F489925

General Info

Members Datasets Scaffolds Average Seq Length
1093 468 2186 126

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10700043|Ga0207694_107000432
Length 153
Sequence MTPIVTVKWGWNSRKNSPGMQGSDISQMNVPRNVLRFEVLLYASLMLDALSVAVQDRTPTSTMSEQTITANTVLAGGMILLLLYFVRLAARQHKNWPRWVLVVALVLSVLSLFPVIGERGLELDSVIEIVSCALTTAGLYYSFTGDAQGWFNA

Samples

Sample ID Description Type Environment
1 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
95 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
96 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
203 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
204 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
206 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
267 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
268 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
269 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
270 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
271 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
272 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
307 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
328 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
329 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
330 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
340 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
341 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
342 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
343 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
344 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
345 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
346 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
347 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
348 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
353 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
354 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
362 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
363 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
390 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
391 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
392 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
397 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
400 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
401 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
402 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
420 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
421 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
422 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
423 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
424 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
425 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
426 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
429 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
432 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
433 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
434 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
435 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
436 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
437 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
438 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
439 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
440 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
441 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
442 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
447 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
448 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
449 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
452 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
453 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
454 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
455 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
456 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
457 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
458 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
459 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
460 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
461 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
462 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
463 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
464 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
465 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
466 2906610324
467 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
468 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.18
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.63
Nodule 1.74
Rhizoplane 6.86
Rhizosphere 73.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207694_10700043 3300025924 Bacteria 854
2 RicEn_C4615 2010549000 Bacteria 1294
3 JGI24739J22299_10011186 3300001989 Bacteria 3315
4 JGI24737J22298_10002064 3300001990 Bacteria 7183
5 JGI24737J22298_10086367 3300001990 Bacteria 932
6 JGI24735J21928_10002565 3300002067 Bacteria 6284
7 JGI25406J46586_10005846 3300003203 Bacteria 5691
8 JGI25153J46596_10007100 3300003215 Bacteria 5560
9 JGI25160J50197_1004681 3300003354 Bacteria 5864
10 JGI25404J52841_10010994 3300003659 Bacteria 1949
11 JGI25404J52841_10023928 3300003659 Bacteria 1317
12 JGI25404J52841_10047589 3300003659 Bacteria 904
13 Ga0055543_1004189 3300004625 Bacteria 4000
14 Ga0065165_1001000 3300005262 Bacteria 34730
15 Ga0065165_1002881 3300005262 Bacteria 13232
16 Ga0065712_10199050 3300005290 Bacteria 1116
17 Ga0070658_11207008 3300005327 Bacteria 658
18 Ga0070676_11309335 3300005328 Bacteria 554
19 Ga0070683_102434131 3300005329 Bacteria 502
20 Ga0070670_100078374 3300005331 Bacteria 2838
21 Ga0070670_100097465 3300005331 Bacteria 2529
22 Ga0068869_100113310 3300005334 Bacteria 2065
23 Ga0068869_100349169 3300005334 Bacteria 1205
24 Ga0068869_100616811 3300005334 Bacteria 918
25 Ga0068869_101897173 3300005334 Bacteria 534
26 Ga0070666_10117710 3300005335 Bacteria 1841
27 Ga0070666_10183673 3300005335 Bacteria 1468
28 Ga0070680_100097309 3300005336 Bacteria 2440
29 Ga0068868_100360667 3300005338 Bacteria 1247
30 Ga0068868_100447024 3300005338 Bacteria 1123
31 Ga0070660_100007203 3300005339 Bacteria 7738
32 Ga0070660_100360253 3300005339 Bacteria 1199
33 Ga0070660_100395897 3300005339 Bacteria 1141
34 Ga0070660_101249082 3300005339 Bacteria 630
35 Ga0070660_101395982 3300005339 Bacteria 595
36 Ga0070689_100168319 3300005340 Bacteria 1775
37 Ga0070687_101040167 3300005343 Bacteria 596
38 Ga0070661_100433428 3300005344 Bacteria 1044
39 Ga0070692_10893448 3300005345 Bacteria 614
40 Ga0070668_100034605 3300005347 Bacteria 3850
41 Ga0070668_100037092 3300005347 Bacteria 3721
42 Ga0070668_100048283 3300005347 Bacteria 3273
43 Ga0070668_100068946 3300005347 Bacteria 2750
44 Ga0070668_100144755 3300005347 Bacteria 1917
45 Ga0070671_100059352 3300005355 Bacteria 3183
46 Ga0070671_100102576 3300005355 Bacteria 2400
47 Ga0070671_101094952 3300005355 Bacteria 699
48 Ga0070673_100518557 3300005364 Bacteria 1080
49 Ga0070673_100776263 3300005364 Bacteria 884
50 Ga0070688_101262148 3300005365 Bacteria 595
51 Ga0070659_100251488 3300005366 Bacteria 1465
52 Ga0070659_100720528 3300005366 Bacteria 864
53 Ga0070659_100832801 3300005366 Bacteria 804
54 Ga0070659_101183258 3300005366 Bacteria 676
55 Ga0070659_101754210 3300005366 Bacteria 556
56 Ga0070667_100323171 3300005367 Bacteria 1393
57 Ga0070667_100373899 3300005367 Bacteria 1293
58 Ga0070667_100547120 3300005367 Bacteria 1064
59 Ga0070709_10014699 3300005434 Bacteria 4432
60 Ga0070709_10071675 3300005434 Bacteria 2238
61 Ga0070709_10536280 3300005434 Bacteria 894
62 Ga0070714_100046876 3300005435 Bacteria 3669
63 Ga0070714_101346255 3300005435 Bacteria 697
64 Ga0070714_101696565 3300005435 Bacteria 617
65 Ga0070713_100021098 3300005436 Bacteria 5004
66 Ga0070713_100443170 3300005436 Bacteria 1219
67 Ga0070713_100890763 3300005436 Bacteria 856
68 Ga0070713_100909299 3300005436 Bacteria 847
69 Ga0070713_100990602 3300005436 Bacteria 811
70 Ga0070710_10011580 3300005437 Bacteria 4361
71 Ga0070710_10017934 3300005437 Bacteria 3635
72 Ga0070711_100082160 3300005439 Bacteria 2298
73 Ga0070711_100089954 3300005439 Bacteria 2209
74 Ga0070711_100359750 3300005439 Bacteria 1172
75 Ga0070711_100498274 3300005439 Bacteria 1004
76 Ga0070705_100550235 3300005440 Bacteria 885
77 Ga0070700_101093221 3300005441 Bacteria 660
78 Ga0070694_100326786 3300005444 Bacteria 1182
79 Ga0070663_100045359 3300005455 Bacteria 3105
80 Ga0070663_100090656 3300005455 Bacteria 2264
81 Ga0070663_100144660 3300005455 Bacteria 1818
82 Ga0070663_100237411 3300005455 Bacteria 1438
83 Ga0070663_100898853 3300005455 Bacteria 765
84 Ga0070663_100932800 3300005455 Bacteria 751
85 Ga0070678_100091264 3300005456 Bacteria 2337
86 Ga0070678_100106088 3300005456 Bacteria 2189
87 Ga0070678_101173743 3300005456 Bacteria 711
88 Ga0070678_101422846 3300005456 Bacteria 648
89 Ga0070662_100044952 3300005457 Bacteria 3166
90 Ga0070662_100185973 3300005457 Bacteria 1640
91 Ga0070681_10017728 3300005458 Bacteria 7116
92 Ga0070681_10241579 3300005458 Bacteria 1719
93 Ga0068867_100552523 3300005459 Bacteria 998
94 Ga0068867_101345730 3300005459 Bacteria 660
95 Ga0070706_101587626 3300005467 Bacteria 597
96 Ga0070679_100127787 3300005530 Bacteria 2523
97 Ga0070679_100189986 3300005530 Bacteria 2023
98 Ga0070679_100477498 3300005530 Bacteria 1191
99 Ga0070679_100503011 3300005530 Bacteria 1156
100 Ga0070679_100978344 3300005530 Bacteria 790
101 Ga0070684_100056215 3300005535 Bacteria 3433
102 Ga0070684_100749437 3300005535 Bacteria 912
103 Ga0070697_100308780 3300005536 Bacteria 1360
104 Ga0068853_100058554 3300005539 Bacteria 3326
105 Ga0068853_100083561 3300005539 Bacteria 2798
106 Ga0068853_100319313 3300005539 Bacteria 1439
107 Ga0068853_100409791 3300005539 Bacteria 1270
108 Ga0068853_100434599 3300005539 Bacteria 1233
109 Ga0068853_100622958 3300005539 Bacteria 1026
110 Ga0068853_101266267 3300005539 Bacteria 712
111 Ga0068853_101375340 3300005539 Bacteria 683
112 Ga0068853_101468293 3300005539 Bacteria 660
113 Ga0070672_100102083 3300005543 Bacteria 2327
114 Ga0070672_101351708 3300005543 Bacteria 637
115 Ga0070696_100185213 3300005546 Bacteria 1546
116 Ga0070693_100981589 3300005547 Bacteria 638
117 Ga0070665_100113812 3300005548 Bacteria 2708
118 Ga0070665_100171671 3300005548 Bacteria 2169
119 Ga0070665_100320013 3300005548 Bacteria 1555
