F489772

General Info

Members Datasets Scaffolds Average Seq Length
1085 807 519 331

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221599|2644006518
Length 348
Sequence CMMPIGLGREVGLDMSVNEETREIRRRPWRDIDLRAVAPFAALFLLLIVGALVNPNFIGITNLANVATRCAFIAIIAVGATFVISAGDLDLSVGSMVAFVASLMILLMNSGVIADPTLMLVAAVVFTLIAGALCGLANGLITTVGKIEPFIATLGTMGIYRGLTTWLSQGGAITLRSADIQTLYRPAYFGSILGVPVPIVVILAVTAVAAFILYRTRYGRHVVAVGSNSDVARYSGIAVNRVRTIAFVIQGLCVAIAVLLYVPRLGSTSATTGILWELQAITAVVVGGTALKGGAGRVWGTICGAFILELVGNIMLLSNFISEYLIGAIQGAIIIIAMLVQRSLVRKS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681786 Brucella suis 92/29 Isolate Unclassified
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
69 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
70 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
71 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
72 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
79 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
80 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
81 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
82 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
83 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
84 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
85 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
86 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
87 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
88 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
89 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
90 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
91 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
92 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
93 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
96 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
97 2643221557 Ensifer sp. Root558 Isolate Unclassified
98 2643221558 Rhizobium sp. Root149 Isolate Unclassified
99 2643221568 Rhizobium sp. Root564 Isolate Unclassified
100 2643221582 Rhizobium sp. Root651 Isolate Unclassified
101 2643221599 Rhizobium sp. Root708 Isolate Unclassified
102 2643221607 Rhizobium sp. Root73 Isolate Unclassified
103 2643221610 Ensifer sp. Root74 Isolate Unclassified
104 2643221618 Ensifer sp. Root231 Isolate Unclassified
105 2643221626 Ensifer sp. Root31 Isolate Unclassified
106 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
107 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
108 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
109 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
110 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
111 2643221655 Ensifer sp. Root1252 Isolate Unclassified
112 2643221659 Ensifer sp. Root127 Isolate Unclassified
113 2643221668 Ensifer sp. Root423 Isolate Unclassified
114 2643221675 Ensifer sp. Root1298 Isolate Unclassified
115 2643221680 Ensifer sp. Root1312 Isolate Unclassified
116 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
117 2643221688 Rhizobium sp. Root482 Isolate Unclassified
118 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
119 2643221693 Rhizobium sp. Root491 Isolate Unclassified
120 2643221698 Ensifer sp. Root142 Isolate Unclassified
121 2643221712 Ensifer sp. Root258 Isolate Unclassified
122 2643221718 Rhizobium sp. Root268 Isolate Unclassified
123 2643221719 Rhizobium sp. Root274 Isolate Unclassified
124 2643221723 Ensifer sp. Root278 Isolate Unclassified
125 2643221726 Ensifer sp. Root954 Isolate Unclassified
126 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
127 2718217882 Rhizobium sp. N741 Isolate Nodule
128 2718217927 Rhizobium sp. N324 Isolate Nodule
129 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
130 2718218009 Rhizobium sp. N561 Isolate Nodule
131 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
132 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
133 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
134 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
135 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
136 2718218363 Rhizobium sp. N113 Isolate Nodule
137 2718218365 Rhizobium sp. N731 Isolate Nodule
138 2718218366 Rhizobium sp. N621 Isolate Nodule
139 2718218423 Rhizobium sp. N941 Isolate Nodule
140 2721755514 Rhizobium sp. N6212 Isolate Nodule
141 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
142 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
143 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
144 2721755809 Rhizobium sp. N541 Isolate Nodule
145 2721755810 Rhizobium sp. N871 Isolate Nodule
146 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
147 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
148 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
149 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
150 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
151 2728369365 Rhizobium sp. N1341 Isolate Nodule
152 2728369397 Rhizobium sp. N1314 Isolate Nodule
153 2738541293 Rhizobium sp. GV031 Isolate Unclassified
154 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
155 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
156 2751185800 Brucella pituitosa AA2 Isolate Unclassified
157 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
158 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
159 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
160 2773857925 Microvirga vignae BR3299 Isolate Unclassified
161 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
162 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
163 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
164 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
165 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
166 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
167 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
168 2791355256 Rhizobium sp. M10 Isolate Nodule
169 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
170 2791355260 Rhizobium sp. L9 Isolate Nodule
171 2791355261 Rhizobium sp. J15 Isolate Nodule
172 2791355262 Rhizobium sp. M1 Isolate Nodule
173 2791355263 Rhizobium chutanense C5 Isolate Nodule
174 2791355264 Rhizobium sp. S9 Isolate Nodule
175 2791355265 Rhizobium sp. H4 Isolate Nodule
176 2791355266 Rhizobium sp. L43 Isolate Nodule
177 2791355267 Rhizobium sp. L18 Isolate Nodule
178 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
179 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
180 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
181 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
182 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
183 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
184 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
185 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
186 2802429633 Rhizobium anhuiense J3 Isolate Nodule
187 2802429634 Rhizobium anhuiense S10 Isolate Nodule
188 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
189 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
190 2802429637 Rhizobium anhuiense C15 Isolate Nodule
191 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
192 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
193 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
194 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
195 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
196 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
197 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
198 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
199 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
200 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
201 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
202 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
203 2838048938 Rhizobium pisi 27/80 Isolate Nodule
204 2838061910 Rhizobium phaseoli L15 Isolate Nodule
205 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
206 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
207 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
208 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
209 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
210 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
211 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
212 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
213 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
214 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
215 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
216 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
217 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
218 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
219 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
220 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
221 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
222 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
223 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
224 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
225 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
226 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
227 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
228 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
229 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
230 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
231 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
232 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
233 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
234 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
235 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
236 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
237 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
238 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
239 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
240 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
241 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
242 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
243 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
244 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
245 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
246 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
247 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
248 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
249 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
250 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
251 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
252 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
253 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
254 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
255 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
256 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
257 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
258 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
259 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
260 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
261 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
262 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
263 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
264 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
265 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
266 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
267 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
268 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
269 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
270 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
271 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
272 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
273 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
274 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
275 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
276 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
277 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
278 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
279 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
280 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
281 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
282 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
283 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
284 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
285 2844163670 Ensifer sp. 1H6 Isolate Unclassified
286 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
287 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
288 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
289 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
290 2854911287 Brucella lupini LUP21 Isolate Unclassified
291 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
292 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
293 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
294 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
295 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
296 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
297 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
298 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
299 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
300 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
301 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
302 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
303 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
304 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
305 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
306 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
307 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
308 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
309 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
310 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
311 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
312 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
313 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
314 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
315 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
316 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
317 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
318 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
319 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
320 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
321 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
322 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
323 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
324 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
325 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
326 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
327 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
328 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
329 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
330 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
331 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
332 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
333 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
334 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
335 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
336 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
337 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
338 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
339 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
340 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
341 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
