F489573

General Info

Members Datasets Scaffolds Average Seq Length
1075 406 1019 366

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2521172590|2521560587
Length 396
Sequence RGHERWRGAIALCRARHRNKLYARGAGMSLQRPPLWQTIKPHLTVFDGALSLIVFLIVSVGIVTLYSAGMNFPGRVEDQLRNILVAFIIMWIAANVSPQLLLRLAVPVYTVGVTLLIAVALFGIIKKGSRRWLNIGMVVQPSEIMKIAMPLMLAWYFQKREGMLRWDAFLVAAILLLIPGFLIIRQPDLGTGLLVLAAGFYVIFFAGLPWKILLALFVAGAASLPVVWSFMHDYQRQRVMMLIDPTSDPLGKGFHIIQSTIAIGSGGITGKGWLMGTQTHLEFIPERTTDFIFSVYSEEFGLIGNIVLLVLYLLLIGRGLIITANAPTLFTRLLGGAITMIFFTYAFVNMGMVSGILPVVGVPLPFMSYGGTALVTLGLGAGILMSIQRHRKLVQS

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
6 2643221556 Massilia sp. Root1485 Isolate Unclassified
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2643221638 Duganella sp. Root336D2 Isolate Unclassified
9 2643221645 Massilia sp. Root351 Isolate Unclassified
10 2643221664 Massilia sp. Root418 Isolate Unclassified
11 2643221684 Massilia sp. Root133 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541297 Duganella sp. GV083 Isolate Unclassified
14 2738541300 Massilia sp. GV016 Isolate Unclassified
15 2738541357 Duganella sp. GV053 Isolate Unclassified
16 2738543003 Duganella sp. GV066 Isolate Unclassified
17 2738543018 Massilia sp. GV045 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
22 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
23 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
24 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
25 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
26 2818991436 Collimonas arenae 515 Isolate Unclassified
27 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
28 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
29 2818991450 Burkholderia sp. 604 Isolate Unclassified
30 2821131069 Duganella sp. 1224 Isolate Unclassified
31 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
32 2842711865 Duganella sp. R-73148 Isolate Unclassified
33 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
34 2857553236 Duganella sp. R-74557 Isolate Unclassified
35 2857558681 Duganella sp. R-74565 Isolate Unclassified
36 2857564685 Duganella sp. R-74599 Isolate Unclassified
37 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
38 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
39 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
40 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
41 2904424332 Duganella sp. 1411 Isolate Rhizosphere
42 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
43 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
44 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
45 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
46 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
47 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
48 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
49 2919476304 Duganella sp. 3397 Isolate Unclassified
50 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
51 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
52 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
53 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
54 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
57 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
58 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
59 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
62 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
65 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
69 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
70 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
73 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
74 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
75 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
76 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
77 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
78 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
79 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
85 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
91 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
101 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
102 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
103 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
104 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
117 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
130 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
131 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
135 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
161 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
162 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
180 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
260 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
261 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
334 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
335 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
336 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
337 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
343 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
344 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
345 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
350 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
351 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
352 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
358 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
359 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
367 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
381 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
382 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
383 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
384 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
392 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
393 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
394 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
395 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
403 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
404 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
405 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
406 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.77
Nodule 0.47
Rhizoplane 2.88
Rhizosphere 79.72
Stem 0
Stem Tuber 0
Unclassified 7.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001831 3300001989 Bacteria 8101
2 JGI24737J22298_10019259 3300001990 Bacteria 2184
3 JGI24735J21928_10019040 3300002067 Bacteria 2113
4 JGI25155J39150_1000140 3300002704 Bacteria 34372
5 JGI25155J39150_1000167 3300002704 Bacteria 29016
6 JGI25162J39368_1000023 3300002737 Bacteria 236658
7 JGI25162J39368_1005670 3300002737 Bacteria 2366
8 JGI25154J39366_1000372 3300002738 Bacteria 24998
9 JGI25154J39366_1000748 3300002738 Bacteria 14564
10 JGI25154J39366_1002151 3300002738 Bacteria 5515
11 JGI25157J39369_1000294 3300002741 Bacteria 36390
12 JGI25157J39369_1000325 3300002741 Bacteria 33856
13 JGI25152J39213_1000994 3300002773 Bacteria 13747
14 JGI25150J39212_1000726 3300002774 Bacteria 11704
15 JGI25150J39212_1000752 3300002774 Bacteria 11338
16 JGI25159J45721_1007516 3300002987 Bacteria 3115
17 JGI25159J45721_1017559 3300002987 Bacteria 1474
18 JGI25165J46597_1000030 3300003214 Bacteria 305254
19 rootH1_10086751 3300003316 Bacteria 3082
20 JGI25160J50197_1000548 3300003354 Bacteria 21264
21 JGI25161J50226_1000872 3300003374 Bacteria 11087
22 Ga0055538_1000017 3300003751 Bacteria 305254
23 Ga0055538_1000024 3300003751 Bacteria 241526
24 Ga0055539_1000022 3300003752 Bacteria 305254
25 Ga0055539_1000031 3300003752 Bacteria 241526
26 Ga0055533_1000030 3300003756 Bacteria 305254
27 Ga0055533_1000041 3300003756 Bacteria 241526
28 Ga0055532_1000074 3300003758 Bacteria 125513
29 Ga0055525_1000034 3300003759 Bacteria 305254
30 Ga0055525_1000049 3300003759 Bacteria 241526
31 Ga0055525_1000179 3300003759 Bacteria 78692
32 Ga0055542_1013195 3300003762 Bacteria 1399
33 Ga0055529_1000027 3300003763 Bacteria 292744
34 Ga0055526_1001365 3300003771 Bacteria 17475
35 Ga0055526_1001772 3300003771 Bacteria 14997
36 Ga0055526_1002513 3300003771 Bacteria 12337
37 Ga0055526_1004528 3300003771 Bacteria 8313
38 Ga0055537_1000172 3300003773 Bacteria 48382
39 Ga0055524_1000022 3300003775 Bacteria 224103
40 Ga0055524_1000049 3300003775 Bacteria 149383
41 Ga0055524_1001210 3300003775 Bacteria 15311
42 Ga0055524_1001582 3300003775 Bacteria 12767
43 Ga0055524_1002507 3300003775 Bacteria 9425
44 Ga0055534_1000169 3300003784 Bacteria 48382
45 Ga0055534_1001643 3300003784 Bacteria 8629
46 Ga0055528_1000482 3300003790 Bacteria 31599
47 Ga0055528_1000486 3300003790 Bacteria 31484
48 Ga0055528_1003257 3300003790 Bacteria 8273
49 Ga0055531_10004385 3300003794 Bacteria 8613
50 Ga0055541_1000015 3300003841 Bacteria 305254
51 Ga0055541_1000022 3300003841 Bacteria 241526
52 Ga0065165_1000882 3300005262 Bacteria 38756
53 Ga0065165_1004612 3300005262 Bacteria 8378
54 Ga0065165_1029628 3300005262 Bacteria 1751
55 Ga0065714_10024661 3300005288 Bacteria 1243
56 Ga0065715_10173908 3300005293 Bacteria 1526
57 Ga0070658_10076930 3300005327 Bacteria 2737
58 Ga0070658_10238587 3300005327 Bacteria 1540
59 Ga0070670_100001043 3300005331 Bacteria 21961
60 Ga0070670_100005639 3300005331 Bacteria 10563
61 Ga0070677_10000809 3300005333 Bacteria 10340
62 Ga0068869_100046178 3300005334 Bacteria 3140
63 Ga0070660_100044166 3300005339 Bacteria 3407
64 Ga0070660_100070378 3300005339 Bacteria 2730
65 Ga0070689_100012684 3300005340 Bacteria 6079
66 Ga0070661_100048867 3300005344 Bacteria 3097
67 Ga0070675_100197349 3300005354 Bacteria 1746
68 Ga0070674_100007079 3300005356 Bacteria 6594
69 Ga0070673_100022136 3300005364 Bacteria 4622
70 Ga0070673_100112224 3300005364 Bacteria 2262
71 Ga0070688_100026044 3300005365 Bacteria 3470
72 Ga0070659_100001264 3300005366 Bacteria 18358
73 Ga0070659_100051729 3300005366 Bacteria 3230
74 Ga0070659_100053621 3300005366 Bacteria 3174
75 Ga0070667_100115333 3300005367 Bacteria 2333
76 Ga0070667_100219511 3300005367 Bacteria 1692
77 Ga0070709_10062075 3300005434 Bacteria 2381
78 Ga0070713_100103012 3300005436 Bacteria 2476
79 Ga0070710_10040804 3300005437 Bacteria 2559
80 Ga0070701_10175462 3300005438 Bacteria 1251
81 Ga0070711_100007512 3300005439 Bacteria 6635
82 Ga0070694_100040466 3300005444 Bacteria 3107
83 Ga0070663_100108327 3300005455 Bacteria 2084
84 Ga0070678_100003601 3300005456 Bacteria 8641
85 Ga0070662_100008580 3300005457 Bacteria 6664
86 Ga0070685_10001242 3300005466 Bacteria 13532
87 Ga0070685_10154991 3300005466 Bacteria 1455
88 Ga0070706_100067702 3300005467 Bacteria 3303
89 Ga0070706_100326848 3300005467 Bacteria 1430
90 Ga0070707_100158560 3300005468 Bacteria 2204
91 Ga0070698_100198347 3300005471 Bacteria 1943
92 Ga0070699_100004479 3300005518 Bacteria 12356
93 Ga0070684_100037077 3300005535 Bacteria 4179
94 Ga0070697_100106790 3300005536 Bacteria 2329
95 Ga0070672_100008921 3300005543 Bacteria 6890
96 Ga0070696_100020672 3300005546 Bacteria 4461
97 Ga0070696_100045904 3300005546 Bacteria 3028
98 Ga0070693_100013520 3300005547 Bacteria 4159
99 Ga0070665_100049754 3300005548 Bacteria 4205
100 Ga0070665_100138353 3300005548 Bacteria 2438
101 Ga0068855_100004477 3300005563 Bacteria 17071
102 Ga0068855_100005723 3300005563 Bacteria 15175
103 Ga0068855_100033221 3300005563 Bacteria 6159
104 Ga0070664_100045233 3300005564 Bacteria 3718
105 Ga0068854_100009651 3300005578 Bacteria 6234
106 Ga0068854_100041525 3300005578 Bacteria 3250
107 Ga0068854_100119647 3300005578 Bacteria 1997
108 Ga0068856_100047465 3300005614 Bacteria 4230
109 Ga0068852_100041477 3300005616 Bacteria 3890
110 Ga0068864_100005652 3300005618 Bacteria 10253
111 Ga0068866_10001450 3300005718 Bacteria 10140
112 Ga0068870_10003957 3300005840 Bacteria 6328
113 Ga0068863_100003727 3300005841 Bacteria 15073
114 Ga0068858_100062410 3300005842 Bacteria 3445
115 Ga0075432_10056982 3300006058 Bacteria 1386
116 Ga0070715_10015827 3300006163 Bacteria 2820
117 Ga0070716_100009211 3300006173 Bacteria 4917
118 Ga0070712_100087600 3300006175 Bacteria 2272
119 Ga0070712_100160332 3300006175 Bacteria 1736
120 Ga0097621_100010542 3300006237 Bacteria 6768
121 Ga0097621_100197464 3300006237 Bacteria 1745
122 Ga0068871_100005239 3300006358 Bacteria 9073
123 Ga0068871_100023493 3300006358 Bacteria 4771
124 Ga0075434_100009206 3300006871 Bacteria 9203
125 Ga0075434_100367339 3300006871 Bacteria 1460
126 Ga0068865_100164266 3300006881 Bacteria 1696
127 Ga0099826_10000005 3300006948 Bacteria 465206
128 Ga0075435_100033662 3300007076 Bacteria 4054
129 Ga0105251_10000895 3300009011 Bacteria 26673
130 Ga0105244_10002568 3300009036 Bacteria 13635
131 Ga0105244_10009443 3300009036 Bacteria 5995
132 Ga0105240_10000718 3300009093 Bacteria 60617
133 Ga0105240_10002320 3300009093 Bacteria 30796
134 Ga0105240_10089082 3300009093 Bacteria 3775
135 Ga0105245_10069028 3300009098 Bacteria 3204
136 Ga0105243_10054586 3300009148 Bacteria 3173
137 Ga0105241_10086633 3300009174 Bacteria 2464
138 Ga0105241_10134519 3300009174 Bacteria 2005
139 Ga0105248_10125724 3300009177 Bacteria 2893
140 Ga0105237_10004756 3300009545 Bacteria 15613
141 Ga0105237_10354181 3300009545 Bacteria 1472
142 Ga0105238_10000107 3300009551 Bacteria 91765
143 Ga0105238_10032510 3300009551 Bacteria 5308
144 Ga0105239_10000289 3300010375 Bacteria 74109
145 Ga0105239_10124092 3300010375 Bacteria 2869
146 Ga0157371_10000153 3300013102 Bacteria 101298
147 Ga0157369_10196718 3300013105 Bacteria 2117
148 Ga0157374_10005077 3300013296 Bacteria 11039
149 Ga0157374_10268083 3300013296 Bacteria 1683
150 Ga0163162_10240864 3300013306 Bacteria 1940
151 Ga0157372_10154334 3300013307 Bacteria 2651
152 Ga0163163_10073735 3300014325 Bacteria 3404
153 Ga0163163_10198934 3300014325 Bacteria 2052
154 Ga0157379_10054036 3300014968 Bacteria 3589
155 Ga0182006_1000138 3300015261 Bacteria 78470
156 Ga0182006_1004867 3300015261 Bacteria 6513
157 Ga0182006_1059205 3300015261 Bacteria 1451
158 Ga0182007_10000169 3300015262 Bacteria 44843
159 Ga0182005_1000046 3300015265 Bacteria 138133
160 Ga0182005_1000207 3300015265 Bacteria 39631
161 Ga0163161_10033109 3300017792 Bacteria 3693
162 Ga0213872_10000065 3300021361 Bacteria 96648
163 Ga0213872_10000403 3300021361 Bacteria 35721
164 Ga0213872_10001325 3300021361 Bacteria 16383
165 Ga0213872_10019758 3300021361 Bacteria 3102
166 Ga0213872_10042999 3300021361 Bacteria 2059
167 Ga0213872_10045535 3300021361 Bacteria 1996
168 Ga0209435_100055 3300025206 Bacteria 86115
169 Ga0209435_100248 3300025206 Bacteria 14274
170 Ga0209760_102799 3300025207 Bacteria 1600
171 Ga0209436_100389 3300025208 Bacteria 19875
172 Ga0209436_100991 3300025208 Bacteria 10948
173 Ga0209436_106134 3300025208 Bacteria 2671
174 Ga0209784_100018 3300025224 Bacteria 456816
175 Ga0209784_100034 3300025224 Bacteria 305504
176 Ga0209566_100016 3300025225 Bacteria 456824
177 Ga0209566_100038 3300025225 Bacteria 305504
178 Ga0209674_100030 3300025226 Bacteria 456824
179 Ga0209674_100056 3300025226 Bacteria 305504
180 Ga0209147_100097 3300025229 Bacteria 164034
181 Ga0209563_100034 3300025230 Bacteria 456824
182 Ga0209563_100057 3300025230 Bacteria 305604
183 Ga0209563_100143 3300025230 Bacteria 78744
184 Ga0207427_100929 3300025231 Bacteria 12491
185 Ga0209437_100071 3300025233 Bacteria 305604
186 Ga0209437_100234 3300025233 Bacteria 92856
