F489573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1075 | 406 | 1019 | 366 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2521172590|2521560587 |
| Length | 396 |
| Sequence | RGHERWRGAIALCRARHRNKLYARGAGMSLQRPPLWQTIKPHLTVFDGALSLIVFLIVSVGIVTLYSAGMNFPGRVEDQLRNILVAFIIMWIAANVSPQLLLRLAVPVYTVGVTLLIAVALFGIIKKGSRRWLNIGMVVQPSEIMKIAMPLMLAWYFQKREGMLRWDAFLVAAILLLIPGFLIIRQPDLGTGLLVLAAGFYVIFFAGLPWKILLALFVAGAASLPVVWSFMHDYQRQRVMMLIDPTSDPLGKGFHIIQSTIAIGSGGITGKGWLMGTQTHLEFIPERTTDFIFSVYSEEFGLIGNIVLLVLYLLLIGRGLIITANAPTLFTRLLGGAITMIFFTYAFVNMGMVSGILPVVGVPLPFMSYGGTALVTLGLGAGILMSIQRHRKLVQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 6 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 7 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 8 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 9 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 10 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 11 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 14 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 15 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 16 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 17 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 18 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 19 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 20 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 21 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 22 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 23 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 24 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 25 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 26 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 27 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 28 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 29 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 30 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 31 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 32 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 33 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 34 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 35 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 36 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 37 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 38 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 39 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 40 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 41 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 42 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 43 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 44 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 45 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 46 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 47 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 48 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 49 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 50 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 51 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 52 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 53 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 54 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 55 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 56 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 57 