342 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
343 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
344 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
345 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
346 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
347 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
348 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
349 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
350 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
351 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
352 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
353 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
354 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
355 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
356 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
357 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
358 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
359 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
360 2933599457 Rhizobium phaseoli M3 Isolate Nodule
361 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
362 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
363 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
364 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
365 2936381700 Rhizobium chutanense C16 Isolate Unclassified
366 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
367 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
368 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
369 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
370 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
371 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
372 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
373 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
374 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
375 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
376 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
377 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
378 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
379 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
380 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
381 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
382 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
383 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
384 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
385 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
386 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
387 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
388 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
389 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
390 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
391 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
392 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
393 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
394 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
395 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
396 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
397 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
398 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
399 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
400 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
401 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
402 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
403 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
404 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
405 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
406 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
407 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
408 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
409 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
410 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
411 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
412 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
413 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
414 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
415 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
416 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
417 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
418 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
419 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
420 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
421 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
422 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
423 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
424 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
425 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
426 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
427 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
428 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
429 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
430 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
431 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
432 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
433 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
434 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
435 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
436 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
437 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
438 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
439 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
440 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
441 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
442 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
443 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
444 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
445 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
446 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
447 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
448 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
449 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
450 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
451 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
452 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
453 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
454 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
455 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
456 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
457 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
458 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
459 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
460 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
461 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
462 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
463 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
464 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
465 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
466 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
467 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
468 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
469 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
470 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
471 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
472 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
473 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
474 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
475 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
476 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
477 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
478 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
479 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
480 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
481 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
482 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
483 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
484 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
485 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
486 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
487 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
488 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
489 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
490 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
491 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
492 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
493 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
494 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
495 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
496 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
497 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
498 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
499 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
500 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
501 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
502 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
503 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
504 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
505 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
506 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
507 2996887358 Rhizobium sp. R711 Isolate Nodule
508 2996893221 Rhizobium sp. R635 Isolate Nodule
509 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
510 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
511 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
512 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
513 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
514 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
515 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
516 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
517 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
518 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
519 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
520 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
521 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
522 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
523 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
524 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
525 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
526 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
527 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
528 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
529 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
530 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
531 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
532 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
533 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
534 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
535 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
536 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
537 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
538 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
539 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
540 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
541 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
542 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
543 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
544 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
545 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
546 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
547 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
548 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
549 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
550 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
551 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
552 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
553 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
554 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
555 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
556 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
557 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
558 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
559 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
560 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
561 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
562 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
563 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
564 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
565 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
566 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
567 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
568 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
569 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
570 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
571 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
572 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
573 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
574 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
575 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
576 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
577 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
578 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
579 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
580 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
582 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
583 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
584 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
585 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
586 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
587 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
589 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
590 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
591 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
592 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
593 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
594 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
596 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
606 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
607 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
608 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
609 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
611 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
612 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
613 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
614 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
615 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
616 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
617 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
618 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
619 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
620 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
621 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
622 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
623 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
624 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
625 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
626 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