187 Ga0209258_100192 3300025242 Bacteria 125565
188 Ga0207425_1000013 3300025245 Bacteria 497384
189 Ga0207425_1000152 3300025245 Bacteria 59354
190 Ga0207425_1000675 3300025245 Bacteria 18625
191 Ga0209646_1000103 3300025246 Bacteria 164034
192 Ga0209646_1000120 3300025246 Bacteria 146035
193 Ga0209646_1000346 3300025246 Bacteria 34384
194 Ga0209026_1000134 3300025250 Bacteria 117098
195 Ga0209026_1003217 3300025250 Bacteria 5505
196 Ga0209026_1004565 3300025250 Bacteria 4065
197 Ga0209677_100019 3300025253 Bacteria 456824
198 Ga0209677_100035 3300025253 Bacteria 305504
199 Ga0209148_1000229 3300025254 Bacteria 91956
200 Ga0209759_1000091 3300025256 Bacteria 164034
201 Ga0209759_1000857 3300025256 Bacteria 23573
202 Ga0209129_1000152 3300025258 Bacteria 112977
203 Ga0209129_1014454 3300025258 Bacteria 1681
204 Ga0209233_1000094 3300025261 Bacteria 305604
205 Ga0209565_1000159 3300025263 Bacteria 90295
206 Ga0209565_1000671 3300025263 Bacteria 21657
207 Ga0209565_1001875 3300025263 Bacteria 8361
208 Ga0209565_1002041 3300025263 Bacteria 7773
209 Ga0209565_1003700 3300025263 Bacteria 4854
210 Ga0209455_1000033 3300025272 Bacteria 504606
211 Ga0209673_1000006 3300025273 Bacteria 650600
212 Ga0209130_1000425 3300025284 Bacteria 45376
213 Ga0209130_1000521 3300025284 Bacteria 38770
214 Ga0209675_1000005 3300025291 Bacteria 849192
215 Ga0209675_1001647 3300025291 Bacteria 12441
216 Ga0209675_1002204 3300025291 Bacteria 10209
217 Ga0209564_1000028 3300025295 Bacteria 510986
218 Ga0209564_1000154 3300025295 Bacteria 166849
219 Ga0209564_1000604 3300025295 Bacteria 56098
220 Ga0209564_1000774 3300025295 Bacteria 44427
221 Ga0209564_1005527 3300025295 Bacteria 7163
222 Ga0209564_1010725 3300025295 Bacteria 4181
223 Ga0209564_1030062 3300025295 Bacteria 1692
224 Ga0209758_1000031 3300025297 Bacteria 497252
225 Ga0209758_1000354 3300025297 Bacteria 83217
226 Ga0209050_1015337 3300025298 Bacteria 3225
227 Ga0209256_1000035 3300025299 Bacteria 386754
228 Ga0209256_1000040 3300025299 Bacteria 366839
229 Ga0209256_1000274 3300025299 Bacteria 90266
230 Ga0209256_1000414 3300025299 Bacteria 67073
231 Ga0209256_1000426 3300025299 Bacteria 66188
232 Ga0209256_1003215 3300025299 Bacteria 11799
233 Ga0207426_1001125 3300025302 Bacteria 24348
234 Ga0209257_1000157 3300025304 Bacteria 181004
235 Ga0207656_10003690 3300025321 Bacteria 5299
236 Ga0207656_10066502 3300025321 Bacteria 1593
237 Ga0207655_1003180 3300025728 Bacteria 12394
238 Ga0207655_1006901 3300025728 Bacteria 7452
239 Ga0207713_1000137 3300025735 Bacteria 111281
240 Ga0207682_10000890 3300025893 Bacteria 13840
241 Ga0207692_10149482 3300025898 Bacteria 1336
242 Ga0207647_10009500 3300025904 Bacteria 6905
243 Ga0207643_10005888 3300025908 Bacteria 6548
244 Ga0207643_10071845 3300025908 Bacteria 1993
245 Ga0207705_10000950 3300025909 Bacteria 23658
246 Ga0207705_10216202 3300025909 Bacteria 1454
247 Ga0207684_10081163 3300025910 Bacteria 2760
248 Ga0207654_10046094 3300025911 Bacteria 2485
249 Ga0207695_10001004 3300025913 Bacteria 49973
250 Ga0207695_10009358 3300025913 Bacteria 12115
251 Ga0207695_10053518 3300025913 Bacteria 4222
252 Ga0207695_10198968 3300025913 Bacteria 1919
253 Ga0207671_10001366 3300025914 Bacteria 28480
254 Ga0207693_10001364 3300025915 Bacteria 21632
255 Ga0207693_10177221 3300025915 Bacteria 1677
256 Ga0207657_10003005 3300025919 Bacteria 18068
257 Ga0207657_10003467 3300025919 Bacteria 16832
258 Ga0207657_10053529 3300025919 Bacteria 3496
259 Ga0207649_10071884 3300025920 Bacteria 2211
260 Ga0207649_10148807 3300025920 Bacteria 1610
261 Ga0207694_10000130 3300025924 Bacteria 77624
262 Ga0207650_10002315 3300025925 Bacteria 13271
263 Ga0207687_10117514 3300025927 Bacteria 1984
264 Ga0207664_10004770 3300025929 Bacteria 9213
265 Ga0207690_10005914 3300025932 Bacteria 7243
266 Ga0207690_10016991 3300025932 Bacteria 4436
267 Ga0207690_10182748 3300025932 Bacteria 1580
268 Ga0207706_10016465 3300025933 Bacteria 6673
269 Ga0207706_10030268 3300025933 Bacteria 4830
270 Ga0207706_10070192 3300025933 Bacteria 3081
271 Ga0207686_10000089 3300025934 Bacteria 74250
272 Ga0207670_10029481 3300025936 Bacteria 3496
273 Ga0207704_10022183 3300025938 Bacteria 3396
274 Ga0207665_10003701 3300025939 Bacteria 10215
275 Ga0207665_10113445 3300025939 Bacteria 1907
276 Ga0207691_10000050 3300025940 Bacteria 94763
277 Ga0207711_10002173 3300025941 Bacteria 17641
278 Ga0207689_10009449 3300025942 Bacteria 8419
279 Ga0207689_10145731 3300025942 Bacteria 1951
280 Ga0207661_10271960 3300025944 Bacteria 1512
281 Ga0207679_10018193 3300025945 Bacteria 4703
282 Ga0207667_10000110 3300025949 Bacteria 131872
283 Ga0207667_10003783 3300025949 Bacteria 18635
284 Ga0207640_10004306 3300025981 Bacteria 7706
285 Ga0207640_10023515 3300025981 Bacteria 3704
286 Ga0207640_10049762 3300025981 Bacteria 2715
287 Ga0207658_10051111 3300025986 Bacteria 3044
288 Ga0207677_10002574 3300026023 Bacteria 9530
289 Ga0207703_10005182 3300026035 Bacteria 10538
290 Ga0207639_10104150 3300026041 Bacteria 2300
291 Ga0207702_10068207 3300026078 Bacteria 3055
292 Ga0207702_10157009 3300026078 Bacteria 2074
293 Ga0207702_10337900 3300026078 Bacteria 1438
294 Ga0207641_10050383 3300026088 Bacteria 3522
295 Ga0207676_10000724 3300026095 Bacteria 25870
296 Ga0207674_10015863 3300026116 Bacteria 8258
297 Ga0207674_10134891 3300026116 Bacteria 2430
298 Ga0207675_100105461 3300026118 Bacteria 2657
299 Ga0207683_10000354 3300026121 Bacteria 42027
300 Ga0207698_10006700 3300026142 Bacteria 7196
301 Ga0207698_10068026 3300026142 Bacteria 2811
302 Ga0209282_1000003 3300027666 Bacteria 856377
303 Ga0268266_10004467 3300028379 Bacteria 13373
304 Ga0307515_10161474 3300028794 Bacteria 2283
305 Ga0316177_1076590 3300030731 Bacteria 7354
306 Ga0307408_100000129 3300031548 Bacteria 84251
307 Ga0307408_100000610 3300031548 Bacteria 30592
308 Ga0307408_100010855 3300031548 Bacteria 6010
309 Ga0307408_100038053 3300031548 Bacteria 3392
310 Ga0265314_10130552 3300031711 Bacteria 1568
311 Ga0307416_100001560 3300032002 Bacteria 12546
312 Ga0373953_0009991 3300035117 Bacteria 3289
313 Ga0373957_0001108 3300035120 Bacteria 7140
314 Ga0373943_0064581 3300035170 Bacteria 1838
315 Ga0373946_0009164 3300035171 Bacteria 3643
316 Ga0373946_0019393 3300035171 Bacteria 2620
317 Ga0373946_0072796 3300035171 Bacteria 1488
318 Ga0373955_0103082 3300035172 Bacteria 1640
319 Ga0373924_0000823 3300035410 Bacteria 9697
320 Ga0373935_0030544 3300035692 Bacteria 3340
321 Ga0373935_0046764 3300035692 Bacteria 2734
322 Ga0373927_0009403 3300035695 Bacteria 6554
323 Ga0373927_0050150 3300035695 Bacteria 2698
324 Ga0373933_0015560 3300035724 Bacteria 4242
325 Ga0373933_0036399 3300035724 Bacteria 2880
326 Ga0373937_0013227 3300036401 Bacteria 7268
327 Ga0373937_0060564 3300036401 Bacteria 3478
328 Ga0373925_0023825 3300037068 Bacteria 4465
329 Ga0373925_0038533 3300037068 Bacteria 3534
330 Ga0395899_0000085 3300037312 Bacteria 159118
331 Ga0395899_0004514 3300037312 Bacteria 10849
332 Ga0395899_0007052 3300037312 Bacteria 8695
333 Ga0395899_0010060 3300037312 Bacteria 7252
334 Ga0395899_0011675 3300037312 Bacteria 6723
335 Ga0395899_0014276 3300037312 Bacteria 6064
336 Ga0395899_0024078 3300037312 Bacteria 4606
337 Ga0395900_0001335 3300037418 Bacteria 29867
338 Ga0395900_0003249 3300037418 Bacteria 17597
339 Ga0395900_0013499 3300037418 Bacteria 8348
340 Ga0395900_0014771 3300037418 Bacteria 7959
341 Ga0395900_0022682 3300037418 Bacteria 6424
342 Ga0395900_0041013 3300037418 Bacteria 4772
343 Ga0395900_0044607 3300037418 Bacteria 4567
344 Ga0395900_0324919 3300037418 Bacteria 1518
345 Ga0395900_0450433 3300037418 Bacteria 1243
346 Ga0395898_0074868 3300037466 Bacteria 3270
347 Ga0395898_0359723 3300037466 Bacteria 1388
348 Ga0395905_0001092 3300037471 Bacteria 34107
349 Ga0395905_0017352 3300037471 Bacteria 6836
350 Ga0395905_0068903 3300037471 Bacteria 3313
351 Ga0395905_0070275 3300037471 Bacteria 3280
352 Ga0395905_0089118 3300037471 Bacteria 2892
353 Ga0395905_0185706 3300037471 Bacteria 1951
354 Ga0395905_0195913 3300037471 Bacteria 1894
355 Ga0395901_0000227 3300038443 Bacteria 70721
356 Ga0395901_0012410 3300038443 Bacteria 8644
357 Ga0395901_0172746 3300038443 Bacteria 2267
358 Ga0395901_0526297 3300038443 Bacteria 1200
359 Ga0436361_0094991 3300039447 Bacteria 18798
360 Ga0436361_0152297 3300039447 Bacteria 5874
361 Ga0436361_0340593 3300039447 Bacteria 6077
362 Ga0436361_0632131 3300039447 Bacteria 10675
363 Ga0436361_0768404 3300039447 Bacteria 16876
364 Ga0436361_0851270 3300039447 Bacteria 59752
365 Ga0436361_0953382 3300039447 Bacteria 8461
366 Ga0439448_0001900 3300042005 Bacteria 5560
367 Ga0439448_0023604 3300042005 Bacteria 1920
368 Ga0439450_016155 3300042008 Bacteria 1539
369 Ga0450888_002193 3300042126 Bacteria 1917
370 Ga0450904_000873 3300042139 Bacteria 4926
371 Ga0451577_0065391 3300042876 Bacteria 3243
372 Ga0451577_0384613 3300042876 Bacteria 1273
373 Ga0466972_0000037 3300044658 Bacteria 137184
374 Ga0466972_0000269 3300044658 Bacteria 33053
375 Ga0466972_0001677 3300044658 Bacteria 10841
376 Ga0466972_0003487 3300044658 Bacteria 7805
377 Ga0466965_0008151 3300044683 Bacteria 4839
378 Ga0466965_0012191 3300044683 Bacteria 4040
379 Ga0466965_0016998 3300044683 Bacteria 3470
380 Ga0466965_0084653 3300044683 Bacteria 1606
381 Ga0466966_0002043 3300044684 Bacteria 13112
382 Ga0466966_0029371 3300044684 Bacteria 3577
383 Ga0466964_0000857 3300044706 Bacteria 9953
384 Ga0466964_0008893 3300044706 Bacteria 3776
385 Ga0453684_0115016 3300044712 Bacteria 3260
386 Ga0466971_0030139 3300044719 Bacteria 2428
387 Ga0466971_0069367 3300044719 Bacteria 1599
388 Ga0466968_0005311 3300044735 Bacteria 4823
389 Ga0466968_0005812 3300044735 Bacteria 4628
390 Ga0466968_0019228 3300044735 Bacteria 2748
391 Ga0466957_0000040 3300044842 Bacteria 47080
392 Ga0466957_0126482 3300044842 Bacteria 1633
393 Ga0466959_0018761 3300045049 Bacteria 5080
394 Ga0466959_0040979 3300045049 Bacteria 3420
395 Ga0466959_0187746 3300045049 Bacteria 1443
396 Ga0466958_0068493 3300045836 Bacteria 2169
397 Ga0466967_0015803 3300045976 Bacteria 5930
398 Ga0466967_0156020 3300045976 Bacteria 2138
399 Ga0495617_000011 3300046452 Bacteria 301936
400 Ga0495617_000046 3300046452 Bacteria 115430
401 Ga0495617_001784 3300046452 Bacteria 9187
402 Ga0495617_003526 3300046452 Bacteria 5857
403 Ga0495617_005907 3300046452 Bacteria 4318
404 Ga0495627_000006 3300046453 Bacteria 581750
405 Ga0495627_001231 3300046453 Bacteria 15945
406 Ga0495627_005070 3300046453 Bacteria 5382
407 Ga0495592_0007848 3300046454 Bacteria 7997
408 Ga0495603_0015177 3300046455 Bacteria 4660
409 Ga0495603_0025448 3300046455 Bacteria 3579
410 Ga0495590_0000022 3300046457 Bacteria 205122
411 Ga0495590_0000134 3300046457 Bacteria 43957
412 Ga0495590_0000881 3300046457 Bacteria 13450
413 Ga0495590_0011223 3300046457 Bacteria 3354
414 Ga0495590_0017136 3300046457 Bacteria 2611
415 Ga0495591_002085 3300046458 Bacteria 11521
416 Ga0495591_026425 3300046458 Bacteria 1803
417 Ga0495629_0026169 3300046459 Bacteria 4145
418 Ga0495629_0085002 3300046459 Bacteria 2207
419 Ga0495638_0000099 3300046460 Bacteria 139325
420 Ga0495638_0000354 3300046460 Bacteria 57368
421 Ga0495638_0006199 3300046460 Bacteria 8736
422 Ga0495638_0011848 3300046460 Bacteria 5998
423 Ga0495638_0056095 3300046460 Bacteria 2445
424 Ga0495638_0165608 3300046460 Bacteria 1272
425 Ga0495651_0008564 3300046462 Bacteria 7839
426 Ga0495653_0000102 3300046463 Bacteria 70205
427 Ga0495653_0002192 3300046463 Bacteria 15456
428 Ga0495653_0007995 3300046463 Bacteria 8662
429 Ga0495653_0063703 3300046463 Bacteria 2780
430 Ga0495650_0000248 3300046471 Bacteria 106527
431 Ga0495650_0000297 3300046471 Bacteria 90619
432 Ga0495650_0000356 3300046471 Bacteria 80805
433 Ga0495650_0000774 3300046471 Bacteria 39438
434 Ga0495650_0001404 3300046471 Bacteria 23556
435 Ga0495650_0001655 3300046471 Bacteria 20604
436 Ga0495650_0002354 3300046471 Bacteria 15586
437 Ga0495650_0005152 3300046471 Bacteria 8619
438 Ga0495650_0010146 3300046471 Bacteria 5282
439 Ga0495650_0017385 3300046471 Bacteria 3607
440 Ga0495580_0004379 3300046472 Bacteria 11859
441 Ga0495580_0080814 3300046472 Bacteria 2265
442 Ga0495580_0119499 3300046472 Bacteria 1830
443 Ga0495582_0001046 3300046473 Bacteria 15523
444 Ga0495582_0008353 3300046473 Bacteria 5713
445 Ga0495582_0031129 3300046473 Bacteria 2931
446 Ga0495605_0000041 3300046474 Bacteria 193873
447 Ga0495605_0000284 3300046474 Bacteria 56120
448 Ga0495605_0000614 3300046474 Bacteria 27775
449 Ga0495605_0001332 3300046474 Bacteria 16335
450 Ga0495605_0005724 3300046474 Bacteria 7213
451 Ga0495605_0007238 3300046474 Bacteria 6304
452 Ga0495605_0009455 3300046474 Bacteria 5477
453 Ga0495605_0010234 3300046474 Bacteria 5252
454 Ga0495605_0028058 3300046474 Bacteria 2908
455 Ga0495605_0106941 3300046474 Bacteria 1280
456 Ga0495639_0015699 3300046475 Bacteria 3284
457 Ga0495662_0030891 3300046476 Bacteria 2586
458 Ga0495584_0000013 3300046491 Bacteria 185735
459 Ga0495584_0000401 3300046491 Bacteria 29931
460 Ga0495584_0000550 3300046491 Bacteria 25389
461 Ga0495584_0000951 3300046491 Bacteria 18190
462 Ga0495584_0000972 3300046491 Bacteria 17980
463 Ga0495584_0002502 3300046491 Bacteria 10416
464 Ga0495584_0002582 3300046491 Bacteria 10214
465 Ga0495584_0003205 3300046491 Bacteria 9105
466 Ga0495584_0005273 3300046491 Bacteria 6847
467 Ga0495584_0006573 3300046491 Bacteria 6076
468 Ga0495584_0012093 3300046491 Bacteria 4412
469 Ga0495584_0012756 3300046491 Bacteria 4288
470 Ga0495584_0013174 3300046491 Bacteria 4219
471 Ga0495584_0016392 3300046491 Bacteria 3778
472 Ga0495584_0154059 3300046491 Bacteria 1167
473 Ga0495585_0000150 3300046492 Bacteria 75556
474 Ga0495585_0001052 3300046492 Bacteria 22828
475 Ga0495585_0001416 3300046492 Bacteria 18867
476 Ga0495585_0002800 3300046492 Bacteria 12147
477 Ga0495585_0002993 3300046492 Bacteria 11666
478 Ga0495585_0003304 3300046492 Bacteria 10949
479 Ga0495585_0005663 3300046492 Bacteria 7844
480 Ga0495585_0006319 3300046492 Bacteria 7361
481 Ga0495585_0007714 3300046492 Bacteria 6559
482 Ga0495585_0007869 3300046492 Bacteria 6483
483 Ga0495585_0008104 3300046492 Bacteria 6384
484 Ga0495585_0013795 3300046492 Bacteria 4721
485 Ga0495585_0014846 3300046492 Bacteria 4531
486 Ga0495585_0037735 3300046492 Bacteria 2720
487 Ga0495585_0052255 3300046492 Bacteria 2262
488 Ga0495585_0053693 3300046492 Bacteria 2229
489 Ga0495585_0060476 3300046492 Bacteria 2084
490 Ga0495585_0061152 3300046492 Bacteria 2071
491 Ga0495585_0091058 3300046492 Bacteria 1642
492 Ga0495585_0187083 3300046492 Bacteria 1061
493 Ga0495594_0001996 3300046499 Bacteria 10636
494 Ga0495594_0003575 3300046499 Bacteria 7996
495 Ga0495594_0025580 3300046499 Bacteria 3172
496 Ga0495594_0047112 3300046499 Bacteria 2367
497 Ga0495594_0114282 3300046499 Bacteria 1523
498 Ga0495594_0142649 3300046499 Bacteria 1359
499 Ga0495596_0001343 3300046500 Bacteria 14164
500 Ga0495596_0001970 3300046500 Bacteria 11330
501 Ga0495596_0003353 3300046500 Bacteria 8139
502 Ga0495596_0005506 3300046500 Bacteria 5966
503 Ga0495596_0005656 3300046500 Bacteria 5870
504 Ga0495596_0008267 3300046500 Bacteria 4639
505 Ga0495596_0009757 3300046500 Bacteria 4213
506 Ga0495596_0014322 3300046500 Bacteria 3341
507 Ga0495596_0018133 3300046500 Bacteria 2904
508 Ga0495596_0025036 3300046500 Bacteria 2414
509 Ga0495596_0056202 3300046500 Bacteria 1537
510 Ga0495607_0001581 3300046501 Bacteria 19837