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 58 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 59 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 60 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 61 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 62 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 63 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 64 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 65 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 66 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 67 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 68 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 69 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 77 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 84 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 90 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 97 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 122 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 123 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 124 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 125 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 126 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 130 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 135 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 260 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 261 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 381 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 382 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 383 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 384 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 387 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 394 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 395 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 405 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 406 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.88 |
| Metatranscriptomes | 0 |
| Isolates | 5.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.77 |
| Nodule | 0.47 |
| Rhizoplane | 2.88 |
| Rhizosphere | 79.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001831 | 3300001989 | Bacteria | 8101 |
| 2 | JGI24737J22298_10019259 | 3300001990 | Bacteria | 2184 |
| 3 | JGI24735J21928_10019040 | 3300002067 | Bacteria | 2113 |
| 4 | JGI25155J39150_1000140 | 3300002704 | Bacteria | 34372 |
| 5 | JGI25155J39150_1000167 | 3300002704 | Bacteria | 29016 |
| 6 | JGI25162J39368_1000023 | 3300002737 | Bacteria | 236658 |
| 7 | JGI25162J39368_1005670 | 3300002737 | Bacteria | 2366 |
| 8 | JGI25154J39366_1000372 | 3300002738 | Bacteria | 24998 |
| 9 | JGI25154J39366_1000748 | 3300002738 | Bacteria | 14564 |
| 10 | JGI25154J39366_1002151 | 3300002738 | Bacteria | 5515 |
| 11 | JGI25157J39369_1000294 | 3300002741 | Bacteria | 36390 |
| 12 | JGI25157J39369_1000325 | 3300002741 | Bacteria | 33856 |
| 13 | JGI25152J39213_1000994 | 3300002773 | Bacteria | 13747 |
| 14 | JGI25150J39212_1000726 | 3300002774 | Bacteria | 11704 |
| 15 | JGI25150J39212_1000752 | 3300002774 | Bacteria | 11338 |
| 16 | JGI25159J45721_1007516 | 3300002987 | Bacteria | 3115 |
| 17 | JGI25159J45721_1017559 | 3300002987 | Bacteria | 1474 |
| 18 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 19 | rootH1_10086751 | 3300003316 | Bacteria | 3082 |
| 20 | JGI25160J50197_1000548 | 3300003354 | Bacteria | 21264 |