627 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
628 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
629 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
630 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
631 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
632 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
633 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
634 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
635 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
636 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
637 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
638 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
639 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
640 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
641 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
642 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
643 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
644 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
645 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
646 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
647 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
648 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
649 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
650 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
651 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
652 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
653 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
654 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
655 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
656 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
657 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
658 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
659 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
660 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
661 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
662 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
663 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
664 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
665 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
666 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
667 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
668 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
669 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
670 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
671 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
672 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
673 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
674 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
675 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
676 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
677 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
678 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
679 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
680 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
681 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
682 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
683 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
684 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
685 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
686 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
687 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
688 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
689 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
690 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
691 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
692 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
693 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
694 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
695 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
696 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
697 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
698 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
699 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
700 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
701 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
703 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
704 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
705 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
706 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
707 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
708 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
709 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
711 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
712 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
713 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
714 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
715 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
716 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
717 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
719 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
720 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
721 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
722 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
723 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
724 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
725 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
726 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
727 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
728 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
729 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
730 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
731 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
732 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
733 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
734 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
735 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
736 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
737 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
738 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
739 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
740 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
741 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
742 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
743 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
744 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
745 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
746 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
747 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
748 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
749 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
750 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
751 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
752 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
753 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
754 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
755 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
756 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
757 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
758 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
759 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
760 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
761 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
762 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
763 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
764 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
765 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
766 8005258706 Rhizobium sp. R693 Isolate Nodule
767 8005275841 Rhizobium sp. N4311 Isolate Nodule
768 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
769 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
770 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
771 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
772 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
773 8005321885 Rhizobium sp. R72 Isolate Nodule
774 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
775 8005382845 Rhizobium sp. R634 Isolate Nodule
776 8005395548 Rhizobium sp. R339 Isolate Nodule
777 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
778 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
779 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
780 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
781 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
782 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
783 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
784 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
785 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
786 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
787 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
788 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
789 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
790 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
791 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
792 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
793 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
794 8018176218 Rhizobium sp. N122 Isolate Nodule
795 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
796 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
797 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
798 8024501048 Rhizobium sp. H4 Isolate Nodule
799 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
800 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
801 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
802 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
803 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
804 8056382006 Rhizobium croatiense 13T Isolate Nodule
805 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
806 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
807 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.93
Metatranscriptomes 0
Isolates 52.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 16.68
Nodule 39.72
Rhizoplane 1.66
Rhizosphere 23.41
Stem 0
Stem Tuber 0
Unclassified 18.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001156 3300001979 Bacteria 11909
2 JGI24740J21852_10036884 3300001979 Bacteria 1514
3 JGI25155J39150_1000012 3300002704 Bacteria 199435
4 JGI25156J39149_1000036 3300002705 Bacteria 110527
5 JGI25162J39368_1000674 3300002737 Bacteria 23983
6 JGI25154J39366_1000033 3300002738 Bacteria 184379
7 JGI25157J39369_1000457 3300002741 Bacteria 25863
8 JGI25152J39213_1001181 3300002773 Bacteria 12068
9 JGI25152J39213_1001905 3300002773 Bacteria 8354
10 JGI25152J39213_1002964 3300002773 Bacteria 6041
11 JGI25152J39213_1007241 3300002773 Bacteria 2899
12 JGI25152J39213_1016687 3300002773 Bacteria 1409
13 JGI25150J39212_1000063 3300002774 Bacteria 64558
14 JGI25150J39212_1005441 3300002774 Bacteria 2717
15 JGI25150J39212_1006207 3300002774 Bacteria 2488
16 JGI25150J39212_1014882 3300002774 Bacteria 1309
17 JGI25159J45721_1000626 3300002987 Bacteria 15678
18 JGI25151J46595_10000140 3300003187 Bacteria 95958
19 JGI25151J46595_10001756 3300003187 Bacteria 14041
20 JGI25151J46595_10013176 3300003187 Bacteria 3730
21 JGI25165J46597_1000653 3300003214 Bacteria 28392
22 JGI25165J46597_1000719 3300003214 Bacteria 25974
23 JGI25153J46596_10019404 3300003215 Bacteria 2607
24 JGI25153J46596_10041665 3300003215 Bacteria 1409
25 JGI25160J50197_1001017 3300003354 Bacteria 14523
26 JGI25160J50197_1001914 3300003354 Bacteria 9964
27 JGI25160J50197_1017789 3300003354 Bacteria 2239
28 JGI25161J50226_1001626 3300003374 Bacteria 6515
29 JGI25161J50226_1001837 3300003374 Bacteria 5942
30 Ga0055526_1001694 3300003771 Bacteria 15400
31 Ga0055526_1008634 3300003771 Bacteria 5040
32 Ga0055526_1009413 3300003771 Bacteria 4701
33 Ga0055526_1016484 3300003771 Bacteria 2886
34 Ga0055526_1025675 3300003771 Bacteria 1883
35 Ga0055524_1000790 3300003775 Bacteria 21100
36 Ga0055524_1001796 3300003775 Bacteria 11760
37 Ga0055524_1005331 3300003775 Bacteria 5763
38 Ga0055536_1004141 3300003781 Bacteria 7519
39 Ga0055536_1007318 3300003781 Bacteria 4963
40 Ga0055528_1000548 3300003790 Bacteria 28660
41 Ga0055528_1000886 3300003790 Bacteria 20225
42 Ga0055528_1005173 3300003790 Bacteria 6133
43 Ga0055540_1000548 3300003792 Bacteria 28000
44 Ga0055540_1018076 3300003792 Bacteria 1943
45 Ga0055531_10004650 3300003794 Bacteria 8241
46 Ga0055531_10007450 3300003794 Bacteria 5971
47 Ga0058692_1001450 3300003856 Bacteria 8748
48 Ga0055543_1000892 3300004625 Bacteria 14160
49 Ga0055543_1001407 3300004625 Bacteria 9571
50 Ga0065165_1002701 3300005262 Bacteria 14246
51 Ga0065165_1005489 3300005262 Bacteria 7096
52 Ga0065165_1009147 3300005262 Bacteria 4490
53 Ga0065704_10033657 3300005289 Bacteria 1294
54 Ga0070670_100002696 3300005331 Bacteria 14664
55 Ga0070668_100038532 3300005347 Bacteria 3653
56 Ga0070668_100325906 3300005347 Bacteria 1294
57 Ga0070669_100279631 3300005353 Bacteria 1337
58 Ga0070671_100042038 3300005355 Bacteria 3799
59 Ga0070685_10104509 3300005466 Bacteria 1734
60 Ga0070665_100057236 3300005548 Bacteria 3909
61 Ga0070665_100313075 3300005548 Bacteria 1574
62 Ga0068852_100083709 3300005616 Bacteria 2837
63 Ga0081540_1007912 3300005983 Bacteria 7503
64 Ga0075365_10000600 3300006038 Bacteria 14128
65 Ga0075365_10007867 3300006038 Bacteria 6007
66 Ga0075365_10087883 3300006038 Bacteria 2114
67 Ga0075368_10006634 3300006042 Bacteria 4057
68 Ga0075368_10023539 3300006042 Bacteria 2353
69 Ga0075363_100095763 3300006048 Bacteria 1638
70 Ga0075362_10002533 3300006177 Bacteria 6160
71 Ga0075367_10008288 3300006178 Bacteria 5381
72 Ga0075367_10019332 3300006178 Bacteria 3776
73 Ga0075369_10006833 3300006186 Bacteria 4332
74 Ga0075369_10009672 3300006186 Bacteria 3752
75 Ga0075366_10017993 3300006195 Bacteria 4077
76 Ga0075370_10000839 3300006353 Bacteria 12435
77 Ga0079104_1000042 3300006946 Bacteria 185991
78 Ga0079104_1003298 3300006946 Bacteria 7678
79 Ga0099826_10000123 3300006948 Bacteria 34864
80 Ga0099826_10003580 3300006948 Bacteria 10608
81 Ga0105251_10027023 3300009011 Bacteria 2915
82 Ga0105240_10000019 3300009093 Bacteria 406211
83 Ga0105243_10006354 3300009148 Bacteria 9126
84 Ga0105248_10052789 3300009177 Bacteria 4562
85 Ga0105237_10004254 3300009545 Bacteria 16661
86 Ga0123341_1000015 3300009765 Bacteria 86184
87 Ga0123341_1043929 3300009765 Bacteria 2775
88 Ga0123342_1003064 3300009766 Bacteria 27242
89 Ga0123342_1008248 3300009766 Bacteria 13251
90 Ga0105239_10018520 3300010375 Bacteria 7691
91 Ga0105239_10241070 3300010375 Bacteria 2029
92 Ga0157373_10003853 3300013100 Bacteria 11337
93 Ga0157373_10033005 3300013100 Bacteria 3726
94 Ga0157371_10000002 3300013102 Bacteria 665040
95 Ga0157371_10021215 3300013102 Bacteria 4771
96 Ga0157370_10002915 3300013104 Bacteria 20380
97 Ga0157369_10106762 3300013105 Bacteria 2980
98 Ga0157369_10155347 3300013105 Bacteria 2417
99 Ga0171463_1022 3300013249 Bacteria 15552
100 Ga0182005_1007319 3300015265 Bacteria 3318
101 Ga0183363_1124 3300015690 Bacteria 20069
102 Ga0163161_10295066 3300017792 Bacteria 1275
103 Ga0214543_1000025 3300021327 Bacteria 225351
104 Ga0213872_10014331 3300021361 Bacteria 3700
105 Ga0228711_1000020 3300022739 Bacteria 108422
106 Ga0228710_1000012 3300022740 Bacteria 148650
107 Ga0209435_100005 3300025206 Bacteria 573745
108 Ga0209436_103526 3300025208 Bacteria 4124
109 Ga0209437_100078 3300025233 Bacteria 278088
110 Ga0207425_1000080 3300025245 Bacteria 100578