511 Ga0495607_0001687 3300046501 Bacteria 19018
512 Ga0495607_0001951 3300046501 Bacteria 17425
513 Ga0495607_0005783 3300046501 Bacteria 8796
514 Ga0495607_0006601 3300046501 Bacteria 8142
515 Ga0495607_0008758 3300046501 Bacteria 6892
516 Ga0495607_0012539 3300046501 Bacteria 5589
517 Ga0495607_0013539 3300046501 Bacteria 5342
518 Ga0495607_0019245 3300046501 Bacteria 4339
519 Ga0495607_0020268 3300046501 Bacteria 4207
520 Ga0495607_0051165 3300046501 Bacteria 2400
521 Ga0495607_0055797 3300046501 Bacteria 2270
522 Ga0495607_0061339 3300046501 Bacteria 2137
523 Ga0495583_0000056 3300046506 Bacteria 200858
524 Ga0495583_0000063 3300046506 Bacteria 194362
525 Ga0495583_0000161 3300046506 Bacteria 113144
526 Ga0495583_0000220 3300046506 Bacteria 96267
527 Ga0495583_0000573 3300046506 Bacteria 50614
528 Ga0495583_0000839 3300046506 Bacteria 37397
529 Ga0495583_0003352 3300046506 Bacteria 12345
530 Ga0495583_0004154 3300046506 Bacteria 10584
531 Ga0495583_0004198 3300046506 Bacteria 10489
532 Ga0495583_0009524 3300046506 Bacteria 5791
533 Ga0495583_0011302 3300046506 Bacteria 5134
534 Ga0495583_0019210 3300046506 Bacteria 3572
535 Ga0495583_0072164 3300046506 Bacteria 1515
536 Ga0495606_0000169 3300046507 Bacteria 115434
537 Ga0495606_0000187 3300046507 Bacteria 108140
538 Ga0495606_0000494 3300046507 Bacteria 64410
539 Ga0495606_0000609 3300046507 Bacteria 56606
540 Ga0495606_0001166 3300046507 Bacteria 37155
541 Ga0495606_0003491 3300046507 Bacteria 16650
542 Ga0495606_0004057 3300046507 Bacteria 14915
543 Ga0495606_0004324 3300046507 Bacteria 14290
544 Ga0495606_0014062 3300046507 Bacteria 6270
545 Ga0495606_0023156 3300046507 Bacteria 4509
546 Ga0495606_0038285 3300046507 Bacteria 3246
547 Ga0495606_0064683 3300046507 Bacteria 2326
548 Ga0495606_0119697 3300046507 Bacteria 1577
549 Ga0495608_0001695 3300046511 Bacteria 15804
550 Ga0495608_0008843 3300046511 Bacteria 7047
551 Ga0495610_0000007 3300046512 Bacteria 820919
552 Ga0495610_0001163 3300046512 Bacteria 23950
553 Ga0495610_0001852 3300046512 Bacteria 18334
554 Ga0495610_0002889 3300046512 Bacteria 13903
555 Ga0495610_0003861 3300046512 Bacteria 11386
556 Ga0495610_0012801 3300046512 Bacteria 5018
557 Ga0495616_0000378 3300046513 Bacteria 34726
558 Ga0495616_0000673 3300046513 Bacteria 25344
559 Ga0495616_0000732 3300046513 Bacteria 24143
560 Ga0495616_0000838 3300046513 Bacteria 22407
561 Ga0495616_0004890 3300046513 Bacteria 8376
562 Ga0495616_0007069 3300046513 Bacteria 6742
563 Ga0495616_0007456 3300046513 Bacteria 6549
564 Ga0495616_0016770 3300046513 Bacteria 4047
565 Ga0495616_0017938 3300046513 Bacteria 3898
566 Ga0495616_0020923 3300046513 Bacteria 3552
567 Ga0495616_0028031 3300046513 Bacteria 2984
568 Ga0495616_0030046 3300046513 Bacteria 2860
569 Ga0495616_0047144 3300046513 Bacteria 2171
570 Ga0495616_0063182 3300046513 Bacteria 1810
571 Ga0495618_0010248 3300046514 Bacteria 5670
572 Ga0495628_0001477 3300046516 Bacteria 21536
573 Ga0495630_0050915 3300046517 Bacteria 3099
574 Ga0495631_0003439 3300046518 Bacteria 8670
575 Ga0495631_0003758 3300046518 Bacteria 8259
576 Ga0495631_0005893 3300046518 Bacteria 6384
577 Ga0495631_0006259 3300046518 Bacteria 6165
578 Ga0495631_0008197 3300046518 Bacteria 5272
579 Ga0495631_0011239 3300046518 Bacteria 4407
580 Ga0495631_0020192 3300046518 Bacteria 3115
581 Ga0495631_0025173 3300046518 Bacteria 2742
582 Ga0495631_0042226 3300046518 Bacteria 2015
583 Ga0495632_0000280 3300046519 Bacteria 50071
584 Ga0495632_0000959 3300046519 Bacteria 25226
585 Ga0495632_0001908 3300046519 Bacteria 16676
586 Ga0495632_0003957 3300046519 Bacteria 10283
587 Ga0495632_0006230 3300046519 Bacteria 7715
588 Ga0495637_0000029 3300046520 Bacteria 143929
589 Ga0495637_0001558 3300046520 Bacteria 13371
590 Ga0495637_0019407 3300046520 Bacteria 3143
591 Ga0495643_0000245 3300046522 Bacteria 80531
592 Ga0495643_0000517 3300046522 Bacteria 48097
593 Ga0495643_0001674 3300046522 Bacteria 19399
594 Ga0495643_0002014 3300046522 Bacteria 16943
595 Ga0495643_0008919 3300046522 Bacteria 6302
596 Ga0495643_0041760 3300046522 Bacteria 2500
597 Ga0495643_0041939 3300046522 Bacteria 2494
598 Ga0495643_0060236 3300046522 Bacteria 2015
599 Ga0495644_0002273 3300046523 Bacteria 7685
600 Ga0495644_0002377 3300046523 Bacteria 7504
601 Ga0495644_0003202 3300046523 Bacteria 6463
602 Ga0495644_0006553 3300046523 Bacteria 4507
603 Ga0495644_0012603 3300046523 Bacteria 3251
604 Ga0495644_0026638 3300046523 Bacteria 2192
605 Ga0495644_0031885 3300046523 Bacteria 1991
606 Ga0495648_0000004 3300046524 Bacteria 373639
607 Ga0495648_0000047 3300046524 Bacteria 166756
608 Ga0495648_0001488 3300046524 Bacteria 22912
609 Ga0495648_0002640 3300046524 Bacteria 16282
610 Ga0495648_0004096 3300046524 Bacteria 12575
611 Ga0495648_0009206 3300046524 Bacteria 7684
612 Ga0495648_0010177 3300046524 Bacteria 7188
613 Ga0495648_0012788 3300046524 Bacteria 6233
614 Ga0495648_0013386 3300046524 Bacteria 6069
615 Ga0495648_0017457 3300046524 Bacteria 5128
616 Ga0495648_0031541 3300046524 Bacteria 3487
617 Ga0495648_0045010 3300046524 Bacteria 2749
618 Ga0495648_0047270 3300046524 Bacteria 2661
619 Ga0495663_0019873 3300046525 Bacteria 1925
620 Ga0495666_0003378 3300046526 Bacteria 8048
621 Ga0495666_0005439 3300046526 Bacteria 6416
622 Ga0495666_0005509 3300046526 Bacteria 6375
623 Ga0495666_0032405 3300046526 Bacteria 2558
624 Ga0495642_0000707 3300046528 Bacteria 16603
625 Ga0495642_0000879 3300046528 Bacteria 14170
626 Ga0495642_0000925 3300046528 Bacteria 13753
627 Ga0495642_0006297 3300046528 Bacteria 4552
628 Ga0495642_0009148 3300046528 Bacteria 3794
629 Ga0495642_0009245 3300046528 Bacteria 3773
630 Ga0495642_0011746 3300046528 Bacteria 3372
631 Ga0495642_0016582 3300046528 Bacteria 2873
632 Ga0495642_0020386 3300046528 Bacteria 2604
633 Ga0495642_0021727 3300046528 Bacteria 2525
634 Ga0495642_0033790 3300046528 Bacteria 2057
635 Ga0495642_0052263 3300046528 Bacteria 1682
636 Ga0495652_0044072 3300046529 Bacteria 3842
637 Ga0495652_0053713 3300046529 Bacteria 3433
638 Ga0495654_0000025 3300046530 Bacteria 236572
639 Ga0495654_0004114 3300046530 Bacteria 8728
640 Ga0495654_0005119 3300046530 Bacteria 7660
641 Ga0495654_0006998 3300046530 Bacteria 6353
642 Ga0495654_0015481 3300046530 Bacteria 4048
643 Ga0495654_0024625 3300046530 Bacteria 3108
644 Ga0495665_0003911 3300046531 Bacteria 8061
645 Ga0495665_0004037 3300046531 Bacteria 7920
646 Ga0495665_0020928 3300046531 Bacteria 3514
647 Ga0495665_0025476 3300046531 Bacteria 3177
648 Ga0495665_0072509 3300046531 Bacteria 1813
649 Ga0495586_0017346 3300046535 Bacteria 3828
650 Ga0495587_0056262 3300046536 Bacteria 2314
651 Ga0495587_0067055 3300046536 Bacteria 2092
652 Ga0495587_0085395 3300046536 Bacteria 1827
653 Ga0495587_0100535 3300046536 Bacteria 1667
654 Ga0495609_0000005 3300046538 Bacteria 439165
655 Ga0495609_0001536 3300046538 Bacteria 15150
656 Ga0495609_0001551 3300046538 Bacteria 15042
657 Ga0495609_0001607 3300046538 Bacteria 14766
658 Ga0495609_0002450 3300046538 Bacteria 11408
659 Ga0495609_0002738 3300046538 Bacteria 10611
660 Ga0495609_0004216 3300046538 Bacteria 7954
661 Ga0495609_0010990 3300046538 Bacteria 4324
662 Ga0495609_0014114 3300046538 Bacteria 3760
663 Ga0495609_0023997 3300046538 Bacteria 2799
664 Ga0495609_0040812 3300046538 Bacteria 2087
665 Ga0495621_0016104 3300046539 Bacteria 2394
666 Ga0495597_0000563 3300046542 Bacteria 30796
667 Ga0495597_0002604 3300046542 Bacteria 11239
668 Ga0495597_0002893 3300046542 Bacteria 10470
669 Ga0495597_0003147 3300046542 Bacteria 9878
670 Ga0495597_0003284 3300046542 Bacteria 9574
671 Ga0495597_0005953 3300046542 Bacteria 6362
672 Ga0495597_0007880 3300046542 Bacteria 5372
673 Ga0495597_0012473 3300046542 Bacteria 4101
674 Ga0495597_0018770 3300046542 Bacteria 3241
675 Ga0495597_0020202 3300046542 Bacteria 3105
676 Ga0495597_0051079 3300046542 Bacteria 1824
677 Ga0495645_0031635 3300046543 Bacteria 3856
678 Ga0495645_0043896 3300046543 Bacteria 3261
679 Ga0495622_0000157 3300046557 Bacteria 57030
680 Ga0495622_0000500 3300046557 Bacteria 24597
681 Ga0495622_0002938 3300046557 Bacteria 8121
682 Ga0495622_0033347 3300046557 Bacteria 2403
683 Ga0495633_0000467 3300046558 Bacteria 41402
684 Ga0495633_0000472 3300046558 Bacteria 40822
685 Ga0495633_0003381 3300046558 Bacteria 10675
686 Ga0495633_0003534 3300046558 Bacteria 10348
687 Ga0495633_0005433 3300046558 Bacteria 7787
688 Ga0495633_0006297 3300046558 Bacteria 7067
689 Ga0495633_0006990 3300046558 Bacteria 6588
690 Ga0495633_0007489 3300046558 Bacteria 6275
691 Ga0495633_0008254 3300046558 Bacteria 5891
692 Ga0495633_0010420 3300046558 Bacteria 5071
693 Ga0495633_0011181 3300046558 Bacteria 4858
694 Ga0495633_0016280 3300046558 Bacteria 3840
695 Ga0495633_0033873 3300046558 Bacteria 2459
696 Ga0495633_0067941 3300046558 Bacteria 1664
697 Ga0495667_0087527 3300046559 Bacteria 2020
698 Ga0495656_0004308 3300046615 Bacteria 4864
699 Ga0495656_0019531 3300046615 Bacteria 2616
700 Ga0495656_0102203 3300046615 Bacteria 1327
701 Ga0495668_0000210 3300046616 Bacteria 84755
702 Ga0495668_0000219 3300046616 Bacteria 83081
703 Ga0495668_0000333 3300046616 Bacteria 64401
704 Ga0495668_0001190 3300046616 Bacteria 26426
705 Ga0495668_0004052 3300046616 Bacteria 10657
706 Ga0495668_0004067 3300046616 Bacteria 10617
707 Ga0495668_0004388 3300046616 Bacteria 10054
708 Ga0495668_0005639 3300046616 Bacteria 8400
709 Ga0495668_0007970 3300046616 Bacteria 6677
710 Ga0495668_0014801 3300046616 Bacteria 4566
711 Ga0495668_0017863 3300046616 Bacteria 4109
712 Ga0495668_0025501 3300046616 Bacteria 3359
713 Ga0495668_0043148 3300046616 Bacteria 2509
714 Ga0495634_0010701 3300046642 Bacteria 6713
715 Ga0495634_0029405 3300046642 Bacteria 3804
716 Ga0495611_0000336 3300046648 Bacteria 30672
717 Ga0495611_0001499 3300046648 Bacteria 11585
718 Ga0495611_0001565 3300046648 Bacteria 11204
719 Ga0495611_0005110 3300046648 Bacteria 5624
720 Ga0495611_0007237 3300046648 Bacteria 4715
721 Ga0495611_0016478 3300046648 Bacteria 3159
722 Ga0495611_0019707 3300046648 Bacteria 2898
723 Ga0495611_0022196 3300046648 Bacteria 2745
724 Ga0495625_0000412 3300046660 Bacteria 64883
725 Ga0495625_0000821 3300046660 Bacteria 42765
726 Ga0495625_0001604 3300046660 Bacteria 26732
727 Ga0495625_0002389 3300046660 Bacteria 20388
728 Ga0495625_0007845 3300046660 Bacteria 9197
729 Ga0495625_0010280 3300046660 Bacteria 7758
730 Ga0495625_0015331 3300046660 Bacteria 6073
731 Ga0495625_0016886 3300046660 Bacteria 5729
732 Ga0495625_0026294 3300046660 Bacteria 4400
733 Ga0495625_0109889 3300046660 Bacteria 1885
734 Ga0495635_0005531 3300046663 Bacteria 8790
735 Ga0495635_0018783 3300046663 Bacteria 4823
736 Ga0495635_0194618 3300046663 Bacteria 1376
737 Ga0495659_0000010 3300046664 Bacteria 87574
738 Ga0495659_0000526 3300046664 Bacteria 14120
739 Ga0495659_0002619 3300046664 Bacteria 5803
740 Ga0495659_0035642 3300046664 Bacteria 1754
741 Ga0495661_0000613 3300046665 Bacteria 36356
742 Ga0495661_0000794 3300046665 Bacteria 29925
743 Ga0495661_0001195 3300046665 Bacteria 22541
744 Ga0495661_0002649 3300046665 Bacteria 13700
745 Ga0495661_0003348 3300046665 Bacteria 11881
746 Ga0495661_0007511 3300046665 Bacteria 7598
747 Ga0495661_0007838 3300046665 Bacteria 7428
748 Ga0495661_0011228 3300046665 Bacteria 6079
749 Ga0495661_0013468 3300046665 Bacteria 5490
750 Ga0495661_0014914 3300046665 Bacteria 5194
751 Ga0495661_0019387 3300046665 Bacteria 4456
752 Ga0495661_0021272 3300046665 Bacteria 4230
753 Ga0495661_0031092 3300046665 Bacteria 3392
754 Ga0495661_0042801 3300046665 Bacteria 2789
755 Ga0495661_0047890 3300046665 Bacteria 2600
756 Ga0495661_0067099 3300046665 Bacteria 2108
757 Ga0495661_0071556 3300046665 Bacteria 2026
758 Ga0495661_0075531 3300046665 Bacteria 1958
759 Ga0495661_0082832 3300046665 Bacteria 1845
760 Ga0495661_0101300 3300046665 Bacteria 1620
761 Ga0495588_0000059 3300046674 Bacteria 263358
762 Ga0495588_0002779 3300046674 Bacteria 7521
763 Ga0495588_0014575 3300046674 Bacteria 3763
764 Ga0495588_0015979 3300046674 Bacteria 3621
765 Ga0495588_0049473 3300046674 Bacteria 2161
766 Ga0495588_0051726 3300046674 Bacteria 2116
767 Ga0495657_0015496 3300046675 Bacteria 5577
768 Ga0495657_0192315 3300046675 Bacteria 1247
769 Ga0495599_0032849 3300046678 Bacteria 3258
770 Ga0495623_0007728 3300046679 Bacteria 6989
771 Ga0495623_0014841 3300046679 Bacteria 5038
772 Ga0495623_0015129 3300046679 Bacteria 4988
773 Ga0495623_0064914 3300046679 Bacteria 2283
774 Ga0495646_0001070 3300046680 Bacteria 15892
775 Ga0495646_0007553 3300046680 Bacteria 6909
776 Ga0495646_0007728 3300046680 Bacteria 6833
777 Ga0495646_0033843 3300046680 Bacteria 3177
778 Ga0495647_0007230 3300046681 Bacteria 3714
779 Ga0495658_0133224 3300046683 Bacteria 1514
780 Ga0495669_0000240 3300046684 Bacteria 32062
781 Ga0495669_0000324 3300046684 Bacteria 26117
782 Ga0495669_0001234 3300046684 Bacteria 10612
783 Ga0495669_0004135 3300046684 Bacteria 5965
784 Ga0495669_0007418 3300046684 Bacteria 4599
785 Ga0495669_0010168 3300046684 Bacteria 3973
786 Ga0495624_0050104 3300046690 Bacteria 2646
787 Ga0495670_0003154 3300046691 Bacteria 8123
788 Ga0495670_0006418 3300046691 Bacteria 5776
789 Ga0495670_0008396 3300046691 Bacteria 5077
790 Ga0495670_0031576 3300046691 Bacteria 2632
791 Ga0495670_0034408 3300046691 Bacteria 2523
792 Ga0495670_0046933 3300046691 Bacteria 2158
793 Ga0495670_0068391 3300046691 Bacteria 1794
794 Ga0495670_0077530 3300046691 Bacteria 1689
795 Ga0495671_0000196 3300046692 Bacteria 53071
796 Ga0495671_0000609 3300046692 Bacteria 26284
797 Ga0495671_0000614 3300046692 Bacteria 26133
798 Ga0495671_0002097 3300046692 Bacteria 12775
799 Ga0495671_0155350 3300046692 Bacteria 1113
800 Ga0495649_0000644 3300046694 Bacteria 28394
801 Ga0495649_0003103 3300046694 Bacteria 11372
802 Ga0495649_0003975 3300046694 Bacteria 9759
803 Ga0495649_0019122 3300046694 Bacteria 3849
804 Ga0495589_0000212 3300046794 Bacteria 49440
805 Ga0495589_0000358 3300046794 Bacteria 35427
806 Ga0495589_0001945 3300046794 Bacteria 11691
807 Ga0495589_0008518 3300046794 Bacteria 5350
808 Ga0495589_0010991 3300046794 Bacteria 4700
809 Ga0495589_0015330 3300046794 Bacteria 3946
810 Ga0495589_0017754 3300046794 Bacteria 3650
811 Ga0495589_0068269 3300046794 Bacteria 1739
812 Ga0495589_0087153 3300046794 Bacteria 1516
813 Ga0495600_0010417 3300046809 Bacteria 5772
814 Ga0495600_0023933 3300046809 Bacteria 3930
815 Ga0495660_0000301 3300046810 Bacteria 44739
816 Ga0495660_0000789 3300046810 Bacteria 23709
817 Ga0495660_0001147 3300046810 Bacteria 18835
818 Ga0495660_0002687 3300046810 Bacteria 11237
819 Ga0495660_0002698 3300046810 Bacteria 11212
820 Ga0495660_0002992 3300046810 Bacteria 10547
821 Ga0495660_0006353 3300046810 Bacteria 7001
822 Ga0495660_0052182 3300046810 Bacteria 2222
823 Ga0495660_0054684 3300046810 Bacteria 2162
824 Ga0495660_0063459 3300046810 Bacteria 1977
825 Ga0495660_0075307 3300046810 Bacteria 1781
826 Ga0495581_0001466 3300047315 Bacteria 13108
827 Ga0495581_0013538 3300047315 Bacteria 4730
828 Ga0495581_0029151 3300047315 Bacteria 3199
829 Ga0495604_0004528 3300047317 Bacteria 11009
830 Ga0495604_0009345 3300047317 Bacteria 7760
831 Ga0495604_0013433 3300047317 Bacteria 6523
832 Ga0495604_0130117 3300047317 Bacteria 1810
833 Ga0495636_0002971 3300047318 Bacteria 6555
834 Ga0495636_0009359 3300047318 Bacteria 3858
835 Ga0495636_0011693 3300047318 Bacteria 3477