120 Ga0070665_100909636 3300005548 Bacteria 892
121 Ga0068855_100020421 3300005563 Bacteria 7943
122 Ga0068855_100293583 3300005563 Bacteria 1802
123 Ga0068855_100446121 3300005563 Bacteria 1412
124 Ga0068855_100523935 3300005563 Bacteria 1285
125 Ga0068855_101083055 3300005563 Bacteria 838
126 Ga0068855_101139573 3300005563 Bacteria 814
127 Ga0068855_101918285 3300005563 Bacteria 600
128 Ga0070664_100613136 3300005564 Bacteria 1010
129 Ga0070664_100765735 3300005564 Bacteria 902
130 Ga0070664_100931037 3300005564 Bacteria 815
131 Ga0068857_100233474 3300005577 Bacteria 1683
132 Ga0068857_100705789 3300005577 Bacteria 959
133 Ga0068857_101960493 3300005577 Bacteria 574
134 Ga0068854_100013815 3300005578 Bacteria 5310
135 Ga0068854_100298451 3300005578 Bacteria 1302
136 Ga0068854_100386996 3300005578 Bacteria 1154
137 Ga0068854_101041165 3300005578 Bacteria 726
138 Ga0068856_100182720 3300005614 Bacteria 2111
139 Ga0068856_100426337 3300005614 Bacteria 1346
140 Ga0068856_100562291 3300005614 Bacteria 1162
141 Ga0068856_101108969 3300005614 Bacteria 809
142 Ga0070702_100156178 3300005615 Bacteria 1470
143 Ga0070702_100571828 3300005615 Bacteria 842
144 Ga0070702_101006503 3300005615 Bacteria 660
145 Ga0068852_100100749 3300005616 Bacteria 2607
146 Ga0068852_100388423 3300005616 Bacteria 1370
147 Ga0068852_100719899 3300005616 Bacteria 1009
148 Ga0068852_101578564 3300005616 Bacteria 679
149 Ga0068859_100175190 3300005617 Bacteria 2227
150 Ga0068859_100391897 3300005617 Bacteria 1485
151 Ga0068866_10101414 3300005718 Bacteria 1588
152 Ga0068866_10223835 3300005718 Bacteria 1137
153 Ga0068861_100255924 3300005719 Bacteria 1496
154 Ga0068861_100273098 3300005719 Bacteria 1452
155 Ga0068861_100606434 3300005719 Bacteria 1005
156 Ga0068851_10466423 3300005834 Bacteria 753
157 Ga0068870_11179688 3300005840 Bacteria 554
158 Ga0068863_101390337 3300005841 Bacteria 709
159 Ga0068858_100091673 3300005842 Bacteria 2828
160 Ga0068858_100308584 3300005842 Bacteria 1510
161 Ga0068858_100328179 3300005842 Bacteria 1463
162 Ga0068858_100526333 3300005842 Bacteria 1143
163 Ga0068860_100443077 3300005843 Bacteria 1290
164 Ga0068860_100771602 3300005843 Bacteria 974
165 Ga0068860_100860696 3300005843 Bacteria 921
166 Ga0068862_100105868 3300005844 Bacteria 2465
167 Ga0068862_100354159 3300005844 Bacteria 1363
168 Ga0068862_100704521 3300005844 Bacteria 978
169 Ga0068862_101871497 3300005844 Bacteria 610
170 Ga0081455_10099030 3300005937 Bacteria 2346
171 Ga0081455_10643714 3300005937 Bacteria 684
172 Ga0081540_1000977 3300005983 Bacteria 25775
173 Ga0081540_1009064 3300005983 Bacteria 6875
174 Ga0081540_1017971 3300005983 Bacteria 4357
175 Ga0081540_1018216 3300005983 Bacteria 4317
176 Ga0081539_10000176 3300005985 Bacteria 150292
177 Ga0081539_10000231 3300005985 Bacteria 131197
178 Ga0070717_10047970 3300006028 Bacteria 3502
179 Ga0070717_10214208 3300006028 Bacteria 1691
180 Ga0070717_10280543 3300006028 Bacteria 1478
181 Ga0070717_10359021 3300006028 Bacteria 1304
182 Ga0070717_11283818 3300006028 Bacteria 666
183 Ga0075365_10019762 3300006038 Bacteria 4164
184 Ga0075365_10055481 3300006038 Bacteria 2630
185 Ga0075365_10373704 3300006038 Bacteria 1005
186 Ga0075365_10554274 3300006038 Bacteria 813
187 Ga0075365_10557530 3300006038 Bacteria 810
188 Ga0075365_10680941 3300006038 Bacteria 727
189 Ga0075365_10726372 3300006038 Bacteria 701
190 Ga0075365_10834195 3300006038 Bacteria 650
191 Ga0075365_10990196 3300006038 Bacteria 592
192 Ga0075368_10069099 3300006042 Bacteria 1424
193 Ga0075368_10284713 3300006042 Bacteria 711
194 Ga0075363_100380402 3300006048 Bacteria 827
195 Ga0075364_10046191 3300006051 Bacteria 2835
196 Ga0075364_10103459 3300006051 Bacteria 1896
197 Ga0070715_10361588 3300006163 Bacteria 796
198 Ga0070715_10775380 3300006163 Bacteria 580
199 Ga0070716_100193111 3300006173 Bacteria 1347
200 Ga0070716_100374472 3300006173 Bacteria 1016
201 Ga0070712_100005919 3300006175 Bacteria 7568
202 Ga0070712_100200331 3300006175 Bacteria 1568
203 Ga0070712_100745534 3300006175 Bacteria 838
204 Ga0075362_10026222 3300006177 Bacteria 2487
205 Ga0075362_10553370 3300006177 Bacteria 592
206 Ga0075367_10051935 3300006178 Bacteria 2425
207 Ga0075367_10054914 3300006178 Bacteria 2362
208 Ga0075367_10167079 3300006178 Bacteria 1370
209 Ga0075367_10204320 3300006178 Bacteria 1234
210 Ga0075369_10017098 3300006186 Bacteria 2935
211 Ga0075369_10079868 3300006186 Bacteria 1449
212 Ga0075369_10230835 3300006186 Bacteria 857
213 Ga0075369_10242823 3300006186 Bacteria 835
214 Ga0075369_10586019 3300006186 Bacteria 533
215 Ga0075366_10005347 3300006195 Bacteria 6960
216 Ga0075366_10084551 3300006195 Bacteria 1897
217 Ga0075366_10231565 3300006195 Bacteria 1126
218 Ga0075366_10240330 3300006195 Bacteria 1104
219 Ga0075366_10527636 3300006195 Bacteria 730
220 Ga0075366_10937286 3300006195 Bacteria 540
221 Ga0097621_100325665 3300006237 Bacteria 1362
222 Ga0097621_101065858 3300006237 Bacteria 758
223 Ga0075370_10014257 3300006353 Bacteria 4238
224 Ga0075370_10221730 3300006353 Bacteria 1118
225 Ga0075370_10705089 3300006353 Bacteria 614
226 Ga0068871_100465123 3300006358 Bacteria 1136
227 Ga0068871_101057517 3300006358 Bacteria 758
228 Ga0075428_100013639 3300006844 Bacteria 9050
229 Ga0075433_10982405 3300006852 Bacteria 736
230 Ga0075434_100497792 3300006871 Bacteria 1240
231 Ga0075434_101627576 3300006871 Bacteria 654
232 Ga0068865_100904500 3300006881 Bacteria 768
233 Ga0075436_100235549 3300006914 Bacteria 1301
234 Ga0097620_100175195 3300006931 Bacteria 2227
235 Ga0097620_100391878 3300006931 Bacteria 1485
236 Ga0099825_1024706 3300006941 Bacteria 3462
237 Ga0099824_1011211 3300006942 Bacteria 10236
238 Ga0099822_1004035 3300006943 Bacteria 19017
239 Ga0099822_1063816 3300006943 Bacteria 1158
240 Ga0099823_1040176 3300006944 Bacteria 3394
241 Ga0075435_100838889 3300007076 Bacteria 801
242 Ga0075435_101222116 3300007076 Bacteria 658
243 Ga0099794_10017491 3300007265 Bacteria 3197
244 Ga0099794_10322919 3300007265 Bacteria 801
245 Ga0099795_10036696 3300007788 Bacteria 1721
246 Ga0099795_10149621 3300007788 Bacteria 955
247 Ga0105250_10102880 3300009092 Bacteria 1166
248 Ga0105250_10121596 3300009092 Bacteria 1074
249 Ga0105240_10002409 3300009093 Bacteria 30057
250 Ga0105240_10007230 3300009093 Bacteria 16167
251 Ga0105240_10007574 3300009093 Bacteria 15726
252 Ga0105240_10288383 3300009093 Bacteria 1883
253 Ga0105240_10424121 3300009093 Bacteria 1494
254 Ga0105240_11223257 3300009093 Bacteria 795
255 Ga0111539_12012394 3300009094 Bacteria 670
256 Ga0105245_10121359 3300009098 Bacteria 2442
257 Ga0105245_10284770 3300009098 Bacteria 1617
258 Ga0105245_10304762 3300009098 Bacteria 1564
259 Ga0105245_10529515 3300009098 Bacteria 1198
260 Ga0105245_12243199 3300009098 Bacteria 600
261 Ga0105247_10037154 3300009101 Bacteria 2971
262 Ga0105247_10674626 3300009101 Bacteria 775
263 Ga0114129_10140555 3300009147 Bacteria 3310
264 Ga0105243_10202764 3300009148 Bacteria 1741
265 Ga0105243_10954789 3300009148 Bacteria 857
266 Ga0105243_11316166 3300009148 Bacteria 740
267 Ga0105243_12413950 3300009148 Bacteria 564
268 Ga0105241_10128663 3300009174 Bacteria 2047
269 Ga0105241_10376609 3300009174 Bacteria 1239
270 Ga0105241_10764691 3300009174 Bacteria 887
271 Ga0105241_12523866 3300009174 Bacteria 515
272 Ga0105242_10600419 3300009176 Bacteria 1063
273 Ga0105242_10637775 3300009176 Bacteria 1034
274 Ga0105242_11157295 3300009176 Bacteria 791
275 Ga0105248_10140529 3300009177 Bacteria 2724
276 Ga0105248_10219879 3300009177 Bacteria 2138
277 Ga0105248_10462966 3300009177 Bacteria 1429
278 Ga0105248_11065624 3300009177 Bacteria 913
279 Ga0105248_11093892 3300009177 Bacteria 901
280 Ga0105248_11789788 3300009177 Bacteria 697
281 Ga0105248_11794819 3300009177 Bacteria 696
282 Ga0105237_10028752 3300009545 Bacteria 5657
283 Ga0105237_10043519 3300009545 Bacteria 4523
284 Ga0105237_10048634 3300009545 Bacteria 4262
285 Ga0105237_10126526 3300009545 Bacteria 2550
286 Ga0105237_10418547 3300009545 Bacteria 1345
287 Ga0105237_10482242 3300009545 Bacteria 1246
288 Ga0105237_10534824 3300009545 Bacteria 1179
289 Ga0105237_10936625 3300009545 Bacteria 873
290 Ga0105237_11276033 3300009545 Bacteria 741
291 Ga0105238_10017182 3300009551 Bacteria 7348
292 Ga0105238_10144870 3300009551 Bacteria 2352
293 Ga0105238_10663820 3300009551 Bacteria 1053
294 Ga0105238_10713475 3300009551 Bacteria 1015
295 Ga0105238_10755481 3300009551 Bacteria 986
296 Ga0105238_12337352 3300009551 Bacteria 570
297 Ga0105249_10259641 3300009553 Bacteria 1726
298 Ga0105249_10416355 3300009553 Bacteria 1377
299 Ga0105249_10478055 3300009553 Bacteria 1288
300 Ga0105249_10545959 3300009553 Bacteria 1209
301 Ga0105249_11670720 3300009553 Bacteria 709
302 Ga0105239_10006100 3300010375 Bacteria 14036
303 Ga0105239_10059849 3300010375 Bacteria 4180
304 Ga0105239_10139872 3300010375 Bacteria 2697
305 Ga0105239_10152837 3300010375 Bacteria 2576
306 Ga0105239_10515953 3300010375 Bacteria 1359
307 Ga0105239_10774516 3300010375 Bacteria 1099
308 Ga0105239_10802634 3300010375 Bacteria 1078
309 Ga0105239_10843157 3300010375 Bacteria 1051
310 Ga0105239_10914444 3300010375 Bacteria 1007
311 Ga0105239_11241957 3300010375 Bacteria 859
312 Ga0105239_11791851 3300010375 Bacteria 711
313 Ga0105246_10044764 3300011119 Bacteria 3009
314 Ga0105246_10161530 3300011119 Bacteria 1707
315 Ga0105246_10413704 3300011119 Bacteria 1123
316 Ga0157326_1063352 3300012513 Bacteria 570
317 Ga0157373_10876288 3300013100 Bacteria 665
318 Ga0157370_10052380 3300013104 Bacteria 3897
319 Ga0157370_10186917 3300013104 Bacteria 1923
320 Ga0157370_11832283 3300013104 Bacteria 544
321 Ga0157369_10023864 3300013105 Bacteria 6808
322 Ga0157369_10032287 3300013105 Bacteria 5760
323 Ga0157369_12234431 3300013105 Bacteria 555
324 Ga0157378_10107999 3300013297 Bacteria 2547
325 Ga0157378_10253135 3300013297 Bacteria 1687
326 Ga0163162_10230636 3300013306 Bacteria 1982
327 Ga0163162_11714275 3300013306 Bacteria 718
328 Ga0157372_10205924 3300013307 Bacteria 2279
329 Ga0157372_11036045 3300013307 Bacteria 950
330 Ga0157372_12087590 3300013307 Bacteria 651
331 Ga0157375_10769960 3300013308 Bacteria 1113
332 Ga0157375_10973558 3300013308 Bacteria 989
333 Ga0163163_10001936 3300014325 Bacteria 17537
334 Ga0163163_10068609 3300014325 Bacteria 3528
335 Ga0163163_10490569 3300014325 Bacteria 1290
336 Ga0163163_11181065 3300014325 Bacteria 828
337 Ga0157380_10554047 3300014326 Bacteria 1128
338 Ga0182008_10305235 3300014497 Bacteria 834