111 Ga0207425_1002325 3300025245 Bacteria 6803
112 Ga0207425_1009181 3300025245 Bacteria 2475
113 Ga0207425_1022926 3300025245 Bacteria 1311
114 Ga0209646_1000011 3300025246 Bacteria 573745
115 Ga0209026_1000008 3300025250 Bacteria 573745
116 Ga0209677_101144 3300025253 Bacteria 12360
117 Ga0209759_1000004 3300025256 Bacteria 573745
118 Ga0209129_1000195 3300025258 Bacteria 80791
119 Ga0209129_1000199 3300025258 Bacteria 77091
120 Ga0209129_1002007 3300025258 Bacteria 10555
121 Ga0209129_1003568 3300025258 Bacteria 6680
122 Ga0209129_1003611 3300025258 Bacteria 6609
123 Ga0209129_1005580 3300025258 Bacteria 4388
124 Ga0209233_1000163 3300025261 Bacteria 152912
125 Ga0209233_1000299 3300025261 Bacteria 60375
126 Ga0209673_1000037 3300025273 Bacteria 313804
127 Ga0209673_1000320 3300025273 Bacteria 88073
128 Ga0209673_1000880 3300025273 Bacteria 38918
129 Ga0209673_1000924 3300025273 Bacteria 37119
130 Ga0209673_1004391 3300025273 Bacteria 7580
131 Ga0209673_1011468 3300025273 Bacteria 3651
132 Ga0209130_1000079 3300025284 Bacteria 167669
133 Ga0209130_1011944 3300025284 Bacteria 2299
134 Ga0209130_1013537 3300025284 Bacteria 2084
135 Ga0209675_1015513 3300025291 Bacteria 2257
136 Ga0209676_1000093 3300025292 Bacteria 250231
137 Ga0209676_1005216 3300025292 Bacteria 6886
138 Ga0209676_1015915 3300025292 Bacteria 2744
139 Ga0209025_1000052 3300025294 Bacteria 324648
140 Ga0209025_1000332 3300025294 Bacteria 104326
141 Ga0209025_1000354 3300025294 Bacteria 98665
142 Ga0209025_1000566 3300025294 Bacteria 67702
143 Ga0209025_1000666 3300025294 Bacteria 59408
144 Ga0209025_1003632 3300025294 Bacteria 14340
145 Ga0209025_1007212 3300025294 Bacteria 8372
146 Ga0209025_1017809 3300025294 Bacteria 4073
147 Ga0209025_1051272 3300025294 Bacteria 1641
148 Ga0209025_1059426 3300025294 Bacteria 1443
149 Ga0209025_1070635 3300025294 Bacteria 1242
150 Ga0209564_1000345 3300025295 Bacteria 88073
151 Ga0209564_1000869 3300025295 Bacteria 40151
152 Ga0209564_1001903 3300025295 Bacteria 18682
153 Ga0209564_1009432 3300025295 Bacteria 4646
154 Ga0209758_1000105 3300025297 Bacteria 221415
155 Ga0209758_1000263 3300025297 Bacteria 104297
156 Ga0209758_1001323 3300025297 Bacteria 30082
157 Ga0209758_1001789 3300025297 Bacteria 23722
158 Ga0209758_1002280 3300025297 Bacteria 19856
159 Ga0209758_1002342 3300025297 Bacteria 19520
160 Ga0209758_1008256 3300025297 Bacteria 6816
161 Ga0209050_1003774 3300025298 Bacteria 10824
162 Ga0209050_1011010 3300025298 Bacteria 4361
163 Ga0209256_1000310 3300025299 Bacteria 85227
164 Ga0209256_1000343 3300025299 Bacteria 75902
165 Ga0209256_1000348 3300025299 Bacteria 75070
166 Ga0209256_1001088 3300025299 Bacteria 31344
167 Ga0209256_1003669 3300025299 Bacteria 10473
168 Ga0209256_1012405 3300025299 Bacteria 3270
169 Ga0207426_1000167 3300025302 Bacteria 167669
170 Ga0207426_1000296 3300025302 Bacteria 98032
171 Ga0207426_1002918 3300025302 Bacteria 10078
172 Ga0209051_1000236 3300025303 Bacteria 92738
173 Ga0209051_1000517 3300025303 Bacteria 48573
174 Ga0209051_1009994 3300025303 Bacteria 4833
175 Ga0209051_1010221 3300025303 Bacteria 4766
176 Ga0209257_1004486 3300025304 Bacteria 10777
177 Ga0209257_1006024 3300025304 Bacteria 8103
178 Ga0209257_1008087 3300025304 Bacteria 6118
179 Ga0209257_1030459 3300025304 Bacteria 1742
180 Ga0207688_10034324 3300025901 Bacteria 2809
181 Ga0207695_10000049 3300025913 Bacteria 406233
182 Ga0207671_10000107 3300025914 Bacteria 128950
183 Ga0207650_10001919 3300025925 Bacteria 14650
184 Ga0207709_10106244 3300025935 Bacteria 1867
185 Ga0207711_10105120 3300025941 Bacteria 2503
186 Ga0207668_10020566 3300025972 Bacteria 4196
187 Ga0207678_10110034 3300026067 Bacteria 2350
188 Ga0207678_10186721 3300026067 Bacteria 1771
189 Ga0207702_10082609 3300026078 Bacteria 2794
190 Ga0209281_1000138 3300027111 Bacteria 180979
191 Ga0209281_1000194 3300027111 Bacteria 139318
192 Ga0209281_1000446 3300027111 Bacteria 59196
193 Ga0209371_1000003 3300027312 Bacteria 1122971
194 Ga0209371_1002844 3300027312 Bacteria 9159
195 Ga0209282_1000020 3300027666 Bacteria 180986
196 Ga0209282_1000176 3300027666 Bacteria 35300
197 Ga0209282_1015163 3300027666 Bacteria 4906
198 Ga0209813_10009431 3300027866 Bacteria 2496
199 Ga0268266_10033214 3300028379 Bacteria 4388
200 Ga0268266_10086667 3300028379 Bacteria 2738
201 Ga0268266_10313451 3300028379 Bacteria 1466
202 Ga0268266_10412311 3300028379 Bacteria 1279
203 Ga0265318_10030678 3300028577 Bacteria 2090
204 Ga0307515_10000145 3300028794 Bacteria 170814
205 Ga0307515_10000263 3300028794 Bacteria 130303
206 Ga0307515_10093119 3300028794 Bacteria 3741
207 Ga0307515_10151926 3300028794 Bacteria 2415
208 Ga0268256_1000004 3300030500 Bacteria 1122967
209 Ga0265330_10034995 3300031235 Bacteria 2242
210 Ga0265328_10004940 3300031239 Bacteria 5745
211 Ga0265325_10004012 3300031241 Bacteria 9404
212 Ga0265325_10006401 3300031241 Bacteria 7141
213 Ga0265340_10000794 3300031247 Bacteria 17926
214 Ga0265340_10018114 3300031247 Bacteria 3636
215 Ga0265340_10034019 3300031247 Bacteria 2535
216 Ga0265339_10002113 3300031249 Bacteria 14479
217 Ga0265339_10011130 3300031249 Bacteria 5553
218 Ga0265339_10033081 3300031249 Bacteria 2914
219 Ga0265316_10016672 3300031344 Bacteria 6368
220 Ga0265316_10044429 3300031344 Bacteria 3534
221 Ga0265316_10187407 3300031344 Bacteria 1538
222 Ga0307513_10003087 3300031456 Bacteria 22729
223 Ga0307513_10003471 3300031456 Bacteria 21323
224 Ga0307513_10053661 3300031456 Bacteria 4330
225 Ga0307408_100016058 3300031548 Bacteria 4992
226 Ga0265313_10000371 3300031595 Bacteria 48762
227 Ga0265313_10008172 3300031595 Bacteria 6994
228 Ga0265313_10070962 3300031595 Bacteria 1604
229 Ga0265314_10025242 3300031711 Bacteria 4489
230 Ga0265314_10030223 3300031711 Bacteria 4013
231 Ga0265314_10062963 3300031711 Bacteria 2518
232 Ga0265314_10123438 3300031711 Bacteria 1626
233 Ga0265342_10014444 3300031712 Bacteria 5240
234 Ga0265342_10015031 3300031712 Bacteria 5110
235 Ga0307516_10016649 3300031730 Bacteria 7681
236 Ga0307516_10022527 3300031730 Bacteria 6466
237 Ga0307516_10138676 3300031730 Bacteria 2204
238 Ga0307405_10001367 3300031731 Bacteria 10231
239 Ga0307405_10018122 3300031731 Bacteria 3879
240 Ga0307406_10023570 3300031901 Bacteria 3664
241 Ga0307406_10249820 3300031901 Bacteria 1335
242 Ga0307412_10004368 3300031911 Bacteria 7882
243 Ga0307412_10014315 3300031911 Bacteria 4675
244 Ga0315914_1000031 3300031967 Bacteria 101407
245 Ga0307409_100179951 3300031995 Bacteria 1871
246 Ga0307414_10128114 3300032004 Bacteria 1965
247 Ga0307510_10083251 3300033180 Bacteria 3090
248 Ga0315913_1000010 3300033430 Bacteria 140890
249 Ga0315915_1000007 3300033464 Bacteria 319225
250 Ga0373943_0133380 3300035170 Bacteria 1331
251 Ga0373935_0024645 3300035692 Bacteria 3705
252 Ga0373927_0000047 3300035695 Bacteria 87289
253 Ga0373925_0001420 3300037068 Bacteria 20792
254 Ga0395905_0001828 3300037471 Bacteria 24574
255 Ga0395905_0006179 3300037471 Bacteria 12087
256 Ga0395905_0049808 3300037471 Bacteria 3926
257 Ga0436360_1304194 3300039438 Bacteria 1574
258 Ga0436361_0563451 3300039447 Bacteria 2423
259 Ga0439436_0025655 3300041404 Bacteria 1730
260 Ga0439439_0012905 3300041406 Bacteria 2022
261 Ga0439465_0008881 3300041413 Bacteria 3166
262 Ga0439465_0015760 3300041413 Bacteria 2357
263 Ga0451787_487060 3300041441 Bacteria 4301
264 Ga0451798_0290064 3300041458 Bacteria 2243
265 Ga0451839_1092244 3300041496 Bacteria 1790
266 Ga0439449_0044724 3300042007 Bacteria 1642
267 Ga0439434_0030723 3300042435 Bacteria 1631
268 Ga0466972_0028935 3300044658 Bacteria 2730
269 Ga0466965_0061260 3300044683 Bacteria 1881
270 Ga0466970_0013042 3300044765 Bacteria 4259
271 Ga0466960_0065776 3300044901 Bacteria 1791
272 Ga0495638_0000591 3300046460 Bacteria 40915
273 Ga0495638_0033311 3300046460 Bacteria 3295
274 Ga0495638_0190347 3300046460 Bacteria 1164
275 Ga0495651_0103046 3300046462 Bacteria 2121
276 Ga0495605_0014574 3300046474 Bacteria 4300
277 Ga0495605_0025162 3300046474 Bacteria 3103
278 Ga0495662_0025297 3300046476 Bacteria 2866
279 Ga0495585_0042765 3300046492 Bacteria 2536
280 Ga0495585_0047769 3300046492 Bacteria 2382
281 Ga0495585_0082527 3300046492 Bacteria 1740
282 Ga0495583_0018919 3300046506 Bacteria 3611
283 Ga0495583_0022293 3300046506 Bacteria 3234
284 Ga0495606_0002219 3300046507 Bacteria 23170
285 Ga0495606_0013151 3300046507 Bacteria 6568
286 Ga0495606_0126417 3300046507 Bacteria 1524
287 Ga0495610_0006787 3300046512 Bacteria 7765
288 Ga0495610_0012381 3300046512 Bacteria 5138
289 Ga0495610_0087136 3300046512 Bacteria 1421
290 Ga0495620_0039077 3300046515 Bacteria 2100
291 Ga0495631_0013351 3300046518 Bacteria 3988
292 Ga0495632_0006479 3300046519 Bacteria 7520
293 Ga0495632_0014663 3300046519 Bacteria 4425
294 Ga0495632_0019658 3300046519 Bacteria 3674
295 Ga0495643_0070462 3300046522 Bacteria 1836
296 Ga0495648_0072972 3300046524 Bacteria 1984
297 Ga0495648_0076014 3300046524 Bacteria 1929
298 Ga0495654_0001861 3300046530 Bacteria 14052
299 Ga0495609_0014234 3300046538 Bacteria 3744
300 Ga0495609_0017098 3300046538 Bacteria 3372
301 Ga0495597_0086343 3300046542 Bacteria 1336
302 Ga0495633_0008943 3300046558 Bacteria 5581
303 Ga0495633_0063371 3300046558 Bacteria 1730
304 Ga0495656_0007577 3300046615 Bacteria 3843
305 Ga0495668_0032402 3300046616 Bacteria 2941
306 Ga0495668_0065935 3300046616 Bacteria 1993
307 Ga0495611_0028580 3300046648 Bacteria 2443
308 Ga0495625_0016371 3300046660 Bacteria 5838
309 Ga0495625_0041947 3300046660 Bacteria 3327
310 Ga0495625_0121150 3300046660 Bacteria 1780
311 Ga0495625_0139187 3300046660 Bacteria 1639
312 Ga0495588_0001719 3300046674 Bacteria 9324
313 Ga0495624_0093949 3300046690 Bacteria 1849
314 Ga0495649_0047454 3300046694 Bacteria 2336
315 Ga0495660_0014687 3300046810 Bacteria 4529
316 Ga0495660_0031536 3300046810 Bacteria 2980
317 Ga0495604_0025551 3300047317 Bacteria 4705
318 Ga0495686_0002643 3300047472 Bacteria 16544
319 Ga0495686_0023395 3300047472 Bacteria 4075
320 Ga0495686_0044801 3300047472 Bacteria 2800
321 Ga0495686_0051091 3300047472 Bacteria 2595
322 Ga0495626_0094034 3300048091 Bacteria 1315
323 Ga0496101_0147835 3300048904 Bacteria 1795
324 Ga0496102_0211453 3300048905 Bacteria 1828
325 Ga0496104_0200868 3300048907 Bacteria 1906
326 Ga0496105_0148638 3300048908 Bacteria 1926
327 Ga0496106_0015899 3300048909 Bacteria 5567
328 Ga0496110_0047664 3300048913 Bacteria 3754
329 Ga0496110_0166737 3300048913 Bacteria 1997
330 Ga0496111_0000570 3300048914 Bacteria 19247
331 Ga0496116_0000026 3300048919 Bacteria 450803
332 Ga0496116_0005540 3300048919 Bacteria 11645
333 Ga0496116_0012007 3300048919 Bacteria 7109
334 Ga0496116_0012328 3300048919 Bacteria 6990
335 Ga0496116_0040317 3300048919 Bacteria 3216
336 Ga0496116_0051820 3300048919 Bacteria 2723
337 Ga0496117_0000016 3300048920 Bacteria 523642
338 Ga0496117_0002458 3300048920 Bacteria 23348
339 Ga0496117_0028194 3300048920 Bacteria 4352
340 Ga0496117_0083821 3300048920 Bacteria 2082
341 Ga0496117_0091385 3300048920 Bacteria 1958
342 Ga0496117_0185452 3300048920 Bacteria 1191
343 Ga0496118_0004029 3300048921 Bacteria 17860
344 Ga0496118_0010916 3300048921 Bacteria 8933
345 Ga0496118_0037836 3300048921 Bacteria 3876
346 Ga0496118_0046435 3300048921 Bacteria 3379
347 Ga0496118_0046573 3300048921 Bacteria 3371
348 Ga0496118_0091661 3300048921 Bacteria 2089
349 Ga0496119_0004065 3300048922 Bacteria 14759
350 Ga0496119_0018854 3300048922 Bacteria 5112
351 Ga0496119_0023424 3300048922 Bacteria 4378
352 Ga0496119_0064058 3300048922 Bacteria 2184
353 Ga0496119_0076320 3300048922 Bacteria 1944
354 Ga0496120_0000056 3300048923 Bacteria 180367
355 Ga0496120_0002742 3300048923 Bacteria 17205
356 Ga0496120_0012085 3300048923 Bacteria 5896
357 Ga0496120_0035007 3300048923 Bacteria 3004
358 Ga0496120_0079917 3300048923 Bacteria 1774
359 Ga0496121_0000003 3300048924 Bacteria 1191431
360 Ga0496121_0000180 3300048924 Bacteria 141128
361 Ga0496121_0056708 3300048924 Bacteria 3251
362 Ga0496121_0065712 3300048924 Bacteria 2949
363 Ga0496121_0091542 3300048924 Bacteria 2374
364 Ga0496121_0128317 3300048924 Bacteria 1903
365 Ga0496121_0153971 3300048924 Bacteria 1688
366 Ga0496121_0172481 3300048924 Bacteria 1569
367 Ga0496121_0217723 3300048924 Bacteria 1347
368 Ga0496122_0000002 3300048925 Bacteria 905834
369 Ga0496122_0000024 3300048925 Bacteria 372400
370 Ga0496122_0000107 3300048925 Bacteria 193163
371 Ga0496122_0017729 3300048925 Bacteria 6629
372 Ga0496122_0036472 3300048925 Bacteria 3974
373 Ga0496122_0049824 3300048925 Bacteria 3200
374 Ga0496122_0062614 3300048925 Bacteria 2722
375 Ga0496122_0065454 3300048925 Bacteria 2635
376 Ga0496122_0096660 3300048925 Bacteria 1991
377 Ga0496122_0099727 3300048925 Bacteria 1946
378 Ga0496122_0128951 3300048925 Bacteria 1612
379 Ga0496123_0000002 3300048926 Bacteria 1811682
380 Ga0496123_0000063 3300048926 Bacteria 216072
381 Ga0496123_0000086 3300048926 Bacteria 183266
382 Ga0496123_0020993 3300048926 Bacteria 5089
383 Ga0496123_0031131 3300048926 Bacteria 3887
384 Ga0496123_0046162 3300048926 Bacteria 2957
385 Ga0496123_0051434 3300048926 Bacteria 2743
386 Ga0496123_0064470 3300048926 Bacteria 2334
387 Ga0496123_0166873 3300048926 Bacteria 1166
388 Ga0496124_0000091 3300048927 Bacteria 189706
389 Ga0496124_0001850 3300048927 Bacteria 29217
390 Ga0496124_0003986 3300048927 Bacteria 17602
391 Ga0496124_0010962 3300048927 Bacteria 9114
392 Ga0496124_0018448 3300048927 Bacteria 6534
393 Ga0496124_0087766 3300048927 Bacteria 2543
394 Ga0496124_0118612 3300048927 Bacteria 2118
395 Ga0496124_0120742 3300048927 Bacteria 2094
396 Ga0496124_0140989 3300048927 Bacteria 1902
397 Ga0496124_0149069 3300048927 Bacteria 1837
398 Ga0496124_0206491 3300048927 Bacteria 1489
399 Ga0496124_0295217 3300048927 Bacteria 1174
400 Ga0496125_0000262 3300048928 Bacteria 108389
401 Ga0496125_0000323 3300048928 Bacteria 93243
402 Ga0496125_0000477 3300048928 Bacteria 70913
403 Ga0496125_0000833 3300048928 Bacteria 49770
404 Ga0496125_0003888 3300048928 Bacteria 17657
405 Ga0496125_0017666 3300048928 Bacteria 6790
406 Ga0496125_0084817 3300048928 Bacteria 2403
407 Ga0496125_0104148 3300048928 Bacteria 2079
408 Ga0496126_0000059 3300048929 Bacteria 267449
409 Ga0496126_0000434 3300048929 Bacteria 83949
410 Ga0496126_0123891 3300048929 Bacteria 2238
411 Ga0496126_0145353 3300048929 Bacteria 2037
412 Ga0495678_022082 3300049459 Bacteria 2789
413 Ga0495678_028523 3300049459 Bacteria 2354
414 Ga0501031_0021483 3300049568 Bacteria 4207
415 Ga0501031_0054122 3300049568 Bacteria 2615
416 Ga0501031_0191332 3300049568 Bacteria 1336
417 Ga0501032_0000013 3300049569 Bacteria 185070
418 Ga0501032_0079944 3300049569 Bacteria 2176
419 Ga0501032_0226446 3300049569 Bacteria 1216
420 Ga0501033_0000361 3300049570 Bacteria 43373
421 Ga0501033_0000522 3300049570 Bacteria 36025
422 Ga0501033_0061697 3300049570 Bacteria 2762
423 Ga0501033_0218368 3300049570 Bacteria 1358
424 Ga0501034_0000054 3300049571 Bacteria 206373
425 Ga0501034_0096196 3300049571 Bacteria 2957
426 Ga0501034_0173063 3300049571 Bacteria 2125
427 Ga0501036_0000828 3300049572 Bacteria 22938
428 Ga0501037_0005064 3300049573 Bacteria 9586
429 Ga0501037_0051215 3300049573 Bacteria 3020
430 Ga0501037_0070049 3300049573 Bacteria 2552
431 Ga0501037_0070716 3300049573 Bacteria 2539
432 Ga0501037_0142774 3300049573 Bacteria 1713
433 Ga0501038_0000018 3300049574 Bacteria 155191
434 Ga0501039_0000152 3300049575 Bacteria 47363
435 Ga0501039_0101641 3300049575 Bacteria 2244
436 Ga0501043_0000014 3300049579 Bacteria 184687
437 Ga0501043_0098352 3300049579 Bacteria 2300
438 Ga0501043_0148584 3300049579 Bacteria 1834
439 Ga0501043_0197794 3300049579 Bacteria 1561
440 Ga0501047_0016929 3300049581 Bacteria 6969
441 Ga0501047_0030248 3300049581 Bacteria 5221
442 Ga0501047_0163998 3300049581 Bacteria 2093