836 Ga0495636_0035052 3300047318 Bacteria 2067
837 Ga0495674_0006740 3300047319 Bacteria 10995
838 Ga0495672_0000078 3300047320 Bacteria 164474
839 Ga0495672_0000107 3300047320 Bacteria 132267
840 Ga0495672_0000431 3300047320 Bacteria 50205
841 Ga0495672_0001709 3300047320 Bacteria 21262
842 Ga0495672_0001925 3300047320 Bacteria 19641
843 Ga0495672_0002234 3300047320 Bacteria 18011
844 Ga0495672_0002438 3300047320 Bacteria 17117
845 Ga0495672_0007705 3300047320 Bacteria 8061
846 Ga0495672_0009016 3300047320 Bacteria 7276
847 Ga0495672_0014433 3300047320 Bacteria 5408
848 Ga0495672_0033307 3300047320 Bacteria 3192
849 Ga0495672_0058641 3300047320 Bacteria 2230
850 Ga0495676_0000069 3300047321 Bacteria 78689
851 Ga0495680_0009108 3300047322 Bacteria 8958
852 Ga0495683_0000221 3300047323 Bacteria 53874
853 Ga0495683_0000559 3300047323 Bacteria 28050
854 Ga0495683_0001444 3300047323 Bacteria 15592
855 Ga0495683_0002282 3300047323 Bacteria 11694
856 Ga0495683_0003435 3300047323 Bacteria 9243
857 Ga0495683_0003967 3300047323 Bacteria 8511
858 Ga0495683_0011823 3300047323 Bacteria 4590
859 Ga0495683_0048157 3300047323 Bacteria 2137
860 Ga0495683_0074678 3300047323 Bacteria 1661
861 Ga0495687_000221 3300047443 Bacteria 80968
862 Ga0495687_000562 3300047443 Bacteria 43714
863 Ga0495687_000714 3300047443 Bacteria 36793
864 Ga0495687_000828 3300047443 Bacteria 33075
865 Ga0495687_000917 3300047443 Bacteria 30658
866 Ga0495687_001108 3300047443 Bacteria 26234
867 Ga0495687_002375 3300047443 Bacteria 15204
868 Ga0495687_004239 3300047443 Bacteria 9829
869 Ga0495687_004864 3300047443 Bacteria 8822
870 Ga0495687_005631 3300047443 Bacteria 7913
871 Ga0495687_010530 3300047443 Bacteria 5064
872 Ga0495675_0012391 3300047444 Bacteria 5366
873 Ga0495675_0045291 3300047444 Bacteria 2801
874 Ga0495677_0000060 3300047445 Bacteria 61831
875 Ga0495677_0000616 3300047445 Bacteria 14512
876 Ga0495677_0001462 3300047445 Bacteria 9465
877 Ga0495677_0002470 3300047445 Bacteria 7260
878 Ga0495677_0003295 3300047445 Bacteria 6293
879 Ga0495677_0004463 3300047445 Bacteria 5371
880 Ga0495677_0006273 3300047445 Bacteria 4491
881 Ga0495677_0007868 3300047445 Bacteria 3967
882 Ga0495677_0012295 3300047445 Bacteria 3123
883 Ga0495677_0012909 3300047445 Bacteria 3042
884 Ga0495677_0016892 3300047445 Bacteria 2646
885 Ga0495677_0049365 3300047445 Bacteria 1546
886 Ga0495679_003216 3300047446 Bacteria 7935
887 Ga0495679_009937 3300047446 Bacteria 3770
888 Ga0495685_000113 3300047447 Bacteria 28884
889 Ga0495685_000340 3300047447 Bacteria 14999
890 Ga0495685_000345 3300047447 Bacteria 14907
891 Ga0495685_002067 3300047447 Bacteria 6236
892 Ga0495673_0000074 3300047469 Bacteria 210788
893 Ga0495673_0000173 3300047469 Bacteria 106086
894 Ga0495673_0000194 3300047469 Bacteria 96014
895 Ga0495673_0017436 3300047469 Bacteria 3646
896 Ga0495681_0000330 3300047470 Bacteria 37408
897 Ga0495681_0000642 3300047470 Bacteria 26610
898 Ga0495681_0001763 3300047470 Bacteria 15948
899 Ga0495681_0002881 3300047470 Bacteria 12160
900 Ga0495681_0043864 3300047470 Bacteria 2153
901 Ga0495681_0044790 3300047470 Bacteria 2122
902 Ga0495681_0070441 3300047470 Bacteria 1585
903 Ga0495681_0084645 3300047470 Bacteria 1409
904 Ga0495686_0000387 3300047472 Bacteria 70185
905 Ga0495686_0001928 3300047472 Bacteria 20665
906 Ga0495686_0004503 3300047472 Bacteria 11437
907 Ga0495686_0006220 3300047472 Bacteria 9202
908 Ga0495686_0006658 3300047472 Bacteria 8796
909 Ga0495686_0010605 3300047472 Bacteria 6544
910 Ga0495686_0036664 3300047472 Bacteria 3146
911 Ga0495686_0087977 3300047472 Bacteria 1889
912 Ga0495593_0003624 3300047673 Bacteria 9220
913 Ga0495593_0007992 3300047673 Bacteria 6158
914 Ga0495593_0029917 3300047673 Bacteria 2983
915 Ga0495602_0001744 3300048088 Bacteria 21687
916 Ga0495602_0025892 3300048088 Bacteria 5669
917 Ga0495602_0029800 3300048088 Bacteria 5188
918 Ga0495614_0004592 3300048089 Bacteria 6216
919 Ga0495614_0005888 3300048089 Bacteria 5525
920 Ga0495614_0082665 3300048089 Bacteria 1392
921 Ga0495615_0001202 3300048090 Bacteria 3770
922 Ga0495615_0011539 3300048090 Bacteria 1799
923 Ga0495626_0000058 3300048091 Bacteria 147007
924 Ga0495626_0000196 3300048091 Bacteria 73575
925 Ga0495626_0001643 3300048091 Bacteria 17320
926 Ga0495626_0004639 3300048091 Bacteria 8354
927 Ga0495626_0006061 3300048091 Bacteria 6946
928 Ga0495626_0006899 3300048091 Bacteria 6398
929 Ga0495626_0009308 3300048091 Bacteria 5312
930 Ga0495626_0020651 3300048091 Bacteria 3278
931 Ga0495626_0022022 3300048091 Bacteria 3152
932 Ga0495626_0039346 3300048091 Bacteria 2238
933 Ga0495626_0050032 3300048091 Bacteria 1932
934 Ga0496100_0080627 3300048903 Bacteria 2197
935 Ga0496101_0027300 3300048904 Bacteria 3976
936 Ga0496101_0051972 3300048904 Bacteria 2953
937 Ga0496102_0000097 3300048905 Bacteria 124414
938 Ga0496102_0000420 3300048905 Bacteria 48887
939 Ga0496102_0033655 3300048905 Bacteria 4606
940 Ga0496103_0002958 3300048906 Bacteria 10527
941 Ga0496103_0067781 3300048906 Bacteria 2229
942 Ga0496104_0102748 3300048907 Bacteria 2738
943 Ga0496104_0108920 3300048907 Bacteria 2655
944 Ga0496104_0376008 3300048907 Bacteria 1333
945 Ga0496105_0034735 3300048908 Bacteria 4148
946 Ga0496106_0050665 3300048909 Bacteria 3130
947 Ga0496106_0107492 3300048909 Bacteria 2170
948 Ga0496107_0103276 3300048910 Bacteria 2091
949 Ga0496108_0070128 3300048911 Bacteria 2958
950 Ga0496108_0415930 3300048911 Bacteria 1174
951 Ga0496109_0373831 3300048912 Bacteria 1346
952 Ga0496109_0447473 3300048912 Bacteria 1220
953 Ga0496110_0004041 3300048913 Bacteria 11322
954 Ga0496111_0032938 3300048914 Bacteria 3695
955 Ga0496111_0054088 3300048914 Bacteria 2901
956 Ga0496111_0173620 3300048914 Bacteria 1602
957 Ga0496113_0015989 3300048916 Bacteria 5175
958 Ga0496113_0034323 3300048916 Bacteria 3701
959 Ga0496114_0051398 3300048917 Bacteria 3431
960 Ga0496115_0006572 3300048918 Bacteria 8521
961 Ga0496115_0007248 3300048918 Bacteria 8149
962 Ga0496115_0014859 3300048918 Bacteria 5905
963 Ga0496115_0063391 3300048918 Bacteria 2982
964 Ga0496115_0115931 3300048918 Bacteria 2203
965 Ga0496116_0003789 3300048919 Bacteria 14777
966 Ga0496116_0012419 3300048919 Bacteria 6960
967 Ga0496117_0083507 3300048920 Bacteria 2088
968 Ga0496118_0002994 3300048921 Bacteria 21830
969 Ga0496122_0001092 3300048925 Bacteria 47015
970 Ga0496122_0003878 3300048925 Bacteria 19185
971 Ga0496122_0005263 3300048925 Bacteria 15501
972 Ga0496122_0025683 3300048925 Bacteria 5106
973 Ga0496123_0000912 3300048926 Bacteria 46427
974 Ga0496123_0002714 3300048926 Bacteria 21267
975 Ga0496123_0003558 3300048926 Bacteria 17279
976 Ga0496123_0003832 3300048926 Bacteria 16407
977 Ga0496124_0007788 3300048927 Bacteria 11313
978 Ga0496124_0019066 3300048927 Bacteria 6401
979 Ga0496124_0021520 3300048927 Bacteria 5940
980 Ga0496124_0076846 3300048927 Bacteria 2755
981 Ga0496125_0000368 3300048928 Bacteria 84924
982 Ga0496125_0003100 3300048928 Bacteria 20723
983 Ga0496125_0008339 3300048928 Bacteria 10871
984 Ga0496126_0025776 3300048929 Bacteria 5649
985 Ga0495678_000013 3300049459 Bacteria 316375
986 Ga0495678_000146 3300049459 Bacteria 85995
987 Ga0495678_001534 3300049459 Bacteria 17833
988 Ga0495678_003140 3300049459 Bacteria 10447
989 Ga0495678_003408 3300049459 Bacteria 9870
990 Ga0495678_003481 3300049459 Bacteria 9716
991 Ga0495678_005649 3300049459 Bacteria 6826
992 Ga0495678_006090 3300049459 Bacteria 6491
993 Ga0495678_007836 3300049459 Bacteria 5488
994 Ga0495678_010397 3300049459 Bacteria 4527
995 Ga0495678_048240 3300049459 Bacteria 1662
996 Ga0495678_062852 3300049459 Bacteria 1388
997 Ga0495682_0001101 3300049460 Bacteria 15713
998 Ga0495682_0001326 3300049460 Bacteria 13739
999 Ga0495682_0002294 3300049460 Bacteria 9141
1000 Ga0495682_0002626 3300049460 Bacteria 8411
1001 Ga0495682_0003910 3300049460 Bacteria 6505
1002 Ga0495682_0011240 3300049460 Bacteria 3446
1003 Ga0495682_0040067 3300049460 Bacteria 1718
1004 Ga0501249_012850 3300049679 Bacteria 1774
1005 Ga0501269_000446 3300049766 Bacteria 9103
1006 Ga0501279_004692 3300049775 Bacteria 1794
1007 Ga0501279_005671 3300049775 Bacteria 1644
1008 Ga0501035_0007367 3300049822 Bacteria 10283
1009 nmdc:mga0n895_374590_c1 3300050512 Bacteria 1441
1010 nmdc:mga08x19_225778_c1 3300050514 Bacteria 1288
1011 nmdc:mga0a205_12156_c1 3300050515 Bacteria 7959
1012 Ga0495601_0005679 3300053077 Bacteria 7273
1013 Ga0500595_005622 3300053119 Bacteria 5450
1014 Ga0500618_000437 3300053125 Bacteria 27382
1015 Ga0500574_021706 3300053141 Bacteria 1629
1016 Ga0500586_006285 3300053145 Bacteria 3074
1017 Ga0500586_011320 3300053145 Bacteria 2551
1018 Ga0466962_0071573 3300061719 Bacteria 1656
1019 Ga0466962_0073054 3300061719 Bacteria 1639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100053621 Ga0070659_1000536211 305
2 3300025981 Ga0207640_10049762 Ga0207640_100497622 305
3 3300026041 Ga0207639_10104150 Ga0207639_101041501 305
4 3300035724 Ga0373933_0015560 Ga0373933_0015560_2986_4098 306
5 3300036401 Ga0373937_0013227 Ga0373937_0013227_3791_4903 306
6 3300046675 Ga0495657_0192315 Ga0495657_0192315_47_1159 306
7 3300046492 Ga0495585_0187083 Ga0495585_0187083_53_1006 317
8 3300046531 Ga0495665_0003911 Ga0495665_0003911_5359_6312 317
9 3300046810 Ga0495660_0006353 Ga0495660_0006353_6014_6979 321
10 3300048906 Ga0496103_0067781 Ga0496103_0067781_1170_2213 330
11 3300046454 Ga0495592_0007848 Ga0495592_0007848_3933_4931 332
12 3300046518 Ga0495631_0011239 Ga0495631_0011239_20_1018 332
13 3300002987 JGI25159J45721_1007516 JGI25159J45721_10075161 334
14 3300035170 Ga0373943_0064581 Ga0373943_0064581_132_1244 337
15 3300035171 Ga0373946_0009164 Ga0373946_0009164_1446_2558 337
16 3300035692 Ga0373935_0030544 Ga0373935_0030544_1125_2237 337
17 3300013105 Ga0157369_10196718 Ga0157369_101967183 339
18 3300005334 Ga0068869_100046178 Ga0068869_1000461783 344
19 3300005340 Ga0070689_100012684 Ga0070689_1000126843 344
20 3300005354 Ga0070675_100197349 Ga0070675_1001973491 344
21 3300005356 Ga0070674_100007079 Ga0070674_1000070794 344
22 3300005364 Ga0070673_100112224 Ga0070673_1001122242 344
23 3300005365 Ga0070688_100026044 Ga0070688_1000260442 344
24 3300005436 Ga0070713_100103012 Ga0070713_1001030123 344
25 3300005437 Ga0070710_10040804 Ga0070710_100408043 344
26 3300005438 Ga0070701_10175462 Ga0070701_101754621 344
27 3300005439 Ga0070711_100007512 Ga0070711_1000075127 344
28 3300005455 Ga0070663_100108327 Ga0070663_1001083272 344
29 3300005456 Ga0070678_100003601 Ga0070678_1000036013 344
30 3300005457 Ga0070662_100008580 Ga0070662_1000085804 344
31 3300005466 Ga0070685_10001242 Ga0070685_1000124212 344
32 3300005546 Ga0070696_100020672 Ga0070696_1000206723 344
33 3300005547 Ga0070693_100013520 Ga0070693_1000135204 344
34 3300005548 Ga0070665_100138353 Ga0070665_1001383533 344
35 3300005578 Ga0068854_100009651 Ga0068854_1000096514 344
36 3300005718 Ga0068866_10001450 Ga0068866_100014507 344
37 3300005841 Ga0068863_100003727 Ga0068863_1000037278 344
38 3300005842 Ga0068858_100062410 Ga0068858_1000624102 344
39 3300006163 Ga0070715_10015827 Ga0070715_100158272 344
40 3300006173 Ga0070716_100009211 Ga0070716_1000092111 344
41 3300006358 Ga0068871_100023493 Ga0068871_1000234934 344
42 3300006881 Ga0068865_100164266 Ga0068865_1001642661 344
43 3300009177 Ga0105248_10125724 Ga0105248_101257242 344
44 3300010375 Ga0105239_10124092 Ga0105239_101240923 344
45 3300013296 Ga0157374_10005077 Ga0157374_100050778 344
46 3300014325 Ga0163163_10073735 Ga0163163_100737353 344
47 3300014968 Ga0157379_10054036 Ga0157379_100540363 344
48 3300025898 Ga0207692_10149482 Ga0207692_101494821 344
49 3300025908 Ga0207643_10071845 Ga0207643_100718453 344
50 3300025911 Ga0207654_10046094 Ga0207654_100460942 344
51 3300025915 Ga0207693_10001364 Ga0207693_100013644 344
52 3300025933 Ga0207706_10016465 Ga0207706_100164654 344
53 3300025934 Ga0207686_10000089 Ga0207686_1000008968 344
54 3300025936 Ga0207670_10029481 Ga0207670_100294812 344
55 3300025938 Ga0207704_10022183 Ga0207704_100221832 344
56 3300025939 Ga0207665_10003701 Ga0207665_100037019 344
57 3300025941 Ga0207711_10002173 Ga0207711_100021739 344
58 3300025942 Ga0207689_10009449 Ga0207689_100094495 344
59 3300025981 Ga0207640_10023515 Ga0207640_100235154 344
60 3300026023 Ga0207677_10002574 Ga0207677_100025748 344
61 3300026035 Ga0207703_10005182 Ga0207703_100051828 344
62 3300026078 Ga0207702_10337900 Ga0207702_103379002 344
63 3300026095 Ga0207676_10000724 Ga0207676_1000072415 344
64 3300026121 Ga0207683_10000354 Ga0207683_100003549 344
65 3300026142 Ga0207698_10068026 Ga0207698_100680262 344
66 3300035117 Ga0373953_0009991 Ga0373953_0009991_875_1987 344
67 3300035120 Ga0373957_0001108 Ga0373957_0001108_3050_4162 344
68 3300035171 Ga0373946_0019393 Ga0373946_0019393_589_1701 344
69 3300035171 Ga0373946_0072796 Ga0373946_0072796_352_1464 344
70 3300035172 Ga0373955_0103082 Ga0373955_0103082_54_1166 344
71 3300035692 Ga0373935_0046764 Ga0373935_0046764_492_1604 344
72 3300035695 Ga0373927_0009403 Ga0373927_0009403_4681_5793 344
73 3300035724 Ga0373933_0036399 Ga0373933_0036399_1203_2315 344
74 3300036401 Ga0373937_0060564 Ga0373937_0060564_1121_2233 344
75 3300037068 Ga0373925_0023825 Ga0373925_0023825_44_1156 344
76 3300037068 Ga0373925_0038533 Ga0373925_0038533_1117_2229 344
77 3300046459 Ga0495629_0085002 Ga0495629_0085002_745_1857 344
78 3300046472 Ga0495580_0080814 Ga0495580_0080814_346_1458 344
79 3300046473 Ga0495582_0031129 Ga0495582_0031129_1162_2274 344
80 3300046476 Ga0495662_0030891 Ga0495662_0030891_505_1617 344
81 3300046491 Ga0495584_0016392 Ga0495584_0016392_530_1570 344
82 3300046499 Ga0495594_0142649 Ga0495594_0142649_127_1239 344
83 3300046526 Ga0495666_0032405 Ga0495666_0032405_637_1749 344
84 3300046536 Ga0495587_0100535 Ga0495587_0100535_351_1463 344
85 3300046539 Ga0495621_0016104 Ga0495621_0016104_1168_2280 344
86 3300046543 Ga0495645_0043896 Ga0495645_0043896_339_1451 344
87 3300046559 Ga0495667_0087527 Ga0495667_0087527_350_1462 344
88 3300046663 Ga0495635_0018783 Ga0495635_0018783_1288_2400 344
89 3300046681 Ga0495647_0007230 Ga0495647_0007230_1471_2583 344
90 3300046683 Ga0495658_0133224 Ga0495658_0133224_130_1242 344
91 3300047315 Ga0495581_0029151 Ga0495581_0029151_640_1752 344
92 3300047673 Ga0495593_0029917 Ga0495593_0029917_1591_2703 344
93 3300048903 Ga0496100_0080627 Ga0496100_0080627_799_1911 344
94 3300048907 Ga0496104_0108920 Ga0496104_0108920_1492_2604 344
95 3300048908 Ga0496105_0034735 Ga0496105_0034735_373_1485 344
96 3300048911 Ga0496108_0415930 Ga0496108_0415930_21_1133 344
97 3300048918 Ga0496115_0063391 Ga0496115_0063391_1073_2185 344
98 3300042005 Ga0439448_0023604 Ga0439448_0023604_402_1514 345
99 3300005339 Ga0070660_100044166 Ga0070660_1000441663 346
100 3300005344 Ga0070661_100048867 Ga0070661_1000488672 346
101 3300005434 Ga0070709_10062075 Ga0070709_100620752 346
102 3300005444 Ga0070694_100040466 Ga0070694_1000404662 346
103 3300005467 Ga0070706_100067702 Ga0070706_1000677023 346
104 3300005471 Ga0070698_100198347 Ga0070698_1001983472 346
105 3300005518 Ga0070699_100004479 Ga0070699_1000044792 346
106 3300005535 Ga0070684_100037077 Ga0070684_1000370772 346
107 3300005536 Ga0070697_100106790 Ga0070697_1001067902 346
108 3300005546 Ga0070696_100045904 Ga0070696_1000459042 346
109 3300005564 Ga0070664_100045233 Ga0070664_1000452333 346
110 3300005578 Ga0068854_100041525 Ga0068854_1000415254 346
111 3300006175 Ga0070712_100160332 Ga0070712_1001603322 346