| 21 | JGI25161J50226_1000872 | 3300003374 | Bacteria | 11087 |
| 22 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 23 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 24 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 25 | Ga0055539_1000031 | 3300003752 | Bacteria | 241526 |
| 26 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 27 | Ga0055533_1000041 | 3300003756 | Bacteria | 241526 |
| 28 | Ga0055532_1000074 | 3300003758 | Bacteria | 125513 |
| 29 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 30 | Ga0055525_1000049 | 3300003759 | Bacteria | 241526 |
| 31 | Ga0055525_1000179 | 3300003759 | Bacteria | 78692 |
| 32 | Ga0055542_1013195 | 3300003762 | Bacteria | 1399 |
| 33 | Ga0055529_1000027 | 3300003763 | Bacteria | 292744 |
| 34 | Ga0055526_1001365 | 3300003771 | Bacteria | 17475 |
| 35 | Ga0055526_1001772 | 3300003771 | Bacteria | 14997 |
| 36 | Ga0055526_1002513 | 3300003771 | Bacteria | 12337 |
| 37 | Ga0055526_1004528 | 3300003771 | Bacteria | 8313 |
| 38 | Ga0055537_1000172 | 3300003773 | Bacteria | 48382 |
| 39 | Ga0055524_1000022 | 3300003775 | Bacteria | 224103 |
| 40 | Ga0055524_1000049 | 3300003775 | Bacteria | 149383 |
| 41 | Ga0055524_1001210 | 3300003775 | Bacteria | 15311 |
| 42 | Ga0055524_1001582 | 3300003775 | Bacteria | 12767 |
| 43 | Ga0055524_1002507 | 3300003775 | Bacteria | 9425 |
| 44 | Ga0055534_1000169 | 3300003784 | Bacteria | 48382 |
| 45 | Ga0055534_1001643 | 3300003784 | Bacteria | 8629 |
| 46 | Ga0055528_1000482 | 3300003790 | Bacteria | 31599 |
| 47 | Ga0055528_1000486 | 3300003790 | Bacteria | 31484 |
| 48 | Ga0055528_1003257 | 3300003790 | Bacteria | 8273 |
| 49 | Ga0055531_10004385 | 3300003794 | Bacteria | 8613 |
| 50 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 51 | Ga0055541_1000022 | 3300003841 | Bacteria | 241526 |
| 52 | Ga0065165_1000882 | 3300005262 | Bacteria | 38756 |
| 53 | Ga0065165_1004612 | 3300005262 | Bacteria | 8378 |
| 54 | Ga0065165_1029628 | 3300005262 | Bacteria | 1751 |
| 55 | Ga0065714_10024661 | 3300005288 | Bacteria | 1243 |
| 56 | Ga0065715_10173908 | 3300005293 | Bacteria | 1526 |
| 57 | Ga0070658_10076930 | 3300005327 | Bacteria | 2737 |
| 58 | Ga0070658_10238587 | 3300005327 | Bacteria | 1540 |
| 59 | Ga0070670_100001043 | 3300005331 | Bacteria | 21961 |
| 60 | Ga0070670_100005639 | 3300005331 | Bacteria | 10563 |
| 61 | Ga0070677_10000809 | 3300005333 | Bacteria | 10340 |
| 62 | Ga0068869_100046178 | 3300005334 | Bacteria | 3140 |
| 63 | Ga0070660_100044166 | 3300005339 | Bacteria | 3407 |
| 64 | Ga0070660_100070378 | 3300005339 | Bacteria | 2730 |
| 65 | Ga0070689_100012684 | 3300005340 | Bacteria | 6079 |
| 66 | Ga0070661_100048867 | 3300005344 | Bacteria | 3097 |
| 67 | Ga0070675_100197349 | 3300005354 | Bacteria | 1746 |
| 68 | Ga0070674_100007079 | 3300005356 | Bacteria | 6594 |
| 69 | Ga0070673_100022136 | 3300005364 | Bacteria | 4622 |
| 70 | Ga0070673_100112224 | 3300005364 | Bacteria | 2262 |
| 71 | Ga0070688_100026044 | 3300005365 | Bacteria | 3470 |
| 72 | Ga0070659_100001264 | 3300005366 | Bacteria | 18358 |
| 73 | Ga0070659_100051729 | 3300005366 | Bacteria | 3230 |
| 74 | Ga0070659_100053621 | 3300005366 | Bacteria | 3174 |
| 75 | Ga0070667_100115333 | 3300005367 | Bacteria | 2333 |
| 76 | Ga0070667_100219511 | 3300005367 | Bacteria | 1692 |
| 77 | Ga0070709_10062075 | 3300005434 | Bacteria | 2381 |
| 78 | Ga0070713_100103012 | 3300005436 | Bacteria | 2476 |
| 79 | Ga0070710_10040804 | 3300005437 | Bacteria | 2559 |