339 Ga0157377_10524980 3300014745 Bacteria 832
340 Ga0157379_10071814 3300014968 Bacteria 3096
341 Ga0157379_10317024 3300014968 Bacteria 1423
342 Ga0157379_10468013 3300014968 Bacteria 1165
343 Ga0157376_10656490 3300014969 Bacteria 1050
344 Ga0157376_10709084 3300014969 Bacteria 1012
345 Ga0157376_11813272 3300014969 Bacteria 646
346 Ga0157376_12225699 3300014969 Bacteria 587
347 Ga0163161_11417401 3300017792 Bacteria 607
348 Ga0154015_1407110 3300020610 Bacteria 762
349 Ga0209563_101473 3300025230 Bacteria 6213
350 Ga0209677_105226 3300025253 Bacteria 3454
351 Ga0209148_1000779 3300025254 Bacteria 23713
352 Ga0209233_1005191 3300025261 Bacteria 4347
353 Ga0209233_1028193 3300025261 Bacteria 1350
354 Ga0209233_1032525 3300025261 Bacteria 1205
355 Ga0209233_1051074 3300025261 Bacteria 840
356 Ga0209455_1003881 3300025272 Bacteria 5100
357 Ga0209673_1027776 3300025273 Bacteria 1835
358 Ga0209564_1003985 3300025295 Bacteria 9373
359 Ga0209758_1001023 3300025297 Bacteria 36896
360 Ga0209758_1003040 3300025297 Bacteria 15973
361 Ga0209758_1014568 3300025297 Bacteria 4168
362 Ga0209758_1028731 3300025297 Bacteria 2344
363 Ga0207426_1000596 3300025302 Bacteria 47621
364 Ga0207426_1001063 3300025302 Bacteria 25997
365 Ga0207426_1036686 3300025302 Bacteria 1556
366 Ga0207697_10345109 3300025315 Bacteria 661
367 Ga0207656_10024424 3300025321 Bacteria 2444
368 Ga0207656_10204750 3300025321 Bacteria 954
369 Ga0207692_10017386 3300025898 Bacteria 3207
370 Ga0207692_10139762 3300025898 Bacteria 1377
371 Ga0207692_10663733 3300025898 Bacteria 674
372 Ga0207642_10095980 3300025899 Bacteria 1477
373 Ga0207710_10164935 3300025900 Bacteria 1081
374 Ga0207688_10175813 3300025901 Bacteria 1275
375 Ga0207680_10162733 3300025903 Bacteria 1498
376 Ga0207647_10017488 3300025904 Bacteria 4874
377 Ga0207647_10018334 3300025904 Bacteria 4737
378 Ga0207647_10176581 3300025904 Bacteria 1242
379 Ga0207647_10180635 3300025904 Bacteria 1226
380 Ga0207647_10258149 3300025904 Bacteria 998
381 Ga0207647_10293453 3300025904 Bacteria 927
382 Ga0207685_10211488 3300025905 Bacteria 917
383 Ga0207685_10288519 3300025905 Bacteria 808
384 Ga0207685_10548058 3300025905 Bacteria 615
385 Ga0207699_10159997 3300025906 Bacteria 1498
386 Ga0207699_10179653 3300025906 Bacteria 1422
387 Ga0207699_10391758 3300025906 Bacteria 988
388 Ga0207699_11405174 3300025906 Bacteria 516
389 Ga0207645_10207023 3300025907 Bacteria 1291
390 Ga0207645_10402686 3300025907 Bacteria 920
391 Ga0207643_10504597 3300025908 Bacteria 773
392 Ga0207705_11092401 3300025909 Bacteria 615
393 Ga0207684_10573166 3300025910 Bacteria 965
394 Ga0207654_10015401 3300025911 Bacteria 3969
395 Ga0207654_10077268 3300025911 Bacteria 1995
396 Ga0207654_10104552 3300025911 Bacteria 1751
397 Ga0207654_10211228 3300025911 Bacteria 1283
398 Ga0207707_10003454 3300025912 Bacteria 14012
399 Ga0207707_10008660 3300025912 Bacteria 8827
400 Ga0207707_10236723 3300025912 Bacteria 1588
401 Ga0207695_10001107 3300025913 Bacteria 46846
402 Ga0207695_10024535 3300025913 Bacteria 6779
403 Ga0207695_10046985 3300025913 Bacteria 4572
404 Ga0207695_10067350 3300025913 Bacteria 3673
405 Ga0207695_10202711 3300025913 Bacteria 1897
406 Ga0207695_10430785 3300025913 Bacteria 1203
407 Ga0207671_10006466 3300025914 Bacteria 10430
408 Ga0207671_10065787 3300025914 Bacteria 2697
409 Ga0207671_10071594 3300025914 Bacteria 2586
410 Ga0207671_10083724 3300025914 Bacteria 2395
411 Ga0207671_10838842 3300025914 Bacteria 728
412 Ga0207693_10010745 3300025915 Bacteria 7433
413 Ga0207693_10115846 3300025915 Bacteria 2104
414 Ga0207693_10328165 3300025915 Bacteria 1198
415 Ga0207693_11256778 3300025915 Bacteria 556
416 Ga0207663_10005229 3300025916 Bacteria 6532
417 Ga0207663_10027896 3300025916 Bacteria 3297
418 Ga0207663_11120731 3300025916 Bacteria 633
419 Ga0207663_11482667 3300025916 Bacteria 546
420 Ga0207660_10127082 3300025917 Bacteria 1937
421 Ga0207660_10715261 3300025917 Bacteria 817
422 Ga0207660_11240073 3300025917 Bacteria 606
423 Ga0207662_10147710 3300025918 Bacteria 1493
424 Ga0207662_10884643 3300025918 Bacteria 632
425 Ga0207657_10013306 3300025919 Bacteria 8071
426 Ga0207657_10614074 3300025919 Bacteria 848
427 Ga0207649_10219441 3300025920 Bacteria 1353
428 Ga0207649_10669363 3300025920 Bacteria 803
429 Ga0207652_10151116 3300025921 Bacteria 2079
430 Ga0207652_10821484 3300025921 Bacteria 824
431 Ga0207652_11247085 3300025921 Bacteria 646
432 Ga0207681_10342327 3300025923 Bacteria 1195
433 Ga0207694_10094672 3300025924 Bacteria 2360
434 Ga0207694_10102706 3300025924 Bacteria 2267
435 Ga0207694_10112395 3300025924 Bacteria 2168
436 Ga0207694_11746429 3300025924 Bacteria 523
437 Ga0207650_10054601 3300025925 Bacteria 2964
438 Ga0207650_10450491 3300025925 Bacteria 1071
439 Ga0207687_10080834 3300025927 Bacteria 2347
440 Ga0207687_10112631 3300025927 Bacteria 2022
441 Ga0207700_10011770 3300025928 Bacteria 5599
442 Ga0207700_10104400 3300025928 Bacteria 2267
443 Ga0207700_10558448 3300025928 Bacteria 1017
444 Ga0207700_11005589 3300025928 Bacteria 746
445 Ga0207664_10022677 3300025929 Bacteria 4693
446 Ga0207664_10150097 3300025929 Bacteria 1979
447 Ga0207664_10170277 3300025929 Bacteria 1864
448 Ga0207644_10149785 3300025931 Bacteria 1805
449 Ga0207644_10372708 3300025931 Bacteria 1163
450 Ga0207644_10436833 3300025931 Bacteria 1074
451 Ga0207690_10271092 3300025932 Bacteria 1318
452 Ga0207690_10597790 3300025932 Bacteria 900
453 Ga0207690_11079388 3300025932 Bacteria 669
454 Ga0207690_11452344 3300025932 Bacteria 573
455 Ga0207706_10076918 3300025933 Bacteria 2935
456 Ga0207706_10226877 3300025933 Bacteria 1635
457 Ga0207706_10397935 3300025933 Bacteria 1194
458 Ga0207686_10086380 3300025934 Bacteria 2060
459 Ga0207709_10045551 3300025935 Bacteria 2657
460 Ga0207709_10508692 3300025935 Bacteria 941
461 Ga0207709_10651697 3300025935 Bacteria 838
462 Ga0207670_11912688 3300025936 Bacteria 504
463 Ga0207704_10053071 3300025938 Bacteria 2461
464 Ga0207665_10060799 3300025939 Bacteria 2559
465 Ga0207665_10291676 3300025939 Bacteria 1217
466 Ga0207665_10935261 3300025939 Bacteria 688
467 Ga0207691_10070757 3300025940 Bacteria 3150
468 Ga0207691_10717625 3300025940 Bacteria 843
469 Ga0207691_11145066 3300025940 Bacteria 646
470 Ga0207711_10097824 3300025941 Bacteria 2592
471 Ga0207711_10347091 3300025941 Bacteria 1374
472 Ga0207711_10394322 3300025941 Bacteria 1285
473 Ga0207711_10634220 3300025941 Bacteria 997
474 Ga0207711_10803565 3300025941 Bacteria 876
475 Ga0207689_10177305 3300025942 Bacteria 1757
476 Ga0207689_10323960 3300025942 Bacteria 1279
477 Ga0207679_10832385 3300025945 Bacteria 842
478 Ga0207679_10866107 3300025945 Bacteria 825
479 Ga0207679_11091876 3300025945 Bacteria 732
480 Ga0207667_10014502 3300025949 Bacteria 8982
481 Ga0207667_10018032 3300025949 Bacteria 7928
482 Ga0207667_10029597 3300025949 Bacteria 5937
483 Ga0207667_10172989 3300025949 Bacteria 2219
484 Ga0207667_10492627 3300025949 Bacteria 1243
485 Ga0207667_11404221 3300025949 Bacteria 672
486 Ga0207651_10358408 3300025960 Bacteria 1230
487 Ga0207712_10113984 3300025961 Bacteria 2033
488 Ga0207712_10540974 3300025961 Bacteria 1001
489 Ga0207668_10055592 3300025972 Bacteria 2752
490 Ga0207668_10087437 3300025972 Bacteria 2279
491 Ga0207668_10232051 3300025972 Bacteria 1488
492 Ga0207668_10261055 3300025972 Bacteria 1411
493 Ga0207640_10013094 3300025981 Bacteria 4744
494 Ga0207640_10335827 3300025981 Bacteria 1208
495 Ga0207658_10536095 3300025986 Bacteria 1046
496 Ga0207658_11875362 3300025986 Bacteria 546
497 Ga0207658_11876657 3300025986 Bacteria 546
498 Ga0207677_10044422 3300026023 Bacteria 2960
499 Ga0207677_10315756 3300026023 Bacteria 1297
500 Ga0207677_11296302 3300026023 Bacteria 669
501 Ga0207703_10133830 3300026035 Bacteria 2144
502 Ga0207703_10325210 3300026035 Bacteria 1409
503 Ga0207703_11489295 3300026035 Bacteria 651
504 Ga0207703_11645954 3300026035 Bacteria 617
505 Ga0207639_10036729 3300026041 Bacteria 3633
506 Ga0207639_10110958 3300026041 Bacteria 2235
507 Ga0207639_10153997 3300026041 Bacteria 1929
508 Ga0207639_10270415 3300026041 Bacteria 1490
509 Ga0207639_10300762 3300026041 Bacteria 1418
510 Ga0207639_10681735 3300026041 Bacteria 952
511 Ga0207639_10887596 3300026041 Bacteria 833
512 Ga0207639_11793201 3300026041 Bacteria 574
513 Ga0207678_10104065 3300026067 Bacteria 2422
514 Ga0207678_10233586 3300026067 Bacteria 1575
515 Ga0207678_10609310 3300026067 Bacteria 957
516 Ga0207678_10682024 3300026067 Bacteria 904
517 Ga0207678_10702958 3300026067 Bacteria 890
518 Ga0207678_10909348 3300026067 Bacteria 778
519 Ga0207678_11360819 3300026067 Bacteria 628
520 Ga0207708_10053369 3300026075 Bacteria 3080
521 Ga0207702_10029932 3300026078 Bacteria 4533
522 Ga0207702_10055150 3300026078 Bacteria 3370
523 Ga0207702_10080823 3300026078 Bacteria 2821
524 Ga0207702_10146894 3300026078 Bacteria 2141
525 Ga0207702_11284238 3300026078 Bacteria 726
526 Ga0207641_10835299 3300026088 Bacteria 912
527 Ga0207641_11654154 3300026088 Bacteria 642
528 Ga0207648_10040201 3300026089 Bacteria 4110
529 Ga0207648_10451827 3300026089 Bacteria 1170
530 Ga0207648_10886273 3300026089 Bacteria 833
531 Ga0207676_11026102 3300026095 Bacteria 813
532 Ga0207676_11254655 3300026095 Bacteria 735
533 Ga0207674_10003961 3300026116 Bacteria 18004
534 Ga0207674_10346396 3300026116 Bacteria 1436
535 Ga0207675_100099826 3300026118 Bacteria 2734
536 Ga0207675_100280190 3300026118 Bacteria 1620
537 Ga0207675_100795440 3300026118 Bacteria 959
538 Ga0207683_10208925 3300026121 Bacteria 1776
539 Ga0207683_10212430 3300026121 Bacteria 1761
540 Ga0207683_10825021 3300026121 Bacteria 861
541 Ga0207698_10167642 3300026142 Bacteria 1930
542 Ga0207698_10879072 3300026142 Bacteria 902
543 Ga0207698_11221784 3300026142 Bacteria 766
544 Ga0207698_11577883 3300026142 Bacteria 672
545 Ga0207698_11607434 3300026142 Bacteria 665
546 Ga0209389_1000068 3300027296 Bacteria 98954
547 Ga0209389_1000084 3300027296 Bacteria 85267
548 Ga0209589_1000023 3300027357 Bacteria 177856
549 Ga0209589_1000041 3300027357 Bacteria 125191
550 Ga0209489_100032 3300027361 Bacteria 177856
551 Ga0209489_100070 3300027361 Bacteria 138580
552 Ga0209489_126518 3300027361 Bacteria 814
553 Ga0209489_126519 3300027361 Bacteria 814
554 Ga0209700_100040 3300027363 Bacteria 177856
555 Ga0209700_100117 3300027363 Bacteria 115595
556 Ga0209588_1113340 3300027671 Bacteria 870
557 Ga0209813_10024452 3300027866 Bacteria 1728
558 Ga0209813_10129339 3300027866 Bacteria 887
559 Ga0268266_10179991 3300028379 Bacteria 1924