443 Ga0501047_0167105 3300049581 Bacteria 2070
444 Ga0501047_0244511 3300049581 Bacteria 1644
445 Ga0501067_0091524 3300049583 Bacteria 1688
446 Ga0501069_0145120 3300049585 Bacteria 1362
447 Ga0501070_0041228 3300049586 Bacteria 3846
448 Ga0501070_0051047 3300049586 Bacteria 3433
449 Ga0501070_0136494 3300049586 Bacteria 2025
450 Ga0501070_0335479 3300049586 Bacteria 1228
451 Ga0501074_0227283 3300049590 Bacteria 1328
452 Ga0501074_0281648 3300049590 Bacteria 1182
453 Ga0501261_006749 3300049690 Bacteria 1465
454 Ga0501079_0199236 3300049741 Bacteria 1564
455 Ga0501083_0055471 3300049744 Bacteria 2656
456 Ga0501083_0174984 3300049744 Bacteria 1402
457 Ga0501035_0000019 3300049822 Bacteria 241152
458 Ga0501035_0008142 3300049822 Bacteria 9770
459 Ga0501035_0021342 3300049822 Bacteria 5953
460 Ga0501035_0078684 3300049822 Bacteria 2912
461 Ga0501044_0092425 3300049823 Bacteria 3051
462 Ga0501044_0125105 3300049823 Bacteria 2569
463 Ga0501044_0212875 3300049823 Bacteria 1886
464 Ga0501045_0190772 3300049824 Bacteria 1527
465 nmdc:mga03n38_57874_c1 3300050490 Bacteria 1754
466 nmdc:mga00v17_107176_c1 3300050491 Bacteria 1769
467 nmdc:mga00v17_230_c1 3300050491 Bacteria 33351
468 nmdc:mga00v17_337_c1 3300050491 Bacteria 26383
469 nmdc:mga0yw44_9347_c2 3300050492 Bacteria 4070
470 nmdc:mga0k408_7537_c1 3300050493 Bacteria 5813
471 nmdc:mga06z11_66756_c1 3300050494 Bacteria 1892
472 nmdc:mga04h51_24749_c1 3300050495 Bacteria 1842
473 nmdc:mga0sz30_354_c1 3300050516 Bacteria 17427
474 nmdc:mga0sz30_8054_c1 3300050516 Bacteria 3970
475 Ga0500610_0085237 3300053079 Bacteria 1645
476 Ga0500578_0032372 3300053086 Bacteria 3360
477 Ga0500578_0085480 3300053086 Bacteria 2004
478 Ga0500651_0124156 3300053093 Bacteria 1565
479 Ga0500654_068947 3300053099 Bacteria 1740
480 Ga0500557_000023 3300053105 Bacteria 87584
481 Ga0500560_000252 3300053107 Bacteria 6600
482 Ga0500569_001403 3300053109 Bacteria 4529
483 Ga0500569_013694 3300053109 Bacteria 1992
484 Ga0500572_016677 3300053111 Bacteria 1875
485 Ga0500594_0004142 3300053118 Bacteria 3198
486 Ga0500594_0023448 3300053118 Bacteria 1565
487 Ga0500607_044592 3300053121 Bacteria 2384
488 Ga0500614_029953 3300053123 Bacteria 1324
489 Ga0500618_000109 3300053125 Bacteria 66318
490 Ga0500618_001997 3300053125 Bacteria 8320
491 Ga0500626_103833 3300053128 Bacteria 1236
492 Ga0500642_0000059 3300053130 Bacteria 65182
493 Ga0500652_077096 3300053131 Bacteria 1386
494 Ga0500658_0001045 3300053134 Bacteria 11320
495 Ga0500658_0047640 3300053134 Bacteria 1740
496 Ga0500659_0099848 3300053135 Bacteria 1505
497 Ga0500559_0004001 3300053136 Bacteria 7080
498 Ga0500559_0073470 3300053136 Bacteria 1543
499 Ga0500561_0000248 3300053137 Bacteria 9498
500 Ga0500568_0005458 3300053139 Bacteria 6566
501 Ga0500568_0020932 3300053139 Bacteria 2821
502 Ga0500590_005965 3300053148 Bacteria 5905
503 Ga0500590_018538 3300053148 Bacteria 3601
504 Ga0500604_0034151 3300053151 Bacteria 1507
505 Ga0500616_0002051 3300053153 Bacteria 17701
506 Ga0500616_0035606 3300053153 Bacteria 2706
507 Ga0500619_000785 3300053154 Bacteria 5430
508 Ga0500622_0001743 3300053156 Bacteria 16801
509 Ga0500622_0005319 3300053156 Bacteria 7761
510 Ga0500627_0014296 3300053158 Bacteria 3037
511 Ga0500634_0038398 3300053161 Bacteria 2603
512 Ga0500634_0059534 3300053161 Bacteria 2031
513 Ga0500636_0000001 3300053177 Bacteria 324086
514 Ga0500636_0000014 3300053177 Bacteria 124740
515 Ga0500636_0006275 3300053177 Bacteria 6818
516 Ga0500637_0072703 3300053178 Bacteria 1979
517 Ga0500625_001971 3300053729 Bacteria 7433
518 Ga0501082_0090721 3300060353 Bacteria 2639
519 Ga0501082_0134700 3300060353 Bacteria 2143

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10241070 Ga0105239_102410702 285
2 3300025304 Ga0209257_1030459 Ga0209257_10304592 288
3 3300003781 Ga0055536_1007318 Ga0055536_10073182 293
4 3300003792 Ga0055540_1018076 Ga0055540_10180762 293
5 3300003794 Ga0055531_10004650 Ga0055531_100046507 293
6 3300025292 Ga0209676_1005216 Ga0209676_10052166 293
7 3300025298 Ga0209050_1003774 Ga0209050_10037742 293
8 3300025303 Ga0209051_1000517 Ga0209051_100051733 293
9 3300025297 Ga0209758_1000105 Ga0209758_100010523 296
10 3300025304 Ga0209257_1008087 Ga0209257_10080875 296
11 3300049579 Ga0501043_0197794 Ga0501043_0197794_24_932 298
12 3300003794 Ga0055531_10007450 Ga0055531_100074503 301
13 3300044658 Ga0466972_0028935 Ga0466972_0028935_1418_2416 301
14 3300031239 Ga0265328_10004940 Ga0265328_100049404 308
15 3300031249 Ga0265339_10002113 Ga0265339_1000211311 308
16 3300031344 Ga0265316_10187407 Ga0265316_101874072 308
17 3300031711 Ga0265314_10025242 Ga0265314_100252422 308
18 3300031711 Ga0265314_10030223 Ga0265314_100302234 308
19 3300046674 Ga0495588_0001719 Ga0495588_0001719_5312_6313 309
20 3300031730 Ga0307516_10022527 Ga0307516_100225273 310
21 iso_pu_bacteria 2941499720 2941502646 310
22 3300053128 Ga0500626_103833 Ga0500626_103833_118_1122 311
23 3300003856 Ga0058692_1001450 Ga0058692_10014502 313
24 3300027312 Ga0209371_1000003 Ga0209371_1000003221 313
25 3300030500 Ga0268256_1000004 Ga0268256_1000004830 313
26 3300005548 Ga0070665_100057236 Ga0070665_1000572362 314
27 3300006042 Ga0075368_10006634 Ga0075368_100066343 314
28 3300009148 Ga0105243_10006354 Ga0105243_100063542 314
29 3300013100 Ga0157373_10003853 Ga0157373_100038536 314
30 3300013102 Ga0157371_10000002 Ga0157371_10000002582 314
31 3300025935 Ga0207709_10106244 Ga0207709_101062442 314
32 3300028379 Ga0268266_10086667 Ga0268266_100866672 314
33 3300031235 Ga0265330_10034995 Ga0265330_100349952 314
34 3300031241 Ga0265325_10006401 Ga0265325_100064012 314
35 3300048919 Ga0496116_0012328 Ga0496116_0012328_1950_2996 314
36 3300048920 Ga0496117_0000016 Ga0496117_0000016_487877_488923 314
37 3300048921 Ga0496118_0004029 Ga0496118_0004029_4433_5479 314
38 3300048922 Ga0496119_0023424 Ga0496119_0023424_1327_2373 314
39 3300048923 Ga0496120_0000056 Ga0496120_0000056_176854_177900 314
40 3300048925 Ga0496122_0000002 Ga0496122_0000002_488538_489584 314
41 3300048926 Ga0496123_0000002 Ga0496123_0000002_1322099_1323145 314
42 3300048926 Ga0496123_0000002 Ga0496123_0000002_488538_489584 314
43 3300048927 Ga0496124_0087766 Ga0496124_0087766_792_1838 314
44 3300050491 nmdc:mga00v17_230_c1 nmdc:mga00v17_230_c1_27128_28174 314
45 3300050516 nmdc:mga0sz30_354_c1 nmdc:mga0sz30_354_c1_13916_14962 314
46 3300053107 Ga0500560_000252 Ga0500560_000252_1868_2869 314
47 3300053137 Ga0500561_0000248 Ga0500561_0000248_2022_3068 314
48 3300053161 Ga0500634_0038398 Ga0500634_0038398_1236_2237 314
49 3300046530 Ga0495654_0001861 Ga0495654_0001861_2399_3400 315
50 3300025294 Ga0209025_1000666 Ga0209025_100066628 316
51 3300046476 Ga0495662_0025297 Ga0495662_0025297_540_1544 316
52 3300046690 Ga0495624_0093949 Ga0495624_0093949_22_1026 316
53 3300047317 Ga0495604_0025551 Ga0495604_0025551_3570_4574 316
54 3300053148 Ga0500590_005965 Ga0500590_005965_336_1340 316
55 3300053153 Ga0500616_0002051 Ga0500616_0002051_1578_2579 316
56 3300005983 Ga0081540_1007912 Ga0081540_10079124 318
57 3300049586 Ga0501070_0335479 Ga0501070_0335479_97_1104 318
58 3300053161 Ga0500634_0059534 Ga0500634_0059534_984_1988 318
59 3300039438 Ga0436360_1304194 Ga0436360_1304194_93_1094 319
60 3300053121 Ga0500607_044592 Ga0500607_044592_827_1831 319
61 3300053123 Ga0500614_029953 Ga0500614_029953_282_1286 319
62 3300053136 Ga0500559_0073470 Ga0500559_0073470_418_1422 319
63 3300053148 Ga0500590_018538 Ga0500590_018538_1672_2676 319
64 3300053154 Ga0500619_000785 Ga0500619_000785_1977_2981 319
65 3300053177 Ga0500636_0000014 Ga0500636_0000014_114418_115422 319
66 3300053178 Ga0500637_0072703 Ga0500637_0072703_705_1709 319
67 3300006038 Ga0075365_10087883 Ga0075365_100878832 320
68 3300006948 Ga0099826_10003580 Ga0099826_100035803 320
69 3300021327 Ga0214543_1000025 Ga0214543_100002573 320
70 3300021361 Ga0213872_10014331 Ga0213872_100143312 320
71 3300027312 Ga0209371_1002844 Ga0209371_10028443 320
72 3300027666 Ga0209282_1015163 Ga0209282_10151633 320
73 3300031595 Ga0265313_10070962 Ga0265313_100709622 320
74 3300031711 Ga0265314_10123438 Ga0265314_101234382 320
75 3300031995 Ga0307409_100179951 Ga0307409_1001799512 320
76 3300039447 Ga0436361_0563451 Ga0436361_0563451_473_1489 320
77 3300044683 Ga0466965_0061260 Ga0466965_0061260_166_1167 320
78 3300044765 Ga0466970_0013042 Ga0466970_0013042_1931_2932 320
79 3300049823 Ga0501044_0125105 Ga0501044_0125105_882_1883 320
80 3300050491 nmdc:mga00v17_107176_c1 nmdc:mga00v17_107176_c1_109_1110 320
81 3300048921 Ga0496118_0037836 Ga0496118_0037836_709_1710 321
82 3300006948 Ga0099826_10000123 Ga0099826_1000012325 322
83 3300027666 Ga0209282_1000176 Ga0209282_10001765 322
84 3300044901 Ga0466960_0065776 Ga0466960_0065776_81_1082 322
85 3300048922 Ga0496119_0018854 Ga0496119_0018854_1208_2209 322
86 3300048928 Ga0496125_0017666 Ga0496125_0017666_4759_5760 322
87 3300053177 Ga0500636_0000001 Ga0500636_0000001_107563_108570 322
88 3300005262 Ga0065165_1009147 Ga0065165_10091474 323
89 3300028794 Ga0307515_10000263 Ga0307515_10000263124 323
90 3300046660 Ga0495625_0139187 Ga0495625_0139187_331_1341 323
91 3300049570 Ga0501033_0061697 Ga0501033_0061697_643_1650 324
92 3300049573 Ga0501037_0142774 Ga0501037_0142774_565_1572 324
93 3300049585 Ga0501069_0145120 Ga0501069_0145120_32_1039 324
94 3300049590 Ga0501074_0227283 Ga0501074_0227283_244_1251 324
95 3300009011 Ga0105251_10027023 Ga0105251_100270232 325
96 3300028794 Ga0307515_10000145 Ga0307515_100001455 325
97 3300033180 Ga0307510_10083251 Ga0307510_100832513 325
98 3300048924 Ga0496121_0153971 Ga0496121_0153971_143_1147 325
99 3300048924 Ga0496121_0217723 Ga0496121_0217723_143_1147 325
100 iso_pu_bacteria 2508501050 2508731439 325
101 iso_pu_bacteria 2508501114 2509077049 325
102 iso_pu_bacteria 2773857925 2774868389 325
103 iso_pu_bacteria 2775506901 2776262585 325
104 iso_pu_bacteria 2835312727 2835313051 325
105 iso_pu_bacteria 2882456835 2882459181 325
106 iso_pu_bacteria 2894232714 2894233218 325
107 3300002773 JGI25152J39213_1001905 JGI25152J39213_10019056 326
108 3300025258 Ga0209129_1000199 Ga0209129_100019949 326
109 3300025294 Ga0209025_1000566 Ga0209025_100056618 326
110 3300046507 Ga0495606_0126417 Ga0495606_0126417_91_1095 326
111 3300048922 Ga0496119_0004065 Ga0496119_0004065_9929_10930 326
112 3300048923 Ga0496120_0035007 Ga0496120_0035007_686_1687 326
113 3300048925 Ga0496122_0017729 Ga0496122_0017729_2199_3200 326
114 3300048926 Ga0496123_0051434 Ga0496123_0051434_372_1373 326
115 3300048928 Ga0496125_0000323 Ga0496125_0000323_43316_44317 326
116 3300006178 Ga0075367_10008288 Ga0075367_100082882 327
117 3300027866 Ga0209813_10009431 Ga0209813_100094312 327
118 3300031241 Ga0265325_10004012 Ga0265325_1000401210 327
119 3300050494 nmdc:mga06z11_66756_c1 nmdc:mga06z11_66756_c1_237_1241 327
120 iso_pu_bacteria 2842521101 2842523245 327
121 iso_pu_bacteria 2923556063 2923558718 327
122 iso_pu_bacteria 8056875544 8056876222 327
123 3300031901 Ga0307406_10249820 Ga0307406_102498201 328
124 3300046460 Ga0495638_0033311 Ga0495638_0033311_484_1497 328
125 3300046660 Ga0495625_0121150 Ga0495625_0121150_305_1318 328
126 3300048923 Ga0496120_0002742 Ga0496120_0002742_11047_12075 328
127 3300049822 Ga0501035_0008142 Ga0501035_0008142_1359_2363 328
128 3300053105 Ga0500557_000023 Ga0500557_000023_34159_35163 328
129 3300053130 Ga0500642_0000059 Ga0500642_0000059_20892_21896 328
130 3300053729 Ga0500625_001971 Ga0500625_001971_3066_4070 328
131 iso_pu_bacteria 2600254933 2600373591 328
132 iso_pu_bacteria 2757320392 2757572462 328
133 iso_pu_bacteria 2854911287 2854915535 328
134 iso_pu_bacteria 8054558443 8054559365 328
135 3300001979 JGI24740J21852_10036884 JGI24740J21852_100368841 329
136 3300005347 Ga0070668_100325906 Ga0070668_1003259062 329
137 3300005466 Ga0070685_10104509 Ga0070685_101045091 329
138 3300006042 Ga0075368_10023539 Ga0075368_100235392 329
139 3300025901 Ga0207688_10034324 Ga0207688_100343242 329
140 3300031548 Ga0307408_100016058 Ga0307408_1000160583 329
141 3300031731 Ga0307405_10018122 Ga0307405_100181222 329
142 3300031911 Ga0307412_10014315 Ga0307412_100143152 329
143 3300037471 Ga0395905_0049808 Ga0395905_0049808_2238_3236 329
144 3300049690 Ga0501261_006749 Ga0501261_006749_264_1262 329
145 3300050495 nmdc:mga04h51_24749_c1 nmdc:mga04h51_24749_c1_646_1644 329
146 iso_pu_bacteria 2509276021 2509389784 329
147 iso_pu_bacteria 2509276033 2509447962 329
148 iso_pu_bacteria 2510065019 2510134900 329
149 iso_pu_bacteria 2510461076 2510896311 329
150 iso_pu_bacteria 2510917026 2511174162 329
151 iso_pu_bacteria 2510917028 2511187238 329
152 iso_pu_bacteria 2510917030 2511195941 329
153 iso_pu_bacteria 2513237084 2513572663 329
154 iso_pu_bacteria 2513237085 2513580105 329
155 iso_pu_bacteria 2513237088 2513599858 329
156 iso_pu_bacteria 2513237093 2513631261 329
157 iso_pu_bacteria 2513237103 2513710844 329
158 iso_pu_bacteria 2513237138 2513867013 329
159 iso_pu_bacteria 2513237159 2513998140 329
160 iso_pu_bacteria 2513237162 2514023201 329
161 iso_pu_bacteria 2515075009 2515113983 329
162 iso_pu_bacteria 2515154113 2515639182 329
163 iso_pu_bacteria 2515154114 2515642970 329
164 iso_pu_bacteria 2515154116 2515656716 329
165 iso_pu_bacteria 2515154134 2515743659 329
166 iso_pu_bacteria 2516653077 2517037615 329
167 iso_pu_bacteria 2516653085 2517077902 329
168 iso_pu_bacteria 2517093000 2517096698 329
169 iso_pu_bacteria 2517287029 2517410413 329
170 iso_pu_bacteria 2519899620 2520377970 329
171 iso_pu_bacteria 2529292951 2530647011 329
172 iso_pu_bacteria 2534681786 2535484300 329
173 iso_pu_bacteria 2534681796 2535519366 329
174 iso_pu_bacteria 2537561587 2537876531 329
175 iso_pu_bacteria 2554235003 2554245699 329
176 iso_pu_bacteria 2558860242 2559296472 329
177 iso_pu_bacteria 2582581294 2585202407 329
178 iso_pu_bacteria 2582581298 2585224722 329
179 iso_pu_bacteria 2582581299 2585227889 329
180 iso_pu_bacteria 2582581304 2585255536 329
181 iso_pu_bacteria 2582581306 2585269705 329
182 iso_pu_bacteria 2582581865 2585388633 329
183 iso_pu_bacteria 2582581866 2585392482 329
184 iso_pu_bacteria 2582581867 2585402285 329
185 iso_pu_bacteria 2585427526 2585529020 329
186 iso_pu_bacteria 2585427528 2585540961 329
187 iso_pu_bacteria 2585427529 2585547278 329
188 iso_pu_bacteria 2585427590 2585822415 329
189 iso_pu_bacteria 2585427593 2585839723 329
190 iso_pu_bacteria 2585427594 2585845447 329
191 iso_pu_bacteria 2585427633 2585997220 329
192 iso_pu_bacteria 2585427634 2586001821 329
193 iso_pu_bacteria 2599185210 2599603039 329
194 iso_pu_bacteria 2599185236 2599720056 329
195 iso_pu_bacteria 2600255279 2601610656 329
196 iso_pu_bacteria 2600255308 2601747014 329
197 iso_pu_bacteria 2615840624 2616295618 329
198 iso_pu_bacteria 2643221551 2643776171 329
199 iso_pu_bacteria 2643221555 2643794618 329
200 iso_pu_bacteria 2643221582 2643922222 329
201 iso_pu_bacteria 2643221618 2644108420 329
202 iso_pu_bacteria 2643221626 2644147609 329
203 iso_pu_bacteria 2643221634 2644195962 329
204 iso_pu_bacteria 2643221637 2644209831 329
205 iso_pu_bacteria 2643221643 2644241934 329
206 iso_pu_bacteria 2643221655 2644309472 329
207 iso_pu_bacteria 2643221659 2644331769 329
208 iso_pu_bacteria 2643221688 2644496421 329
209 iso_pu_bacteria 2643221693 2644520599 329
210 iso_pu_bacteria 2643221698 2644542150 329
211 iso_pu_bacteria 2643221712 2644615975 329
212 iso_pu_bacteria 2643221718 2644653382 329
213 iso_pu_bacteria 2718217882 2719182652 329
214 iso_pu_bacteria 2718217927 2719387323 329
215 iso_pu_bacteria 2718217997 2719666968 329
216 iso_pu_bacteria 2718218009 2719733370 329
217 iso_pu_bacteria 2718218199 2720493388 329
218 iso_pu_bacteria 2718218232 2720614859 329
219 iso_pu_bacteria 2718218235 2720632960 329
220 iso_pu_bacteria 2718218269 2720776684 329