112 3300009093 Ga0105240_10089082 Ga0105240_100890822 346
113 3300009174 Ga0105241_10134519 Ga0105241_101345192 346
114 3300009551 Ga0105238_10032510 Ga0105238_100325101 346
115 3300025321 Ga0207656_10066502 Ga0207656_100665022 346
116 3300025915 Ga0207693_10177221 Ga0207693_101772213 346
117 3300025919 Ga0207657_10003005 Ga0207657_1000300511 346
118 3300025920 Ga0207649_10148807 Ga0207649_101488072 346
119 3300025927 Ga0207687_10117514 Ga0207687_101175142 346
120 3300025929 Ga0207664_10004770 Ga0207664_100047708 346
121 3300025932 Ga0207690_10182748 Ga0207690_101827482 346
122 3300025939 Ga0207665_10113445 Ga0207665_101134452 346
123 3300025944 Ga0207661_10271960 Ga0207661_102719602 346
124 3300026078 Ga0207702_10068207 Ga0207702_100682072 346
125 3300026116 Ga0207674_10015863 Ga0207674_100158632 346
126 3300026118 Ga0207675_100105461 Ga0207675_1001054612 346
127 3300035410 Ga0373924_0000823 Ga0373924_0000823_2200_3303 346
128 3300046660 Ga0495625_0109889 Ga0495625_0109889_649_1692 346
129 3300048909 Ga0496106_0107492 Ga0496106_0107492_157_1269 346
130 3300050514 nmdc:mga08x19_225778_c1 nmdc:mga08x19_225778_c1_10_1053 346
131 3300030731 Ga0316177_1076590 Ga0316177_10765902 347
132 3300039447 Ga0436361_0094991 Ga0436361_0094991_5820_6896 348
133 3300039447 Ga0436361_0953382 Ga0436361_0953382_3979_5058 348
134 3300046455 Ga0495603_0025448 Ga0495603_0025448_1142_2257 351
135 3300046492 Ga0495585_0052255 Ga0495585_0052255_671_1786 351
136 3300046499 Ga0495594_0001996 Ga0495594_0001996_4931_6046 351
137 3300046507 Ga0495606_0000187 Ga0495606_0000187_32329_33438 351
138 3300046691 Ga0495670_0077530 Ga0495670_0077530_522_1637 351
139 3300047472 Ga0495686_0036664 Ga0495686_0036664_1223_2332 351
140 3300046499 Ga0495594_0114282 Ga0495594_0114282_24_1085 353
141 3300047320 Ga0495672_0000078 Ga0495672_0000078_129974_131053 353
142 iso_pu_bacteria 2857564685 2857569501 354
143 3300046491 Ga0495584_0002582 Ga0495584_0002582_5122_6237 356
144 3300046530 Ga0495654_0024625 Ga0495654_0024625_1490_2605 356
145 3300046557 Ga0495622_0000500 Ga0495622_0000500_19102_20214 356
146 3300046616 Ga0495668_0014801 Ga0495668_0014801_3426_4541 356
147 3300047320 Ga0495672_0007705 Ga0495672_0007705_4029_5144 356
148 3300003775 Ga0055524_1000049 Ga0055524_1000049134 357
149 3300006948 Ga0099826_10000005 Ga0099826_10000005199 357
150 3300013102 Ga0157371_10000153 Ga0157371_1000015332 357
151 3300025295 Ga0209564_1010725 Ga0209564_10107252 357
152 3300025299 Ga0209256_1000040 Ga0209256_1000040199 357
153 3300027666 Ga0209282_1000003 Ga0209282_1000003601 357
154 3300031711 Ga0265314_10130552 Ga0265314_101305521 357
155 3300046471 Ga0495650_0000297 Ga0495650_0000297_37509_38621 357
156 3300046542 Ga0495597_0005953 Ga0495597_0005953_884_1999 357
157 3300003316 rootH1_10086751 rootH1_100867512 358
158 3300003775 Ga0055524_1000022 Ga0055524_100002244 358
159 3300005366 Ga0070659_100001264 Ga0070659_10000126421 358
160 3300009036 Ga0105244_10002568 Ga0105244_1000256810 358
161 3300025920 Ga0207649_10071884 Ga0207649_100718842 358
162 3300025932 Ga0207690_10005914 Ga0207690_100059142 358
163 3300025945 Ga0207679_10018193 Ga0207679_100181932 358
164 3300046452 Ga0495617_000011 Ga0495617_000011_254704_255780 358
165 3300046460 Ga0495638_0000354 Ga0495638_0000354_53599_54678 358
166 3300046463 Ga0495653_0000102 Ga0495653_0000102_21092_22168 358
167 3300046471 Ga0495650_0000356 Ga0495650_0000356_46279_47358 358
168 3300046471 Ga0495650_0000774 Ga0495650_0000774_21767_22843 358
169 3300046471 Ga0495650_0001404 Ga0495650_0001404_18109_19188 358
170 3300046474 Ga0495605_0000041 Ga0495605_0000041_48139_49218 358
171 3300046491 Ga0495584_0154059 Ga0495584_0154059_55_1134 358
172 3300046492 Ga0495585_0002800 Ga0495585_0002800_1834_2910 358
173 3300046501 Ga0495607_0005783 Ga0495607_0005783_505_1584 358
174 3300046501 Ga0495607_0008758 Ga0495607_0008758_5209_6288 358
175 3300046506 Ga0495583_0000063 Ga0495583_0000063_29587_30666 358
176 3300046507 Ga0495606_0000169 Ga0495606_0000169_7684_8760 358
177 3300046507 Ga0495606_0000494 Ga0495606_0000494_7413_8492 358
178 3300046512 Ga0495610_0000007 Ga0495610_0000007_773239_774315 358
179 3300046512 Ga0495610_0001852 Ga0495610_0001852_5875_6954 358
180 3300046524 Ga0495648_0004096 Ga0495648_0004096_2024_3103 358
181 3300046524 Ga0495648_0010177 Ga0495648_0010177_5371_6447 358
182 3300046530 Ga0495654_0000025 Ga0495654_0000025_40887_41963 358
183 3300046530 Ga0495654_0005119 Ga0495654_0005119_3497_4573 358
184 3300046530 Ga0495654_0015481 Ga0495654_0015481_2349_3428 358
185 3300046538 Ga0495609_0002738 Ga0495609_0002738_5759_6838 358
186 3300046542 Ga0495597_0012473 Ga0495597_0012473_1196_2275 358
187 3300046558 Ga0495633_0007489 Ga0495633_0007489_4586_5665 358
188 3300046558 Ga0495633_0016280 Ga0495633_0016280_1631_2707 358
189 3300046615 Ga0495656_0102203 Ga0495656_0102203_24_1103 358
190 3300046616 Ga0495668_0000219 Ga0495668_0000219_51827_52906 358
191 3300046616 Ga0495668_0004388 Ga0495668_0004388_5061_6140 358
192 3300046616 Ga0495668_0005639 Ga0495668_0005639_2757_3833 358
193 3300046660 Ga0495625_0000821 Ga0495625_0000821_34419_35498 358
194 3300046664 Ga0495659_0000010 Ga0495659_0000010_56063_57142 358
195 3300046664 Ga0495659_0035642 Ga0495659_0035642_481_1560 358
196 3300046665 Ga0495661_0047890 Ga0495661_0047890_995_2071 358
197 3300046665 Ga0495661_0075531 Ga0495661_0075531_376_1455 358
198 3300046692 Ga0495671_0000196 Ga0495671_0000196_9496_10572 358
199 3300046692 Ga0495671_0000614 Ga0495671_0000614_6410_7489 358
200 3300046692 Ga0495671_0155350 Ga0495671_0155350_11_1087 358
201 3300046694 Ga0495649_0019122 Ga0495649_0019122_2476_3591 358
202 3300047318 Ga0495636_0011693 Ga0495636_0011693_2374_3453 358
203 3300047320 Ga0495672_0000107 Ga0495672_0000107_100747_101826 358
204 3300047320 Ga0495672_0058641 Ga0495672_0058641_1139_2218 358
205 3300047323 Ga0495683_0001444 Ga0495683_0001444_13015_14094 358
206 3300047443 Ga0495687_000562 Ga0495687_000562_25237_26316 358
207 3300047445 Ga0495677_0006273 Ga0495677_0006273_574_1653 358
208 3300047469 Ga0495673_0000173 Ga0495673_0000173_47724_48800 358
209 3300047469 Ga0495673_0017436 Ga0495673_0017436_573_1652 358
210 3300048905 Ga0496102_0000097 Ga0496102_0000097_34372_35448 358
211 3300048906 Ga0496103_0002958 Ga0496103_0002958_4069_5181 358
212 3300048919 Ga0496116_0012419 Ga0496116_0012419_3313_4392 358
213 3300048926 Ga0496123_0003832 Ga0496123_0003832_15216_16292 358
214 3300048929 Ga0496126_0025776 Ga0496126_0025776_2975_4054 358
215 3300049460 Ga0495682_0001101 Ga0495682_0001101_14604_15683 358
216 3300049775 Ga0501279_004692 Ga0501279_004692_174_1253 358
217 3300049775 Ga0501279_005671 Ga0501279_005671_252_1331 358
218 3300053125 Ga0500618_000437 Ga0500618_000437_282_1358 358
219 3300053145 Ga0500586_006285 Ga0500586_006285_1812_2888 358
220 3300021361 Ga0213872_10000065 Ga0213872_1000006561 359
221 3300021361 Ga0213872_10001325 Ga0213872_100013258 359
222 3300021361 Ga0213872_10019758 Ga0213872_100197582 359
223 3300021361 Ga0213872_10042999 Ga0213872_100429992 359
224 3300021361 Ga0213872_10045535 Ga0213872_100455352 359
225 3300025250 Ga0209026_1004565 Ga0209026_10045652 359
226 3300039447 Ga0436361_0152297 Ga0436361_0152297_2841_3956 359
227 3300039447 Ga0436361_0340593 Ga0436361_0340593_4802_5917 359
228 3300039447 Ga0436361_0851270 Ga0436361_0851270_19279_20361 359
229 3300046525 Ga0495663_0019873 Ga0495663_0019873_676_1788 359
230 3300048090 Ga0495615_0001202 Ga0495615_0001202_21_1133 359
231 3300049459 Ga0495678_048240 Ga0495678_048240_397_1479 359
232 3300003759 Ga0055525_1000179 Ga0055525_100017924 360
233 3300005327 Ga0070658_10076930 Ga0070658_100769302 360
234 3300005327 Ga0070658_10238587 Ga0070658_102385871 360
235 3300005339 Ga0070660_100070378 Ga0070660_1000703782 360
236 3300005366 Ga0070659_100051729 Ga0070659_1000517292 360
237 3300005563 Ga0068855_100033221 Ga0068855_1000332212 360
238 3300006237 Ga0097621_100197464 Ga0097621_1001974642 360
239 3300009098 Ga0105245_10069028 Ga0105245_100690282 360
240 3300009148 Ga0105243_10054586 Ga0105243_100545863 360
241 3300009174 Ga0105241_10086633 Ga0105241_100866332 360
242 3300009545 Ga0105237_10354181 Ga0105237_103541812 360
243 3300025230 Ga0209563_100143 Ga0209563_10014352 360
244 3300025909 Ga0207705_10000950 Ga0207705_100009509 360
245 3300025913 Ga0207695_10198968 Ga0207695_101989682 360
246 3300025919 Ga0207657_10003467 Ga0207657_100034674 360
247 3300025919 Ga0207657_10053529 Ga0207657_100535292 360
248 3300025932 Ga0207690_10016991 Ga0207690_100169913 360
249 3300025933 Ga0207706_10030268 Ga0207706_100302683 360
250 3300025942 Ga0207689_10145731 Ga0207689_101457312 360
251 3300026078 Ga0207702_10157009 Ga0207702_101570091 360
252 3300026116 Ga0207674_10134891 Ga0207674_101348912 360
253 3300037312 Ga0395899_0014276 Ga0395899_0014276_4542_5657 360
254 3300037312 Ga0395899_0024078 Ga0395899_0024078_1932_3047 360
255 3300037418 Ga0395900_0003249 Ga0395900_0003249_4429_5544 360
256 3300037418 Ga0395900_0014771 Ga0395900_0014771_2573_3688 360
257 3300037418 Ga0395900_0022682 Ga0395900_0022682_3510_4625 360
258 3300037466 Ga0395898_0074868 Ga0395898_0074868_32_1147 360
259 3300037471 Ga0395905_0185706 Ga0395905_0185706_811_1926 360
260 3300038443 Ga0395901_0012410 Ga0395901_0012410_56_1171 360
261 3300042005 Ga0439448_0001900 Ga0439448_0001900_518_1633 360
262 3300042008 Ga0439450_016155 Ga0439450_016155_293_1408 360
263 3300044658 Ga0466972_0001677 Ga0466972_0001677_5372_6487 360
264 3300044683 Ga0466965_0016998 Ga0466965_0016998_1177_2292 360
265 3300044683 Ga0466965_0084653 Ga0466965_0084653_106_1221 360
266 3300044684 Ga0466966_0002043 Ga0466966_0002043_8993_10108 360
267 3300044684 Ga0466966_0029371 Ga0466966_0029371_802_1917 360
268 3300044706 Ga0466964_0000857 Ga0466964_0000857_4261_5376 360
269 3300044706 Ga0466964_0008893 Ga0466964_0008893_264_1379 360
270 3300044719 Ga0466971_0069367 Ga0466971_0069367_106_1221 360
271 3300044735 Ga0466968_0019228 Ga0466968_0019228_1042_2157 360
272 3300044842 Ga0466957_0000040 Ga0466957_0000040_4141_5256 360
273 3300045049 Ga0466959_0018761 Ga0466959_0018761_2048_3163 360
274 3300045049 Ga0466959_0040979 Ga0466959_0040979_1878_2993 360
275 3300045049 Ga0466959_0187746 Ga0466959_0187746_278_1393 360
276 3300045836 Ga0466958_0068493 Ga0466958_0068493_545_1660 360
277 3300045976 Ga0466967_0015803 Ga0466967_0015803_2756_3871 360
278 3300045976 Ga0466967_0156020 Ga0466967_0156020_1001_2116 360
279 3300046491 Ga0495584_0000550 Ga0495584_0000550_3896_5011 360
280 3300046507 Ga0495606_0023156 Ga0495606_0023156_3129_4244 360
281 3300046522 Ga0495643_0041760 Ga0495643_0041760_537_1652 360
282 3300046665 Ga0495661_0082832 Ga0495661_0082832_706_1821 360
283 3300046674 Ga0495588_0000059 Ga0495588_0000059_230519_231634 360
284 3300047443 Ga0495687_000828 Ga0495687_000828_20271_21386 360
285 3300048904 Ga0496101_0027300 Ga0496101_0027300_2849_3964 360
286 3300048916 Ga0496113_0015989 Ga0496113_0015989_2793_3908 360
287 3300048925 Ga0496122_0005263 Ga0496122_0005263_12164_13279 360
288 3300048925 Ga0496122_0025683 Ga0496122_0025683_366_1481 360
289 3300048926 Ga0496123_0003558 Ga0496123_0003558_12832_13947 360
290 3300048927 Ga0496124_0021520 Ga0496124_0021520_2595_3710 360
291 3300049459 Ga0495678_003408 Ga0495678_003408_4504_5616 360
292 3300061719 Ga0466962_0071573 Ga0466962_0071573_118_1233 360
293 3300046452 Ga0495617_005907 Ga0495617_005907_1460_2563 361
294 3300046460 Ga0495638_0006199 Ga0495638_0006199_207_1310 361
295 3300046474 Ga0495605_0005724 Ga0495605_0005724_2697_3800 361
296 3300046491 Ga0495584_0000401 Ga0495584_0000401_24847_25950 361
297 3300046492 Ga0495585_0003304 Ga0495585_0003304_1811_2914 361
298 3300046492 Ga0495585_0013795 Ga0495585_0013795_845_1948 361
299 3300046506 Ga0495583_0000056 Ga0495583_0000056_112791_113894 361
300 3300046513 Ga0495616_0000378 Ga0495616_0000378_6516_7619 361
301 3300046513 Ga0495616_0007069 Ga0495616_0007069_2573_3676 361
302 3300046523 Ga0495644_0003202 Ga0495644_0003202_3294_4397 361
303 3300046524 Ga0495648_0001488 Ga0495648_0001488_11433_12536 361
304 3300046538 Ga0495609_0001536 Ga0495609_0001536_13209_14312 361
305 3300046558 Ga0495633_0003534 Ga0495633_0003534_1213_2316 361
306 3300046615 Ga0495656_0019531 Ga0495656_0019531_362_1465 361
307 3300046648 Ga0495611_0005110 Ga0495611_0005110_3662_4765 361
308 3300046660 Ga0495625_0001604 Ga0495625_0001604_18012_19100 361
309 3300046660 Ga0495625_0016886 Ga0495625_0016886_3474_4577 361
310 3300046664 Ga0495659_0000526 Ga0495659_0000526_1401_2504 361
311 3300046665 Ga0495661_0042801 Ga0495661_0042801_474_1577 361
312 3300046691 Ga0495670_0003154 Ga0495670_0003154_4349_5452 361
313 3300046691 Ga0495670_0031576 Ga0495670_0031576_589_1692 361
314 3300047318 Ga0495636_0009359 Ga0495636_0009359_777_1880 361
315 3300047320 Ga0495672_0014433 Ga0495672_0014433_2533_3636 361
316 3300047320 Ga0495672_0033307 Ga0495672_0033307_87_1190 361
317 3300047323 Ga0495683_0003967 Ga0495683_0003967_2145_3248 361
318 3300047443 Ga0495687_001108 Ga0495687_001108_19383_20486 361
319 3300047445 Ga0495677_0001462 Ga0495677_0001462_5520_6623 361
320 3300047447 Ga0495685_000113 Ga0495685_000113_4585_5688 361
321 3300049459 Ga0495678_005649 Ga0495678_005649_1169_2272 361
322 3300049460 Ga0495682_0002626 Ga0495682_0002626_4569_5672 361
323 3300005331 Ga0070670_100001043 Ga0070670_10000104316 362
324 3300005333 Ga0070677_10000809 Ga0070677_100008097 362
325 3300005364 Ga0070673_100022136 Ga0070673_1000221362 362
326 3300005367 Ga0070667_100115333 Ga0070667_1001153333 362
327 3300005466 Ga0070685_10154991 Ga0070685_101549912 362
328 3300005467 Ga0070706_100326848 Ga0070706_1003268482 362
329 3300005468 Ga0070707_100158560 Ga0070707_1001585603 362
330 3300005543 Ga0070672_100008921 Ga0070672_1000089218 362
331 3300005548 Ga0070665_100049754 Ga0070665_1000497542 362
332 3300005618 Ga0068864_100005652 Ga0068864_1000056525 362
333 3300005840 Ga0068870_10003957 Ga0068870_100039579 362
334 3300006237 Ga0097621_100010542 Ga0097621_1000105427 362
335 3300006358 Ga0068871_100005239 Ga0068871_1000052399 362
336 3300006871 Ga0075434_100009206 Ga0075434_1000092065 362
337 3300006871 Ga0075434_100367339 Ga0075434_1003673392 362
338 3300007076 Ga0075435_100033662 Ga0075435_1000336624 362
339 3300013306 Ga0163162_10240864 Ga0163162_102408642 362
340 3300014325 Ga0163163_10198934 Ga0163163_101989342 362
341 3300017792 Ga0163161_10033109 Ga0163161_100331093 362
342 3300025321 Ga0207656_10003690 Ga0207656_100036905 362
343 3300025893 Ga0207682_10000890 Ga0207682_1000089011 362
344 3300025908 Ga0207643_10005888 Ga0207643_100058882 362
345 3300025910 Ga0207684_10081163 Ga0207684_100811632 362
346 3300025933 Ga0207706_10070192 Ga0207706_100701921 362
347 3300025940 Ga0207691_10000050 Ga0207691_1000005055 362
348 3300025986 Ga0207658_10051111 Ga0207658_100511112 362
349 3300026088 Ga0207641_10050383 Ga0207641_100503832 362
350 3300028379 Ga0268266_10004467 Ga0268266_100044679 362
351 3300035695 Ga0373927_0050150 Ga0373927_0050150_254_1366 362
352 3300046460 Ga0495638_0056095 Ga0495638_0056095_148_1263 362
353 3300046472 Ga0495580_0119499 Ga0495580_0119499_153_1265 362
354 3300046474 Ga0495605_0106941 Ga0495605_0106941_52_1167 362
355 3300046506 Ga0495583_0004154 Ga0495583_0004154_4566_5681 362
356 3300046513 Ga0495616_0000732 Ga0495616_0000732_2205_3320 362
357 3300046522 Ga0495643_0000517 Ga0495643_0000517_4699_5814 362