560 Ga0268266_10226203 3300028379 Bacteria 1721
561 Ga0268266_10311862 3300028379 Bacteria 1470
562 Ga0268266_11277080 3300028379 Bacteria 709
563 Ga0268265_10552275 3300028380 Bacteria 1093
564 Ga0268265_11093543 3300028380 Bacteria 791
565 Ga0268264_10291245 3300028381 Bacteria 1533
566 Ga0268264_11072380 3300028381 Bacteria 813
567 Ga0265334_10252012 3300028573 Bacteria 607
568 Ga0307517_10002371 3300028786 Bacteria 30326
569 Ga0307517_10475190 3300028786 Bacteria 642
570 Ga0265330_10036375 3300031235 Bacteria 2195
571 Ga0265330_10040331 3300031235 Bacteria 2074
572 Ga0265330_10287949 3300031235 Bacteria 692
573 Ga0265332_10010212 3300031238 Bacteria 4179
574 Ga0265332_10027117 3300031238 Bacteria 2510
575 Ga0265332_10260161 3300031238 Bacteria 718
576 Ga0265328_10212550 3300031239 Bacteria 736
577 Ga0265325_10028245 3300031241 Bacteria 3025
578 Ga0265340_10000375 3300031247 Bacteria 23722
579 Ga0265340_10252895 3300031247 Bacteria 785
580 Ga0265339_10016283 3300031249 Bacteria 4436
581 Ga0265339_10141743 3300031249 Bacteria 1222
582 Ga0265339_10341154 3300031249 Bacteria 708
583 Ga0265331_10171693 3300031250 Bacteria 981
584 Ga0265331_10191472 3300031250 Bacteria 922
585 Ga0307408_100195724 3300031548 Bacteria 1632
586 Ga0265313_10087630 3300031595 Bacteria 1403
587 Ga0265314_10054570 3300031711 Bacteria 2766
588 Ga0265314_10274783 3300031711 Bacteria 956
589 Ga0265342_10040689 3300031712 Bacteria 2818
590 Ga0307516_10147886 3300031730 Bacteria 2113
591 Ga0307405_10315417 3300031731 Bacteria 1192
592 Ga0307412_11302013 3300031911 Bacteria 654
593 Ga0307412_11303951 3300031911 Bacteria 654
594 Ga0307409_100834587 3300031995 Bacteria 931
595 Ga0307416_100305850 3300032002 Bacteria 1583
596 Ga0307416_100442412 3300032002 Bacteria 1350
597 Ga0307411_11046880 3300032005 Bacteria 733
598 Ga0307510_10206466 3300033180 Bacteria 1492
599 Ga0307510_10273830 3300033180 Bacteria 1162
600 Ga0316215_1000403 3300033544 Bacteria 5173
601 Ga0373958_0211203 3300034819 Bacteria 512
602 Ga0373959_0090084 3300034820 Bacteria 718
603 Ga0373938_0090091 3300034957 Bacteria 758
604 Ga0373926_0126259 3300035083 Bacteria 967
605 Ga0373934_0002259 3300035086 Bacteria 7082
606 Ga0373944_0261169 3300035089 Bacteria 642
607 Ga0373944_0312345 3300035089 Bacteria 592
608 Ga0373923_0000561 3300035111 Bacteria 9120
609 Ga0373936_0021847 3300035113 Bacteria 2490
610 Ga0373941_0029854 3300035115 Bacteria 1612
611 Ga0373953_0052617 3300035117 Bacteria 1648
612 Ga0373953_0311020 3300035117 Bacteria 688
613 Ga0373954_0000273 3300035118 Bacteria 18782
614 Ga0373956_0004613 3300035119 Bacteria 5507
615 Ga0373957_0000313 3300035120 Bacteria 12192
616 Ga0373957_0007058 3300035120 Bacteria 3573
617 Ga0373957_0100244 3300035120 Bacteria 1159
618 Ga0373943_0011786 3300035170 Bacteria 3935
619 Ga0373946_0052659 3300035171 Bacteria 1708
620 Ga0373946_0254019 3300035171 Bacteria 858
621 Ga0373946_0763743 3300035171 Bacteria 508
622 Ga0373955_0004906 3300035172 Bacteria 5968
623 Ga0373961_0137836 3300035241 Bacteria 822
624 Ga0373962_0126922 3300035242 Bacteria 818
625 Ga0373924_0001394 3300035410 Bacteria 7816
626 Ga0373931_0048749 3300035691 Bacteria 2246
627 Ga0373931_0228047 3300035691 Bacteria 1124
628 Ga0373935_0032089 3300035692 Bacteria 3263
629 Ga0373935_0111462 3300035692 Bacteria 1817
630 Ga0373935_0116880 3300035692 Bacteria 1777
631 Ga0373935_0445569 3300035692 Bacteria 935
632 Ga0373927_0002786 3300035695 Bacteria 12762
633 Ga0373927_0048423 3300035695 Bacteria 2749
634 Ga0373927_0094557 3300035695 Bacteria 1942
635 Ga0373927_0116391 3300035695 Bacteria 1743
636 Ga0373933_0001950 3300035724 Bacteria 11904
637 Ga0373947_0004007 3300035725 Bacteria 8651
638 Ga0373937_0011586 3300036401 Bacteria 7741
639 Ga0373937_0072826 3300036401 Bacteria 3169
640 Ga0372808_036262 3300036459 Bacteria 708
641 Ga0373925_0001317 3300037068 Bacteria 21738
642 Ga0373925_0494488 3300037068 Bacteria 1004
643 Ga0373925_1241306 3300037068 Bacteria 612
644 Ga0395899_0325946 3300037312 Bacteria 1033
645 Ga0395899_0427478 3300037312 Bacteria 871
646 Ga0395900_0004063 3300037418 Bacteria 15603
647 Ga0395900_0078805 3300037418 Bacteria 3385
648 Ga0395898_0005719 3300037466 Bacteria 13397
649 Ga0395898_0116452 3300037466 Bacteria 2561
650 Ga0395898_1767960 3300037466 Bacteria 540
651 Ga0395905_1227613 3300037471 Bacteria 653
652 Ga0436364_0159664 3300037853 Bacteria 1088
653 Ga0436364_0899798 3300037853 Bacteria 1758
654 Ga0395901_0268694 3300038443 Bacteria 1774
655 Ga0395901_0292119 3300038443 Bacteria 1691
656 Ga0395901_0694699 3300038443 Bacteria 1016
657 Ga0436365_0388356 3300039437 Bacteria 551
658 Ga0436361_0111464 3300039447 Bacteria 1515
659 Ga0436363_0689938 3300039450 Bacteria 578
660 Ga0451793_0059355 3300041452 Bacteria 2314
661 Ga0451793_0690763 3300041452 Bacteria 580
662 Ga0451797_0198863 3300041453 Bacteria 1200
663 Ga0451795_0747937 3300041456 Bacteria 504
664 Ga0451835_1266689 3300041492 Bacteria 816
665 Ga0451847_0967965 3300041503 Bacteria 858
666 Ga0451853_2604563 3300041512 Bacteria 577
667 Ga0466969_0269529 3300044656 Bacteria 771
668 Ga0466965_0154127 3300044683 Bacteria 1202
669 Ga0466966_0001701 3300044684 Bacteria 14207
670 Ga0466961_0000064 3300044693 Bacteria 63553
671 Ga0466961_0822756 3300044693 Bacteria 554
672 Ga0466963_0023676 3300044694 Bacteria 3902
673 Ga0466963_0270068 3300044694 Bacteria 1195
674 Ga0466968_0019847 3300044735 Bacteria 2709
675 Ga0466968_0033041 3300044735 Bacteria 2155
676 Ga0466968_0104300 3300044735 Bacteria 1269
677 Ga0466970_0131370 3300044765 Bacteria 1376
678 Ga0466957_0097815 3300044842 Bacteria 1846
679 Ga0466957_1209508 3300044842 Bacteria 547
680 Ga0466960_0092264 3300044901 Bacteria 1546
681 Ga0466959_0004743 3300045049 Bacteria 9159
682 Ga0466967_0019942 3300045976 Bacteria 5405
683 Ga0466967_0103843 3300045976 Bacteria 2601
684 Ga0466967_0545088 3300045976 Bacteria 1141
685 Ga0495592_0003384 3300046454 Bacteria 11438
686 Ga0495592_0075234 3300046454 Bacteria 2452
687 Ga0495592_0308956 3300046454 Bacteria 1025
688 Ga0495603_0005350 3300046455 Bacteria 7655
689 Ga0495603_0243677 3300046455 Bacteria 1035
690 Ga0495590_0103762 3300046457 Bacteria 1011
691 Ga0495590_0145587 3300046457 Bacteria 857
692 Ga0495590_0306525 3300046457 Bacteria 598
693 Ga0495629_0000581 3300046459 Bacteria 29697
694 Ga0495629_0004536 3300046459 Bacteria 10393
695 Ga0495629_0084445 3300046459 Bacteria 2215
696 Ga0495638_0161042 3300046460 Bacteria 1294
697 Ga0495641_0013094 3300046461 Bacteria 4584
698 Ga0495651_0004932 3300046462 Bacteria 10203
699 Ga0495651_0011399 3300046462 Bacteria 6830
700 Ga0495651_0106525 3300046462 Bacteria 2078
701 Ga0495651_0402526 3300046462 Bacteria 893
702 Ga0495653_0002259 3300046463 Bacteria 15242
703 Ga0495653_0472606 3300046463 Bacteria 785
704 Ga0495580_0065208 3300046472 Bacteria 2551
705 Ga0495582_0000528 3300046473 Bacteria 21108
706 Ga0495582_0567799 3300046473 Bacteria 656
707 Ga0495605_0090501 3300046474 Bacteria 1419
708 Ga0495605_0108498 3300046474 Bacteria 1269
709 Ga0495639_0000044 3300046475 Bacteria 55019
710 Ga0495639_0203577 3300046475 Bacteria 969
711 Ga0495662_0001271 3300046476 Bacteria 12462
712 Ga0495664_0015612 3300046477 Bacteria 4319
713 Ga0495664_0287814 3300046477 Bacteria 992
714 Ga0495584_0408608 3300046491 Bacteria 690
715 Ga0495585_0104343 3300046492 Bacteria 1513
716 Ga0495585_0399262 3300046492 Bacteria 662
717 Ga0495594_0000351 3300046499 Bacteria 23112
718 Ga0495594_0061151 3300046499 Bacteria 2084
719 Ga0495594_0089094 3300046499 Bacteria 1728
720 Ga0495594_0344380 3300046499 Bacteria 849
721 Ga0495596_0209539 3300046500 Bacteria 757
722 Ga0495596_0254674 3300046500 Bacteria 681
723 Ga0495583_0305329 3300046506 Bacteria 632
724 Ga0495606_0030295 3300046507 Bacteria 3782
725 Ga0495606_0568819 3300046507 Bacteria 561
726 Ga0495608_0002317 3300046511 Bacteria 13740
727 Ga0495608_0015452 3300046511 Bacteria 5294
728 Ga0495610_0289571 3300046512 Bacteria 635
729 Ga0495618_0078803 3300046514 Bacteria 2100
730 Ga0495618_0217737 3300046514 Bacteria 1205
731 Ga0495618_0430717 3300046514 Bacteria 803
732 Ga0495618_0645519 3300046514 Bacteria 626
733 Ga0495628_0041294 3300046516 Bacteria 3682
734 Ga0495628_0272250 3300046516 Bacteria 1259
735 Ga0495628_0606531 3300046516 Bacteria 781
736 Ga0495628_0959312 3300046516 Bacteria 590
737 Ga0495630_0129606 3300046517 Bacteria 1915
738 Ga0495630_0426812 3300046517 Bacteria 1016
739 Ga0495630_0612377 3300046517 Bacteria 835
740 Ga0495630_1363484 3300046517 Bacteria 534
741 Ga0495631_0131348 3300046518 Bacteria 1076
742 Ga0495632_0066789 3300046519 Bacteria 1735
743 Ga0495632_0296362 3300046519 Bacteria 718
744 Ga0495643_0021099 3300046522 Bacteria 3743
745 Ga0495644_0022030 3300046523 Bacteria 2429
746 Ga0495648_0005365 3300046524 Bacteria 10672
747 Ga0495648_0201345 3300046524 Bacteria 996
748 Ga0495648_0242298 3300046524 Bacteria 875
749 Ga0495648_0371214 3300046524 Bacteria 647
750 Ga0495666_0234677 3300046526 Bacteria 838
751 Ga0495642_0403396 3300046528 Bacteria 603
752 Ga0495652_0044737 3300046529 Bacteria 3811
753 Ga0495652_0046914 3300046529 Bacteria 3707
754 Ga0495652_0059768 3300046529 Bacteria 3224
755 Ga0495654_0345832 3300046530 Bacteria 599
756 Ga0495665_0000397 3300046531 Bacteria 22124
757 Ga0495640_0006961 3300046533 Bacteria 8903
758 Ga0495640_0028817 3300046533 Bacteria 3993
759 Ga0495640_0081266 3300046533 Bacteria 2154
760 Ga0495640_0126000 3300046533 Bacteria 1661
761 Ga0495586_0078554 3300046535 Bacteria 1811
762 Ga0495587_0024998 3300046536 Bacteria 3654
763 Ga0495587_0269695 3300046536 Bacteria 955
764 Ga0495598_0016689 3300046537 Bacteria 1879
765 Ga0495609_0148382 3300046538 Bacteria 998
766 Ga0495609_0163201 3300046538 Bacteria 943
767 Ga0495609_0256532 3300046538 Bacteria 719
768 Ga0495621_0016641 3300046539 Bacteria 2363
769 Ga0495645_0087030 3300046543 Bacteria 2235
770 Ga0495645_0914633 3300046543 Bacteria 520
771 Ga0495622_0002861 3300046557 Bacteria 8237
772 Ga0495622_0028361 3300046557 Bacteria 2614
773 Ga0495633_0018819 3300046558 Bacteria 3500
774 Ga0495633_0040307 3300046558 Bacteria 2225
775 Ga0495667_0000359 3300046559 Bacteria 28998
776 Ga0495667_0012846 3300046559 Bacteria 5673
777 Ga0495667_0121591 3300046559 Bacteria 1685
778 Ga0495667_0653687 3300046559 Bacteria 653
779 Ga0495656_0040458 3300046615 Bacteria 1943
780 Ga0495668_0079760 3300046616 Bacteria 1796
781 Ga0495668_0270182 3300046616 Bacteria 931
782 Ga0495634_0000252 3300046642 Bacteria 50709
783 Ga0495634_0012038 3300046642 Bacteria 6271
