018819 | |||
| 1867 | Ga0495633_0040307 | |||
| 1868 | Ga0495667_0000359 | |||
| 1869 | Ga0495667_0012846 | |||
| 1870 | Ga0495667_0121591 | |||
| 1871 | Ga0495667_0653687 | |||
| 1872 | Ga0495656_0040458 | |||
| 1873 | Ga0495668_0079760 | |||
| 1874 | Ga0495668_0270182 | |||
| 1875 | Ga0495634_0000252 | |||
| 1876 | Ga0495634_0012038 | |||
| 1877 | Ga0495634_0115615 | |||
| 1878 | Ga0495634_0163912 | |||
| 1879 | Ga0495611_0362112 | |||
| 1880 | Ga0495611_0456807 | |||
| 1881 | Ga0495625_0286459 | |||
| 1882 | Ga0495625_0388348 | |||
| 1883 | Ga0495635_0000251 | |||
| 1884 | Ga0495635_0004777 | |||
| 1885 | Ga0495635_0008104 | |||
| 1886 | Ga0495635_0293417 | |||
| 1887 | Ga0495635_0746670 | |||
| 1888 | Ga0495659_0037018 | |||
| 1889 | Ga0495661_0272002 | |||
| 1890 | Ga0495661_0370201 | |||
| 1891 | Ga0495588_0006813 | |||
| 1892 | Ga0495588_0118258 | |||
| 1893 | Ga0495657_0005246 | |||
| 1894 | Ga0495657_0042021 | |||
| 1895 | Ga0495657_0053434 | |||
| 1896 | Ga0495657_0800501 | |||
| 1897 | Ga0495599_0000305 | |||
| 1898 | Ga0495599_0610490 | |||
| 1899 | Ga0495623_0001012 | |||
| 1900 | Ga0495623_0208049 | |||
| 1901 | Ga0495623_0541637 | |||
| 1902 | Ga0495646_0055175 | |||
| 1903 | Ga0495647_0003477 | |||
| 1904 | Ga0495658_0009797 | |||
| 1905 | Ga0495658_0823973 | |||
| 1906 | Ga0495669_0053388 | |||
| 1907 | Ga0495669_0055937 | |||
| 1908 | Ga0495613_0013328 | |||
| 1909 | Ga0495613_0055277 | |||
| 1910 | Ga0495613_0132640 | |||
| 1911 | Ga0495624_0000832 | |||
| 1912 | Ga0495624_0144788 | |||
| 1913 | Ga0495624_0449920 | |||
| 1914 | Ga0495670_0172201 | |||
| 1915 | Ga0495670_0506459 | |||
| 1916 | Ga0495649_0188463 | |||
| 1917 | Ga0495649_0428360 | |||
| 1918 | Ga0495589_0331526 | |||
| 1919 | Ga0495600_0001567 | |||
| 1920 | Ga0495600_0046355 | |||
| 1921 | Ga0495581_0004430 | |||
| 1922 | Ga0495581_0160997 | |||
| 1923 | Ga0495604_0013917 | |||
| 1924 | Ga0495604_0095991 | |||
| 1925 | Ga0495604_0097526 | |||
| 1926 | Ga0495604_0181603 | |||
| 1927 | Ga0495636_0488091 | |||
| 1928 | Ga0495674_0012961 | |||
| 1929 | Ga0495674_0020357 | |||
| 1930 | Ga0495674_0095708 | |||
| 1931 | Ga0495674_0373305 | |||
| 1932 | Ga0495674_0994739 | |||
| 1933 | Ga0495672_0026351 | |||
| 1934 | Ga0495672_0198189 | |||
| 1935 | Ga0495676_0025127 | |||
| 1936 | Ga0495676_0042368 | |||
| 1937 | Ga0495676_0130134 | |||
| 1938 | Ga0495676_0663042 | |||
| 1939 | Ga0495680_0004040 | |||
| 1940 | Ga0495680_0019046 | |||
| 1941 | Ga0495680_0070812 | |||
| 1942 | Ga0495683_0016620 | |||
| 1943 | Ga0495683_0018489 | |||
| 1944 | Ga0495683_0289283 | |||
| 1945 | Ga0495675_0012888 | |||
| 1946 | Ga0495675_0023093 | |||
| 1947 | Ga0495685_135450 | |||
| 1948 | Ga0495673_0095006 | |||
| 1949 | Ga0495673_0134010 | |||
| 1950 | Ga0495673_0284528 | |||
| 1951 | Ga0495681_0097243 | |||
| 1952 | Ga0495681_0213557 | |||
| 1953 | Ga0495684_0000297 | |||
| 1954 | Ga0495684_0065459 | |||
| 1955 | Ga0495684_0617417 | |||
| 1956 | Ga0495686_0064501 | |||
| 1957 | Ga0495686_0652492 | |||
| 1958 | Ga0495593_0000353 | |||
| 1959 | Ga0495593_0000354 | |||