358 3300050512 nmdc:mga0n895_374590_c1 nmdc:mga0n895_374590_c1_258_1370 362
359 3300050515 nmdc:mga0a205_12156_c1 nmdc:mga0a205_12156_c1_2831_3943 362
360 3300015261 Ga0182006_1000138 Ga0182006_100013840 363
361 3300015265 Ga0182005_1000046 Ga0182005_100004640 363
362 3300042139 Ga0450904_000873 Ga0450904_000873_2474_3589 363
363 3300046524 Ga0495648_0047270 Ga0495648_0047270_370_1482 363
364 3300046810 Ga0495660_0075307 Ga0495660_0075307_328_1443 364
365 3300048927 Ga0496124_0007788 Ga0496124_0007788_4170_5288 364
366 iso_pu_bacteria 2511231003 2511250509 364
367 iso_pu_bacteria 2511231026 2511383441 364
368 iso_pu_bacteria 2551306416 2553005707 364
369 iso_pu_bacteria 2765235838 2765571839 364
370 iso_pu_bacteria 2808606386 2808982160 364
371 iso_pu_bacteria 2808606415 2809130040 364
372 iso_pu_bacteria 2808606419 2809148905 364
373 iso_pu_bacteria 2818991436 2819542239 364
374 iso_pu_bacteria 2818991445 2819595605 364
375 iso_pu_bacteria 2818991449 2819617280 364
376 iso_pu_bacteria 2839094727 2839098440 364
377 iso_pu_bacteria 2852618963 2852619040 364
378 iso_pu_bacteria 2884811622 2884816191 364
379 iso_pu_bacteria 2884836552 2884839366 364
380 iso_pu_bacteria 2884852848 2884856824 364
381 iso_pu_bacteria 2896154374 2896158170 364
382 iso_pu_bacteria 2904439833 2904442919 364
383 iso_pu_bacteria 2904530477 2904534881 364
384 iso_pu_bacteria 2904584206 2904588776 364
385 iso_pu_bacteria 2904589729 2904594150 364
386 iso_pu_bacteria 2904601388 2904605012 364
387 iso_pu_bacteria 2919046199 2919048582 364
388 iso_pu_bacteria 2919079590 2919083246 364
389 iso_pu_bacteria 2923510766 2923514390 364
390 iso_pu_bacteria 2928130867 2928133106 364
391 iso_pu_bacteria 2643221554 2643788934 365
392 iso_pu_bacteria 2643221638 2644213011 365
393 iso_pu_bacteria 2643221645 2644250790 365
394 iso_pu_bacteria 2643221664 2644358313 365
395 iso_pu_bacteria 2738541280 2738739249 365
396 iso_pu_bacteria 2738541297 2738827906 365
397 iso_pu_bacteria 2738541300 2738846969 365
398 iso_pu_bacteria 2738541357 2739151702 365
399 iso_pu_bacteria 2738543003 2739193622 365
400 iso_pu_bacteria 2738543018 2739276027 365
401 iso_pu_bacteria 2738543026 2739320098 365
402 iso_pu_bacteria 2738543029 2739338339 365
403 iso_pu_bacteria 2738543030 2739345071 365
404 iso_pu_bacteria 2821131069 2821136134 365
405 iso_pu_bacteria 2842711865 2842717845 365
406 iso_pu_bacteria 2857553236 2857556654 365
407 iso_pu_bacteria 2857558681 2857563511 365
408 iso_pu_bacteria 2904424332 2904429661 365
409 iso_pu_bacteria 2919476304 2919480594 365
410 3300042126 Ga0450888_002193 Ga0450888_002193_371_1489 366
411 3300042876 Ga0451577_0065391 Ga0451577_0065391_1474_2592 366
412 3300042876 Ga0451577_0384613 Ga0451577_0384613_109_1227 366
413 3300044712 Ga0453684_0115016 Ga0453684_0115016_691_1809 366
414 iso_pu_bacteria 2643221556 2643797135 366
415 iso_pu_bacteria 2643221684 2644469761 366
416 iso_pu_bacteria 2808606418 2809147440 366
417 iso_pu_bacteria 8047673197 8047676578 366
418 3300002704 JGI25155J39150_1000140 JGI25155J39150_100014014 367
419 3300002704 JGI25155J39150_1000167 JGI25155J39150_100016712 367
420 3300002737 JGI25162J39368_1000023 JGI25162J39368_1000023178 367
421 3300002737 JGI25162J39368_1005670 JGI25162J39368_10056702 367
422 3300002738 JGI25154J39366_1000372 JGI25154J39366_100037220 367
423 3300002738 JGI25154J39366_1000748 JGI25154J39366_100074811 367
424 3300002741 JGI25157J39369_1000294 JGI25157J39369_100029415 367
425 3300002741 JGI25157J39369_1000325 JGI25157J39369_100032530 367
426 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030122 367
427 3300003751 Ga0055538_1000017 Ga0055538_1000017178 367
428 3300003751 Ga0055538_1000024 Ga0055538_100002492 367
429 3300003752 Ga0055539_1000022 Ga0055539_1000022178 367
430 3300003752 Ga0055539_1000031 Ga0055539_100003192 367
431 3300003756 Ga0055533_1000030 Ga0055533_1000030178 367
432 3300003756 Ga0055533_1000041 Ga0055533_100004192 367
433 3300003758 Ga0055532_1000074 Ga0055532_100007428 367
434 3300003759 Ga0055525_1000034 Ga0055525_1000034178 367
435 3300003759 Ga0055525_1000049 Ga0055525_100004992 367
436 3300003841 Ga0055541_1000015 Ga0055541_1000015178 367
437 3300003841 Ga0055541_1000022 Ga0055541_100002292 367
438 3300005331 Ga0070670_100005639 Ga0070670_1000056394 367
439 3300005563 Ga0068855_100004477 Ga0068855_10000447716 367
440 3300005563 Ga0068855_100005723 Ga0068855_10000572312 367
441 3300005578 Ga0068854_100119647 Ga0068854_1001196472 367
442 3300005614 Ga0068856_100047465 Ga0068856_1000474652 367
443 3300005616 Ga0068852_100041477 Ga0068852_1000414774 367
444 3300006058 Ga0075432_10056982 Ga0075432_100569822 367
445 3300009093 Ga0105240_10000718 Ga0105240_1000071828 367
446 3300009093 Ga0105240_10002320 Ga0105240_1000232013 367
447 3300009545 Ga0105237_10004756 Ga0105237_100047568 367
448 3300009551 Ga0105238_10000107 Ga0105238_1000010720 367
449 3300010375 Ga0105239_10000289 Ga0105239_1000028949 367
450 3300015261 Ga0182006_1004867 Ga0182006_10048673 367
451 3300015261 Ga0182006_1059205 Ga0182006_10592052 367
452 3300015265 Ga0182005_1000207 Ga0182005_100020733 367
453 3300025206 Ga0209435_100055 Ga0209435_10005528 367
454 3300025206 Ga0209435_100248 Ga0209435_1002482 367
455 3300025207 Ga0209760_102799 Ga0209760_1027992 367
456 3300025224 Ga0209784_100018 Ga0209784_10001889 367
457 3300025224 Ga0209784_100034 Ga0209784_100034122 367
458 3300025225 Ga0209566_100016 Ga0209566_10001689 367
459 3300025225 Ga0209566_100038 Ga0209566_100038177 367
460 3300025226 Ga0209674_100030 Ga0209674_10003089 367
461 3300025226 Ga0209674_100056 Ga0209674_100056122 367
462 3300025229 Ga0209147_100097 Ga0209147_10009762 367
463 3300025230 Ga0209563_100034 Ga0209563_10003489 367
464 3300025230 Ga0209563_100057 Ga0209563_100057177 367
465 3300025231 Ga0207427_100929 Ga0207427_1009297 367
466 3300025233 Ga0209437_100071 Ga0209437_100071177 367
467 3300025233 Ga0209437_100234 Ga0209437_10023460 367
468 3300025242 Ga0209258_100192 Ga0209258_10019228 367
469 3300025246 Ga0209646_1000103 Ga0209646_100010362 367
470 3300025246 Ga0209646_1000346 Ga0209646_100034628 367
471 3300025250 Ga0209026_1000134 Ga0209026_100013428 367
472 3300025250 Ga0209026_1003217 Ga0209026_10032172 367
473 3300025253 Ga0209677_100019 Ga0209677_10001989 367
474 3300025253 Ga0209677_100035 Ga0209677_100035122 367
475 3300025256 Ga0209759_1000091 Ga0209759_100009162 367
476 3300025256 Ga0209759_1000857 Ga0209759_100085720 367
477 3300025261 Ga0209233_1000094 Ga0209233_1000094177 367
478 3300025913 Ga0207695_10001004 Ga0207695_1000100430 367
479 3300025913 Ga0207695_10009358 Ga0207695_100093582 367
480 3300025913 Ga0207695_10053518 Ga0207695_100535184 367
481 3300025914 Ga0207671_10001366 Ga0207671_1000136612 367
482 3300025924 Ga0207694_10000130 Ga0207694_1000013068 367
483 3300025925 Ga0207650_10002315 Ga0207650_100023159 367
484 3300025949 Ga0207667_10000110 Ga0207667_10000110114 367
485 3300025949 Ga0207667_10003783 Ga0207667_1000378318 367
486 3300025981 Ga0207640_10004306 Ga0207640_100043067 367
487 3300026142 Ga0207698_10006700 Ga0207698_100067005 367
488 3300039447 Ga0436361_0768404 Ga0436361_0768404_7411_8520 367
489 3300044842 Ga0466957_0126482 Ga0466957_0126482_199_1305 367
490 3300046463 Ga0495653_0002192 Ga0495653_0002192_12745_13857 367
491 3300046511 Ga0495608_0001695 Ga0495608_0001695_7644_8756 367
492 3300046514 Ga0495618_0010248 Ga0495618_0010248_2798_3910 367
493 3300046516 Ga0495628_0001477 Ga0495628_0001477_10965_12077 367
494 3300046529 Ga0495652_0044072 Ga0495652_0044072_1331_2443 367
495 3300046675 Ga0495657_0015496 Ga0495657_0015496_766_1878 367
496 3300046678 Ga0495599_0032849 Ga0495599_0032849_376_1488 367
497 3300046679 Ga0495623_0014841 Ga0495623_0014841_185_1297 367
498 3300046680 Ga0495646_0007728 Ga0495646_0007728_2951_4063 367
499 3300046690 Ga0495624_0050104 Ga0495624_0050104_1431_2543 367
500 3300046809 Ga0495600_0010417 Ga0495600_0010417_78_1190 367
501 3300047317 Ga0495604_0004528 Ga0495604_0004528_937_2049 367
502 3300048919 Ga0496116_0003789 Ga0496116_0003789_6577_7686 367
503 3300048925 Ga0496122_0003878 Ga0496122_0003878_13541_14650 367
504 3300048926 Ga0496123_0000912 Ga0496123_0000912_13669_14778 367
505 3300048928 Ga0496125_0003100 Ga0496125_0003100_17930_19039 367
506 3300053077 Ga0495601_0005679 Ga0495601_0005679_4000_5112 367
507 3300053119 Ga0500595_005622 Ga0500595_005622_217_1329 367
508 3300053141 Ga0500574_021706 Ga0500574_021706_113_1225 367
509 iso_pu_bacteria 2521172590 2521560587 367
510 3300006175 Ga0070712_100087600 Ga0070712_1000876002 368
511 3300037312 Ga0395899_0004514 Ga0395899_0004514_7587_8708 368
512 3300037312 Ga0395899_0007052 Ga0395899_0007052_403_1524 368
513 3300037312 Ga0395899_0010060 Ga0395899_0010060_2329_3441 368
514 3300037418 Ga0395900_0013499 Ga0395900_0013499_219_1331 368
515 3300037418 Ga0395900_0044607 Ga0395900_0044607_2334_3455 368
516 3300037418 Ga0395900_0324919 Ga0395900_0324919_256_1368 368
517 3300037471 Ga0395905_0001092 Ga0395905_0001092_17792_18904 368
518 3300037471 Ga0395905_0017352 Ga0395905_0017352_1951_3063 368
519 3300037471 Ga0395905_0070275 Ga0395905_0070275_767_1879 368
520 3300038443 Ga0395901_0526297 Ga0395901_0526297_11_1132 368
521 3300044658 Ga0466972_0000037 Ga0466972_0000037_79675_80814 368
522 3300044658 Ga0466972_0000269 Ga0466972_0000269_20310_21422 368
523 3300044658 Ga0466972_0003487 Ga0466972_0003487_2480_3595 368
524 3300044683 Ga0466965_0008151 Ga0466965_0008151_656_1771 368
525 3300044719 Ga0466971_0030139 Ga0466971_0030139_30_1142 368
526 3300044735 Ga0466968_0005311 Ga0466968_0005311_2697_3812 368
527 3300044735 Ga0466968_0005812 Ga0466968_0005812_527_1642 368
528 3300046462 Ga0495651_0008564 Ga0495651_0008564_4076_5188 368
529 3300046511 Ga0495608_0008843 Ga0495608_0008843_2175_3287 368
530 3300046528 Ga0495642_0033790 Ga0495642_0033790_352_1464 368
531 3300046616 Ga0495668_0025501 Ga0495668_0025501_734_1846 368
532 3300046665 Ga0495661_0003348 Ga0495661_0003348_4313_5425 368
533 3300046679 Ga0495623_0007728 Ga0495623_0007728_2251_3363 368
534 3300047443 Ga0495687_004239 Ga0495687_004239_4427_5539 368
535 3300047472 Ga0495686_0000387 Ga0495686_0000387_30252_31361 368
536 3300048088 Ga0495602_0029800 Ga0495602_0029800_4027_5139 368
537 3300048907 Ga0496104_0376008 Ga0496104_0376008_97_1209 368
538 3300048909 Ga0496106_0050665 Ga0496106_0050665_1657_2769 368
539 3300048911 Ga0496108_0070128 Ga0496108_0070128_1382_2494 368
540 3300048912 Ga0496109_0447473 Ga0496109_0447473_23_1135 368
541 3300048914 Ga0496111_0054088 Ga0496111_0054088_1112_2224 368
542 3300061719 Ga0466962_0073054 Ga0466962_0073054_500_1612 368
543 3300002738 JGI25154J39366_1002151 JGI25154J39366_10021513 369
544 3300002773 JGI25152J39213_1000994 JGI25152J39213_10009949 369
545 3300002774 JGI25150J39212_1000726 JGI25150J39212_10007265 369
546 3300002774 JGI25150J39212_1000752 JGI25150J39212_10007525 369
547 3300002987 JGI25159J45721_1017559 JGI25159J45721_10175592 369
548 3300003354 JGI25160J50197_1000548 JGI25160J50197_10005487 369
549 3300003374 JGI25161J50226_1000872 JGI25161J50226_10008729 369
550 3300003762 Ga0055542_1013195 Ga0055542_10131951 369
551 3300003763 Ga0055529_1000027 Ga0055529_100002766 369
552 3300003771 Ga0055526_1001365 Ga0055526_100136514 369
553 3300003771 Ga0055526_1001772 Ga0055526_10017725 369
554 3300003771 Ga0055526_1002513 Ga0055526_10025139 369
555 3300003771 Ga0055526_1004528 Ga0055526_10045283 369
556 3300003773 Ga0055537_1000172 Ga0055537_100017242 369
557 3300003775 Ga0055524_1001210 Ga0055524_10012104 369
558 3300003775 Ga0055524_1001582 Ga0055524_10015825 369
559 3300003775 Ga0055524_1002507 Ga0055524_10025078 369
560 3300003784 Ga0055534_1000169 Ga0055534_100016912 369
561 3300003784 Ga0055534_1001643 Ga0055534_10016432 369
562 3300003790 Ga0055528_1000482 Ga0055528_100048223 369
563 3300003790 Ga0055528_1000486 Ga0055528_100048612 369
564 3300003790 Ga0055528_1003257 Ga0055528_10032575 369
565 3300003794 Ga0055531_10004385 Ga0055531_100043852 369
566 3300005262 Ga0065165_1000882 Ga0065165_10008829 369
567 3300005262 Ga0065165_1004612 Ga0065165_10046123 369
568 3300005262 Ga0065165_1029628 Ga0065165_10296282 369
569 3300005288 Ga0065714_10024661 Ga0065714_100246611 369
570 3300005293 Ga0065715_10173908 Ga0065715_101739082 369
571 3300009036 Ga0105244_10009443 Ga0105244_100094433 369
572 3300013296 Ga0157374_10268083 Ga0157374_102680831 369
573 3300013307 Ga0157372_10154334 Ga0157372_101543342 369
574 3300021361 Ga0213872_10000403 Ga0213872_1000040315 369
575 3300025208 Ga0209436_100389 Ga0209436_1003897 369
576 3300025208 Ga0209436_100991 Ga0209436_1009919 369
577 3300025208 Ga0209436_106134 Ga0209436_1061342 369
578 3300025245 Ga0207425_1000013 Ga0207425_100001346 369
579 3300025245 Ga0207425_1000152 Ga0207425_100015236 369
580 3300025245 Ga0207425_1000675 Ga0207425_100067514 369
581 3300025246 Ga0209646_1000120 Ga0209646_100012079 369
582 3300025254 Ga0209148_1000229 Ga0209148_100022939 369
583 3300025258 Ga0209129_1000152 Ga0209129_100015247 369
584 3300025258 Ga0209129_1014454 Ga0209129_10144542 369
585 3300025263 Ga0209565_1000159 Ga0209565_100015942 369
586 3300025263 Ga0209565_1000671 Ga0209565_10006717 369
587 3300025263 Ga0209565_1001875 Ga0209565_10018758 369
588 3300025263 Ga0209565_1002041 Ga0209565_10020415 369
589 3300025263 Ga0209565_1003700 Ga0209565_10037002 369
590 3300025272 Ga0209455_1000033 Ga0209455_1000033378 369
591 3300025273 Ga0209673_1000006 Ga0209673_100000642 369
592 3300025284 Ga0209130_1000425 Ga0209130_100042518 369
593 3300025284 Ga0209130_1000521 Ga0209130_10005219 369
594 3300025291 Ga0209675_1000005 Ga0209675_1000005729 369
595 3300025291 Ga0209675_1001647 Ga0209675_100164710 369
596 3300025291 Ga0209675_1002204 Ga0209675_10022048 369
597 3300025295 Ga0209564_1000028 Ga0209564_1000028428 369
598 3300025295 Ga0209564_1000154 Ga0209564_1000154113 369
599 3300025295 Ga0209564_1000604 Ga0209564_100060452 369
600 3300025295 Ga0209564_1000774 Ga0209564_100077410 369
601 3300025295 Ga0209564_1005527 Ga0209564_10055274 369
602 3300025295 Ga0209564_1030062 Ga0209564_10300622 369
603 3300025297 Ga0209758_1000031 Ga0209758_1000031418 369
604 3300025297 Ga0209758_1000354 Ga0209758_100035440 369
605 3300025298 Ga0209050_1015337 Ga0209050_10153371 369
606 3300025299 Ga0209256_1000035 Ga0209256_100003544 369
607 3300025299 Ga0209256_1000274 Ga0209256_100027442 369
608 3300025299 Ga0209256_1000414 Ga0209256_10004145 369
609 3300025299 Ga0209256_1000426 Ga0209256_100042635 369
610 3300025299 Ga0209256_1003215 Ga0209256_10032155 369
611 3300025302 Ga0207426_1001125 Ga0207426_100112521 369
612 3300025304 Ga0209257_1000157 Ga0209257_1000157140 369
613 3300025728 Ga0207655_1003180 Ga0207655_10031803 369
614 3300025728 Ga0207655_1006901 Ga0207655_10069015 369
615 3300025909 Ga0207705_10216202 Ga0207705_102162022 369
616 3300027666 Ga0209282_1000003 Ga0209282_10000035 369
617 3300028794 Ga0307515_10161474 Ga0307515_101614742 369
618 3300031548 Ga0307408_100000129 Ga0307408_10000012941 369
619 3300031548 Ga0307408_100000610 Ga0307408_10000061032 369
620 3300031548 Ga0307408_100010855 Ga0307408_1000108551 369
621 3300031548 Ga0307408_100038053 Ga0307408_1000380532 369
622 3300032002 Ga0307416_100001560 Ga0307416_1000015602 369
623 3300037312 Ga0395899_0000085 Ga0395899_0000085_45504_46622 369
624 3300037312 Ga0395899_0011675 Ga0395899_0011675_3132_4247 369
625 3300037418 Ga0395900_0001335 Ga0395900_0001335_8957_10072 369