| 80 | Ga0070701_10175462 | 3300005438 | Bacteria | 1251 |
| 81 | Ga0070711_100007512 | 3300005439 | Bacteria | 6635 |
| 82 | Ga0070694_100040466 | 3300005444 | Bacteria | 3107 |
| 83 | Ga0070663_100108327 | 3300005455 | Bacteria | 2084 |
| 84 | Ga0070678_100003601 | 3300005456 | Bacteria | 8641 |
| 85 | Ga0070662_100008580 | 3300005457 | Bacteria | 6664 |
| 86 | Ga0070685_10001242 | 3300005466 | Bacteria | 13532 |
| 87 | Ga0070685_10154991 | 3300005466 | Bacteria | 1455 |
| 88 | Ga0070706_100067702 | 3300005467 | Bacteria | 3303 |
| 89 | Ga0070706_100326848 | 3300005467 | Bacteria | 1430 |
| 90 | Ga0070707_100158560 | 3300005468 | Bacteria | 2204 |
| 91 | Ga0070698_100198347 | 3300005471 | Bacteria | 1943 |
| 92 | Ga0070699_100004479 | 3300005518 | Bacteria | 12356 |
| 93 | Ga0070684_100037077 | 3300005535 | Bacteria | 4179 |
| 94 | Ga0070697_100106790 | 3300005536 | Bacteria | 2329 |
| 95 | Ga0070672_100008921 | 3300005543 | Bacteria | 6890 |
| 96 | Ga0070696_100020672 | 3300005546 | Bacteria | 4461 |
| 97 | Ga0070696_100045904 | 3300005546 | Bacteria | 3028 |
| 98 | Ga0070693_100013520 | 3300005547 | Bacteria | 4159 |
| 99 | Ga0070665_100049754 | 3300005548 | Bacteria | 4205 |
| 100 | Ga0070665_100138353 | 3300005548 | Bacteria | 2438 |
| 101 | Ga0068855_100004477 | 3300005563 | Bacteria | 17071 |
| 102 | Ga0068855_100005723 | 3300005563 | Bacteria | 15175 |
| 103 | Ga0068855_100033221 | 3300005563 | Bacteria | 6159 |
| 104 | Ga0070664_100045233 | 3300005564 | Bacteria | 3718 |
| 105 | Ga0068854_100009651 | 3300005578 | Bacteria | 6234 |
| 106 | Ga0068854_100041525 | 3300005578 | Bacteria | 3250 |
| 107 | Ga0068854_100119647 | 3300005578 | Bacteria | 1997 |
| 108 | Ga0068856_100047465 | 3300005614 | Bacteria | 4230 |
| 109 | Ga0068852_100041477 | 3300005616 | Bacteria | 3890 |
| 110 | Ga0068864_100005652 | 3300005618 | Bacteria | 10253 |
| 111 | Ga0068866_10001450 | 3300005718 | Bacteria | 10140 |
| 112 | Ga0068870_10003957 | 3300005840 | Bacteria | 6328 |
| 113 | Ga0068863_100003727 | 3300005841 | Bacteria | 15073 |
| 114 | Ga0068858_100062410 | 3300005842 | Bacteria | 3445 |
| 115 | Ga0075432_10056982 | 3300006058 | Bacteria | 1386 |
| 116 | Ga0070715_10015827 | 3300006163 | Bacteria | 2820 |
| 117 | Ga0070716_100009211 | 3300006173 | Bacteria | 4917 |
| 118 | Ga0070712_100087600 | 3300006175 | Bacteria | 2272 |
| 119 | Ga0070712_100160332 | 3300006175 | Bacteria | 1736 |
| 120 | Ga0097621_100010542 | 3300006237 | Bacteria | 6768 |
| 121 | Ga0097621_100197464 | 3300006237 | Bacteria | 1745 |
| 122 | Ga0068871_100005239 | 3300006358 | Bacteria | 9073 |
| 123 | Ga0068871_100023493 | 3300006358 | Bacteria | 4771 |
| 124 | Ga0075434_100009206 | 3300006871 | Bacteria | 9203 |
| 125 | Ga0075434_100367339 | 3300006871 | Bacteria | 1460 |
| 126 | Ga0068865_100164266 | 3300006881 | Bacteria | 1696 |
| 127 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 128 | Ga0075435_100033662 | 3300007076 | Bacteria | 4054 |
| 129 | Ga0105251_10000895 | 3300009011 | Bacteria | 26673 |
| 130 | Ga0105244_10002568 | 3300009036 | Bacteria | 13635 |
| 131 | Ga0105244_10009443 | 3300009036 | Bacteria | 5995 |
| 132 | Ga0105240_10000718 | 3300009093 | Bacteria | 60617 |
| 133 | Ga0105240_10002320 | 3300009093 | Bacteria | 30796 |
| 134 | Ga0105240_10089082 | 3300009093 | Bacteria | 3775 |
| 135 | Ga0105245_10069028 | 3300009098 | Bacteria | 3204 |
| 136 | Ga0105243_10054586 | 3300009148 | Bacteria | 3173 |