784 Ga0495634_0115615 3300046642 Bacteria 1722
785 Ga0495634_0163912 3300046642 Bacteria 1400
786 Ga0495611_0362112 3300046648 Bacteria 665
787 Ga0495611_0456807 3300046648 Bacteria 582
788 Ga0495625_0286459 3300046660 Bacteria 1058
789 Ga0495625_0388348 3300046660 Bacteria 874
790 Ga0495635_0000251 3300046663 Bacteria 34185
791 Ga0495635_0004777 3300046663 Bacteria 9417
792 Ga0495635_0008104 3300046663 Bacteria 7341
793 Ga0495635_0293417 3300046663 Bacteria 1091
794 Ga0495635_0746670 3300046663 Bacteria 633
795 Ga0495659_0037018 3300046664 Bacteria 1727
796 Ga0495661_0272002 3300046665 Bacteria 857
797 Ga0495661_0370201 3300046665 Bacteria 702
798 Ga0495588_0006813 3300046674 Bacteria 5173
799 Ga0495588_0118258 3300046674 Bacteria 1397
800 Ga0495657_0005246 3300046675 Bacteria 10258
801 Ga0495657_0042021 3300046675 Bacteria 3124
802 Ga0495657_0053434 3300046675 Bacteria 2703
803 Ga0495657_0800501 3300046675 Bacteria 539
804 Ga0495599_0000305 3300046678 Bacteria 29662
805 Ga0495599_0610490 3300046678 Bacteria 634
806 Ga0495623_0001012 3300046679 Bacteria 18985
807 Ga0495623_0208049 3300046679 Bacteria 1121
808 Ga0495623_0541637 3300046679 Bacteria 610
809 Ga0495646_0055175 3300046680 Bacteria 2387
810 Ga0495647_0003477 3300046681 Bacteria 5038
811 Ga0495658_0009797 3300046683 Bacteria 4776
812 Ga0495658_0823973 3300046683 Bacteria 594
813 Ga0495669_0053388 3300046684 Bacteria 1817
814 Ga0495669_0055937 3300046684 Bacteria 1778
815 Ga0495613_0013328 3300046689 Bacteria 6107
816 Ga0495613_0055277 3300046689 Bacteria 2917
817 Ga0495613_0132640 3300046689 Bacteria 1783
818 Ga0495624_0000832 3300046690 Bacteria 24417
819 Ga0495624_0144788 3300046690 Bacteria 1454
820 Ga0495624_0449920 3300046690 Bacteria 772
821 Ga0495670_0172201 3300046691 Bacteria 1140
822 Ga0495670_0506459 3300046691 Bacteria 656
823 Ga0495649_0188463 3300046694 Bacteria 1074
824 Ga0495649_0428360 3300046694 Bacteria 662
825 Ga0495589_0331526 3300046794 Bacteria 702
826 Ga0495600_0001567 3300046809 Bacteria 12723
827 Ga0495600_0046355 3300046809 Bacteria 2836
828 Ga0495581_0004430 3300047315 Bacteria 8116
829 Ga0495581_0160997 3300047315 Bacteria 1312
830 Ga0495604_0013917 3300047317 Bacteria 6416
831 Ga0495604_0095991 3300047317 Bacteria 2189
832 Ga0495604_0097526 3300047317 Bacteria 2167
833 Ga0495604_0181603 3300047317 Bacteria 1471
834 Ga0495636_0488091 3300047318 Bacteria 595
835 Ga0495674_0012961 3300047319 Bacteria 7848
836 Ga0495674_0020357 3300047319 Bacteria 6143
837 Ga0495674_0095708 3300047319 Bacteria 2531
838 Ga0495674_0373305 3300047319 Bacteria 1155
839 Ga0495674_0994739 3300047319 Bacteria 643
840 Ga0495672_0026351 3300047320 Bacteria 3710
841 Ga0495672_0198189 3300047320 Bacteria 1006
842 Ga0495676_0025127 3300047321 Bacteria 5146
843 Ga0495676_0042368 3300047321 Bacteria 3738
844 Ga0495676_0130134 3300047321 Bacteria 1818
845 Ga0495676_0663042 3300047321 Bacteria 676
846 Ga0495680_0004040 3300047322 Bacteria 14143
847 Ga0495680_0019046 3300047322 Bacteria 5809
848 Ga0495680_0070812 3300047322 Bacteria 2657
849 Ga0495683_0016620 3300047323 Bacteria 3820
850 Ga0495683_0018489 3300047323 Bacteria 3603
851 Ga0495683_0289283 3300047323 Bacteria 707
852 Ga0495675_0012888 3300047444 Bacteria 5267
853 Ga0495675_0023093 3300047444 Bacteria 3963
854 Ga0495685_135450 3300047447 Bacteria 804
855 Ga0495673_0095006 3300047469 Bacteria 1213
856 Ga0495673_0134010 3300047469 Bacteria 971
857 Ga0495673_0284528 3300047469 Bacteria 596
858 Ga0495681_0097243 3300047470 Bacteria 1292
859 Ga0495681_0213557 3300047470 Bacteria 777
860 Ga0495684_0000297 3300047471 Bacteria 40486
861 Ga0495684_0065459 3300047471 Bacteria 2763
862 Ga0495684_0617417 3300047471 Bacteria 729
863 Ga0495686_0064501 3300047472 Bacteria 2267
864 Ga0495686_0652492 3300047472 Bacteria 540
865 Ga0495593_0000353 3300047673 Bacteria 25428
866 Ga0495593_0000354 3300047673 Bacteria 25361
867 Ga0495593_0295441 3300047673 Bacteria 810
868 Ga0495602_0034391 3300048088 Bacteria 4741
869 Ga0495602_0043460 3300048088 Bacteria 4084
870 Ga0495602_0116200 3300048088 Bacteria 2162
871 Ga0495602_0364883 3300048088 Bacteria 1039
872 Ga0495614_0029542 3300048089 Bacteria 2360
873 Ga0495626_0072272 3300048091 Bacteria 1548
874 Ga0496100_0194276 3300048903 Bacteria 1475
875 Ga0496100_0204377 3300048903 Bacteria 1441
876 Ga0496100_0331885 3300048903 Bacteria 1145
877 Ga0496100_0748634 3300048903 Bacteria 764
878 Ga0496101_0040852 3300048904 Bacteria 3304
879 Ga0496101_0065283 3300048904 Bacteria 2653
880 Ga0496101_0275948 3300048904 Bacteria 1313
881 Ga0496101_0301976 3300048904 Bacteria 1254
882 Ga0496101_1082444 3300048904 Bacteria 630
883 Ga0496102_0018941 3300048905 Bacteria 6056
884 Ga0496102_0220536 3300048905 Bacteria 1788
885 Ga0496102_0284506 3300048905 Bacteria 1558
886 Ga0496102_0297898 3300048905 Bacteria 1520
887 Ga0496102_0349357 3300048905 Bacteria 1392
888 Ga0496102_0404688 3300048905 Bacteria 1283
889 Ga0496102_0477994 3300048905 Bacteria 1167
890 Ga0496103_0032398 3300048906 Bacteria 3190
891 Ga0496103_0047180 3300048906 Bacteria 2661
892 Ga0496104_0003628 3300048907 Bacteria 13337
893 Ga0496104_0006867 3300048907 Bacteria 10035
894 Ga0496104_0028291 3300048907 Bacteria 5195
895 Ga0496104_0098535 3300048907 Bacteria 2798
896 Ga0496105_0005048 3300048908 Bacteria 9996
897 Ga0496105_0030914 3300048908 Bacteria 4389
898 Ga0496105_0035621 3300048908 Bacteria 4096
899 Ga0496105_0124790 3300048908 Bacteria 2122
900 Ga0496106_0032366 3300048909 Bacteria 3899
901 Ga0496106_0085320 3300048909 Bacteria 2431
902 Ga0496106_0087123 3300048909 Bacteria 2406
903 Ga0496106_0705097 3300048909 Bacteria 804
904 Ga0496106_0950907 3300048909 Bacteria 677
905 Ga0496106_1361958 3300048909 Bacteria 549
906 Ga0496107_0011454 3300048910 Bacteria 6178
907 Ga0496107_0014705 3300048910 Bacteria 5479
908 Ga0496107_0140329 3300048910 Bacteria 1786
909 Ga0496107_0207012 3300048910 Bacteria 1458
910 Ga0496107_0209897 3300048910 Bacteria 1448
911 Ga0496107_0284408 3300048910 Bacteria 1231
912 Ga0496108_0029559 3300048911 Bacteria 4540
913 Ga0496108_0125044 3300048911 Bacteria 2207
914 Ga0496108_0138973 3300048911 Bacteria 2092
915 Ga0496108_0423084 3300048911 Bacteria 1163
916 Ga0496108_1108959 3300048911 Bacteria 672
917 Ga0496109_0227289 3300048912 Bacteria 1755
918 Ga0496109_0284667 3300048912 Bacteria 1558
919 Ga0496110_0058995 3300048913 Bacteria 3381
920 Ga0496110_0074927 3300048913 Bacteria 3006
921 Ga0496110_0125698 3300048913 Bacteria 2313
922 Ga0496111_0026206 3300048914 Bacteria 4116
923 Ga0496111_0115837 3300048914 Bacteria 1976
924 Ga0496111_0259109 3300048914 Bacteria 1290
925 Ga0496112_0000004 3300048915 Bacteria 553294
926 Ga0496112_0000992 3300048915 Bacteria 20760
927 Ga0496112_0023912 3300048915 Bacteria 5845
928 Ga0496112_0080896 3300048915 Bacteria 3212
929 Ga0496112_0270245 3300048915 Bacteria 1648
930 Ga0496113_0101567 3300048916 Bacteria 2229
931 Ga0496113_0267807 3300048916 Bacteria 1365
932 Ga0496113_0326550 3300048916 Bacteria 1230
933 Ga0496113_0352388 3300048916 Bacteria 1181
934 Ga0496114_0079724 3300048917 Bacteria 2764
935 Ga0496114_0119923 3300048917 Bacteria 2262
936 Ga0496114_0366075 3300048917 Bacteria 1275
937 Ga0496114_0404332 3300048917 Bacteria 1209
938 Ga0496115_0015081 3300048918 Bacteria 5857
939 Ga0496115_0024858 3300048918 Bacteria 4659
940 Ga0496115_0129789 3300048918 Bacteria 2077
941 Ga0496115_0143029 3300048918 Bacteria 1973
942 Ga0496115_0182940 3300048918 Bacteria 1732
943 Ga0496115_0242538 3300048918 Bacteria 1485
944 Ga0496116_0032971 3300048919 Bacteria 3683
945 Ga0496116_0138010 3300048919 Bacteria 1377
946 Ga0496117_0043874 3300048920 Bacteria 3245
947 Ga0496117_0058877 3300048920 Bacteria 2658
948 Ga0496118_0051558 3300048921 Bacteria 3147
949 Ga0496118_0093767 3300048921 Bacteria 2055
950 Ga0496118_0105830 3300048921 Bacteria 1884
951 Ga0496119_0015494 3300048922 Bacteria 5863
952 Ga0496119_0046477 3300048922 Bacteria 2710
953 Ga0496119_0190509 3300048922 Bacteria 1069
954 Ga0496120_0017309 3300048923 Bacteria 4679
955 Ga0496121_0009741 3300048924 Bacteria 10988
956 Ga0496121_0080061 3300048924 Bacteria 2591
957 Ga0496121_0251104 3300048924 Bacteria 1227
958 Ga0496121_0348964 3300048924 Bacteria 986
959 Ga0496122_0096470 3300048925 Bacteria 1994
960 Ga0496124_0165086 3300048927 Bacteria 1722
961 Ga0496124_0174939 3300048927 Bacteria 1658
962 Ga0496124_0212824 3300048927 Bacteria 1461
963 Ga0496124_0473024 3300048927 Bacteria 848
964 Ga0496124_0666093 3300048927 Bacteria 665
965 Ga0496125_0025883 3300048928 Bacteria 5362
966 Ga0496125_0075151 3300048928 Bacteria 2616
967 Ga0496125_0087691 3300048928 Bacteria 2349
968 Ga0496125_0105915 3300048928 Bacteria 2054
969 Ga0496125_0300709 3300048928 Bacteria 983
970 Ga0496126_0006093 3300048929 Bacteria 13526
971 Ga0496126_0021321 3300048929 Bacteria 6329
972 Ga0496126_0023638 3300048929 Bacteria 5954
973 Ga0496126_0176252 3300048929 Bacteria 1818
974 Ga0496126_0272766 3300048929 Bacteria 1403
975 Ga0496126_0300590 3300048929 Bacteria 1324
976 Ga0496126_0508734 3300048929 Bacteria 961
977 Ga0496126_0534418 3300048929 Bacteria 933
978 Ga0496126_0623967 3300048929 Bacteria 847
979 Ga0496126_0736643 3300048929 Bacteria 762
980 Ga0496126_0876925 3300048929 Bacteria 682
981 Ga0496126_1002157 3300048929 Bacteria 627
982 Ga0495678_187774 3300049459 Bacteria 644
983 Ga0501032_0311861 3300049569 Bacteria 1016
984 Ga0501047_0063880 3300049581 Bacteria 3551
985 Ga0501070_0017157 3300049586 Bacteria 6077
986 Ga0501074_0013275 3300049590 Bacteria 5989
987 Ga0501079_0940544 3300049741 Bacteria 681
988 Ga0501080_0018387 3300049742 Bacteria 6469
989 Ga0501044_0058485 3300049823 Bacteria 3953
990 nmdc:mga03683_118285_c2 3300050489 Bacteria 721
991 nmdc:mga03683_130443_c1 3300050489 Bacteria 1124
992 nmdc:mga03n38_363681_c1 3300050490 Bacteria 790
993 nmdc:mga00v17_115026_c1 3300050491 Bacteria 1709
994 nmdc:mga00v17_259613_c1 3300050491 Bacteria 1127
995 nmdc:mga00v17_468493_c1 3300050491 Bacteria 817
996 nmdc:mga0yw44_10663_c1 3300050492 Bacteria 4705
997 nmdc:mga0yw44_185119_c1 3300050492 Bacteria 1372
998 nmdc:mga0yw44_351928_c1 3300050492 Bacteria 992
999 nmdc:mga0yw44_46808_c1 3300050492 Bacteria 2600
1000 nmdc:mga0yw44_633414_c1 3300050492 Bacteria 727
1001 nmdc:mga0yw44_75034_c1 3300050492 Bacteria 2108
1002 nmdc:mga0k408_125733_c1 3300050493 Bacteria 1521
1003 nmdc:mga0k408_294680_c1 3300050493 Bacteria 968
1004 nmdc:mga0k408_404199_c1 3300050493 Bacteria 813
1005 nmdc:mga0k408_98906_c2 3300050493 Bacteria 689