626 3300037418 Ga0395900_0041013 Ga0395900_0041013_1878_2993 369
627 3300037418 Ga0395900_0450433 Ga0395900_0450433_54_1172 369
628 3300037466 Ga0395898_0359723 Ga0395898_0359723_25_1143 369
629 3300037471 Ga0395905_0068903 Ga0395905_0068903_2147_3265 369
630 3300037471 Ga0395905_0089118 Ga0395905_0089118_1694_2812 369
631 3300037471 Ga0395905_0195913 Ga0395905_0195913_555_1670 369
632 3300038443 Ga0395901_0000227 Ga0395901_0000227_33095_34210 369
633 3300038443 Ga0395901_0172746 Ga0395901_0172746_24_1139 369
634 3300039447 Ga0436361_0632131 Ga0436361_0632131_5765_6880 369
635 3300044683 Ga0466965_0012191 Ga0466965_0012191_196_1311 369
636 3300046452 Ga0495617_000046 Ga0495617_000046_76010_77128 369
637 3300046452 Ga0495617_001784 Ga0495617_001784_3661_4773 369
638 3300046452 Ga0495617_003526 Ga0495617_003526_4448_5566 369
639 3300046453 Ga0495627_000006 Ga0495627_000006_537458_538570 369
640 3300046453 Ga0495627_001231 Ga0495627_001231_4077_5195 369
641 3300046453 Ga0495627_005070 Ga0495627_005070_1703_2821 369
642 3300046455 Ga0495603_0015177 Ga0495603_0015177_2802_3920 369
643 3300046457 Ga0495590_0000022 Ga0495590_0000022_152168_153280 369
644 3300046457 Ga0495590_0000134 Ga0495590_0000134_1778_2896 369
645 3300046457 Ga0495590_0000881 Ga0495590_0000881_4306_5421 369
646 3300046457 Ga0495590_0011223 Ga0495590_0011223_1387_2505 369
647 3300046457 Ga0495590_0017136 Ga0495590_0017136_1149_2264 369
648 3300046458 Ga0495591_002085 Ga0495591_002085_6038_7156 369
649 3300046458 Ga0495591_026425 Ga0495591_026425_48_1166 369
650 3300046459 Ga0495629_0026169 Ga0495629_0026169_798_1913 369
651 3300046460 Ga0495638_0000099 Ga0495638_0000099_59570_60682 369
652 3300046460 Ga0495638_0011848 Ga0495638_0011848_472_1590 369
653 3300046460 Ga0495638_0165608 Ga0495638_0165608_106_1224 369
654 3300046463 Ga0495653_0007995 Ga0495653_0007995_6975_8093 369
655 3300046463 Ga0495653_0063703 Ga0495653_0063703_405_1520 369
656 3300046471 Ga0495650_0000248 Ga0495650_0000248_48104_49216 369
657 3300046471 Ga0495650_0001655 Ga0495650_0001655_4530_5645 369
658 3300046471 Ga0495650_0002354 Ga0495650_0002354_9936_11048 369
659 3300046471 Ga0495650_0005152 Ga0495650_0005152_5460_6572 369
660 3300046471 Ga0495650_0010146 Ga0495650_0010146_2078_3190 369
661 3300046471 Ga0495650_0017385 Ga0495650_0017385_207_1325 369
662 3300046473 Ga0495582_0001046 Ga0495582_0001046_4267_5382 369
663 3300046473 Ga0495582_0008353 Ga0495582_0008353_153_1271 369
664 3300046474 Ga0495605_0000284 Ga0495605_0000284_38303_39421 369
665 3300046474 Ga0495605_0000614 Ga0495605_0000614_4466_5581 369
666 3300046474 Ga0495605_0001332 Ga0495605_0001332_10836_11951 369
667 3300046474 Ga0495605_0007238 Ga0495605_0007238_5125_6243 369
668 3300046474 Ga0495605_0009455 Ga0495605_0009455_2775_3893 369
669 3300046474 Ga0495605_0010234 Ga0495605_0010234_2032_3147 369
670 3300046474 Ga0495605_0028058 Ga0495605_0028058_526_1644 369
671 3300046475 Ga0495639_0015699 Ga0495639_0015699_1449_2561 369
672 3300046491 Ga0495584_0000013 Ga0495584_0000013_4157_5275 369
673 3300046491 Ga0495584_0000951 Ga0495584_0000951_14823_15941 369
674 3300046491 Ga0495584_0000972 Ga0495584_0000972_6798_7913 369
675 3300046491 Ga0495584_0002502 Ga0495584_0002502_5127_6242 369
676 3300046491 Ga0495584_0003205 Ga0495584_0003205_7750_8868 369
677 3300046491 Ga0495584_0005273 Ga0495584_0005273_3003_4118 369
678 3300046491 Ga0495584_0006573 Ga0495584_0006573_74_1189 369
679 3300046491 Ga0495584_0012093 Ga0495584_0012093_1170_2288 369
680 3300046491 Ga0495584_0012756 Ga0495584_0012756_2643_3758 369
681 3300046491 Ga0495584_0013174 Ga0495584_0013174_2667_3785 369
682 3300046492 Ga0495585_0000150 Ga0495585_0000150_37744_38862 369
683 3300046492 Ga0495585_0001052 Ga0495585_0001052_4419_5537 369
684 3300046492 Ga0495585_0001416 Ga0495585_0001416_13785_14903 369
685 3300046492 Ga0495585_0002993 Ga0495585_0002993_6162_7280 369
686 3300046492 Ga0495585_0005663 Ga0495585_0005663_1035_2150 369
687 3300046492 Ga0495585_0006319 Ga0495585_0006319_3595_4713 369
688 3300046492 Ga0495585_0007714 Ga0495585_0007714_2306_3424 369
689 3300046492 Ga0495585_0007869 Ga0495585_0007869_3921_5036 369
690 3300046492 Ga0495585_0008104 Ga0495585_0008104_1264_2382 369
691 3300046492 Ga0495585_0014846 Ga0495585_0014846_2979_4094 369
692 3300046492 Ga0495585_0037735 Ga0495585_0037735_1423_2541 369
693 3300046492 Ga0495585_0053693 Ga0495585_0053693_874_1992 369
694 3300046492 Ga0495585_0060476 Ga0495585_0060476_315_1430 369
695 3300046492 Ga0495585_0061152 Ga0495585_0061152_847_1962 369
696 3300046492 Ga0495585_0091058 Ga0495585_0091058_78_1193 369
697 3300046499 Ga0495594_0003575 Ga0495594_0003575_2938_4056 369
698 3300046499 Ga0495594_0025580 Ga0495594_0025580_718_1833 369
699 3300046499 Ga0495594_0047112 Ga0495594_0047112_384_1499 369
700 3300046500 Ga0495596_0001343 Ga0495596_0001343_11628_12746 369
701 3300046500 Ga0495596_0001970 Ga0495596_0001970_3835_4950 369
702 3300046500 Ga0495596_0003353 Ga0495596_0003353_4008_5126 369
703 3300046500 Ga0495596_0005506 Ga0495596_0005506_2820_3938 369
704 3300046500 Ga0495596_0005656 Ga0495596_0005656_1157_2272 369
705 3300046500 Ga0495596_0008267 Ga0495596_0008267_1340_2458 369
706 3300046500 Ga0495596_0009757 Ga0495596_0009757_1996_3111 369
707 3300046500 Ga0495596_0014322 Ga0495596_0014322_631_1749 369
708 3300046500 Ga0495596_0018133 Ga0495596_0018133_535_1650 369
709 3300046500 Ga0495596_0025036 Ga0495596_0025036_427_1545 369
710 3300046500 Ga0495596_0056202 Ga0495596_0056202_365_1483 369
711 3300046501 Ga0495607_0001581 Ga0495607_0001581_18173_19288 369
712 3300046501 Ga0495607_0001687 Ga0495607_0001687_3556_4668 369
713 3300046501 Ga0495607_0001951 Ga0495607_0001951_4548_5663 369
714 3300046501 Ga0495607_0006601 Ga0495607_0006601_2165_3280 369
715 3300046501 Ga0495607_0012539 Ga0495607_0012539_4027_5142 369
716 3300046501 Ga0495607_0013539 Ga0495607_0013539_2539_3654 369
717 3300046501 Ga0495607_0019245 Ga0495607_0019245_1836_2954 369
718 3300046501 Ga0495607_0020268 Ga0495607_0020268_1608_2723 369
719 3300046501 Ga0495607_0051165 Ga0495607_0051165_382_1500 369
720 3300046501 Ga0495607_0055797 Ga0495607_0055797_664_1782 369
721 3300046501 Ga0495607_0061339 Ga0495607_0061339_909_2024 369
722 3300046506 Ga0495583_0000161 Ga0495583_0000161_54390_55508 369
723 3300046506 Ga0495583_0000220 Ga0495583_0000220_91032_92144 369
724 3300046506 Ga0495583_0000573 Ga0495583_0000573_4305_5420 369
725 3300046506 Ga0495583_0000839 Ga0495583_0000839_4269_5384 369
726 3300046506 Ga0495583_0003352 Ga0495583_0003352_7087_8205 369
727 3300046506 Ga0495583_0004198 Ga0495583_0004198_1645_2760 369
728 3300046506 Ga0495583_0011302 Ga0495583_0011302_3162_4280 369
729 3300046506 Ga0495583_0019210 Ga0495583_0019210_300_1418 369
730 3300046506 Ga0495583_0072164 Ga0495583_0072164_375_1490 369
731 3300046507 Ga0495606_0000609 Ga0495606_0000609_4207_5319 369
732 3300046507 Ga0495606_0001166 Ga0495606_0001166_3983_5095 369
733 3300046507 Ga0495606_0003491 Ga0495606_0003491_4391_5506 369
734 3300046507 Ga0495606_0004057 Ga0495606_0004057_9571_10695 369
735 3300046507 Ga0495606_0004324 Ga0495606_0004324_4334_5446 369
736 3300046507 Ga0495606_0014062 Ga0495606_0014062_2231_3346 369
737 3300046507 Ga0495606_0038285 Ga0495606_0038285_471_1589 369
738 3300046507 Ga0495606_0064683 Ga0495606_0064683_941_2059 369
739 3300046507 Ga0495606_0119697 Ga0495606_0119697_361_1479 369
740 3300046512 Ga0495610_0001163 Ga0495610_0001163_16659_17777 369
741 3300046512 Ga0495610_0002889 Ga0495610_0002889_3463_4575 369
742 3300046512 Ga0495610_0003861 Ga0495610_0003861_821_1933 369
743 3300046512 Ga0495610_0012801 Ga0495610_0012801_3531_4643 369
744 3300046513 Ga0495616_0000673 Ga0495616_0000673_20240_21358 369
745 3300046513 Ga0495616_0000838 Ga0495616_0000838_16237_17352 369
746 3300046513 Ga0495616_0004890 Ga0495616_0004890_6112_7230 369
747 3300046513 Ga0495616_0007456 Ga0495616_0007456_1332_2447 369
748 3300046513 Ga0495616_0016770 Ga0495616_0016770_510_1628 369
749 3300046513 Ga0495616_0017938 Ga0495616_0017938_2151_3266 369
750 3300046513 Ga0495616_0020923 Ga0495616_0020923_536_1651 369
751 3300046513 Ga0495616_0028031 Ga0495616_0028031_741_1856 369
752 3300046513 Ga0495616_0030046 Ga0495616_0030046_923_2041 369
753 3300046513 Ga0495616_0047144 Ga0495616_0047144_315_1430 369
754 3300046513 Ga0495616_0063182 Ga0495616_0063182_507_1625 369
755 3300046517 Ga0495630_0050915 Ga0495630_0050915_96_1211 369
756 3300046518 Ga0495631_0003439 Ga0495631_0003439_3546_4664 369
757 3300046518 Ga0495631_0003758 Ga0495631_0003758_6269_7387 369
758 3300046518 Ga0495631_0005893 Ga0495631_0005893_1626_2744 369
759 3300046518 Ga0495631_0006259 Ga0495631_0006259_1253_2371 369
760 3300046518 Ga0495631_0008197 Ga0495631_0008197_3325_4440 369
761 3300046518 Ga0495631_0020192 Ga0495631_0020192_1008_2123 369
762 3300046518 Ga0495631_0025173 Ga0495631_0025173_246_1364 369
763 3300046518 Ga0495631_0042226 Ga0495631_0042226_435_1553 369
764 3300046519 Ga0495632_0000280 Ga0495632_0000280_41088_42203 369
765 3300046519 Ga0495632_0000959 Ga0495632_0000959_20214_21332 369
766 3300046519 Ga0495632_0001908 Ga0495632_0001908_11508_12626 369
767 3300046519 Ga0495632_0003957 Ga0495632_0003957_906_2021 369
768 3300046519 Ga0495632_0006230 Ga0495632_0006230_4059_5177 369
769 3300046520 Ga0495637_0000029 Ga0495637_0000029_137052_138170 369
770 3300046520 Ga0495637_0001558 Ga0495637_0001558_9846_10958 369
771 3300046520 Ga0495637_0019407 Ga0495637_0019407_1027_2145 369
772 3300046522 Ga0495643_0000245 Ga0495643_0000245_23024_24136 369
773 3300046522 Ga0495643_0001674 Ga0495643_0001674_4020_5135 369
774 3300046522 Ga0495643_0002014 Ga0495643_0002014_4232_5344 369
775 3300046522 Ga0495643_0008919 Ga0495643_0008919_1542_2657 369
776 3300046522 Ga0495643_0041939 Ga0495643_0041939_677_1795 369
777 3300046522 Ga0495643_0060236 Ga0495643_0060236_589_1704 369
778 3300046523 Ga0495644_0002273 Ga0495644_0002273_2931_4046 369
779 3300046523 Ga0495644_0002377 Ga0495644_0002377_1685_2803 369
780 3300046523 Ga0495644_0006553 Ga0495644_0006553_2332_3447 369
781 3300046523 Ga0495644_0012603 Ga0495644_0012603_65_1183 369
782 3300046523 Ga0495644_0026638 Ga0495644_0026638_901_2019 369
783 3300046523 Ga0495644_0031885 Ga0495644_0031885_831_1949 369
784 3300046524 Ga0495648_0000004 Ga0495648_0000004_328039_329151 369
785 3300046524 Ga0495648_0000047 Ga0495648_0000047_4380_5498 369
786 3300046524 Ga0495648_0002640 Ga0495648_0002640_3972_5090 369
787 3300046524 Ga0495648_0009206 Ga0495648_0009206_1138_2253 369
788 3300046524 Ga0495648_0012788 Ga0495648_0012788_4210_5325 369
789 3300046524 Ga0495648_0013386 Ga0495648_0013386_979_2094 369
790 3300046524 Ga0495648_0017457 Ga0495648_0017457_2984_4099 369
791 3300046524 Ga0495648_0031541 Ga0495648_0031541_1378_2496 369
792 3300046524 Ga0495648_0045010 Ga0495648_0045010_1624_2736 369
793 3300046526 Ga0495666_0003378 Ga0495666_0003378_5340_6455 369
794 3300046526 Ga0495666_0005439 Ga0495666_0005439_4249_5367 369
795 3300046526 Ga0495666_0005509 Ga0495666_0005509_4315_5433 369
796 3300046528 Ga0495642_0000707 Ga0495642_0000707_6610_7728 369
797 3300046528 Ga0495642_0000879 Ga0495642_0000879_1054_2169 369
798 3300046528 Ga0495642_0000925 Ga0495642_0000925_3894_5012 369
799 3300046528 Ga0495642_0006297 Ga0495642_0006297_1702_2817 369
800 3300046528 Ga0495642_0009148 Ga0495642_0009148_1370_2485 369
801 3300046528 Ga0495642_0009245 Ga0495642_0009245_1260_2375 369
802 3300046528 Ga0495642_0011746 Ga0495642_0011746_422_1537 369
803 3300046528 Ga0495642_0016582 Ga0495642_0016582_1194_2312 369
804 3300046528 Ga0495642_0020386 Ga0495642_0020386_1339_2457 369
805 3300046528 Ga0495642_0021727 Ga0495642_0021727_228_1346 369
806 3300046528 Ga0495642_0052263 Ga0495642_0052263_432_1550 369
807 3300046529 Ga0495652_0053713 Ga0495652_0053713_1450_2565 369
808 3300046530 Ga0495654_0004114 Ga0495654_0004114_4056_5174 369
809 3300046530 Ga0495654_0006998 Ga0495654_0006998_186_1304 369
810 3300046531 Ga0495665_0004037 Ga0495665_0004037_3843_4961 369
811 3300046531 Ga0495665_0020928 Ga0495665_0020928_1648_2763 369
812 3300046531 Ga0495665_0025476 Ga0495665_0025476_437_1552 369
813 3300046531 Ga0495665_0072509 Ga0495665_0072509_671_1789 369
814 3300046535 Ga0495586_0017346 Ga0495586_0017346_319_1434 369
815 3300046536 Ga0495587_0056262 Ga0495587_0056262_1050_2168 369
816 3300046536 Ga0495587_0067055 Ga0495587_0067055_635_1753 369
817 3300046536 Ga0495587_0085395 Ga0495587_0085395_282_1400 369
818 3300046538 Ga0495609_0000005 Ga0495609_0000005_392095_393210 369
819 3300046538 Ga0495609_0001551 Ga0495609_0001551_9734_10846 369
820 3300046538 Ga0495609_0001607 Ga0495609_0001607_2346_3461 369
821 3300046538 Ga0495609_0002450 Ga0495609_0002450_4099_5214 369
822 3300046538 Ga0495609_0004216 Ga0495609_0004216_2735_3850 369
823 3300046538 Ga0495609_0010990 Ga0495609_0010990_1719_2837 369
824 3300046538 Ga0495609_0014114 Ga0495609_0014114_1928_3040 369
825 3300046538 Ga0495609_0023997 Ga0495609_0023997_1320_2435 369
826 3300046538 Ga0495609_0040812 Ga0495609_0040812_165_1283 369
827 3300046542 Ga0495597_0000563 Ga0495597_0000563_4286_5398 369
828 3300046542 Ga0495597_0002604 Ga0495597_0002604_4052_5167 369
829 3300046542 Ga0495597_0002893 Ga0495597_0002893_8188_9306 369
830 3300046542 Ga0495597_0003147 Ga0495597_0003147_6726_7838 369
831 3300046542 Ga0495597_0003284 Ga0495597_0003284_6332_7450 369
832 3300046542 Ga0495597_0007880 Ga0495597_0007880_361_1476 369
833 3300046542 Ga0495597_0018770 Ga0495597_0018770_1248_2366 369
834 3300046542 Ga0495597_0020202 Ga0495597_0020202_181_1296 369
835 3300046542 Ga0495597_0051079 Ga0495597_0051079_458_1573 369
836 3300046543 Ga0495645_0031635 Ga0495645_0031635_1081_2196 369
837 3300046557 Ga0495622_0000157 Ga0495622_0000157_4267_5379 369
838 3300046557 Ga0495622_0002938 Ga0495622_0002938_5359_6474 369
839 3300046557 Ga0495622_0033347 Ga0495622_0033347_1172_2287 369
840 3300046558 Ga0495633_0000467 Ga0495633_0000467_34321_35433 369
841 3300046558 Ga0495633_0000472 Ga0495633_0000472_35560_36672 369
842 3300046558 Ga0495633_0003381 Ga0495633_0003381_5627_6742 369
843 3300046558 Ga0495633_0005433 Ga0495633_0005433_2546_3664 369
844 3300046558 Ga0495633_0006297 Ga0495633_0006297_4264_5379 369
845 3300046558 Ga0495633_0006990 Ga0495633_0006990_5057_6175 369
846 3300046558 Ga0495633_0008254 Ga0495633_0008254_3251_4366 369
847 3300046558 Ga0495633_0010420 Ga0495633_0010420_3914_5029 369
848 3300046558 Ga0495633_0011181 Ga0495633_0011181_3137_4255 369
849 3300046558 Ga0495633_0033873 Ga0495633_0033873_1158_2273 369
850 3300046558 Ga0495633_0067941 Ga0495633_0067941_299_1414 369
851 3300046615 Ga0495656_0004308 Ga0495656_0004308_2482_3600 369
852 3300046616 Ga0495668_0000210 Ga0495668_0000210_49255_50370 369
853 3300046616 Ga0495668_0000333 Ga0495668_0000333_58951_60063 369
854 3300046616 Ga0495668_0001190 Ga0495668_0001190_4015_5133 369
855 3300046616 Ga0495668_0004052 Ga0495668_0004052_4187_5305 369
856 3300046616 Ga0495668_0004067 Ga0495668_0004067_355_1470 369
857 3300046616 Ga0495668_0007970 Ga0495668_0007970_2774_3889 369
858 3300046616 Ga0495668_0017863 Ga0495668_0017863_505_1620 369
859 3300046616 Ga0495668_0043148 Ga0495668_0043148_1381_2496 369
860 3300046642 Ga0495634_0010701 Ga0495634_0010701_2624_3742 369
861 3300046642 Ga0495634_0029405 Ga0495634_0029405_2324_3439 369
862 3300046648 Ga0495611_0000336 Ga0495611_0000336_5946_7064 369