221 iso_pu_bacteria 2718218363 2721148765 329
222 iso_pu_bacteria 2718218365 2721160149 329
223 iso_pu_bacteria 2718218366 2721165578 329
224 iso_pu_bacteria 2718218423 2721400958 329
225 iso_pu_bacteria 2721755514 2722841748 329
226 iso_pu_bacteria 2721755556 2723028272 329
227 iso_pu_bacteria 2721755684 2723561900 329
228 iso_pu_bacteria 2721755685 2723568532 329
229 iso_pu_bacteria 2721755809 2724039771 329
230 iso_pu_bacteria 2721755810 2724046126 329
231 iso_pu_bacteria 2721755819 2724091291 329
232 iso_pu_bacteria 2721755822 2724105797 329
233 iso_pu_bacteria 2721755823 2724111623 329
234 iso_pu_bacteria 2728369352 2730109208 329
235 iso_pu_bacteria 2728369365 2730165887 329
236 iso_pu_bacteria 2728369397 2730299781 329
237 iso_pu_bacteria 2738541293 2738804787 329
238 iso_pu_bacteria 2738541333 2739035518 329
239 iso_pu_bacteria 2751185800 2753357622 329
240 iso_pu_bacteria 2758568016 2758640119 329
241 iso_pu_bacteria 2765235942 2766065265 329
242 iso_pu_bacteria 2791355256 2793293567 329
243 iso_pu_bacteria 2791355259 2793313020 329
244 iso_pu_bacteria 2791355260 2793319667 329
245 iso_pu_bacteria 2791355262 2793333448 329
246 iso_pu_bacteria 2791355263 2793342031 329
247 iso_pu_bacteria 2791355264 2793347426 329
248 iso_pu_bacteria 2791355265 2793353757 329
249 iso_pu_bacteria 2791355266 2793359643 329
250 iso_pu_bacteria 2791355267 2793369393 329
251 iso_pu_bacteria 2802429605 2805929462 329
252 iso_pu_bacteria 2802429606 2805935357 329
253 iso_pu_bacteria 2802429633 2806044504 329
254 iso_pu_bacteria 2802429634 2806052705 329
255 iso_pu_bacteria 2802429635 2806059005 329
256 iso_pu_bacteria 2802429636 2806068332 329
257 iso_pu_bacteria 2802429637 2806074452 329
258 iso_pu_bacteria 2808606387 2808986923 329
259 iso_pu_bacteria 2818991439 2819557750 329
260 iso_pu_bacteria 2821123053 2821126219 329
261 iso_pu_bacteria 2838016132 2838019164 329
262 iso_pu_bacteria 2838022645 2838024245 329
263 iso_pu_bacteria 2838042994 2838047415 329
264 iso_pu_bacteria 2838048938 2838051117 329
265 iso_pu_bacteria 2838061910 2838063904 329
266 iso_pu_bacteria 2838068647 2838073389 329
267 iso_pu_bacteria 2838668709 2838671078 329
268 iso_pu_bacteria 2838675328 2838677728 329
269 iso_pu_bacteria 2838680041 2838684899 329
270 iso_pu_bacteria 2838686498 2838691262 329
271 iso_pu_bacteria 2838694306 2838699264 329
272 iso_pu_bacteria 2838701080 2838703743 329
273 iso_pu_bacteria 2838707686 2838712745 329
274 iso_pu_bacteria 2838714209 2838717367 329
275 iso_pu_bacteria 2838719591 2838722023 329
276 iso_pu_bacteria 2838724970 2838728116 329
277 iso_pu_bacteria 2838729681 2838735745 329
278 iso_pu_bacteria 2838736955 2838737306 329
279 iso_pu_bacteria 2838742623 2838748647 329
280 iso_pu_bacteria 2841840854 2841842325 329
281 iso_pu_bacteria 2841846520 2841849777 329
282 iso_pu_bacteria 2841851746 2841853918 329
283 iso_pu_bacteria 2841859092 2841864211 329
284 iso_pu_bacteria 2841864319 2841868114 329
285 iso_pu_bacteria 2842077413 2842082222 329
286 iso_pu_bacteria 2842110456 2842113377 329
287 iso_pu_bacteria 2842118031 2842123147 329
288 iso_pu_bacteria 2842124991 2842127475 329
289 iso_pu_bacteria 2842130223 2842132621 329
290 iso_pu_bacteria 2842140634 2842142104 329
291 iso_pu_bacteria 2842146304 2842151252 329
292 iso_pu_bacteria 2842152218 2842154615 329
293 iso_pu_bacteria 2842156927 2842162564 329
294 iso_pu_bacteria 2842163707 2842170008 329
295 iso_pu_bacteria 2842170452 2842173112 329
296 iso_pu_bacteria 2842175837 2842178235 329
297 iso_pu_bacteria 2842180545 2842185001 329
298 iso_pu_bacteria 2842187318 2842190474 329
299 iso_pu_bacteria 2842192696 2842198204 329
300 iso_pu_bacteria 2842198810 2842199787 329
301 iso_pu_bacteria 2842205361 2842208373 329
302 iso_pu_bacteria 2842211629 2842214788 329
303 iso_pu_bacteria 2842217011 2842220019 329
304 iso_pu_bacteria 2842224351 2842227509 329
305 iso_pu_bacteria 2842229732 2842235626 329
306 iso_pu_bacteria 2842237096 2842241953 329
307 iso_pu_bacteria 2842243621 2842249340 329
308 iso_pu_bacteria 2842250916 2842256308 329
309 iso_pu_bacteria 2842257432 2842263523 329
310 iso_pu_bacteria 2842264693 2842266664 329
311 iso_pu_bacteria 2842271015 2842275737 329
312 iso_pu_bacteria 2842278818 2842281618 329
313 iso_pu_bacteria 2842285085 2842288741 329
314 iso_pu_bacteria 2842291075 2842296223 329
315 iso_pu_bacteria 2842304105 2842308279 329
316 iso_pu_bacteria 2842311132 2842316440 329
317 iso_pu_bacteria 2842317721 2842321328 329
318 iso_pu_bacteria 2842341865 2842345066 329
319 iso_pu_bacteria 2842363717 2842369182 329
320 iso_pu_bacteria 2842370503 2842375575 329
321 iso_pu_bacteria 2842377471 2842382623 329
322 iso_pu_bacteria 2842384541 2842390024 329
323 iso_pu_bacteria 2842395702 2842398452 329
324 iso_pu_bacteria 2842402390 2842406592 329
325 iso_pu_bacteria 2842409023 2842412981 329
326 iso_pu_bacteria 2842415677 2842419624 329
327 iso_pu_bacteria 2842422224 2842427024 329
328 iso_pu_bacteria 2842428310 2842429983 329
329 iso_pu_bacteria 2842434925 2842436357 329
330 iso_pu_bacteria 2842441272 2842444060 329
331 iso_pu_bacteria 2842447887 2842451087 329
332 iso_pu_bacteria 2842462802 2842464404 329
333 iso_pu_bacteria 2842469257 2842470686 329
334 iso_pu_bacteria 2842489311 2842493335 329
335 iso_pu_bacteria 2842495871 2842499094 329
336 iso_pu_bacteria 2842515876 2842521042 329
337 iso_pu_bacteria 2844163670 2844166094 329
338 iso_pu_bacteria 2844454524 2844457436 329
339 iso_pu_bacteria 2854896431 2854897337 329
340 iso_pu_bacteria 2854911287 2854913436 329
341 iso_pu_bacteria 2854916844 2854921529 329
342 iso_pu_bacteria 2857516855 2857518845 329
343 iso_pu_bacteria 2857531043 2857532780 329
344 iso_pu_bacteria 2891373044 2891375627 329
345 iso_pu_bacteria 2899792073 2899793470 329
346 iso_pu_bacteria 2899845264 2899847671 329
347 iso_pu_bacteria 2919100787 2919104625 329
348 iso_pu_bacteria 2919114240 2919117633 329
349 iso_pu_bacteria 2919171160 2919173513 329
350 iso_pu_bacteria 2926754445 2926759070 329
351 iso_pu_bacteria 2926760298 2926763420 329
352 iso_pu_bacteria 2929138655 2929141115 329
353 iso_pu_bacteria 2933006813 2933010002 329
354 iso_pu_bacteria 2933011516 2933011546 329
355 iso_pu_bacteria 2933570622 2933574728 329
356 iso_pu_bacteria 2933594066 2933595966 329
357 iso_pu_bacteria 2933599457 2933603481 329
358 iso_pu_bacteria 2935894831 2935901224 329
359 iso_pu_bacteria 2935901341 2935907497 329
360 iso_pu_bacteria 2936367885 2936374813 329
361 iso_pu_bacteria 2936375103 2936380505 329
362 iso_pu_bacteria 2936381700 2936382327 329
363 iso_pu_bacteria 2939669807 2939670112 329
364 iso_pu_bacteria 2979089926 2979091547 329
365 iso_pu_bacteria 2979095461 2979097068 329
366 iso_pu_bacteria 2979100975 2979102790 329
367 iso_pu_bacteria 2984509177 2984509321 329
368 iso_pu_bacteria 2984518228 2984519979 329
369 iso_pu_bacteria 2984537506 2984537651 329
370 iso_pu_bacteria 2984601300 2984604399 329
371 iso_pu_bacteria 2989349275 2989350382 329
372 iso_pu_bacteria 2996887358 2996889265 329
373 iso_pu_bacteria 2996893221 2996894676 329
374 iso_pu_bacteria 3005452660 3005455636 329
375 iso_pu_bacteria 3005452660 3005457942 329
376 iso_pu_bacteria 639633055 639650052 329
377 iso_pu_bacteria 650716007 650842889 329
378 iso_pu_bacteria 8003570095 8003574411 329
379 iso_pu_bacteria 8005258706 8005264157 329
380 iso_pu_bacteria 8005275841 8005282070 329
381 iso_pu_bacteria 8005282627 8005285114 329
382 iso_pu_bacteria 8005289223 8005294209 329
383 iso_pu_bacteria 8005301065 8005306622 329
384 iso_pu_bacteria 8005307578 8005309444 329
385 iso_pu_bacteria 8005321885 8005323792 329
386 iso_pu_bacteria 8005376324 8005382730 329
387 iso_pu_bacteria 8005382845 8005383787 329
388 iso_pu_bacteria 8005430974 8005434067 329
389 iso_pu_bacteria 8005460587 8005464671 329
390 iso_pu_bacteria 8005497431 8005501720 329
391 iso_pu_bacteria 8005542996 8005547054 329
392 iso_pu_bacteria 8005556819 8005559109 329
393 iso_pu_bacteria 8005563573 8005566832 329
394 iso_pu_bacteria 8005570704 8005574890 329
395 iso_pu_bacteria 8005619151 8005623074 329
396 iso_pu_bacteria 8005626139 8005631618 329
397 iso_pu_bacteria 8005668836 8005673142 329
398 iso_pu_bacteria 8005688590 8005693682 329
399 iso_pu_bacteria 8005695170 8005700922 329
400 iso_pu_bacteria 8018127388 8018133561 329
401 iso_pu_bacteria 8018163183 8018170275 329
402 iso_pu_bacteria 8018176218 8018178410 329
403 iso_pu_bacteria 8023680758 8023687491 329
404 iso_pu_bacteria 8024479707 8024482007 329
405 iso_pu_bacteria 8024486573 8024486967 329
406 iso_pu_bacteria 8024501048 8024505881 329
407 iso_pu_bacteria 8056375014 8056381643 329
408 iso_pu_bacteria 8057874678 8057877047 329
409 3300046462 Ga0495651_0103046 Ga0495651_0103046_752_1750 330
410 3300048926 Ga0496123_0166873 Ga0496123_0166873_30_1034 330
411 iso_pu_bacteria 2511231027 2511391285 330
412 iso_pu_bacteria 2818991461 2819686492 330
413 iso_pu_bacteria 2842871566 2842875722 330
414 iso_pu_bacteria 2928521798 2928524844 330
415 iso_pu_bacteria 2954011201 2954011534 330
416 iso_pu_bacteria 2508501122 2509111012 331
417 iso_pu_bacteria 2509276019 2509379344 331
418 iso_pu_bacteria 2510065057 2510305736 331
419 iso_pu_bacteria 2511231052 2511497510 331
420 iso_pu_bacteria 2512047086 2512529958 331
421 iso_pu_bacteria 2512875026 2512969812 331
422 iso_pu_bacteria 2513237086 2513581887 331
423 iso_pu_bacteria 2513237089 2513603030 331
424 iso_pu_bacteria 2513237091 2513615301 331
425 iso_pu_bacteria 2513237140 2513884616 331
426 iso_pu_bacteria 2513237143 2513901386 331
427 iso_pu_bacteria 2513237144 2513908127 331
428 iso_pu_bacteria 2513237146 2513927003 331
429 iso_pu_bacteria 2513237160 2514004599 331
430 iso_pu_bacteria 2515154107 2515609787 331
431 iso_pu_bacteria 2516653046 2516896836 331
432 iso_pu_bacteria 2517487022 2517565308 331
433 iso_pu_bacteria 2524023207 2524451380 331
434 iso_pu_bacteria 2551306084 2551675489 331
435 iso_pu_bacteria 2551306085 2551688438 331
436 iso_pu_bacteria 2551306086 2551691905 331
437 iso_pu_bacteria 2551306087 2551701818 331
438 iso_pu_bacteria 2551306089 2551708395 331
439 iso_pu_bacteria 2551306090 2551720333 331
440 iso_pu_bacteria 2551306091 2551727215 331
441 iso_pu_bacteria 2551306093 2551744856 331
442 iso_pu_bacteria 2582581283 2585168088 331
443 iso_pu_bacteria 2599185170 2599420503 331
444 iso_pu_bacteria 2599185352 2600194423 331
445 iso_pu_bacteria 2643221557 2643809471 331
446 iso_pu_bacteria 2643221558 2643814620 331
447 iso_pu_bacteria 2643221607 2644048363 331
448 iso_pu_bacteria 2643221610 2644066867 331
449 iso_pu_bacteria 2643221636 2644201725 331
450 iso_pu_bacteria 2643221653 2644299297 331
451 iso_pu_bacteria 2643221668 2644375812 331
452 iso_pu_bacteria 2643221675 2644418070 331
453 iso_pu_bacteria 2643221680 2644451325 331
454 iso_pu_bacteria 2643221686 2644481165 331
455 iso_pu_bacteria 2643221689 2644500142 331
456 iso_pu_bacteria 2643221719 2644657525 331
457 iso_pu_bacteria 2643221723 2644673275 331
458 iso_pu_bacteria 2643221726 2644691670 331
459 iso_pu_bacteria 2718218233 2720621632 331
460 iso_pu_bacteria 2724679232 2725945409 331
461 iso_pu_bacteria 2775507049 2776914621 331
462 iso_pu_bacteria 2791355082 2792582062 331
463 iso_pu_bacteria 2791355091 2792623398 331
464 iso_pu_bacteria 2791355092 2792629286 331
465 iso_pu_bacteria 2791355253 2793280643 331
466 iso_pu_bacteria 2791355261 2793327834 331
467 iso_pu_bacteria 2802428858 2802716240 331
468 iso_pu_bacteria 2802428859 2802722722 331
469 iso_pu_bacteria 2802428860 2802729135 331
470 iso_pu_bacteria 2802428861 2802735527 331
471 iso_pu_bacteria 2802428862 2802741897 331
472 iso_pu_bacteria 2802428863 2802748348 331
473 iso_pu_bacteria 2818991272 2819243865 331
474 iso_pu_bacteria 2838074704 2838075740 331
475 iso_pu_bacteria 2850079185 2850084504 331
476 iso_pu_bacteria 2855825444 2855828342 331
477 iso_pu_bacteria 2855839649 2855843454 331
478 iso_pu_bacteria 2858800743 2858806278 331
479 iso_pu_bacteria 2891373044 2891377471 331
480 iso_pu_bacteria 2896384573 2896388193 331
481 iso_pu_bacteria 2915980308 2915984168 331
482 iso_pu_bacteria 2915986958 2915987826 331
483 iso_pu_bacteria 2915993759 2916000083 331
484 iso_pu_bacteria 2916000859 2916006018 331
485 iso_pu_bacteria 2916007675 2916013074 331
486 iso_pu_bacteria 2916014648 2916018938 331
487 iso_pu_bacteria 2916021584 2916024811 331
488 iso_pu_bacteria 2916028427 2916029380 331
489 iso_pu_bacteria 2916035215 2916037160 331
490 iso_pu_bacteria 2916041962 2916046056 331
491 iso_pu_bacteria 2916048683 2916050144 331
492 iso_pu_bacteria 2916055098 2916058855 331
493 iso_pu_bacteria 2916061851 2916068587 331
494 iso_pu_bacteria 2916068649 2916072128 331
495 iso_pu_bacteria 2916076590 2916082781 331
496 iso_pu_bacteria 2920760137 2920764303 331
497 iso_pu_bacteria 2920822456 2920826293 331
498 iso_pu_bacteria 2921201388 2921202277 331
499 iso_pu_bacteria 2921208531 2921214742 331
500 iso_pu_bacteria 2921237296 2921237829 331
501 iso_pu_bacteria 2921244191 2921247380 331
502 iso_pu_bacteria 2921250672 2921253400 331
503 iso_pu_bacteria 2921257292 2921259842 331
504 iso_pu_bacteria 2921263974 2921265323 331
505 iso_pu_bacteria 2921282425 2921282610 331
506 iso_pu_bacteria 2921289301 2921291329 331
507 iso_pu_bacteria 2921296804 2921301338 331
508 iso_pu_bacteria 2924144063 2924150169 331
509 iso_pu_bacteria 2924150972 2924155331 331
510 iso_pu_bacteria 2924158325 2924158582 331
511 iso_pu_bacteria 2924165586 2924168893 331
512 iso_pu_bacteria 2924172951 2924176347 331
513 iso_pu_bacteria 2924179722 2924186038 331
514 iso_pu_bacteria 2924186466 2924188333 331
515 iso_pu_bacteria 2924193448 2924198463 331
516 iso_pu_bacteria 2924200457 2924206075 331
517 iso_pu_bacteria 2924207177 2924210099 331
518 iso_pu_bacteria 2924214083 2924215718 331
519 iso_pu_bacteria 2924221636 2924226056 331
520 iso_pu_bacteria 2924228884 2924230684 331
521 iso_pu_bacteria 2936996657 2936996748 331
522 iso_pu_bacteria 2937002841 2937004758 331
523 iso_pu_bacteria 2937009748 2937013489 331
524 iso_pu_bacteria 2937016420 2937016732 331
525 iso_pu_bacteria 2937023124 2937026592 331
526 iso_pu_bacteria 2937029754 2937032303 331
527 iso_pu_bacteria 2937036028 2937038289 331
528 iso_pu_bacteria 2937042894 2937043899 331
529 iso_pu_bacteria 2937049772 2937052571 331
530 iso_pu_bacteria 2937056579 2937060135 331
531 iso_pu_bacteria 2937063883 2937067982 331
532 iso_pu_bacteria 2937071275 2937074262 331
533 iso_pu_bacteria 2937078374 2937081766 331
534 iso_pu_bacteria 2937084907 2937090359 331
535 iso_pu_bacteria 2937091812 2937098375 331
536 iso_pu_bacteria 2937098957 2937099102 331
537 iso_pu_bacteria 2937106411 2937108928 331
538 iso_pu_bacteria 2937113482 2937117336 331
539 iso_pu_bacteria 2937119839 2937122464 331
540 iso_pu_bacteria 2937126314 2937127314 331
541 iso_pu_bacteria 2957375807 2957377433 331
542 iso_pu_bacteria 2957382221 2957388275 331
543 iso_pu_bacteria 2957388812 2957392203 331
544 iso_pu_bacteria 2957395598 2957395820 331
545 iso_pu_bacteria 2957402308 2957402618 331
546 iso_pu_bacteria 2957408893 2957411098 331
547 iso_pu_bacteria 2957415311 2957417826 331
548 iso_pu_bacteria 2957422303 2957425185 331
549 iso_pu_bacteria 2957430029 2957434154 331
550 iso_pu_bacteria 2957437181 2957441051 331
551 iso_pu_bacteria 2957443900 2957444136 331
552 iso_pu_bacteria 2957450854 2957456728 331
553 iso_pu_bacteria 2957457609 2957458933 331
554 iso_pu_bacteria 2957464669 2957466962 331
555 iso_pu_bacteria 2957471148 2957472869 331
556 iso_pu_bacteria 2957478035 2957479223 331
557 iso_pu_bacteria 2957484790 2957486512 331
558 iso_pu_bacteria 2957491536 2957494951 331
559 iso_pu_bacteria 2957498199 2957502810 331
560 iso_pu_bacteria 2957505466 2957510048 331
561 iso_pu_bacteria 2960584000 2960588149 331
562 iso_pu_bacteria 2960591022 2960596727 331