| 1960 | Ga0495593_0295441 | |||
| 1961 | Ga0495602_0034391 | |||
| 1962 | Ga0495602_0043460 | |||
| 1963 | Ga0495602_0116200 | |||
| 1964 | Ga0495602_0364883 | |||
| 1965 | Ga0495614_0029542 | |||
| 1966 | Ga0495626_0072272 | |||
| 1967 | Ga0496100_0194276 | |||
| 1968 | Ga0496100_0204377 | |||
| 1969 | Ga0496100_0331885 | |||
| 1970 | Ga0496100_0748634 | |||
| 1971 | Ga0496101_0040852 | |||
| 1972 | Ga0496101_0065283 | |||
| 1973 | Ga0496101_0275948 | |||
| 1974 | Ga0496101_0301976 | |||
| 1975 | Ga0496101_1082444 | |||
| 1976 | Ga0496102_0018941 | |||
| 1977 | Ga0496102_0220536 | |||
| 1978 | Ga0496102_0284506 | |||
| 1979 | Ga0496102_0297898 | |||
| 1980 | Ga0496102_0349357 | |||
| 1981 | Ga0496102_0404688 | |||
| 1982 | Ga0496102_0477994 | |||
| 1983 | Ga0496103_0032398 | |||
| 1984 | Ga0496103_0047180 | |||
| 1985 | Ga0496104_0003628 | |||
| 1986 | Ga0496104_0006867 | |||
| 1987 | Ga0496104_0028291 | |||
| 1988 | Ga0496104_0098535 | |||
| 1989 | Ga0496105_0005048 | |||
| 1990 | Ga0496105_0030914 | |||
| 1991 | Ga0496105_0035621 | |||
| 1992 | Ga0496105_0124790 | |||
| 1993 | Ga0496106_0032366 | |||
| 1994 | Ga0496106_0085320 | |||
| 1995 | Ga0496106_0087123 | |||
| 1996 | Ga0496106_0705097 | |||
| 1997 | Ga0496106_0950907 | |||
| 1998 | Ga0496106_1361958 | |||
| 1999 | Ga0496107_0011454 | |||
| 2000 | Ga0496107_0014705 | |||
| 2001 | Ga0496107_0140329 | |||
| 2002 | Ga0496107_0207012 | |||
| 2003 | Ga0496107_0209897 | |||
| 2004 | Ga0496107_0284408 | |||
| 2005 | Ga0496108_0029559 | |||
| 2006 | Ga0496108_0125044 | |||
| 2007 | Ga0496108_0138973 | |||
| 2008 | Ga0496108_0423084 | |||
| 2009 | Ga0496108_1108959 | |||
| 2010 | Ga0496109_0227289 | |||
| 2011 | Ga0496109_0284667 | |||
| 2012 | Ga0496110_0058995 | |||
| 2013 | Ga0496110_0074927 | |||
| 2014 | Ga0496110_0125698 | |||
| 2015 | Ga0496111_0026206 | |||
| 2016 | Ga0496111_0115837 | |||
| 2017 | Ga0496111_0259109 | |||
| 2018 | Ga0496112_0000004 | |||
| 2019 | Ga0496112_0000992 | |||
| 2020 | Ga0496112_0023912 | |||
| 2021 | Ga0496112_0080896 | |||
| 2022 | Ga0496112_0270245 | |||
| 2023 | Ga0496113_0101567 | |||
| 2024 | Ga0496113_0267807 | |||
| 2025 | Ga0496113_0326550 | |||
| 2026 | Ga0496113_0352388 | |||
| 2027 | Ga0496114_0079724 | |||
| 2028 | Ga0496114_0119923 | |||
| 2029 | Ga0496114_0366075 | |||
| 2030 | Ga0496114_0404332 | |||
| 2031 | Ga0496115_0015081 | |||
| 2032 | Ga0496115_0024858 | |||
| 2033 | Ga0496115_0129789 | |||
| 2034 | Ga0496115_0143029 | |||
| 2035 | Ga0496115_0182940 | |||
| 2036 | Ga0496115_0242538 | |||
| 2037 | Ga0496116_0032971 | |||
| 2038 | Ga0496116_0138010 | |||
| 2039 | Ga0496117_0043874 | |||
| 2040 | Ga0496117_0058877 | |||
| 2041 | Ga0496118_0051558 | |||
| 2042 | Ga0496118_0093767 | |||
| 2043 | Ga0496118_0105830 | |||
| 2044 | Ga0496119_0015494 | |||
| 2045 | Ga0496119_0046477 | |||
| 2046 | Ga0496119_0190509 | |||
| 2047 | Ga0496120_0017309 | |||
| 2048 | Ga0496121_0009741 | |||
| 2049 | Ga0496121_0080061 | |||
| 2050 | Ga0496121_0251104 | |||
| 2051 | Ga0496121_0348964 | |||
| 2052 | Ga0496122_0096470 | |||