863 3300046648 Ga0495611_0001499 Ga0495611_0001499_6221_7336 369
864 3300046648 Ga0495611_0001565 Ga0495611_0001565_5985_7103 369
865 3300046648 Ga0495611_0007237 Ga0495611_0007237_1247_2362 369
866 3300046648 Ga0495611_0016478 Ga0495611_0016478_1902_3017 369
867 3300046648 Ga0495611_0019707 Ga0495611_0019707_1210_2325 369
868 3300046648 Ga0495611_0022196 Ga0495611_0022196_571_1686 369
869 3300046660 Ga0495625_0000412 Ga0495625_0000412_59551_60663 369
870 3300046660 Ga0495625_0002389 Ga0495625_0002389_15046_16161 369
871 3300046660 Ga0495625_0007845 Ga0495625_0007845_1488_2600 369
872 3300046660 Ga0495625_0010280 Ga0495625_0010280_2161_3279 369
873 3300046660 Ga0495625_0015331 Ga0495625_0015331_4064_5179 369
874 3300046660 Ga0495625_0026294 Ga0495625_0026294_2879_3991 369
875 3300046663 Ga0495635_0005531 Ga0495635_0005531_4300_5418 369
876 3300046663 Ga0495635_0194618 Ga0495635_0194618_245_1360 369
877 3300046664 Ga0495659_0002619 Ga0495659_0002619_3400_4515 369
878 3300046665 Ga0495661_0000613 Ga0495661_0000613_31273_32388 369
879 3300046665 Ga0495661_0000794 Ga0495661_0000794_16683_17798 369
880 3300046665 Ga0495661_0001195 Ga0495661_0001195_19284_20402 369
881 3300046665 Ga0495661_0002649 Ga0495661_0002649_3970_5085 369
882 3300046665 Ga0495661_0007511 Ga0495661_0007511_2350_3468 369
883 3300046665 Ga0495661_0007838 Ga0495661_0007838_796_1914 369
884 3300046665 Ga0495661_0011228 Ga0495661_0011228_2672_3790 369
885 3300046665 Ga0495661_0013468 Ga0495661_0013468_2809_3927 369
886 3300046665 Ga0495661_0014914 Ga0495661_0014914_3992_5107 369
887 3300046665 Ga0495661_0019387 Ga0495661_0019387_983_2098 369
888 3300046665 Ga0495661_0021272 Ga0495661_0021272_463_1578 369
889 3300046665 Ga0495661_0031092 Ga0495661_0031092_648_1766 369
890 3300046665 Ga0495661_0067099 Ga0495661_0067099_966_2081 369
891 3300046665 Ga0495661_0071556 Ga0495661_0071556_306_1421 369
892 3300046665 Ga0495661_0101300 Ga0495661_0101300_99_1214 369
893 3300046674 Ga0495588_0002779 Ga0495588_0002779_1845_2963 369
894 3300046674 Ga0495588_0014575 Ga0495588_0014575_2627_3745 369
895 3300046674 Ga0495588_0015979 Ga0495588_0015979_1089_2207 369
896 3300046674 Ga0495588_0049473 Ga0495588_0049473_703_1818 369
897 3300046674 Ga0495588_0051726 Ga0495588_0051726_753_1871 369
898 3300046679 Ga0495623_0015129 Ga0495623_0015129_1227_2345 369
899 3300046679 Ga0495623_0064914 Ga0495623_0064914_459_1574 369
900 3300046680 Ga0495646_0001070 Ga0495646_0001070_4069_5184 369
901 3300046680 Ga0495646_0007553 Ga0495646_0007553_4074_5192 369
902 3300046680 Ga0495646_0033843 Ga0495646_0033843_1435_2550 369
903 3300046684 Ga0495669_0000240 Ga0495669_0000240_11573_12688 369
904 3300046684 Ga0495669_0000324 Ga0495669_0000324_20726_21841 369
905 3300046684 Ga0495669_0001234 Ga0495669_0001234_1763_2881 369
906 3300046684 Ga0495669_0004135 Ga0495669_0004135_2908_4023 369
907 3300046684 Ga0495669_0007418 Ga0495669_0007418_3430_4548 369
908 3300046684 Ga0495669_0010168 Ga0495669_0010168_1220_2338 369
909 3300046691 Ga0495670_0006418 Ga0495670_0006418_334_1449 369
910 3300046691 Ga0495670_0008396 Ga0495670_0008396_2138_3253 369
911 3300046691 Ga0495670_0034408 Ga0495670_0034408_1246_2361 369
912 3300046691 Ga0495670_0046933 Ga0495670_0046933_524_1639 369
913 3300046691 Ga0495670_0068391 Ga0495670_0068391_457_1575 369
914 3300046692 Ga0495671_0000609 Ga0495671_0000609_4328_5446 369
915 3300046692 Ga0495671_0002097 Ga0495671_0002097_8203_9321 369
916 3300046694 Ga0495649_0000644 Ga0495649_0000644_4236_5354 369
917 3300046694 Ga0495649_0003103 Ga0495649_0003103_4119_5234 369
918 3300046694 Ga0495649_0003975 Ga0495649_0003975_7488_8606 369
919 3300046794 Ga0495589_0000212 Ga0495589_0000212_14623_15738 369
920 3300046794 Ga0495589_0000358 Ga0495589_0000358_4138_5253 369
921 3300046794 Ga0495589_0001945 Ga0495589_0001945_4211_5329 369
922 3300046794 Ga0495589_0008518 Ga0495589_0008518_1824_2939 369
923 3300046794 Ga0495589_0010991 Ga0495589_0010991_2470_3585 369
924 3300046794 Ga0495589_0015330 Ga0495589_0015330_2676_3794 369
925 3300046794 Ga0495589_0017754 Ga0495589_0017754_2433_3551 369
926 3300046794 Ga0495589_0068269 Ga0495589_0068269_41_1156 369
927 3300046794 Ga0495589_0087153 Ga0495589_0087153_388_1506 369
928 3300046809 Ga0495600_0023933 Ga0495600_0023933_2482_3597 369
929 3300046810 Ga0495660_0000301 Ga0495660_0000301_17507_18622 369
930 3300046810 Ga0495660_0000789 Ga0495660_0000789_2066_3181 369
931 3300046810 Ga0495660_0001147 Ga0495660_0001147_15384_16496 369
932 3300046810 Ga0495660_0002687 Ga0495660_0002687_8109_9221 369
933 3300046810 Ga0495660_0002698 Ga0495660_0002698_9461_10573 369
934 3300046810 Ga0495660_0002992 Ga0495660_0002992_6067_7182 369
935 3300046810 Ga0495660_0052182 Ga0495660_0052182_723_1841 369
936 3300046810 Ga0495660_0054684 Ga0495660_0054684_770_1888 369
937 3300046810 Ga0495660_0063459 Ga0495660_0063459_714_1832 369
938 3300047315 Ga0495581_0001466 Ga0495581_0001466_4294_5409 369
939 3300047315 Ga0495581_0013538 Ga0495581_0013538_3101_4216 369
940 3300047317 Ga0495604_0009345 Ga0495604_0009345_4207_5325 369
941 3300047317 Ga0495604_0013433 Ga0495604_0013433_1460_2575 369
942 3300047317 Ga0495604_0130117 Ga0495604_0130117_638_1756 369
943 3300047318 Ga0495636_0002971 Ga0495636_0002971_2606_3721 369
944 3300047318 Ga0495636_0035052 Ga0495636_0035052_123_1241 369
945 3300047320 Ga0495672_0000431 Ga0495672_0000431_39558_40670 369
946 3300047320 Ga0495672_0001709 Ga0495672_0001709_15794_16909 369
947 3300047320 Ga0495672_0001925 Ga0495672_0001925_14441_15556 369
948 3300047320 Ga0495672_0002234 Ga0495672_0002234_10783_11898 369
949 3300047320 Ga0495672_0002438 Ga0495672_0002438_6190_7308 369
950 3300047320 Ga0495672_0009016 Ga0495672_0009016_5684_6802 369
951 3300047321 Ga0495676_0000069 Ga0495676_0000069_4240_5358 369
952 3300047322 Ga0495680_0009108 Ga0495680_0009108_866_1984 369
953 3300047323 Ga0495683_0000221 Ga0495683_0000221_4350_5468 369
954 3300047323 Ga0495683_0000559 Ga0495683_0000559_22563_23681 369
955 3300047323 Ga0495683_0002282 Ga0495683_0002282_9895_11010 369
956 3300047323 Ga0495683_0003435 Ga0495683_0003435_5198_6313 369
957 3300047323 Ga0495683_0011823 Ga0495683_0011823_1870_2985 369
958 3300047323 Ga0495683_0048157 Ga0495683_0048157_906_2024 369
959 3300047323 Ga0495683_0074678 Ga0495683_0074678_17_1135 369
960 3300047443 Ga0495687_000221 Ga0495687_000221_46151_47266 369
961 3300047443 Ga0495687_000714 Ga0495687_000714_7972_9087 369
962 3300047443 Ga0495687_000917 Ga0495687_000917_25385_26503 369
963 3300047443 Ga0495687_002375 Ga0495687_002375_3197_4309 369
964 3300047443 Ga0495687_004864 Ga0495687_004864_4514_5626 369
965 3300047443 Ga0495687_005631 Ga0495687_005631_2539_3654 369
966 3300047443 Ga0495687_010530 Ga0495687_010530_2582_3700 369
967 3300047444 Ga0495675_0012391 Ga0495675_0012391_1869_2987 369
968 3300047444 Ga0495675_0045291 Ga0495675_0045291_710_1825 369
969 3300047445 Ga0495677_0000060 Ga0495677_0000060_14712_15827 369
970 3300047445 Ga0495677_0000616 Ga0495677_0000616_9388_10506 369
971 3300047445 Ga0495677_0002470 Ga0495677_0002470_4089_5204 369
972 3300047445 Ga0495677_0003295 Ga0495677_0003295_3838_4956 369
973 3300047445 Ga0495677_0004463 Ga0495677_0004463_2692_3807 369
974 3300047445 Ga0495677_0007868 Ga0495677_0007868_1645_2760 369
975 3300047445 Ga0495677_0012295 Ga0495677_0012295_545_1657 369
976 3300047445 Ga0495677_0012909 Ga0495677_0012909_1634_2749 369
977 3300047445 Ga0495677_0016892 Ga0495677_0016892_942_2057 369
978 3300047445 Ga0495677_0049365 Ga0495677_0049365_123_1241 369
979 3300047446 Ga0495679_003216 Ga0495679_003216_3044_4162 369
980 3300047446 Ga0495679_009937 Ga0495679_009937_633_1748 369
981 3300047447 Ga0495685_000340 Ga0495685_000340_7602_8717 369
982 3300047447 Ga0495685_000345 Ga0495685_000345_8096_9211 369
983 3300047447 Ga0495685_002067 Ga0495685_002067_4073_5191 369
984 3300047469 Ga0495673_0000074 Ga0495673_0000074_158856_159968 369
985 3300047469 Ga0495673_0000194 Ga0495673_0000194_39548_40663 369
986 3300047470 Ga0495681_0000330 Ga0495681_0000330_30129_31244 369
987 3300047470 Ga0495681_0000642 Ga0495681_0000642_23455_24567 369
988 3300047470 Ga0495681_0001763 Ga0495681_0001763_12364_13479 369
989 3300047470 Ga0495681_0002881 Ga0495681_0002881_7636_8754 369
990 3300047470 Ga0495681_0043864 Ga0495681_0043864_17_1132 369
991 3300047470 Ga0495681_0044790 Ga0495681_0044790_226_1344 369
992 3300047470 Ga0495681_0070441 Ga0495681_0070441_19_1137 369
993 3300047470 Ga0495681_0084645 Ga0495681_0084645_100_1218 369
994 3300047472 Ga0495686_0001928 Ga0495686_0001928_4203_5318 369
995 3300047472 Ga0495686_0004503 Ga0495686_0004503_6069_7184 369
996 3300047472 Ga0495686_0006220 Ga0495686_0006220_5709_6827 369
997 3300047472 Ga0495686_0006658 Ga0495686_0006658_2287_3405 369
998 3300047472 Ga0495686_0010605 Ga0495686_0010605_2847_3962 369
999 3300047472 Ga0495686_0087977 Ga0495686_0087977_158_1273 369
1000 3300047673 Ga0495593_0003624 Ga0495593_0003624_4149_5264 369
1001 3300047673 Ga0495593_0007992 Ga0495593_0007992_4273_5388 369
1002 3300048088 Ga0495602_0001744 Ga0495602_0001744_17041_18159 369
1003 3300048088 Ga0495602_0025892 Ga0495602_0025892_473_1588 369
1004 3300048089 Ga0495614_0004592 Ga0495614_0004592_4015_5130 369
1005 3300048089 Ga0495614_0005888 Ga0495614_0005888_3349_4467 369
1006 3300048089 Ga0495614_0082665 Ga0495614_0082665_67_1182 369
1007 3300048090 Ga0495615_0011539 Ga0495615_0011539_273_1388 369
1008 3300048091 Ga0495626_0000058 Ga0495626_0000058_13392_14507 369
1009 3300048091 Ga0495626_0000196 Ga0495626_0000196_35831_36949 369
1010 3300048091 Ga0495626_0001643 Ga0495626_0001643_12101_13216 369
1011 3300048091 Ga0495626_0004639 Ga0495626_0004639_4409_5524 369
1012 3300048091 Ga0495626_0006061 Ga0495626_0006061_3938_5056 369
1013 3300048091 Ga0495626_0006899 Ga0495626_0006899_4164_5282 369
1014 3300048091 Ga0495626_0009308 Ga0495626_0009308_4003_5121 369
1015 3300048091 Ga0495626_0020651 Ga0495626_0020651_1579_2697 369
1016 3300048091 Ga0495626_0022022 Ga0495626_0022022_1033_2151 369
1017 3300048091 Ga0495626_0039346 Ga0495626_0039346_1019_2137 369
1018 3300048091 Ga0495626_0050032 Ga0495626_0050032_148_1263 369
1019 3300048904 Ga0496101_0051972 Ga0496101_0051972_588_1706 369
1020 3300048905 Ga0496102_0000420 Ga0496102_0000420_3993_5111 369
1021 3300048905 Ga0496102_0033655 Ga0496102_0033655_56_1171 369
1022 3300048907 Ga0496104_0102748 Ga0496104_0102748_989_2101 369
1023 3300048910 Ga0496107_0103276 Ga0496107_0103276_172_1287 369
1024 3300048912 Ga0496109_0373831 Ga0496109_0373831_121_1239 369
1025 3300048913 Ga0496110_0004041 Ga0496110_0004041_4015_5133 369
1026 3300048914 Ga0496111_0032938 Ga0496111_0032938_458_1576 369
1027 3300048914 Ga0496111_0173620 Ga0496111_0173620_403_1521 369
1028 3300048916 Ga0496113_0034323 Ga0496113_0034323_355_1473 369
1029 3300048917 Ga0496114_0051398 Ga0496114_0051398_1510_2625 369
1030 3300048918 Ga0496115_0006572 Ga0496115_0006572_3068_4183 369
1031 3300048918 Ga0496115_0007248 Ga0496115_0007248_1713_2828 369
1032 3300048918 Ga0496115_0014859 Ga0496115_0014859_2662_3780 369
1033 3300048918 Ga0496115_0115931 Ga0496115_0115931_19_1134 369
1034 3300048925 Ga0496122_0001092 Ga0496122_0001092_735_1853 369
1035 3300048926 Ga0496123_0002714 Ga0496123_0002714_19415_20533 369
1036 3300048927 Ga0496124_0019066 Ga0496124_0019066_2624_3739 369
1037 3300048927 Ga0496124_0076846 Ga0496124_0076846_1097_2212 369
1038 3300048928 Ga0496125_0000368 Ga0496125_0000368_46715_47830 369
1039 3300048928 Ga0496125_0008339 Ga0496125_0008339_7041_8159 369
1040 3300049459 Ga0495678_000013 Ga0495678_000013_272485_273597 369
1041 3300049459 Ga0495678_000146 Ga0495678_000146_43903_45021 369
1042 3300049459 Ga0495678_001534 Ga0495678_001534_7155_8267 369
1043 3300049459 Ga0495678_003140 Ga0495678_003140_4276_5394 369
1044 3300049459 Ga0495678_003481 Ga0495678_003481_2374_3489 369
1045 3300049459 Ga0495678_006090 Ga0495678_006090_4472_5587 369
1046 3300049459 Ga0495678_007836 Ga0495678_007836_4316_5434 369
1047 3300049459 Ga0495678_010397 Ga0495678_010397_960_2072 369
1048 3300049459 Ga0495678_062852 Ga0495678_062852_242_1354 369
1049 3300049460 Ga0495682_0001326 Ga0495682_0001326_4074_5192 369
1050 3300049460 Ga0495682_0002294 Ga0495682_0002294_7432_8547 369
1051 3300049460 Ga0495682_0003910 Ga0495682_0003910_4371_5489 369
1052 3300049460 Ga0495682_0011240 Ga0495682_0011240_1986_3104 369
1053 3300049460 Ga0495682_0040067 Ga0495682_0040067_57_1175 369
1054 3300049679 Ga0501249_012850 Ga0501249_012850_368_1480 369
1055 3300049766 Ga0501269_000446 Ga0501269_000446_5475_6587 369
1056 3300049822 Ga0501035_0007367 Ga0501035_0007367_4362_5477 369
1057 3300053145 Ga0500586_011320 Ga0500586_011320_691_1803 369
1058 iso_pu_bacteria 2643221603 2644028082 369
1059 iso_pu_bacteria 2818991450 2819624095 378
1060 iso_pu_bacteria 2928108538 2928112802 378
1061 iso_pu_bacteria 2928135762 2928141749 378
1062 iso_pu_bacteria 2928503688 2928508350 378
1063 3300001989 JGI24739J22299_10001831 JGI24739J22299_100018312 382
1064 3300001990 JGI24737J22298_10019259 JGI24737J22298_100192592 382
1065 3300002067 JGI24735J21928_10019040 JGI24735J21928_100190402 382
1066 3300005367 Ga0070667_100219511 Ga0070667_1002195111 382
1067 3300009011 Ga0105251_10000895 Ga0105251_1000089525 382
1068 3300015262 Ga0182007_10000169 Ga0182007_1000016928 382
1069 3300025735 Ga0207713_1000137 Ga0207713_100013761 382
1070 3300025904 Ga0207647_10009500 Ga0207647_100095002 382
1071 3300046472 Ga0495580_0004379 Ga0495580_0004379_10569_11786 382
1072 3300046506 Ga0495583_0009524 Ga0495583_0009524_2222_3439 382
1073 3300047319 Ga0495674_0006740 Ga0495674_0006740_8694_9842 382
1074 3300048920 Ga0496117_0083507 Ga0496117_0083507_13_1161 382
1075 3300048921 Ga0496118_0002994 Ga0496118_0002994_4250_5398 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

47

393

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8984 19 377
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8919 19 377
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8785 19 377
8tj3-assembly1.cif.gz_B structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex 0.8689 15 376
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8665 19 377
ID Description Score Start End Superfamily
af_K7MB47_65_296_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3139 46 249 1.25.40.10
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2889 81 217 1.20.1250.20
af_Q54S92_730_1069_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.2773 36 340 1.25.10.10
af_K7MB47_65_296_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2483 46 249 1.25.40.10
af_Q54S92_730_1069_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.2474 36 340 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A0Q7F3V5-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9434 9 379 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A2R4CCK4-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.942 13 381 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A6N9HKM6-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.94 8 381 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A7X7CW87-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9391 30 380 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A5E4RNR2-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9382 1 382 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
80.77 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map