563 iso_pu_bacteria 2960597568 2960599602 331
564 iso_pu_bacteria 2960603979 2960606959 331
565 iso_pu_bacteria 2960610863 2960614447 331
566 iso_pu_bacteria 2960617483 2960619301 331
567 iso_pu_bacteria 2960624210 2960628261 331
568 iso_pu_bacteria 2960631154 2960637681 331
569 iso_pu_bacteria 2960637947 2960645397 331
570 iso_pu_bacteria 2960645483 2960648857 331
571 iso_pu_bacteria 2960652885 2960652894 331
572 iso_pu_bacteria 2960660292 2960662543 331
573 iso_pu_bacteria 2960667422 2960669272 331
574 iso_pu_bacteria 2960674078 2960678753 331
575 iso_pu_bacteria 2960680706 2960684801 331
576 iso_pu_bacteria 2960687367 2960688967 331
577 iso_pu_bacteria 2964607997 2964608445 331
578 iso_pu_bacteria 2964615318 2964617274 331
579 iso_pu_bacteria 2964621998 2964622191 331
580 iso_pu_bacteria 2964628898 2964630757 331
581 iso_pu_bacteria 2964636051 2964640350 331
582 iso_pu_bacteria 2964643177 2964647543 331
583 iso_pu_bacteria 2964649959 2964652017 331
584 iso_pu_bacteria 2964656573 2964658511 331
585 iso_pu_bacteria 2964663802 2964668697 331
586 iso_pu_bacteria 2964670856 2964673814 331
587 iso_pu_bacteria 2964678106 2964680119 331
588 iso_pu_bacteria 2964685014 2964687518 331
589 iso_pu_bacteria 2964691889 2964693421 331
590 iso_pu_bacteria 2964698721 2964703842 331
591 iso_pu_bacteria 2964705432 2964707298 331
592 iso_pu_bacteria 2964712639 2964716002 331
593 iso_pu_bacteria 2964719344 2964720110 331
594 iso_pu_bacteria 2967664464 2967669129 331
595 iso_pu_bacteria 2967671571 2967674183 331
596 iso_pu_bacteria 2967678726 2967682327 331
597 iso_pu_bacteria 2967686174 2967689009 331
598 iso_pu_bacteria 2967693043 2967694736 331
599 iso_pu_bacteria 2967699805 2967706366 331
600 iso_pu_bacteria 2967706974 2967710834 331
601 iso_pu_bacteria 2967714385 2967718101 331
602 iso_pu_bacteria 2967721400 2967723947 331
603 iso_pu_bacteria 2967728569 2967734524 331
604 iso_pu_bacteria 2967735183 2967738596 331
605 iso_pu_bacteria 2967742019 2967746565 331
606 iso_pu_bacteria 2967748971 2967753371 331
607 iso_pu_bacteria 2967755722 2967761440 331
608 iso_pu_bacteria 2967762386 2967766177 331
609 iso_pu_bacteria 2967769361 2967774888 331
610 iso_pu_bacteria 2967775926 2967779397 331
611 iso_pu_bacteria 2970019648 2970023194 331
612 iso_pu_bacteria 2970026789 2970028427 331
613 iso_pu_bacteria 2970033650 2970034846 331
614 iso_pu_bacteria 2970040964 2970043882 331
615 iso_pu_bacteria 2970047711 2970048065 331
616 iso_pu_bacteria 2970054988 2970055211 331
617 iso_pu_bacteria 2970061556 2970064124 331
618 iso_pu_bacteria 2970068827 2970070133 331
619 iso_pu_bacteria 2970076120 2970079868 331
620 iso_pu_bacteria 2970082768 2970083037 331
621 iso_pu_bacteria 2970088815 2970094948 331
622 iso_pu_bacteria 2970095765 2970102468 331
623 iso_pu_bacteria 2970102677 2970104945 331
624 iso_pu_bacteria 2970109326 2970109582 331
625 iso_pu_bacteria 2970116247 2970118762 331
626 iso_pu_bacteria 2970122695 2970124928 331
627 iso_pu_bacteria 2970129317 2970132583 331
628 iso_pu_bacteria 2970136068 2970140190 331
629 iso_pu_bacteria 2970143518 2970148335 331
630 iso_pu_bacteria 2970149975 2970150029 331
631 iso_pu_bacteria 2970156795 2970161005 331
632 iso_pu_bacteria 2970164137 2970166203 331
633 iso_pu_bacteria 2970170962 2970172820 331
634 iso_pu_bacteria 2970177841 2970184028 331
635 iso_pu_bacteria 2970184632 2970184864 331
636 iso_pu_bacteria 2970191845 2970195157 331
637 iso_pu_bacteria 2977516862 2977522076 331
638 iso_pu_bacteria 2977523885 2977526899 331
639 iso_pu_bacteria 2977530762 2977533099 331
640 iso_pu_bacteria 2977537788 2977538279 331
641 iso_pu_bacteria 2977544691 2977546171 331
642 iso_pu_bacteria 2977551784 2977554069 331
643 iso_pu_bacteria 2977558990 2977565259 331
644 iso_pu_bacteria 2977565890 2977568002 331
645 iso_pu_bacteria 2977572785 2977572893 331
646 iso_pu_bacteria 2977579622 2977581791 331
647 iso_pu_bacteria 2989349275 2989354591 331
648 iso_pu_bacteria 2989771324 2989775196 331
649 iso_pu_bacteria 2989776772 2989780402 331
650 iso_pu_bacteria 3005409236 3005415428 331
651 iso_pu_bacteria 3005445848 3005449332 331
652 iso_pu_bacteria 643692032 643823356 331
653 iso_pu_bacteria 648276728 648739772 331
654 iso_pu_bacteria 8003992118 8003996031 331
655 iso_pu_bacteria 8003999396 8004003790 331
656 iso_pu_bacteria 8005246636 8005249509 331
657 iso_pu_bacteria 8005395548 8005401113 331
658 iso_pu_bacteria 8018150411 8018152089 331
659 iso_pu_bacteria 8049293176 8049296090 331
660 iso_pu_bacteria 8056382006 8056387080 331
661 3300013105 Ga0157369_10155347 Ga0157369_101553471 332
662 3300017792 Ga0163161_10295066 Ga0163161_102950662 332
663 3300028577 Ga0265318_10030678 Ga0265318_100306781 332
664 3300031247 Ga0265340_10018114 Ga0265340_100181142 332
665 3300031247 Ga0265340_10034019 Ga0265340_100340192 332
666 3300031249 Ga0265339_10033081 Ga0265339_100330812 332
667 3300031344 Ga0265316_10016672 Ga0265316_100166722 332
668 3300031595 Ga0265313_10008172 Ga0265313_100081725 332
669 3300031711 Ga0265314_10062963 Ga0265314_100629632 332
670 3300031712 Ga0265342_10015031 Ga0265342_100150313 332
671 3300032004 Ga0307414_10128114 Ga0307414_101281142 332
672 3300049570 Ga0501033_0000361 Ga0501033_0000361_37050_38054 332
673 3300049583 Ga0501067_0091524 Ga0501067_0091524_281_1282 332
674 3300049590 Ga0501074_0281648 Ga0501074_0281648_160_1161 332
675 3300049744 Ga0501083_0055471 Ga0501083_0055471_742_1743 332
676 3300049744 Ga0501083_0174984 Ga0501083_0174984_161_1162 332
677 3300049822 Ga0501035_0021342 Ga0501035_0021342_649_1653 332
678 3300060353 Ga0501082_0090721 Ga0501082_0090721_1264_2265 332
679 3300060353 Ga0501082_0134700 Ga0501082_0134700_335_1336 332
680 iso_pu_bacteria 2582581308 2585280256 332
681 iso_pu_bacteria 2582581315 2585322533 332
682 iso_pu_bacteria 2585427527 2585532485 332
683 iso_pu_bacteria 2585427530 2585554498 332
684 iso_pu_bacteria 2585427608 2585898981 332
685 iso_pu_bacteria 2615840626 2616307444 332
686 iso_pu_bacteria 2617270742 2617383443 332
687 iso_pu_bacteria 2667528174 2671112236 332
688 iso_pu_bacteria 2775507266 2778176055 332
689 iso_pu_bacteria 2818991453 2819639655 332
690 iso_pu_bacteria 2838029111 2838033176 332
691 iso_pu_bacteria 2842475841 2842479909 332
692 iso_pu_bacteria 2842502639 2842507085 332
693 iso_pu_bacteria 2852387548 2852391269 332
694 iso_pu_bacteria 8005484373 8005488448 332
695 iso_pu_bacteria 8005682033 8005682156 332
696 iso_pu_bacteria 8046767195 8046773175 332
697 iso_pu_bacteria 8054460903 8054465265 332
698 iso_pu_bacteria 8057575449 8057581088 332
699 3300002773 JGI25152J39213_1001181 JGI25152J39213_10011814 333
700 3300002773 JGI25152J39213_1002964 JGI25152J39213_10029643 333
701 3300002773 JGI25152J39213_1007241 JGI25152J39213_10072413 333
702 3300002773 JGI25152J39213_1016687 JGI25152J39213_10166872 333
703 3300002774 JGI25150J39212_1000063 JGI25150J39212_100006346 333
704 3300002774 JGI25150J39212_1005441 JGI25150J39212_10054412 333
705 3300002774 JGI25150J39212_1006207 JGI25150J39212_10062072 333
706 3300002774 JGI25150J39212_1014882 JGI25150J39212_10148821 333
707 3300003187 JGI25151J46595_10000140 JGI25151J46595_1000014079 333
708 3300003187 JGI25151J46595_10001756 JGI25151J46595_100017563 333
709 3300003215 JGI25153J46596_10019404 JGI25153J46596_100194042 333
710 3300003215 JGI25153J46596_10041665 JGI25153J46596_100416652 333
711 3300003354 JGI25160J50197_1001914 JGI25160J50197_10019143 333
712 3300003354 JGI25160J50197_1017789 JGI25160J50197_10177892 333
713 3300003374 JGI25161J50226_1001626 JGI25161J50226_10016262 333
714 3300003771 Ga0055526_1008634 Ga0055526_10086344 333
715 3300003771 Ga0055526_1009413 Ga0055526_10094133 333
716 3300003771 Ga0055526_1016484 Ga0055526_10164843 333
717 3300003771 Ga0055526_1025675 Ga0055526_10256752 333
718 3300003775 Ga0055524_1000790 Ga0055524_100079013 333
719 3300003775 Ga0055524_1005331 Ga0055524_10053312 333
720 3300003790 Ga0055528_1000548 Ga0055528_100054823 333
721 3300003790 Ga0055528_1000886 Ga0055528_100088617 333
722 3300003790 Ga0055528_1005173 Ga0055528_10051733 333
723 3300003792 Ga0055540_1000548 Ga0055540_10005488 333
724 3300004625 Ga0055543_1001407 Ga0055543_10014072 333
725 3300005262 Ga0065165_1005489 Ga0065165_10054892 333
726 3300005289 Ga0065704_10033657 Ga0065704_100336572 333
727 3300005331 Ga0070670_100002696 Ga0070670_10000269611 333
728 3300005347 Ga0070668_100038532 Ga0070668_1000385323 333
729 3300005353 Ga0070669_100279631 Ga0070669_1002796311 333
730 3300005355 Ga0070671_100042038 Ga0070671_1000420382 333
731 3300005548 Ga0070665_100313075 Ga0070665_1003130752 333
732 3300006038 Ga0075365_10000600 Ga0075365_100006003 333
733 3300006038 Ga0075365_10007867 Ga0075365_100078673 333
734 3300006048 Ga0075363_100095763 Ga0075363_1000957632 333
735 3300006177 Ga0075362_10002533 Ga0075362_100025334 333
736 3300006178 Ga0075367_10019332 Ga0075367_100193322 333
737 3300006186 Ga0075369_10006833 Ga0075369_100068333 333
738 3300006186 Ga0075369_10009672 Ga0075369_100096723 333
739 3300006195 Ga0075366_10017993 Ga0075366_100179932 333
740 3300006353 Ga0075370_10000839 Ga0075370_100008398 333
741 3300006946 Ga0079104_1000042 Ga0079104_100004234 333
742 3300009177 Ga0105248_10052789 Ga0105248_100527892 333
743 3300009765 Ga0123341_1000015 Ga0123341_100001517 333
744 3300009765 Ga0123341_1043929 Ga0123341_10439292 333
745 3300009766 Ga0123342_1003064 Ga0123342_10030646 333
746 3300009766 Ga0123342_1008248 Ga0123342_10082487 333
747 3300025245 Ga0207425_1000080 Ga0207425_100008079 333
748 3300025245 Ga0207425_1002325 Ga0207425_10023256 333
749 3300025245 Ga0207425_1009181 Ga0207425_10091812 333
750 3300025245 Ga0207425_1022926 Ga0207425_10229262 333
751 3300025258 Ga0209129_1000195 Ga0209129_100019522 333
752 3300025258 Ga0209129_1002007 Ga0209129_10020073 333
753 3300025258 Ga0209129_1003568 Ga0209129_10035683 333
754 3300025258 Ga0209129_1003611 Ga0209129_10036114 333
755 3300025258 Ga0209129_1005580 Ga0209129_10055802 333
756 3300025273 Ga0209673_1000037 Ga0209673_100003788 333
757 3300025273 Ga0209673_1000320 Ga0209673_100032016 333
758 3300025273 Ga0209673_1000880 Ga0209673_100088027 333
759 3300025273 Ga0209673_1000924 Ga0209673_100092421 333
760 3300025273 Ga0209673_1004391 Ga0209673_10043914 333
761 3300025273 Ga0209673_1011468 Ga0209673_10114682 333
762 3300025284 Ga0209130_1011944 Ga0209130_10119442 333
763 3300025291 Ga0209675_1015513 Ga0209675_10155132 333
764 3300025294 Ga0209025_1000332 Ga0209025_100033279 333
765 3300025294 Ga0209025_1000354 Ga0209025_100035418 333
766 3300025294 Ga0209025_1007212 Ga0209025_10072126 333
767 3300025294 Ga0209025_1017809 Ga0209025_10178092 333
768 3300025294 Ga0209025_1051272 Ga0209025_10512721 333
769 3300025294 Ga0209025_1059426 Ga0209025_10594262 333
770 3300025294 Ga0209025_1070635 Ga0209025_10706352 333
771 3300025295 Ga0209564_1000345 Ga0209564_100034516 333
772 3300025295 Ga0209564_1001903 Ga0209564_100190318 333
773 3300025295 Ga0209564_1009432 Ga0209564_10094321 333
774 3300025297 Ga0209758_1000263 Ga0209758_100026379 333
775 3300025297 Ga0209758_1001323 Ga0209758_100132319 333
776 3300025297 Ga0209758_1001789 Ga0209758_100178910 333
777 3300025297 Ga0209758_1002280 Ga0209758_10022804 333
778 3300025297 Ga0209758_1002342 Ga0209758_10023424 333
779 3300025297 Ga0209758_1008256 Ga0209758_10082563 333
780 3300025299 Ga0209256_1000343 Ga0209256_100034369 333
781 3300025299 Ga0209256_1000348 Ga0209256_100034854 333
782 3300025299 Ga0209256_1003669 Ga0209256_10036692 333
783 3300025299 Ga0209256_1012405 Ga0209256_10124052 333
784 3300025302 Ga0207426_1000296 Ga0207426_100029618 333
785 3300025302 Ga0207426_1002918 Ga0207426_10029188 333
786 3300025303 Ga0209051_1000236 Ga0209051_100023640 333
787 3300025303 Ga0209051_1009994 Ga0209051_10099943 333
788 3300025303 Ga0209051_1010221 Ga0209051_10102215 333
789 3300025304 Ga0209257_1004486 Ga0209257_10044868 333
790 3300025925 Ga0207650_10001919 Ga0207650_100019195 333
791 3300025941 Ga0207711_10105120 Ga0207711_101051202 333
792 3300025972 Ga0207668_10020566 Ga0207668_100205664 333
793 3300026067 Ga0207678_10110034 Ga0207678_101100342 333
794 3300026067 Ga0207678_10186721 Ga0207678_101867212 333
795 3300027111 Ga0209281_1000194 Ga0209281_100019434 333
796 3300028379 Ga0268266_10313451 Ga0268266_103134512 333
797 3300028379 Ga0268266_10412311 Ga0268266_104123112 333
798 3300028794 Ga0307515_10093119 Ga0307515_100931193 333
799 3300028794 Ga0307515_10151926 Ga0307515_101519262 333
800 3300031456 Ga0307513_10003087 Ga0307513_1000308716 333
801 3300031456 Ga0307513_10003471 Ga0307513_1000347117 333
802 3300031730 Ga0307516_10016649 Ga0307516_100166494 333
803 3300031731 Ga0307405_10001367 Ga0307405_1000136712 333
804 3300031901 Ga0307406_10023570 Ga0307406_100235701 333
805 3300031911 Ga0307412_10004368 Ga0307412_100043687 333
806 3300037471 Ga0395905_0001828 Ga0395905_0001828_1859_2878 333
807 3300041404 Ga0439436_0025655 Ga0439436_0025655_365_1393 333
808 3300041406 Ga0439439_0012905 Ga0439439_0012905_284_1312 333
809 3300041413 Ga0439465_0008881 Ga0439465_0008881_2005_3033 333
810 3300041441 Ga0451787_487060 Ga0451787_487060_842_1846 333
811 3300041458 Ga0451798_0290064 Ga0451798_0290064_697_1701 333
812 3300041496 Ga0451839_1092244 Ga0451839_1092244_552_1556 333
813 3300042007 Ga0439449_0044724 Ga0439449_0044724_47_1075 333
814 3300042435 Ga0439434_0030723 Ga0439434_0030723_465_1493 333
815 3300046474 Ga0495605_0014574 Ga0495605_0014574_2724_3728 333
816 3300046492 Ga0495585_0047769 Ga0495585_0047769_1093_2097 333
817 3300046492 Ga0495585_0082527 Ga0495585_0082527_307_1308 333
818 3300046506 Ga0495583_0022293 Ga0495583_0022293_1218_2219 333
819 3300046507 Ga0495606_0002219 Ga0495606_0002219_18757_19788 333
820 3300046507 Ga0495606_0013151 Ga0495606_0013151_175_1179 333
821 3300046512 Ga0495610_0006787 Ga0495610_0006787_459_1472 333
822 3300046512 Ga0495610_0012381 Ga0495610_0012381_3353_4357 333
823 3300046512 Ga0495610_0087136 Ga0495610_0087136_165_1169 333
824 3300046515 Ga0495620_0039077 Ga0495620_0039077_379_1383 333
825 3300046519 Ga0495632_0006479 Ga0495632_0006479_2188_3201 333
826 3300046519 Ga0495632_0014663 Ga0495632_0014663_2869_3873 333
827 3300046524 Ga0495648_0076014 Ga0495648_0076014_289_1293 333
828 3300046538 Ga0495609_0017098 Ga0495609_0017098_139_1143 333
829 3300046542 Ga0495597_0086343 Ga0495597_0086343_56_1060 333
830 3300046558 Ga0495633_0008943 Ga0495633_0008943_593_1597 333
831 3300046558 Ga0495633_0063371 Ga0495633_0063371_414_1442 333
832 3300046615 Ga0495656_0007577 Ga0495656_0007577_2233_3234 333
833 3300046616 Ga0495668_0065935 Ga0495668_0065935_315_1316 333
834 3300046660 Ga0495625_0041947 Ga0495625_0041947_1773_2777 333
835 3300046694 Ga0495649_0047454 Ga0495649_0047454_584_1588 333
836 3300046810 Ga0495660_0014687 Ga0495660_0014687_555_1559 333
837 3300047472 Ga0495686_0002643 Ga0495686_0002643_853_1857 333
838 3300047472 Ga0495686_0023395 Ga0495686_0023395_2428_3432 333
839 3300047472 Ga0495686_0044801 Ga0495686_0044801_1395_2408 333
840 3300047472 Ga0495686_0051091 Ga0495686_0051091_50_1054 333
841 3300048091 Ga0495626_0094034 Ga0495626_0094034_261_1265 333
842 3300048904 Ga0496101_0147835 Ga0496101_0147835_717_1721 333
843 3300048905 Ga0496102_0211453 Ga0496102_0211453_114_1118 333
844 3300048907 Ga0496104_0200868 Ga0496104_0200868_810_1814 333
845 3300048908 Ga0496105_0148638 Ga0496105_0148638_829_1833 333
846 3300048909 Ga0496106_0015899 Ga0496106_0015899_492_1496 333
847 3300048913 Ga0496110_0047664 Ga0496110_0047664_146_1147 333
848 3300048913 Ga0496110_0166737 Ga0496110_0166737_113_1117 333
849 3300048914 Ga0496111_0000570 Ga0496111_0000570_8243_9244 333
850 3300048919 Ga0496116_0005540 Ga0496116_0005540_89_1102 333
851 3300048919 Ga0496116_0012007 Ga0496116_0012007_6008_7021 333
852 3300048919 Ga0496116_0040317 Ga0496116_0040317_1981_2982 333