| 2053 | Ga0496124_0165086 | |||
| 2054 | Ga0496124_0174939 | |||
| 2055 | Ga0496124_0212824 | |||
| 2056 | Ga0496124_0473024 | |||
| 2057 | Ga0496124_0666093 | |||
| 2058 | Ga0496125_0025883 | |||
| 2059 | Ga0496125_0075151 | |||
| 2060 | Ga0496125_0087691 | |||
| 2061 | Ga0496125_0105915 | |||
| 2062 | Ga0496125_0300709 | |||
| 2063 | Ga0496126_0006093 | |||
| 2064 | Ga0496126_0021321 | |||
| 2065 | Ga0496126_0023638 | |||
| 2066 | Ga0496126_0176252 | |||
| 2067 | Ga0496126_0272766 | |||
| 2068 | Ga0496126_0300590 | |||
| 2069 | Ga0496126_0508734 | |||
| 2070 | Ga0496126_0534418 | |||
| 2071 | Ga0496126_0623967 | |||
| 2072 | Ga0496126_0736643 | |||
| 2073 | Ga0496126_0876925 | |||
| 2074 | Ga0496126_1002157 | |||
| 2075 | Ga0495678_187774 | |||
| 2076 | Ga0501032_0311861 | |||
| 2077 | Ga0501047_0063880 | |||
| 2078 | Ga0501070_0017157 | |||
| 2079 | Ga0501074_0013275 | |||
| 2080 | Ga0501079_0940544 | |||
| 2081 | Ga0501080_0018387 | |||
| 2082 | Ga0501044_0058485 | |||
| 2083 | nmdc:mga03683_118285_c2 | |||
| 2084 | nmdc:mga03683_130443_c1 | |||
| 2085 | nmdc:mga03n38_363681_c1 | |||
| 2086 | nmdc:mga00v17_115026_c1 | |||
| 2087 | nmdc:mga00v17_259613_c1 | |||
| 2088 | nmdc:mga00v17_468493_c1 | |||
| 2089 | nmdc:mga0yw44_10663_c1 | |||
| 2090 | nmdc:mga0yw44_185119_c1 | |||
| 2091 | nmdc:mga0yw44_351928_c1 | |||
| 2092 | nmdc:mga0yw44_46808_c1 | |||
| 2093 | nmdc:mga0yw44_633414_c1 | |||
| 2094 | nmdc:mga0yw44_75034_c1 | |||
| 2095 | nmdc:mga0k408_125733_c1 | |||
| 2096 | nmdc:mga0k408_294680_c1 | |||
| 2097 | nmdc:mga0k408_404199_c1 | |||
| 2098 | nmdc:mga0k408_98906_c2 | |||
| 2099 | nmdc:mga06z11_110149_c1 | |||
| 2100 | nmdc:mga06z11_123298_c1 | |||
| 2101 | nmdc:mga04h51_227627_c1 | |||
| 2102 | nmdc:mga04h51_33249_c1 | |||
| 2103 | nmdc:mga07m45_136166_c1 | |||
| 2104 | nmdc:mga07m45_349009_c1 | |||
| 2105 | nmdc:mga07m45_86850_c1 | |||
| 2106 | nmdc:mga05p37_223714_c1 | |||
| 2107 | nmdc:mga0n895_292136_c1 | |||
| 2108 | nmdc:mga0n895_843011_c1 | |||
| 2109 | nmdc:mga0rr50_1568498_c1 | |||
| 2110 | nmdc:mga08x19_274042_c1 | |||
| 2111 | nmdc:mga0a205_1308477_c1 | |||
| 2112 | nmdc:mga0sz30_15675_c1 | |||
| 2113 | nmdc:mga0sz30_238319_c1 | |||
| 2114 | nmdc:mga0sz30_422440_c1 | |||
| 2115 | nmdc:mga0sz30_47091_c1 | |||
| 2116 | nmdc:mga0sz30_47659_c1 | |||
| 2117 | Ga0495601_0055289 | |||
| 2118 | Ga0495601_0524500 | |||
| 2119 | Ga0495601_0642899 | |||
| 2120 | Ga0500610_0143868 | |||
| 2121 | Ga0500635_0098504 | |||
| 2122 | Ga0495655_0002827 | |||
| 2123 | Ga0495655_0003704 | |||
| 2124 | Ga0495655_0058175 | |||
| 2125 | Ga0495655_0066522 | |||
| 2126 | Ga0495595_0001211 | |||
| 2127 | Ga0495595_0007545 | |||
| 2128 | Ga0495619_0001922 | |||
| 2129 | Ga0495619_0026539 | |||
| 2130 | Ga0495619_0948117 | |||
| 2131 | Ga0495619_1061202 | |||
| 2132 | Ga0500578_0538260 | |||
| 2133 | Ga0500578_0591572 | |||
| 2134 | Ga0500643_000025 | |||
| 2135 | Ga0500644_0042470 | |||
| 2136 | Ga0500583_0221286 | |||
| 2137 | Ga0500566_0000171 | |||
| 2138 | Ga0500566_0454023 | |||
| 2139 | Ga0500640_017219 | |||