| 137 | Ga0105241_10086633 | 3300009174 | Bacteria | 2464 |
| 138 | Ga0105241_10134519 | 3300009174 | Bacteria | 2005 |
| 139 | Ga0105248_10125724 | 3300009177 | Bacteria | 2893 |
| 140 | Ga0105237_10004756 | 3300009545 | Bacteria | 15613 |
| 141 | Ga0105237_10354181 | 3300009545 | Bacteria | 1472 |
| 142 | Ga0105238_10000107 | 3300009551 | Bacteria | 91765 |
| 143 | Ga0105238_10032510 | 3300009551 | Bacteria | 5308 |
| 144 | Ga0105239_10000289 | 3300010375 | Bacteria | 74109 |
| 145 | Ga0105239_10124092 | 3300010375 | Bacteria | 2869 |
| 146 | Ga0157371_10000153 | 3300013102 | Bacteria | 101298 |
| 147 | Ga0157369_10196718 | 3300013105 | Bacteria | 2117 |
| 148 | Ga0157374_10005077 | 3300013296 | Bacteria | 11039 |
| 149 | Ga0157374_10268083 | 3300013296 | Bacteria | 1683 |
| 150 | Ga0163162_10240864 | 3300013306 | Bacteria | 1940 |
| 151 | Ga0157372_10154334 | 3300013307 | Bacteria | 2651 |
| 152 | Ga0163163_10073735 | 3300014325 | Bacteria | 3404 |
| 153 | Ga0163163_10198934 | 3300014325 | Bacteria | 2052 |
| 154 | Ga0157379_10054036 | 3300014968 | Bacteria | 3589 |
| 155 | Ga0182006_1000138 | 3300015261 | Bacteria | 78470 |
| 156 | Ga0182006_1004867 | 3300015261 | Bacteria | 6513 |
| 157 | Ga0182006_1059205 | 3300015261 | Bacteria | 1451 |
| 158 | Ga0182007_10000169 | 3300015262 | Bacteria | 44843 |
| 159 | Ga0182005_1000046 | 3300015265 | Bacteria | 138133 |
| 160 | Ga0182005_1000207 | 3300015265 | Bacteria | 39631 |
| 161 | Ga0163161_10033109 | 3300017792 | Bacteria | 3693 |
| 162 | Ga0213872_10000065 | 3300021361 | Bacteria | 96648 |
| 163 | Ga0213872_10000403 | 3300021361 | Bacteria | 35721 |
| 164 | Ga0213872_10001325 | 3300021361 | Bacteria | 16383 |
| 165 | Ga0213872_10019758 | 3300021361 | Bacteria | 3102 |
| 166 | Ga0213872_10042999 | 3300021361 | Bacteria | 2059 |
| 167 | Ga0213872_10045535 | 3300021361 | Bacteria | 1996 |
| 168 | Ga0209435_100055 | 3300025206 | Bacteria | 86115 |
| 169 | Ga0209435_100248 | 3300025206 | Bacteria | 14274 |
| 170 | Ga0209760_102799 | 3300025207 | Bacteria | 1600 |
| 171 | Ga0209436_100389 | 3300025208 | Bacteria | 19875 |
| 172 | Ga0209436_100991 | 3300025208 | Bacteria | 10948 |
| 173 | Ga0209436_106134 | 3300025208 | Bacteria | 2671 |
| 174 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 175 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 176 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 177 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 178 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 179 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 180 | Ga0209147_100097 | 3300025229 | Bacteria | 164034 |
| 181 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 182 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 183 | Ga0209563_100143 | 3300025230 | Bacteria | 78744 |
| 184 | Ga0207427_100929 | 3300025231 | Bacteria | 12491 |
| 185 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 186 | Ga0209437_100234 | 3300025233 | Bacteria | 92856 |
| 187 | Ga0209258_100192 | 3300025242 | Bacteria | 125565 |
| 188 | Ga0207425_1000013 | 3300025245 | Bacteria | 497384 |
| 189 | Ga0207425_1000152 | 3300025245 | Bacteria | 59354 |
| 190 | Ga0207425_1000675 | 3300025245 | Bacteria | 18625 |
| 191 | Ga0209646_1000103 | 3300025246 | Bacteria | 164034 |
| 192 | Ga0209646_1000120 | 3300025246 | Bacteria | 146035 |
| 193 | Ga0209646_1000346 | 3300025246 | Bacteria | 34384 |
| 194 | Ga0209026_1000134 | 3300025250 | Bacteria | 117098 |