853 3300048919 Ga0496116_0051820 Ga0496116_0051820_1392_2396 333
854 3300048920 Ga0496117_0028194 Ga0496117_0028194_2960_3973 333
855 3300048920 Ga0496117_0083821 Ga0496117_0083821_314_1315 333
856 3300048920 Ga0496117_0091385 Ga0496117_0091385_708_1709 333
857 3300048921 Ga0496118_0010916 Ga0496118_0010916_7360_8364 333
858 3300048921 Ga0496118_0091661 Ga0496118_0091661_764_1765 333
859 3300048922 Ga0496119_0064058 Ga0496119_0064058_57_1058 333
860 3300048922 Ga0496119_0076320 Ga0496119_0076320_825_1829 333
861 3300048923 Ga0496120_0012085 Ga0496120_0012085_3837_4838 333
862 3300048924 Ga0496121_0000003 Ga0496121_0000003_665425_666426 333
863 3300048924 Ga0496121_0000180 Ga0496121_0000180_8891_9892 333
864 3300048924 Ga0496121_0056708 Ga0496121_0056708_92_1105 333
865 3300048924 Ga0496121_0065712 Ga0496121_0065712_1845_2858 333
866 3300048924 Ga0496121_0091542 Ga0496121_0091542_505_1536 333
867 3300048924 Ga0496121_0128317 Ga0496121_0128317_772_1776 333
868 3300048924 Ga0496121_0172481 Ga0496121_0172481_124_1128 333
869 3300048925 Ga0496122_0000107 Ga0496122_0000107_95164_96165 333
870 3300048925 Ga0496122_0049824 Ga0496122_0049824_41_1054 333
871 3300048925 Ga0496122_0062614 Ga0496122_0062614_439_1440 333
872 3300048925 Ga0496122_0065454 Ga0496122_0065454_218_1219 333
873 3300048925 Ga0496122_0096660 Ga0496122_0096660_64_1068 333
874 3300048925 Ga0496122_0128951 Ga0496122_0128951_41_1054 333
875 3300048926 Ga0496123_0000063 Ga0496123_0000063_96944_97945 333
876 3300048926 Ga0496123_0020993 Ga0496123_0020993_283_1296 333
877 3300048926 Ga0496123_0031131 Ga0496123_0031131_2439_3440 333
878 3300048926 Ga0496123_0046162 Ga0496123_0046162_1853_2866 333
879 3300048926 Ga0496123_0064470 Ga0496123_0064470_235_1236 333
880 3300048927 Ga0496124_0003986 Ga0496124_0003986_3499_4512 333
881 3300048927 Ga0496124_0010962 Ga0496124_0010962_7685_8686 333
882 3300048927 Ga0496124_0018448 Ga0496124_0018448_4980_5981 333
883 3300048927 Ga0496124_0118612 Ga0496124_0118612_463_1467 333
884 3300048927 Ga0496124_0120742 Ga0496124_0120742_967_1971 333
885 3300048927 Ga0496124_0140989 Ga0496124_0140989_695_1699 333
886 3300048927 Ga0496124_0149069 Ga0496124_0149069_108_1121 333
887 3300048927 Ga0496124_0206491 Ga0496124_0206491_409_1410 333
888 3300048927 Ga0496124_0295217 Ga0496124_0295217_82_1098 333
889 3300048928 Ga0496125_0000262 Ga0496125_0000262_74720_75721 333
890 3300048928 Ga0496125_0000477 Ga0496125_0000477_50341_51345 333
891 3300048928 Ga0496125_0003888 Ga0496125_0003888_13126_14139 333
892 3300048928 Ga0496125_0084817 Ga0496125_0084817_953_1957 333
893 3300048928 Ga0496125_0104148 Ga0496125_0104148_466_1470 333
894 3300048929 Ga0496126_0123891 Ga0496126_0123891_467_1471 333
895 3300048929 Ga0496126_0145353 Ga0496126_0145353_348_1361 333
896 3300049459 Ga0495678_028523 Ga0495678_028523_79_1092 333
897 3300049568 Ga0501031_0054122 Ga0501031_0054122_892_1911 333
898 3300049569 Ga0501032_0079944 Ga0501032_0079944_964_1968 333
899 3300049570 Ga0501033_0218368 Ga0501033_0218368_115_1122 333
900 3300049571 Ga0501034_0096196 Ga0501034_0096196_787_1794 333
901 3300049571 Ga0501034_0173063 Ga0501034_0173063_561_1568 333
902 3300049573 Ga0501037_0051215 Ga0501037_0051215_702_1706 333
903 3300049573 Ga0501037_0070049 Ga0501037_0070049_415_1434 333
904 3300049573 Ga0501037_0070716 Ga0501037_0070716_1132_2139 333
905 3300049575 Ga0501039_0101641 Ga0501039_0101641_165_1169 333
906 3300049579 Ga0501043_0098352 Ga0501043_0098352_185_1192 333
907 3300049581 Ga0501047_0030248 Ga0501047_0030248_662_1669 333
908 3300049581 Ga0501047_0244511 Ga0501047_0244511_549_1553 333
909 3300049586 Ga0501070_0051047 Ga0501070_0051047_1482_2489 333
910 3300049586 Ga0501070_0136494 Ga0501070_0136494_296_1300 333
911 3300049823 Ga0501044_0092425 Ga0501044_0092425_144_1148 333
912 3300049823 Ga0501044_0212875 Ga0501044_0212875_313_1320 333
913 3300050490 nmdc:mga03n38_57874_c1 nmdc:mga03n38_57874_c1_443_1447 333
914 3300050491 nmdc:mga00v17_337_c1 nmdc:mga00v17_337_c1_18301_19302 333
915 3300050492 nmdc:mga0yw44_9347_c2 nmdc:mga0yw44_9347_c2_2503_3507 333
916 3300050493 nmdc:mga0k408_7537_c1 nmdc:mga0k408_7537_c1_471_1475 333
917 3300050516 nmdc:mga0sz30_8054_c1 nmdc:mga0sz30_8054_c1_340_1344 333
918 3300053086 Ga0500578_0032372 Ga0500578_0032372_968_1972 333
919 3300053093 Ga0500651_0124156 Ga0500651_0124156_253_1257 333
920 3300053099 Ga0500654_068947 Ga0500654_068947_654_1658 333
921 3300053109 Ga0500569_001403 Ga0500569_001403_2989_3993 333
922 3300053118 Ga0500594_0023448 Ga0500594_0023448_273_1277 333
923 3300053125 Ga0500618_000109 Ga0500618_000109_17566_18567 333
924 3300053134 Ga0500658_0001045 Ga0500658_0001045_9673_10677 333
925 3300053134 Ga0500658_0047640 Ga0500658_0047640_373_1377 333
926 3300053135 Ga0500659_0099848 Ga0500659_0099848_270_1274 333
927 3300053139 Ga0500568_0020932 Ga0500568_0020932_1195_2199 333
928 3300053151 Ga0500604_0034151 Ga0500604_0034151_319_1323 333
929 3300053153 Ga0500616_0035606 Ga0500616_0035606_562_1566 333
930 3300053156 Ga0500622_0001743 Ga0500622_0001743_5614_6618 333
931 3300053156 Ga0500622_0005319 Ga0500622_0005319_408_1412 333
932 3300053158 Ga0500627_0014296 Ga0500627_0014296_1835_2839 333
933 iso_pu_bacteria 2558860100 2558861528 333
934 iso_pu_bacteria 2599185156 2599334701 333
935 iso_pu_bacteria 2643221599 2644006518 333
936 iso_pu_bacteria 2838035591 2838040825 333
937 iso_pu_bacteria 2838661181 2838664784 333
938 iso_pu_bacteria 2842922631 2842925825 333
939 iso_pu_bacteria 2899803654 2899805190 333
940 iso_pu_bacteria 2933016740 2933019917 333
941 iso_pu_bacteria 2933586486 2933589333 333
942 3300025284 Ga0209130_1013537 Ga0209130_10135372 334
943 3300031247 Ga0265340_10000794 Ga0265340_100007946 334
944 3300031249 Ga0265339_10011130 Ga0265339_100111304 334
945 3300031344 Ga0265316_10044429 Ga0265316_100444293 334
946 3300031456 Ga0307513_10053661 Ga0307513_100536612 334
947 3300031595 Ga0265313_10000371 Ga0265313_1000037134 334
948 3300031712 Ga0265342_10014444 Ga0265342_100144443 334
949 3300031730 Ga0307516_10138676 Ga0307516_101386762 334
950 3300037471 Ga0395905_0006179 Ga0395905_0006179_9544_10551 334
951 3300046460 Ga0495638_0190347 Ga0495638_0190347_33_1043 334
952 3300048920 Ga0496117_0185452 Ga0496117_0185452_150_1157 334
953 3300048921 Ga0496118_0046435 Ga0496118_0046435_492_1499 334
954 3300048925 Ga0496122_0036472 Ga0496122_0036472_437_1444 334
955 3300049568 Ga0501031_0021483 Ga0501031_0021483_2549_3556 334
956 3300049568 Ga0501031_0191332 Ga0501031_0191332_203_1210 334
957 3300049569 Ga0501032_0000013 Ga0501032_0000013_93719_94726 334
958 3300049569 Ga0501032_0226446 Ga0501032_0226446_54_1061 334
959 3300049570 Ga0501033_0000522 Ga0501033_0000522_3908_4915 334
960 3300049571 Ga0501034_0000054 Ga0501034_0000054_198101_199108 334
961 3300049572 Ga0501036_0000828 Ga0501036_0000828_19473_20480 334
962 3300049573 Ga0501037_0005064 Ga0501037_0005064_7842_8849 334
963 3300049574 Ga0501038_0000018 Ga0501038_0000018_150268_151275 334
964 3300049575 Ga0501039_0000152 Ga0501039_0000152_45689_46696 334
965 3300049579 Ga0501043_0000014 Ga0501043_0000014_11243_12250 334
966 3300049579 Ga0501043_0148584 Ga0501043_0148584_567_1574 334
967 3300049581 Ga0501047_0016929 Ga0501047_0016929_543_1550 334
968 3300049581 Ga0501047_0163998 Ga0501047_0163998_208_1221 334
969 3300049581 Ga0501047_0167105 Ga0501047_0167105_329_1336 334
970 3300049586 Ga0501070_0041228 Ga0501070_0041228_2109_3116 334
971 3300049741 Ga0501079_0199236 Ga0501079_0199236_303_1310 334
972 3300049822 Ga0501035_0000019 Ga0501035_0000019_43293_44300 334
973 3300049822 Ga0501035_0078684 Ga0501035_0078684_1432_2439 334
974 3300049824 Ga0501045_0190772 Ga0501045_0190772_440_1447 334
975 3300053111 Ga0500572_016677 Ga0500572_016677_336_1343 334
976 3300053125 Ga0500618_001997 Ga0500618_001997_1591_2595 334
977 3300053136 Ga0500559_0004001 Ga0500559_0004001_691_1698 334
978 3300053177 Ga0500636_0006275 Ga0500636_0006275_5090_6097 334
979 iso_pu_bacteria 2643221568 2643854223 334
980 iso_pu_bacteria 2842482326 2842483344 334
981 iso_pu_bacteria 2842509118 2842510782 334
982 iso_pu_bacteria 2919166419 2919168610 334
983 iso_pu_bacteria 2978969890 2978971297 334
984 iso_pu_bacteria 2984587000 2984588442 334
985 iso_pu_bacteria 8005314921 8005318668 334
986 3300002987 JGI25159J45721_1000626 JGI25159J45721_100062612 335
987 3300003187 JGI25151J46595_10013176 JGI25151J46595_100131762 335
988 3300003354 JGI25160J50197_1001017 JGI25160J50197_100101712 335
989 3300003374 JGI25161J50226_1001837 JGI25161J50226_10018374 335
990 3300003771 Ga0055526_1001694 Ga0055526_10016943 335
991 3300003775 Ga0055524_1001796 Ga0055524_10017963 335
992 3300003781 Ga0055536_1004141 Ga0055536_10041413 335
993 3300004625 Ga0055543_1000892 Ga0055543_10008923 335
994 3300005262 Ga0065165_1002701 Ga0065165_100270112 335
995 3300006946 Ga0079104_1003298 Ga0079104_10032986 335
996 3300013100 Ga0157373_10033005 Ga0157373_100330052 335
997 3300013249 Ga0171463_1022 Ga0171463_102212 335
998 3300015690 Ga0183363_1124 Ga0183363_112415 335
999 3300022739 Ga0228711_1000020 Ga0228711_100002064 335
1000 3300022740 Ga0228710_1000012 Ga0228710_100001292 335
1001 3300025208 Ga0209436_103526 Ga0209436_1035262 335
1002 3300025284 Ga0209130_1000079 Ga0209130_1000079125 335
1003 3300025292 Ga0209676_1015915 Ga0209676_10159152 335
1004 3300025294 Ga0209025_1000052 Ga0209025_1000052203 335
1005 3300025294 Ga0209025_1003632 Ga0209025_10036322 335
1006 3300025295 Ga0209564_1000869 Ga0209564_100086914 335
1007 3300025299 Ga0209256_1000310 Ga0209256_100031048 335
1008 3300025299 Ga0209256_1001088 Ga0209256_100108818 335
1009 3300025302 Ga0207426_1000167 Ga0207426_10001673 335
1010 3300025304 Ga0209257_1006024 Ga0209257_10060243 335
1011 3300027111 Ga0209281_1000138 Ga0209281_1000138146 335
1012 3300027111 Ga0209281_1000446 Ga0209281_10004462 335
1013 3300027666 Ga0209282_1000020 Ga0209282_1000020146 335
1014 3300031967 Ga0315914_1000031 Ga0315914_100003159 335
1015 3300033430 Ga0315913_1000010 Ga0315913_100001089 335
1016 3300033464 Ga0315915_1000007 Ga0315915_100000722 335
1017 3300035170 Ga0373943_0133380 Ga0373943_0133380_262_1272 335
1018 3300035692 Ga0373935_0024645 Ga0373935_0024645_2234_3244 335
1019 3300035695 Ga0373927_0000047 Ga0373927_0000047_34229_35239 335
1020 3300037068 Ga0373925_0001420 Ga0373925_0001420_2187_3197 335
1021 3300041413 Ga0439465_0015760 Ga0439465_0015760_372_1382 335
1022 3300046460 Ga0495638_0000591 Ga0495638_0000591_26173_27183 335
1023 3300046474 Ga0495605_0025162 Ga0495605_0025162_1279_2289 335
1024 3300046492 Ga0495585_0042765 Ga0495585_0042765_525_1535 335
1025 3300046506 Ga0495583_0018919 Ga0495583_0018919_990_2000 335
1026 3300046518 Ga0495631_0013351 Ga0495631_0013351_1035_2045 335
1027 3300046519 Ga0495632_0019658 Ga0495632_0019658_590_1600 335
1028 3300046524 Ga0495648_0072972 Ga0495648_0072972_588_1598 335
1029 3300046538 Ga0495609_0014234 Ga0495609_0014234_1062_2072 335
1030 3300046616 Ga0495668_0032402 Ga0495668_0032402_872_1882 335
1031 3300046648 Ga0495611_0028580 Ga0495611_0028580_1071_2081 335
1032 3300046660 Ga0495625_0016371 Ga0495625_0016371_3243_4253 335
1033 3300046810 Ga0495660_0031536 Ga0495660_0031536_325_1335 335
1034 3300048920 Ga0496117_0002458 Ga0496117_0002458_1208_2218 335
1035 3300048923 Ga0496120_0079917 Ga0496120_0079917_476_1486 335
1036 3300048925 Ga0496122_0000024 Ga0496122_0000024_156653_157663 335
1037 3300048926 Ga0496123_0000086 Ga0496123_0000086_80252_81262 335
1038 3300048927 Ga0496124_0001850 Ga0496124_0001850_14918_15928 335
1039 3300048928 Ga0496125_0000833 Ga0496125_0000833_11656_12666 335
1040 3300048929 Ga0496126_0000434 Ga0496126_0000434_13321_14331 335
1041 3300049459 Ga0495678_022082 Ga0495678_022082_677_1687 335
1042 3300053079 Ga0500610_0085237 Ga0500610_0085237_335_1345 335
1043 3300053086 Ga0500578_0085480 Ga0500578_0085480_414_1424 335
1044 3300053109 Ga0500569_013694 Ga0500569_013694_449_1459 335
1045 3300053118 Ga0500594_0004142 Ga0500594_0004142_1100_2110 335
1046 3300053131 Ga0500652_077096 Ga0500652_077096_133_1143 335
1047 3300053139 Ga0500568_0005458 Ga0500568_0005458_3569_4579 335
1048 3300001979 JGI24740J21852_10001156 JGI24740J21852_100011564 336
1049 3300002704 JGI25155J39150_1000012 JGI25155J39150_1000012111 336
1050 3300002705 JGI25156J39149_1000036 JGI25156J39149_100003670 336
1051 3300002737 JGI25162J39368_1000674 JGI25162J39368_10006745 336
1052 3300002738 JGI25154J39366_1000033 JGI25154J39366_100003362 336
1053 3300002741 JGI25157J39369_1000457 JGI25157J39369_100045723 336
1054 3300003214 JGI25165J46597_1000653 JGI25165J46597_10006538 336
1055 3300003214 JGI25165J46597_1000719 JGI25165J46597_100071910 336
1056 3300005616 Ga0068852_100083709 Ga0068852_1000837092 336
1057 3300009093 Ga0105240_10000019 Ga0105240_10000019116 336
1058 3300009545 Ga0105237_10004254 Ga0105237_1000425413 336
1059 3300010375 Ga0105239_10018520 Ga0105239_100185203 336
1060 3300013102 Ga0157371_10021215 Ga0157371_100212153 336
1061 3300013104 Ga0157370_10002915 Ga0157370_1000291514 336
1062 3300013105 Ga0157369_10106762 Ga0157369_101067623 336
1063 3300015265 Ga0182005_1007319 Ga0182005_10073192 336
1064 3300025206 Ga0209435_100005 Ga0209435_100005111 336
1065 3300025233 Ga0209437_100078 Ga0209437_100078137 336
1066 3300025246 Ga0209646_1000011 Ga0209646_1000011111 336
1067 3300025250 Ga0209026_1000008 Ga0209026_1000008111 336
1068 3300025253 Ga0209677_101144 Ga0209677_1011443 336
1069 3300025256 Ga0209759_1000004 Ga0209759_1000004111 336
1070 3300025261 Ga0209233_1000163 Ga0209233_1000163137 336
1071 3300025261 Ga0209233_1000299 Ga0209233_100029935 336
1072 3300025292 Ga0209676_1000093 Ga0209676_100009358 336
1073 3300025298 Ga0209050_1011010 Ga0209050_10110103 336
1074 3300025913 Ga0207695_10000049 Ga0207695_10000049118 336
1075 3300025914 Ga0207671_10000107 Ga0207671_1000010751 336
1076 3300026078 Ga0207702_10082609 Ga0207702_100826092 336
1077 3300028379 Ga0268266_10033214 Ga0268266_100332143 336
1078 3300046522 Ga0495643_0070462 Ga0495643_0070462_585_1598 336
1079 3300048919 Ga0496116_0000026 Ga0496116_0000026_434415_435428 336
1080 3300048921 Ga0496118_0046573 Ga0496118_0046573_1612_2625 336
1081 3300048925 Ga0496122_0099727 Ga0496122_0099727_811_1824 336
1082 3300048927 Ga0496124_0000091 Ga0496124_0000091_91033_92046 336
1083 3300048929 Ga0496126_0000059 Ga0496126_0000059_134108_135121 336
1084 iso_pu_bacteria 2738541317 2738944557 336
1085 iso_pu_bacteria 2913308742 2913309177 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

62

338

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5755 25 329
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5693 25 329
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5673 53 327
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5651 19 329
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5648 22 321
ID Description Score Start End Superfamily
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9407 51 326 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9407 51 326 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.934 51 326 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9339 51 326 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9297 51 326 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2S4JJN0-F1-model_v4 Ribose ABC transporter permease 0.9536 22 332 GO:0005886
GO:0022857
AF-A0A6I4G7W6-F1-model_v4 deleted 0.9511 24 336
AF-A0A202DX07-F1-model_v4 Ribose ABC transporter permease 0.9507 24 335 GO:0005886
GO:0022857
AF-A0A0S8DNU2-F1-model_v4 Sugar ABC transporter permease 0.9466 22 335 GO:0005886
GO:0022857
AF-A0A6I3Q8Z3-F1-model_v4 Ribose ABC transporter permease 0.9459 23 336 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
87.62 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map