| 2140 | Ga0500641_0078870 | |||
| 2141 | Ga0500650_0391966 | |||
| 2142 | Ga0500557_000001 | |||
| 2143 | Ga0500562_007899 | |||
| 2144 | Ga0500569_001417 | |||
| 2145 | Ga0500572_014491 | |||
| 2146 | Ga0500592_006946 | |||
| 2147 | Ga0500594_0007738 | |||
| 2148 | Ga0500595_067485 | |||
| 2149 | Ga0500595_104134 | |||
| 2150 | Ga0500597_213422 | |||
| 2151 | Ga0500597_297190 | |||
| 2152 | Ga0500607_132854 | |||
| 2153 | Ga0500614_160671 | |||
| 2154 | Ga0500642_0000170 | |||
| 2155 | Ga0500642_0050484 | |||
| 2156 | Ga0500642_0191998 | |||
| 2157 | Ga0500559_0380230 | |||
| 2158 | Ga0500564_175782 | |||
| 2159 | Ga0500568_0025821 | |||
| 2160 | Ga0500568_0182519 | |||
| 2161 | Ga0500577_0373662 | |||
| 2162 | Ga0500588_0262793 | |||
| 2163 | Ga0500590_123882 | |||
| 2164 | Ga0500590_191676 | |||
| 2165 | Ga0500604_0105908 | |||
| 2166 | Ga0500616_0012430 | |||
| 2167 | Ga0500620_011573 | |||
| 2168 | Ga0500633_0261987 | |||
| 2169 | Ga0500634_0364387 | |||
| 2170 | Ga0500638_323092 | |||
| 2171 | Ga0500639_249736 | |||
| 2172 | Ga0500636_0003830 | |||
| 2173 | Ga0500636_0315192 | |||
| 2174 | Ga0500636_0381408 | |||
| 2175 | Ga0500637_0443933 | |||
| 2176 | Ga0500611_033434 | |||
| 2177 | Ga0500625_004711 | |||
| 2178 | Ga0500656_020084 | |||
| 2179 | Ga0500601_000994 | |||
| 2180 | Ga0500661_019684 | |||
| 2181 | 2671117845 | |||
| 2182 | 2793069924 | |||
| 2183 | 2903755673 | |||
| 2184 | 2906617587 | |||
| 2185 | 8019557616 | |||
| 2186 | 8019567682 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z0c-assembly4.cif.gz_D | structure of in silico modelled artificial maquette-3 protein | 0.654 | 6 | 125 |
| 7jpv-assembly1.cif.gz_E | rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution | 0.646 | 2 | 115 |
| 6z0c-assembly4.cif.gz_D | structure of in silico modelled artificial maquette-3 protein | 0.6253 | 6 | 125 |
| 5arn-assembly1.cif.gz_A | cu(i)-csp3 (copper storage protein 3) from methylosinus | 0.611 | 4 | 115 |
| 5nqm-assembly1.cif.gz_A | cu(i)-csp3 (copper storage protein 3) from methylosinus | 0.604 | 3 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0JN56_9_95_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8022 | 71 | 117 | 1.20.1280.290 |
| af_Q55C26_1_134_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7336 | 1 | 116 | 1.20.140.150 |
| af_Q9SAC5_34_166_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.7084 | 1 | 116 | 1.20.140.40 |
| af_A0A078BS54_1_192_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6739 | 1 | 116 | 1.20.140.150 |
| af_O81320_4_142_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.6713 | 1 | 117 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A150Z7L3-F1-model_v4 | deleted | 1.001 | 1 | 126 |
|
| AF-A0A7S9CNU7-F1-model_v4 | Uncharacterized protein | 0.9893 | 1 | 126 |
GO:0016020
|
| AF-A0A1H4QIN4-F1-model_v4 | Uncharacterized protein | 0.9836 | 1 | 126 |
GO:0016020
|
| AF-A0A7S9CNU7-F1-model_v4 | Uncharacterized protein | 0.9816 | 1 | 126 |
GO:0016020
|
| AF-A0A1H4QIN4-F1-model_v4 | Uncharacterized protein | 0.976 | 1 | 126 |
GO:0016020
|