1006 nmdc:mga06z11_110149_c1 3300050494 Bacteria 1523
1007 nmdc:mga06z11_123298_c1 3300050494 Bacteria 1448
1008 nmdc:mga04h51_227627_c1 3300050495 Bacteria 741
1009 nmdc:mga04h51_33249_c1 3300050495 Bacteria 1641
1010 nmdc:mga07m45_136166_c1 3300050496 Bacteria 1422
1011 nmdc:mga07m45_349009_c1 3300050496 Bacteria 860
1012 nmdc:mga07m45_86850_c1 3300050496 Bacteria 1789
1013 nmdc:mga05p37_223714_c1 3300050507 Bacteria 2270
1014 nmdc:mga0n895_292136_c1 3300050512 Bacteria 1652
1015 nmdc:mga0n895_843011_c1 3300050512 Bacteria 905
1016 nmdc:mga0rr50_1568498_c1 3300050513 Bacteria 556
1017 nmdc:mga08x19_274042_c1 3300050514 Bacteria 1168
1018 nmdc:mga0a205_1308477_c1 3300050515 Bacteria 572
1019 nmdc:mga0sz30_15675_c1 3300050516 Bacteria 2997
1020 nmdc:mga0sz30_238319_c1 3300050516 Bacteria 810
1021 nmdc:mga0sz30_422440_c1 3300050516 Bacteria 598
1022 nmdc:mga0sz30_47091_c1 3300050516 Bacteria 1822
1023 nmdc:mga0sz30_47659_c1 3300050516 Bacteria 1811
1024 Ga0495601_0055289 3300053077 Bacteria 2513
1025 Ga0495601_0524500 3300053077 Bacteria 763
1026 Ga0495601_0642899 3300053077 Bacteria 679
1027 Ga0500610_0143868 3300053079 Bacteria 1201
1028 Ga0500635_0098504 3300053080 Bacteria 1072
1029 Ga0495655_0002827 3300053083 Bacteria 2794
1030 Ga0495655_0003704 3300053083 Bacteria 2547
1031 Ga0495655_0058175 3300053083 Bacteria 1046
1032 Ga0495655_0066522 3300053083 Bacteria 997
1033 Ga0495595_0001211 3300053084 Bacteria 10032
1034 Ga0495595_0007545 3300053084 Bacteria 4453
1035 Ga0495619_0001922 3300053085 Bacteria 13848
1036 Ga0495619_0026539 3300053085 Bacteria 3727
1037 Ga0495619_0948117 3300053085 Bacteria 577
1038 Ga0495619_1061202 3300053085 Bacteria 540
1039 Ga0500578_0538260 3300053086 Bacteria 651
1040 Ga0500578_0591572 3300053086 Bacteria 611
1041 Ga0500643_000025 3300053087 Bacteria 259605
1042 Ga0500644_0042470 3300053088 Bacteria 1516
1043 Ga0500583_0221286 3300053092 Bacteria 938
1044 Ga0500566_0000171 3300053094 Bacteria 32979
1045 Ga0500566_0454023 3300053094 Bacteria 561
1046 Ga0500640_017219 3300053095 Bacteria 3062
1047 Ga0500641_0078870 3300053096 Bacteria 1395
1048 Ga0500650_0391966 3300053098 Bacteria 602
1049 Ga0500557_000001 3300053105 Bacteria 241298
1050 Ga0500562_007899 3300053108 Bacteria 2687
1051 Ga0500569_001417 3300053109 Bacteria 4512
1052 Ga0500572_014491 3300053111 Bacteria 1971
1053 Ga0500592_006946 3300053116 Bacteria 1801
1054 Ga0500594_0007738 3300053118 Bacteria 2437
1055 Ga0500595_067485 3300053119 Bacteria 1067
1056 Ga0500595_104134 3300053119 Bacteria 811
1057 Ga0500597_213422 3300053120 Bacteria 805
1058 Ga0500597_297190 3300053120 Bacteria 646
1059 Ga0500607_132854 3300053121 Bacteria 1183
1060 Ga0500614_160671 3300053123 Bacteria 680
1061 Ga0500642_0000170 3300053130 Bacteria 26891
1062 Ga0500642_0050484 3300053130 Bacteria 1834
1063 Ga0500642_0191998 3300053130 Bacteria 952
1064 Ga0500559_0380230 3300053136 Bacteria 658
1065 Ga0500564_175782 3300053138 Bacteria 896
1066 Ga0500568_0025821 3300053139 Bacteria 2472
1067 Ga0500568_0182519 3300053139 Bacteria 771
1068 Ga0500577_0373662 3300053142 Bacteria 623
1069 Ga0500588_0262793 3300053146 Bacteria 649
1070 Ga0500590_123882 3300053148 Bacteria 1206
1071 Ga0500590_191676 3300053148 Bacteria 875
1072 Ga0500604_0105908 3300053151 Bacteria 930
1073 Ga0500616_0012430 3300053153 Bacteria 4980
1074 Ga0500620_011573 3300053155 Bacteria 2371
1075 Ga0500633_0261987 3300053160 Bacteria 641
1076 Ga0500634_0364387 3300053161 Bacteria 546
1077 Ga0500638_323092 3300053162 Bacteria 585
1078 Ga0500639_249736 3300053163 Bacteria 712
1079 Ga0500636_0003830 3300053177 Bacteria 8501
1080 Ga0500636_0315192 3300053177 Bacteria 763
1081 Ga0500636_0381408 3300053177 Bacteria 661
1082 Ga0500637_0443933 3300053178 Bacteria 660
1083 Ga0500611_033434 3300053727 Bacteria 1082
1084 Ga0500625_004711 3300053729 Bacteria 5613
1085 Ga0500656_020084 3300053732 Bacteria 821
1086 Ga0500601_000994 3300053737 Bacteria 3295
1087 Ga0500661_019684 3300055283 Bacteria 1201
1088 2671117845 2667528175 Bacteria 7532676
1089 2793069924 2791355197 Bacteria 8420563
1090 2903755673 2903748898 Bacteria 9972761
1091 2906617587
1092 8019557616 8019555841 Bacteria 9642137
1093 8019567682 8019565922 Bacteria 9639779
1094 Ga0207694_10700043
1095 RicEn_C4615
1096 JGI24739J22299_10011186
1097 JGI24737J22298_10002064
1098 JGI24737J22298_10086367
1099 JGI24735J21928_10002565
1100 JGI25406J46586_10005846
1101 JGI25153J46596_10007100
1102 JGI25160J50197_1004681
1103 JGI25404J52841_10010994
1104 JGI25404J52841_10023928
1105 JGI25404J52841_10047589
1106 Ga0055543_1004189
1107 Ga0065165_1001000
1108 Ga0065165_1002881
1109 Ga0065712_10199050
1110 Ga0070658_11207008
1111 Ga0070676_11309335
1112 Ga0070683_102434131
1113 Ga0070670_100078374
1114 Ga0070670_100097465
1115 Ga0068869_100113310
1116 Ga0068869_100349169
1117 Ga0068869_100616811
1118 Ga0068869_101897173
1119 Ga0070666_10117710
1120 Ga0070666_10183673
1121 Ga0070680_100097309
1122 Ga0068868_100360667
1123 Ga0068868_100447024
1124 Ga0070660_100007203
1125 Ga0070660_100360253
1126 Ga0070660_100395897
1127 Ga0070660_101249082
1128 Ga0070660_101395982
1129 Ga0070689_100168319
1130 Ga0070687_101040167
1131 Ga0070661_100433428
1132 Ga0070692_10893448
1133 Ga0070668_100034605
1134 Ga0070668_100037092
1135 Ga0070668_100048283
1136 Ga0070668_100068946
1137 Ga0070668_100144755
1138 Ga0070671_100059352
1139 Ga0070671_100102576
1140 Ga0070671_101094952
1141 Ga0070673_100518557
1142 Ga0070673_100776263
1143 Ga0070688_101262148
1144 Ga0070659_100251488
1145 Ga0070659_100720528
1146 Ga0070659_100832801
1147 Ga0070659_101183258
1148 Ga0070659_101754210
1149 Ga0070667_100323171
1150 Ga0070667_100373899
1151 Ga0070667_100547120
1152 Ga0070709_10014699
1153 Ga0070709_10071675
1154 Ga0070709_10536280
1155 Ga0070714_100046876
1156 Ga0070714_101346255
1157 Ga0070714_101696565
1158 Ga0070713_100021098
1159 Ga0070713_100443170
1160 Ga0070713_100890763
1161 Ga0070713_100909299
1162 Ga0070713_100990602
1163 Ga0070710_10011580
1164 Ga0070710_10017934
1165 Ga0070711_100082160
1166 Ga0070711_100089954
1167 Ga0070711_100359750
1168 Ga0070711_100498274
1169 Ga0070705_100550235
1170 Ga0070700_101093221
1171 Ga0070694_100326786
1172 Ga0070663_100045359
1173 Ga0070663_100090656
1174 Ga0070663_100144660
1175 Ga0070663_100237411
1176 Ga0070663_100898853
1177 Ga0070663_100932800
1178 Ga0070678_100091264
1179 Ga0070678_100106088
1180 Ga0070678_101173743
1181 Ga0070678_101422846
1182 Ga0070662_100044952
1183 Ga0070662_100185973
1184 Ga0070681_10017728
1185 Ga0070681_10241579
1186 Ga0068867_100552523
1187 Ga0068867_101345730
1188 Ga0070706_101587626
1189 Ga0070679_100127787
1190 Ga0070679_100189986
1191 Ga0070679_100477498
1192 Ga0070679_100503011
1193 Ga0070679_100978344
1194 Ga0070684_100056215
1195 Ga0070684_100749437
1196 Ga0070697_100308780
1197 Ga0068853_100058554
1198 Ga0068853_100083561
1199 Ga0068853_100319313
1200 Ga0068853_100409791
1201 Ga0068853_100434599
1202 Ga0068853_100622958
1203 Ga0068853_101266267
1204 Ga0068853_101375340
1205 Ga0068853_101468293
1206 Ga0070672_100102083
1207 Ga0070672_101351708
1208 Ga0070696_100185213
1209 Ga0070693_100981589
1210 Ga0070665_100113812
1211 Ga0070665_100171671
1212 Ga0070665_100320013
1213 Ga0070665_100909636
1214 Ga0068855_100020421
1215 Ga0068855_100293583
1216 Ga0068855_100446121
1217 Ga0068855_100523935
1218 Ga0068855_101083055
1219 Ga0068855_101139573
1220 Ga0068855_101918285
1221 Ga0070664_100613136
1222 Ga0070664_100765735
1223 Ga0070664_100931037
1224 Ga0068857_100233474
1225 Ga0068857_100705789
1226 Ga0068857_101960493
1227 Ga0068854_100013815
1228 Ga0068854_100298451
1229 Ga0068854_100386996
1230 Ga0068854_101041165
1231 Ga0068856_100182720
1232 Ga0068856_100426337
1233 Ga0068856_100562291
1234 Ga0068856_101108969
1235 Ga0070702_100156178
1236 Ga0070702_100571828
1237 Ga0070702_101006503
1238 Ga0068852_100100749
1239 Ga0068852_100388423
1240 Ga0068852_100719899
1241 Ga0068852_101578564
1242 Ga0068859_100175190
1243 Ga0068859_100391897
1244 Ga0068866_10101414
1245 Ga0068866_10223835
1246 Ga0068861_100255924
1247 Ga0068861_100273098
1248 Ga0068861_100606434
1249 Ga0068851_10466423
1250 Ga0068870_11179688
1251 Ga0068863_101390337
1252 Ga0068858_100091673
1253 Ga0068858_100308584
1254 Ga0068858_100328179
1255 Ga0068858_100526333
1256 Ga0068860_100443077
1257 Ga0068860_100771602
1258 Ga0068860_100860696
1259 Ga0068862_100105868
1260 Ga0068862_100354159
1261 Ga0068862_100704521
1262 Ga0068862_101871497
1263 Ga0081455_10099030
1264 Ga0081455_10643714
1265 Ga0081540_1000977
1266 Ga0081540_1009064
1267 Ga0081540_1017971
1268 Ga0081540_1018216
1269 Ga0081539_10000176
1270 Ga0081539_10000231
1271 Ga0070717_10047970
1272 Ga0070717_10214208
1273 Ga0070717_10280543
1274 Ga0070717_10359021
1275 Ga0070717_11283818
1276 Ga0075365_10019762
1277 Ga0075365_10055481
1278 Ga0075365_10373704
1279 Ga0075365_10554274
1280 Ga0075365_10557530
1281 Ga0075365_10680941
1282 Ga0075365_10726372
1283 Ga0075365_10834195
1284 Ga0075365_10990196
1285 Ga0075368_10069099
1286 Ga0075368_10284713
1287 Ga0075363_100380402
1288 Ga0075364_10046191
1289 Ga0075364_10103459
1290 Ga0070715_10361588
1291 Ga0070715_10775380
1292 Ga0070716_100193111
1293 Ga0070716_100374472
1294 Ga0070712_100005919
1295 Ga0070712_100200331
1296 Ga0070712_100745534
1297 Ga0075362_10026222
1298 Ga0075362_10553370
1299 Ga0075367_10051935
1300 Ga0075367_10054914
1301 Ga0075367_10167079
1302 Ga0075367_10204320
1303 Ga0075369_10017098
1304 Ga0075369_10079868
1305 Ga0075369_10230835
1306 Ga0075369_10242823
1307 Ga0075369_10586019
1308 Ga0075366_10005347
1309 Ga0075366_10084551
1310 Ga0075366_10231565
1311 Ga0075366_10240330
1312 Ga0075366_10527636
1313 Ga0075366_10937286
1314 Ga0097621_100325665
1315 Ga0097621_101065858
1316 Ga0075370_10014257
1317 Ga0075370_10221730
1318 Ga0075370_10705089
1319 Ga0068871_100465123
1320 Ga0068871_101057517
1321 Ga0075428_100013639
1322 Ga0075433_10982405
1323 Ga0075434_100497792
1324 Ga0075434_101627576
1325 Ga0068865_100904500
1326 Ga0075436_100235549
1327 Ga0097620_100175195
1328 Ga0097620_100391878
1329 Ga0099825_1024706
1330 Ga0099824_1011211
1331 Ga0099822_1004035
1332 Ga0099822_1063816
1333 Ga0099823_1040176
1334 Ga0075435_100838889
1335 Ga0075435_101222116
1336 Ga0099794_10017491
1337 Ga0099794_10322919
1338 Ga0099795_10036696
1339 Ga0099795_10149621
1340 Ga0105250_10102880
1341 Ga0105250_10121596
1342 Ga0105240_10002409
1343 Ga0105240_10007230
1344 Ga0105240_10007574
1345 Ga0105240_10288383
1346 Ga0105240_10424121
1347 Ga0105240_11223257
1348 Ga0111539_12012394
1349 Ga0105245_10121359