| 195 | Ga0209026_1003217 | 3300025250 | Bacteria | 5505 |
| 196 | Ga0209026_1004565 | 3300025250 | Bacteria | 4065 |
| 197 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 198 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 199 | Ga0209148_1000229 | 3300025254 | Bacteria | 91956 |
| 200 | Ga0209759_1000091 | 3300025256 | Bacteria | 164034 |
| 201 | Ga0209759_1000857 | 3300025256 | Bacteria | 23573 |
| 202 | Ga0209129_1000152 | 3300025258 | Bacteria | 112977 |
| 203 | Ga0209129_1014454 | 3300025258 | Bacteria | 1681 |
| 204 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 205 | Ga0209565_1000159 | 3300025263 | Bacteria | 90295 |
| 206 | Ga0209565_1000671 | 3300025263 | Bacteria | 21657 |
| 207 | Ga0209565_1001875 | 3300025263 | Bacteria | 8361 |
| 208 | Ga0209565_1002041 | 3300025263 | Bacteria | 7773 |
| 209 | Ga0209565_1003700 | 3300025263 | Bacteria | 4854 |
| 210 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 211 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 212 | Ga0209130_1000425 | 3300025284 | Bacteria | 45376 |
| 213 | Ga0209130_1000521 | 3300025284 | Bacteria | 38770 |
| 214 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 215 | Ga0209675_1001647 | 3300025291 | Bacteria | 12441 |
| 216 | Ga0209675_1002204 | 3300025291 | Bacteria | 10209 |
| 217 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 218 | Ga0209564_1000154 | 3300025295 | Bacteria | 166849 |
| 219 | Ga0209564_1000604 | 3300025295 | Bacteria | 56098 |
| 220 | Ga0209564_1000774 | 3300025295 | Bacteria | 44427 |
| 221 | Ga0209564_1005527 | 3300025295 | Bacteria | 7163 |
| 222 | Ga0209564_1010725 | 3300025295 | Bacteria | 4181 |
| 223 | Ga0209564_1030062 | 3300025295 | Bacteria | 1692 |
| 224 | Ga0209758_1000031 | 3300025297 | Bacteria | 497252 |
| 225 | Ga0209758_1000354 | 3300025297 | Bacteria | 83217 |
| 226 | Ga0209050_1015337 | 3300025298 | Bacteria | 3225 |
| 227 | Ga0209256_1000035 | 3300025299 | Bacteria | 386754 |
| 228 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 229 | Ga0209256_1000274 | 3300025299 | Bacteria | 90266 |
| 230 | Ga0209256_1000414 | 3300025299 | Bacteria | 67073 |
| 231 | Ga0209256_1000426 | 3300025299 | Bacteria | 66188 |
| 232 | Ga0209256_1003215 | 3300025299 | Bacteria | 11799 |
| 233 | Ga0207426_1001125 | 3300025302 | Bacteria | 24348 |
| 234 | Ga0209257_1000157 | 3300025304 | Bacteria | 181004 |
| 235 | Ga0207656_10003690 | 3300025321 | Bacteria | 5299 |
| 236 | Ga0207656_10066502 | 3300025321 | Bacteria | 1593 |
| 237 | Ga0207655_1003180 | 3300025728 | Bacteria | 12394 |
| 238 | Ga0207655_1006901 | 3300025728 | Bacteria | 7452 |
| 239 | Ga0207713_1000137 | 3300025735 | Bacteria | 111281 |
| 240 | Ga0207682_10000890 | 3300025893 | Bacteria | 13840 |
| 241 | Ga0207692_10149482 | 3300025898 | Bacteria | 1336 |
| 242 | Ga0207647_10009500 | 3300025904 | Bacteria | 6905 |
| 243 | Ga0207643_10005888 | 3300025908 | Bacteria | 6548 |
| 244 | Ga0207643_10071845 | 3300025908 | Bacteria | 1993 |
| 245 | Ga0207705_10000950 | 3300025909 | Bacteria | 23658 |
| 246 | Ga0207705_10216202 | 3300025909 | Bacteria | 1454 |
| 247 | Ga0207684_10081163 | 3300025910 | Bacteria | 2760 |
| 248 | Ga0207654_10046094 | 3300025911 | Bacteria | 2485 |
| 249 | Ga0207695_10001004 | 3300025913 | Bacteria | 49973 |
| 250 | Ga0207695_10009358 | 3300025913 | Bacteria | 12115 |
| 251 | Ga0207695_10053518 | 3300025913 | Bacteria | 4222 |
| 252 | Ga0207695_10198968 | 3300025913 | Bacteria | 1919 |