1350 Ga0105245_10284770
1351 Ga0105245_10304762
1352 Ga0105245_10529515
1353 Ga0105245_12243199
1354 Ga0105247_10037154
1355 Ga0105247_10674626
1356 Ga0114129_10140555
1357 Ga0105243_10202764
1358 Ga0105243_10954789
1359 Ga0105243_11316166
1360 Ga0105243_12413950
1361 Ga0105241_10128663
1362 Ga0105241_10376609
1363 Ga0105241_10764691
1364 Ga0105241_12523866
1365 Ga0105242_10600419
1366 Ga0105242_10637775
1367 Ga0105242_11157295
1368 Ga0105248_10140529
1369 Ga0105248_10219879
1370 Ga0105248_10462966
1371 Ga0105248_11065624
1372 Ga0105248_11093892
1373 Ga0105248_11789788
1374 Ga0105248_11794819
1375 Ga0105237_10028752
1376 Ga0105237_10043519
1377 Ga0105237_10048634
1378 Ga0105237_10126526
1379 Ga0105237_10418547
1380 Ga0105237_10482242
1381 Ga0105237_10534824
1382 Ga0105237_10936625
1383 Ga0105237_11276033
1384 Ga0105238_10017182
1385 Ga0105238_10144870
1386 Ga0105238_10663820
1387 Ga0105238_10713475
1388 Ga0105238_10755481
1389 Ga0105238_12337352
1390 Ga0105249_10259641
1391 Ga0105249_10416355
1392 Ga0105249_10478055
1393 Ga0105249_10545959
1394 Ga0105249_11670720
1395 Ga0105239_10006100
1396 Ga0105239_10059849
1397 Ga0105239_10139872
1398 Ga0105239_10152837
1399 Ga0105239_10515953
1400 Ga0105239_10774516
1401 Ga0105239_10802634
1402 Ga0105239_10843157
1403 Ga0105239_10914444
1404 Ga0105239_11241957
1405 Ga0105239_11791851
1406 Ga0105246_10044764
1407 Ga0105246_10161530
1408 Ga0105246_10413704
1409 Ga0157326_1063352
1410 Ga0157373_10876288
1411 Ga0157370_10052380
1412 Ga0157370_10186917
1413 Ga0157370_11832283
1414 Ga0157369_10023864
1415 Ga0157369_10032287
1416 Ga0157369_12234431
1417 Ga0157378_10107999
1418 Ga0157378_10253135
1419 Ga0163162_10230636
1420 Ga0163162_11714275
1421 Ga0157372_10205924
1422 Ga0157372_11036045
1423 Ga0157372_12087590
1424 Ga0157375_10769960
1425 Ga0157375_10973558
1426 Ga0163163_10001936
1427 Ga0163163_10068609
1428 Ga0163163_10490569
1429 Ga0163163_11181065
1430 Ga0157380_10554047
1431 Ga0182008_10305235
1432 Ga0157377_10524980
1433 Ga0157379_10071814
1434 Ga0157379_10317024
1435 Ga0157379_10468013
1436 Ga0157376_10656490
1437 Ga0157376_10709084
1438 Ga0157376_11813272
1439 Ga0157376_12225699
1440 Ga0163161_11417401
1441 Ga0154015_1407110
1442 Ga0209563_101473
1443 Ga0209677_105226
1444 Ga0209148_1000779
1445 Ga0209233_1005191
1446 Ga0209233_1028193
1447 Ga0209233_1032525
1448 Ga0209233_1051074
1449 Ga0209455_1003881
1450 Ga0209673_1027776
1451 Ga0209564_1003985
1452 Ga0209758_1001023
1453 Ga0209758_1003040
1454 Ga0209758_1014568
1455 Ga0209758_1028731
1456 Ga0207426_1000596
1457 Ga0207426_1001063
1458 Ga0207426_1036686
1459 Ga0207697_10345109
1460 Ga0207656_10024424
1461 Ga0207656_10204750
1462 Ga0207692_10017386
1463 Ga0207692_10139762
1464 Ga0207692_10663733
1465 Ga0207642_10095980
1466 Ga0207710_10164935
1467 Ga0207688_10175813
1468 Ga0207680_10162733
1469 Ga0207647_10017488
1470 Ga0207647_10018334
1471 Ga0207647_10176581
1472 Ga0207647_10180635
1473 Ga0207647_10258149
1474 Ga0207647_10293453
1475 Ga0207685_10211488
1476 Ga0207685_10288519
1477 Ga0207685_10548058
1478 Ga0207699_10159997
1479 Ga0207699_10179653
1480 Ga0207699_10391758
1481 Ga0207699_11405174
1482 Ga0207645_10207023
1483 Ga0207645_10402686
1484 Ga0207643_10504597
1485 Ga0207705_11092401
1486 Ga0207684_10573166
1487 Ga0207654_10015401
1488 Ga0207654_10077268
1489 Ga0207654_10104552
1490 Ga0207654_10211228
1491 Ga0207707_10003454
1492 Ga0207707_10008660
1493 Ga0207707_10236723
1494 Ga0207695_10001107
1495 Ga0207695_10024535
1496 Ga0207695_10046985
1497 Ga0207695_10067350
1498 Ga0207695_10202711
1499 Ga0207695_10430785
1500 Ga0207671_10006466
1501 Ga0207671_10065787
1502 Ga0207671_10071594
1503 Ga0207671_10083724
1504 Ga0207671_10838842
1505 Ga0207693_10010745
1506 Ga0207693_10115846
1507 Ga0207693_10328165
1508 Ga0207693_11256778
1509 Ga0207663_10005229
1510 Ga0207663_10027896
1511 Ga0207663_11120731
1512 Ga0207663_11482667
1513 Ga0207660_10127082
1514 Ga0207660_10715261
1515 Ga0207660_11240073
1516 Ga0207662_10147710
1517 Ga0207662_10884643
1518 Ga0207657_10013306
1519 Ga0207657_10614074
1520 Ga0207649_10219441
1521 Ga0207649_10669363
1522 Ga0207652_10151116
1523 Ga0207652_10821484
1524 Ga0207652_11247085
1525 Ga0207681_10342327
1526 Ga0207694_10094672
1527 Ga0207694_10102706
1528 Ga0207694_10112395
1529 Ga0207694_11746429
1530 Ga0207650_10054601
1531 Ga0207650_10450491
1532 Ga0207687_10080834
1533 Ga0207687_10112631
1534 Ga0207700_10011770
1535 Ga0207700_10104400
1536 Ga0207700_10558448
1537 Ga0207700_11005589
1538 Ga0207664_10022677
1539 Ga0207664_10150097
1540 Ga0207664_10170277
1541 Ga0207644_10149785
1542 Ga0207644_10372708
1543 Ga0207644_10436833
1544 Ga0207690_10271092
1545 Ga0207690_10597790
1546 Ga0207690_11079388
1547 Ga0207690_11452344
1548 Ga0207706_10076918
1549 Ga0207706_10226877
1550 Ga0207706_10397935
1551 Ga0207686_10086380
1552 Ga0207709_10045551
1553 Ga0207709_10508692
1554 Ga0207709_10651697
1555 Ga0207670_11912688
1556 Ga0207704_10053071
1557 Ga0207665_10060799
1558 Ga0207665_10291676
1559 Ga0207665_10935261
1560 Ga0207691_10070757
1561 Ga0207691_10717625
1562 Ga0207691_11145066
1563 Ga0207711_10097824
1564 Ga0207711_10347091
1565 Ga0207711_10394322
1566 Ga0207711_10634220
1567 Ga0207711_10803565
1568 Ga0207689_10177305
1569 Ga0207689_10323960
1570 Ga0207679_10832385
1571 Ga0207679_10866107
1572 Ga0207679_11091876
1573 Ga0207667_10014502
1574 Ga0207667_10018032
1575 Ga0207667_10029597
1576 Ga0207667_10172989
1577 Ga0207667_10492627
1578 Ga0207667_11404221
1579 Ga0207651_10358408
1580 Ga0207712_10113984
1581 Ga0207712_10540974
1582 Ga0207668_10055592
1583 Ga0207668_10087437
1584 Ga0207668_10232051
1585 Ga0207668_10261055
1586 Ga0207640_10013094
1587 Ga0207640_10335827
1588 Ga0207658_10536095
1589 Ga0207658_11875362
1590 Ga0207658_11876657
1591 Ga0207677_10044422
1592 Ga0207677_10315756
1593 Ga0207677_11296302
1594 Ga0207703_10133830
1595 Ga0207703_10325210
1596 Ga0207703_11489295
1597 Ga0207703_11645954
1598 Ga0207639_10036729
1599 Ga0207639_10110958
1600 Ga0207639_10153997
1601 Ga0207639_10270415
1602 Ga0207639_10300762
1603 Ga0207639_10681735
1604 Ga0207639_10887596
1605 Ga0207639_11793201
1606 Ga0207678_10104065
1607 Ga0207678_10233586
1608 Ga0207678_10609310
1609 Ga0207678_10682024
1610 Ga0207678_10702958
1611 Ga0207678_10909348
1612 Ga0207678_11360819
1613 Ga0207708_10053369
1614 Ga0207702_10029932
1615 Ga0207702_10055150
1616 Ga0207702_10080823
1617 Ga0207702_10146894
1618 Ga0207702_11284238
1619 Ga0207641_10835299
1620 Ga0207641_11654154
1621 Ga0207648_10040201
1622 Ga0207648_10451827
1623 Ga0207648_10886273
1624 Ga0207676_11026102
1625 Ga0207676_11254655
1626 Ga0207674_10003961
1627 Ga0207674_10346396
1628 Ga0207675_100099826
1629 Ga0207675_100280190
1630 Ga0207675_100795440
1631 Ga0207683_10208925
1632 Ga0207683_10212430
1633 Ga0207683_10825021
1634 Ga0207698_10167642
1635 Ga0207698_10879072
1636 Ga0207698_11221784
1637 Ga0207698_11577883
1638 Ga0207698_11607434
1639 Ga0209389_1000068
1640 Ga0209389_1000084
1641 Ga0209589_1000023
1642 Ga0209589_1000041
1643 Ga0209489_100032
1644 Ga0209489_100070
1645 Ga0209489_126518
1646 Ga0209489_126519
1647 Ga0209700_100040
1648 Ga0209700_100117
1649 Ga0209588_1113340
1650 Ga0209813_10024452
1651 Ga0209813_10129339
1652 Ga0268266_10179991
1653 Ga0268266_10226203
1654 Ga0268266_10311862
1655 Ga0268266_11277080
1656 Ga0268265_10552275
1657 Ga0268265_11093543
1658 Ga0268264_10291245
1659 Ga0268264_11072380
1660 Ga0265334_10252012
1661 Ga0307517_10002371
1662 Ga0307517_10475190
1663 Ga0265330_10036375
1664 Ga0265330_10040331
1665 Ga0265330_10287949
1666 Ga0265332_10010212
1667 Ga0265332_10027117
1668 Ga0265332_10260161
1669 Ga0265328_10212550
1670 Ga0265325_10028245
1671 Ga0265340_10000375
1672 Ga0265340_10252895
1673 Ga0265339_10016283
1674 Ga0265339_10141743
1675 Ga0265339_10341154
1676 Ga0265331_10171693
1677 Ga0265331_10191472
1678 Ga0307408_100195724
1679 Ga0265313_10087630
1680 Ga0265314_10054570
1681 Ga0265314_10274783
1682 Ga0265342_10040689
1683 Ga0307516_10147886
1684 Ga0307405_10315417
1685 Ga0307412_11302013
1686 Ga0307412_11303951
1687 Ga0307409_100834587
1688 Ga0307416_100305850
1689 Ga0307416_100442412
1690 Ga0307411_11046880
1691 Ga0307510_10206466
1692 Ga0307510_10273830
1693 Ga0316215_1000403
1694 Ga0373958_0211203
1695 Ga0373959_0090084
1696 Ga0373938_0090091
1697 Ga0373926_0126259
1698 Ga0373934_0002259
1699 Ga0373944_0261169
1700 Ga0373944_0312345
1701 Ga0373923_0000561
1702 Ga0373936_0021847
1703 Ga0373941_0029854
1704 Ga0373953_0052617
1705 Ga0373953_0311020
1706 Ga0373954_0000273
1707 Ga0373956_0004613
1708 Ga0373957_0000313
1709 Ga0373957_0007058
1710 Ga0373957_0100244
1711 Ga0373943_0011786
1712 Ga0373946_0052659
1713 Ga0373946_0254019
1714 Ga0373946_0763743
1715 Ga0373955_0004906
1716 Ga0373961_0137836
1717 Ga0373962_0126922
1718 Ga0373924_0001394
1719 Ga0373931_0048749
1720 Ga0373931_0228047
1721 Ga0373935_0032089
1722 Ga0373935_0111462
1723 Ga0373935_0116880
1724 Ga0373935_0445569
1725 Ga0373927_0002786
1726 Ga0373927_0048423
1727 Ga0373927_0094557
1728 Ga0373927_0116391
1729 Ga0373933_0001950
1730 Ga0373947_0004007
1731 Ga0373937_0011586
1732 Ga0373937_0072826
1733 Ga0372808_036262
1734 Ga0373925_0001317
1735 Ga0373925_0494488
1736 Ga0373925_1241306
1737 Ga0395899_0325946
1738 Ga0395899_0427478
1739 Ga0395900_0004063
1740 Ga0395900_0078805
1741 Ga0395898_0005719
1742 Ga0395898_0116452
1743 Ga0395898_1767960
1744 Ga0395905_1227613
1745 Ga0436364_0159664
1746 Ga0436364_0899798
1747 Ga0395901_0268694
1748 Ga0395901_0292119
1749 Ga0395901_0694699
1750 Ga0436365_0388356
1751 Ga0436361_0111464
1752 Ga0436363_0689938
1753 Ga0451793_0059355
1754 Ga0451793_0690763
1755 Ga0451797_0198863
1756 Ga0451795_0747937
1757 Ga0451835_1266689
1758 Ga0451847_0967965
1759 Ga0451853_2604563
1760 Ga0466969_0269529
1761 Ga0466965_0154127
1762 Ga0466966_0001701
1763 Ga0466961_0000064
1764 Ga0466961_0822756
1765 Ga0466963_0023676
1766 Ga0466963_0270068
1767 Ga0466968_0019847
1768 Ga0466968_0033041
1769 Ga0466968_0104300
1770 Ga0466970_0131370
1771 Ga0466957_0097815
1772 Ga0466957_1209508
1773 Ga0466960_0092264
1774 Ga0466959_0004743
1775 Ga0466967_0019942
1776 Ga0466967_0103843
1777 Ga0466967_0545088
1778 Ga0495592_0003384
1779 Ga0495592_0075234
1780 Ga0495592_0308956
1781 Ga0495603_0005350
1782 Ga0495603_0243677
1783 Ga0495590_0103762
1784 Ga0495590_0145587
1785 Ga0495590_0306525
1786 Ga0495629_0000581
1787 Ga0495629_0004536
1788 Ga0495629_0084445
1789 Ga0495638_0161042
1790 Ga0495641_0013094
1791 Ga0495651_0004932
1792 Ga0495651_0011399
1793 Ga0495651_0106525
1794 Ga0495651_0402526
1795 Ga0495653_0002259
1796 Ga0495653_0472606
1797 Ga0495580_0065208
1798 Ga0495582_0000528
1799 Ga0495582_0567799
1800 Ga0495605_0090501
1801 Ga0495605_0108498
1802 Ga0495639_0000044
1803 Ga0495639_0203577
1804 Ga0495662_0001271
1805 Ga0495664_0015612
1806 Ga0495664_0287814
1807 Ga0495584_0408608
1808 Ga0495585_0104343
1809 Ga0495585_0399262
1810 Ga0495594_0000351
1811 Ga0495594_0061151
1812 Ga0495594_0089094
1813 Ga0495594_0344380
1814 Ga0495596_0209539
1815 Ga0495596_0254674
1816 Ga0495583_0305329
1817 Ga0495606_0030295
1818 Ga0495606_0568819
1819 Ga0495608_0002317
1820 Ga0495608_0015452
1821 Ga0495610_0289571
1822 Ga0495618_0078803
1823 Ga0495618_0217737
1824 Ga0495618_0430717
1825 Ga0495618_0645519
1826 Ga0495628_0041294
1827 Ga0495628_0272250
1828 Ga0495628_0606531
1829 Ga0495628_0959312
1830 Ga0495630_0129606
1831 Ga0495630_0426812
1832 Ga0495630_0612377
1833 Ga0495630_1363484
1834 Ga0495631_0131348
1835 Ga0495632_0066789
1836 Ga0495632_0296362
1837 Ga0495643_0021099
1838 Ga0495644_0022030
1839 Ga0495648_0005365
1840 Ga0495648_0201345
1841 Ga0495648_0242298
1842 Ga0495648_0371214
1843 Ga0495666_0234677
1844 Ga0495642_0403396
1845 Ga0495652_0044737
1846 Ga0495652_0046914
1847 Ga0495652_0059768
1848 Ga0495654_0345832
1849 Ga0495665_0000397
1850 Ga0495640_0006961
1851 Ga0495640_0028817
1852 Ga0495640_0081266
1853 Ga0495640_0126000
1854 Ga0495586_0078554
1855 Ga0495587_0024998
1856 Ga0495587_0269695
1857 Ga0495598_0016689
1858 Ga0495609_0148382
1859 Ga0495609_0163201
1860 Ga0495609_0256532
1861 Ga0495621_0016641
1862 Ga0495645_0087030
1863 Ga0495645_0914633
1864 Ga0495622_0002861
1865 Ga0495622_0028361
1866 Ga0495633_0018819
1867 Ga0495633_0040307
1868 Ga0495667_0000359
1869 Ga0495667_0012846
1870 Ga0495667_0121591
1871 Ga0495667_0653687
1872 Ga0495656_0040458
1873 Ga0495668_0079760
1874 Ga0495668_0270182
1875 Ga0495634_0000252
1876 Ga0495634_0012038
1877 Ga0495634_0115615
1878 Ga0495634_0163912
1879 Ga0495611_0362112
1880 Ga0495611_0456807
1881 Ga0495625_0286459
1882 Ga0495625_0388348
1883 Ga0495635_0000251
1884 Ga0495635_0004777
1885 Ga0495635_0008104
1886 Ga0495635_0293417
1887 Ga0495635_0746670
1888 Ga0495659_0037018
1889 Ga0495661_0272002
1890 Ga0495661_0370201
1891 Ga0495588_0006813
1892 Ga0495588_0118258
1893 Ga0495657_0005246
1894 Ga0495657_0042021
1895 Ga0495657_0053434
1896 Ga0495657_0800501
1897 Ga0495599_0000305
1898 Ga0495599_0610490
1899 Ga0495623_0001012
1900 Ga0495623_0208049
1901 Ga0495623_0541637
1902 Ga0495646_0055175
1903 Ga0495647_0003477
1904 Ga0495658_0009797
1905 Ga0495658_0823973
1906 Ga0495669_0053388
1907 Ga0495669_0055937
1908 Ga0495613_0013328
1909 Ga0495613_0055277
1910 Ga0495613_0132640
1911 Ga0495624_0000832
1912 Ga0495624_0144788
1913 Ga0495624_0449920
1914 Ga0495670_0172201
1915 Ga0495670_0506459
1916 Ga0495649_0188463
1917 Ga0495649_0428360
1918 Ga0495589_0331526
1919 Ga0495600_0001567
1920 Ga0495600_0046355
1921 Ga0495581_0004430
1922 Ga0495581_0160997
1923 Ga0495604_0013917
1924 Ga0495604_0095991
1925 Ga0495604_0097526
1926 Ga0495604_0181603
1927 Ga0495636_0488091
1928 Ga0495674_0012961
1929 Ga0495674_0020357
1930 Ga0495674_0095708
1931 Ga0495674_0373305
1932 Ga0495674_0994739
1933 Ga0495672_0026351
1934 Ga0495672_0198189
1935 Ga0495676_0025127
1936 Ga0495676_0042368
1937 Ga0495676_0130134
1938 Ga0495676_0663042
1939 Ga0495680_0004040
1940 Ga0495680_0019046
1941 Ga0495680_0070812
1942 Ga0495683_0016620
1943 Ga0495683_0018489
1944 Ga0495683_0289283
1945 Ga0495675_0012888
1946 Ga0495675_0023093
1947 Ga0495685_135450
1948 Ga0495673_0095006
1949 Ga0495673_0134010
1950 Ga0495673_0284528
1951 Ga0495681_0097243
1952 Ga0495681_0213557
1953 Ga0495684_0000297
1954 Ga0495684_0065459
1955 Ga0495684_0617417
1956 Ga0495686_0064501
1957 Ga0495686_0652492
1958 Ga0495593_0000353
1959 Ga0495593_0000354
1960 Ga0495593_0295441
1961 Ga0495602_0034391
1962 Ga0495602_0043460
1963 Ga0495602_0116200
1964 Ga0495602_0364883
1965 Ga0495614_0029542
1966 Ga0495626_0072272
1967 Ga0496100_0194276
1968 Ga0496100_0204377
1969 Ga0496100_0331885
1970 Ga0496100_0748634
1971 Ga0496101_0040852
1972 Ga0496101_0065283
1973 Ga0496101_0275948
1974 Ga0496101_0301976
1975 Ga0496101_1082444
1976 Ga0496102_0018941
1977 Ga0496102_0220536
1978 Ga0496102_0284506
1979 Ga0496102_0297898
1980 Ga0496102_0349357
1981 Ga0496102_0404688
1982 Ga0496102_0477994
1983 Ga0496103_0032398
1984 Ga0496103_0047180
1985 Ga0496104_0003628
1986 Ga0496104_0006867
1987 Ga0496104_0028291
1988 Ga0496104_0098535
1989 Ga0496105_0005048
1990 Ga0496105_0030914
1991 Ga0496105_0035621
1992 Ga0496105_0124790
1993 Ga0496106_0032366
1994 Ga0496106_0085320
1995 Ga0496106_0087123
1996 Ga0496106_0705097
1997 Ga0496106_0950907
1998 Ga0496106_1361958
1999 Ga0496107_0011454
2000 Ga0496107_0014705
2001 Ga0496107_0140329
2002 Ga0496107_0207012
2003 Ga0496107_0209897
2004 Ga0496107_0284408
2005 Ga0496108_0029559
2006 Ga0496108_0125044
2007 Ga0496108_0138973
2008 Ga0496108_0423084
2009 Ga0496108_1108959
2010 Ga0496109_0227289
2011 Ga0496109_0284667
2012 Ga0496110_0058995
2013 Ga0496110_0074927
2014 Ga0496110_0125698
2015 Ga0496111_0026206
2016 Ga0496111_0115837
2017 Ga0496111_0259109
2018 Ga0496112_0000004
2019 Ga0496112_0000992
2020 Ga0496112_0023912
2021 Ga0496112_0080896
2022 Ga0496112_0270245
2023 Ga0496113_0101567
2024 Ga0496113_0267807
2025 Ga0496113_0326550
2026 Ga0496113_0352388
2027 Ga0496114_0079724
2028 Ga0496114_0119923
2029 Ga0496114_0366075
2030 Ga0496114_0404332
2031 Ga0496115_0015081
2032 Ga0496115_0024858
2033 Ga0496115_0129789
2034 Ga0496115_0143029
2035 Ga0496115_0182940
2036 Ga0496115_0242538
2037 Ga0496116_0032971
2038 Ga0496116_0138010
2039 Ga0496117_0043874
2040 Ga0496117_0058877
2041 Ga0496118_0051558
2042 Ga0496118_0093767
2043 Ga0496118_0105830
2044 Ga0496119_0015494
2045 Ga0496119_0046477
2046 Ga0496119_0190509
2047 Ga0496120_0017309
2048 Ga0496121_0009741
2049 Ga0496121_0080061
2050 Ga0496121_0251104
2051 Ga0496121_0348964
2052 Ga0496122_0096470
2053 Ga0496124_0165086
2054 Ga0496124_0174939
2055 Ga0496124_0212824
2056 Ga0496124_0473024
2057 Ga0496124_0666093
2058 Ga0496125_0025883
2059 Ga0496125_0075151
2060 Ga0496125_0087691
2061 Ga0496125_0105915
2062 Ga0496125_0300709
2063 Ga0496126_0006093
2064 Ga0496126_0021321
2065 Ga0496126_0023638
2066 Ga0496126_0176252
2067 Ga0496126_0272766
2068 Ga0496126_0300590
2069 Ga0496126_0508734
2070 Ga0496126_0534418
2071 Ga0496126_0623967
2072 Ga0496126_0736643
2073 Ga0496126_0876925
2074 Ga0496126_1002157
2075 Ga0495678_187774
2076 Ga0501032_0311861
2077 Ga0501047_0063880
2078 Ga0501070_0017157
2079 Ga0501074_0013275
2080 Ga0501079_0940544
2081 Ga0501080_0018387
2082 Ga0501044_0058485
2083 nmdc:mga03683_118285_c2
2084 nmdc:mga03683_130443_c1
2085 nmdc:mga03n38_363681_c1
2086 nmdc:mga00v17_115026_c1
2087 nmdc:mga00v17_259613_c1
2088 nmdc:mga00v17_468493_c1
2089 nmdc:mga0yw44_10663_c1
2090 nmdc:mga0yw44_185119_c1
2091 nmdc:mga0yw44_351928_c1
2092 nmdc:mga0yw44_46808_c1
2093 nmdc:mga0yw44_633414_c1
2094 nmdc:mga0yw44_75034_c1
2095 nmdc:mga0k408_125733_c1
2096 nmdc:mga0k408_294680_c1
2097 nmdc:mga0k408_404199_c1
2098 nmdc:mga0k408_98906_c2
2099 nmdc:mga06z11_110149_c1
2100 nmdc:mga06z11_123298_c1
2101 nmdc:mga04h51_227627_c1
2102 nmdc:mga04h51_33249_c1
2103 nmdc:mga07m45_136166_c1
2104 nmdc:mga07m45_349009_c1
2105 nmdc:mga07m45_86850_c1
2106 nmdc:mga05p37_223714_c1
2107 nmdc:mga0n895_292136_c1
2108 nmdc:mga0n895_843011_c1
2109 nmdc:mga0rr50_1568498_c1
2110 nmdc:mga08x19_274042_c1
2111 nmdc:mga0a205_1308477_c1
2112 nmdc:mga0sz30_15675_c1
2113 nmdc:mga0sz30_238319_c1
2114 nmdc:mga0sz30_422440_c1
2115 nmdc:mga0sz30_47091_c1
2116 nmdc:mga0sz30_47659_c1
2117 Ga0495601_0055289
2118 Ga0495601_0524500
2119 Ga0495601_0642899
2120 Ga0500610_0143868
2121 Ga0500635_0098504
2122 Ga0495655_0002827
2123 Ga0495655_0003704
2124 Ga0495655_0058175
2125 Ga0495655_0066522
2126 Ga0495595_0001211
2127 Ga0495595_0007545
2128 Ga0495619_0001922
2129 Ga0495619_0026539
2130 Ga0495619_0948117
2131 Ga0495619_1061202
2132 Ga0500578_0538260
2133 Ga0500578_0591572
2134 Ga0500643_000025
2135 Ga0500644_0042470
2136 Ga0500583_0221286
2137 Ga0500566_0000171
2138 Ga0500566_0454023
2139 Ga0500640_017219
2140 Ga0500641_0078870
2141 Ga0500650_0391966
2142 Ga0500557_000001
2143 Ga0500562_007899
2144 Ga0500569_001417
2145 Ga0500572_014491
2146 Ga0500592_006946
2147 Ga0500594_0007738
2148 Ga0500595_067485
2149 Ga0500595_104134
2150 Ga0500597_213422
2151 Ga0500597_297190
2152 Ga0500607_132854
2153 Ga0500614_160671
2154 Ga0500642_0000170
2155 Ga0500642_0050484
2156 Ga0500642_0191998
2157 Ga0500559_0380230
2158 Ga0500564_175782
2159 Ga0500568_0025821
2160 Ga0500568_0182519
2161 Ga0500577_0373662
2162 Ga0500588_0262793
2163 Ga0500590_123882
2164 Ga0500590_191676
2165 Ga0500604_0105908
2166 Ga0500616_0012430
2167 Ga0500620_011573
2168 Ga0500633_0261987
2169 Ga0500634_0364387
2170 Ga0500638_323092
2171 Ga0500639_249736
2172 Ga0500636_0003830
2173 Ga0500636_0315192
2174 Ga0500636_0381408
2175 Ga0500637_0443933
2176 Ga0500611_033434
2177 Ga0500625_004711
2178 Ga0500656_020084
2179 Ga0500601_000994
2180 Ga0500661_019684
2181 2671117845
2182 2793069924
2183 2903755673
2184 2906617587
2185 8019557616
2186 8019567682

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z0c-assembly4.cif.gz_D structure of in silico modelled artificial maquette-3 protein 0.654 6 125
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.646 2 115
6z0c-assembly4.cif.gz_D structure of in silico modelled artificial maquette-3 protein 0.6253 6 125
5arn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.611 4 115
5nqm-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.604 3 118
ID Description Score Start End Superfamily
af_A0A0R0JN56_9_95_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8022 71 117 1.20.1280.290
af_Q55C26_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7336 1 116 1.20.140.150
af_Q9SAC5_34_166_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7084 1 116 1.20.140.40
af_A0A078BS54_1_192_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6739 1 116 1.20.140.150
af_O81320_4_142_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6713 1 117 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A150Z7L3-F1-model_v4 deleted 1.001 1 126
AF-A0A7S9CNU7-F1-model_v4 Uncharacterized protein 0.9893 1 126 GO:0016020
AF-A0A1H4QIN4-F1-model_v4 Uncharacterized protein 0.9836 1 126 GO:0016020
AF-A0A7S9CNU7-F1-model_v4 Uncharacterized protein 0.9816 1 126 GO:0016020
AF-A0A1H4QIN4-F1-model_v4 Uncharacterized protein 0.976 1 126 GO:0016020

Map