| 253 | Ga0207671_10001366 | 3300025914 | Bacteria | 28480 |
| 254 | Ga0207693_10001364 | 3300025915 | Bacteria | 21632 |
| 255 | Ga0207693_10177221 | 3300025915 | Bacteria | 1677 |
| 256 | Ga0207657_10003005 | 3300025919 | Bacteria | 18068 |
| 257 | Ga0207657_10003467 | 3300025919 | Bacteria | 16832 |
| 258 | Ga0207657_10053529 | 3300025919 | Bacteria | 3496 |
| 259 | Ga0207649_10071884 | 3300025920 | Bacteria | 2211 |
| 260 | Ga0207649_10148807 | 3300025920 | Bacteria | 1610 |
| 261 | Ga0207694_10000130 | 3300025924 | Bacteria | 77624 |
| 262 | Ga0207650_10002315 | 3300025925 | Bacteria | 13271 |
| 263 | Ga0207687_10117514 | 3300025927 | Bacteria | 1984 |
| 264 | Ga0207664_10004770 | 3300025929 | Bacteria | 9213 |
| 265 | Ga0207690_10005914 | 3300025932 | Bacteria | 7243 |
| 266 | Ga0207690_10016991 | 3300025932 | Bacteria | 4436 |
| 267 | Ga0207690_10182748 | 3300025932 | Bacteria | 1580 |
| 268 | Ga0207706_10016465 | 3300025933 | Bacteria | 6673 |
| 269 | Ga0207706_10030268 | 3300025933 | Bacteria | 4830 |
| 270 | Ga0207706_10070192 | 3300025933 | Bacteria | 3081 |
| 271 | Ga0207686_10000089 | 3300025934 | Bacteria | 74250 |
| 272 | Ga0207670_10029481 | 3300025936 | Bacteria | 3496 |
| 273 | Ga0207704_10022183 | 3300025938 | Bacteria | 3396 |
| 274 | Ga0207665_10003701 | 3300025939 | Bacteria | 10215 |
| 275 | Ga0207665_10113445 | 3300025939 | Bacteria | 1907 |
| 276 | Ga0207691_10000050 | 3300025940 | Bacteria | 94763 |
| 277 | Ga0207711_10002173 | 3300025941 | Bacteria | 17641 |
| 278 | Ga0207689_10009449 | 3300025942 | Bacteria | 8419 |
| 279 | Ga0207689_10145731 | 3300025942 | Bacteria | 1951 |
| 280 | Ga0207661_10271960 | 3300025944 | Bacteria | 1512 |
| 281 | Ga0207679_10018193 | 3300025945 | Bacteria | 4703 |
| 282 | Ga0207667_10000110 | 3300025949 | Bacteria | 131872 |
| 283 | Ga0207667_10003783 | 3300025949 | Bacteria | 18635 |
| 284 | Ga0207640_10004306 | 3300025981 | Bacteria | 7706 |
| 285 | Ga0207640_10023515 | 3300025981 | Bacteria | 3704 |
| 286 | Ga0207640_10049762 | 3300025981 | Bacteria | 2715 |
| 287 | Ga0207658_10051111 | 3300025986 | Bacteria | 3044 |
| 288 | Ga0207677_10002574 | 3300026023 | Bacteria | 9530 |
| 289 | Ga0207703_10005182 | 3300026035 | Bacteria | 10538 |
| 290 | Ga0207639_10104150 | 3300026041 | Bacteria | 2300 |
| 291 | Ga0207702_10068207 | 3300026078 | Bacteria | 3055 |
| 292 | Ga0207702_10157009 | 3300026078 | Bacteria | 2074 |
| 293 | Ga0207702_10337900 | 3300026078 | Bacteria | 1438 |
| 294 | Ga0207641_10050383 | 3300026088 | Bacteria | 3522 |
| 295 | Ga0207676_10000724 | 3300026095 | Bacteria | 25870 |
| 296 | Ga0207674_10015863 | 3300026116 | Bacteria | 8258 |
| 297 | Ga0207674_10134891 | 3300026116 | Bacteria | 2430 |
| 298 | Ga0207675_100105461 | 3300026118 | Bacteria | 2657 |
| 299 | Ga0207683_10000354 | 3300026121 | Bacteria | 42027 |
| 300 | Ga0207698_10006700 | 3300026142 | Bacteria | 7196 |
| 301 | Ga0207698_10068026 | 3300026142 | Bacteria | 2811 |
| 302 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 303 | Ga0268266_10004467 | 3300028379 | Bacteria | 13373 |
| 304 | Ga0307515_10161474 | 3300028794 | Bacteria | 2283 |
| 305 | Ga0316177_1076590 | 3300030731 | Bacteria | 7354 |
| 306 | Ga0307408_100000129 | 3300031548 | Bacteria | 84251 |
| 307 | Ga0307408_100000610 | 3300031548 | Bacteria | 30592 |
| 308 | Ga0307408_100010855 | 3300031548 | Bacteria | 6010 |
| 309 | Ga0307408_100038053 | 3300031548 | Bacteria | 3392 |
| 310 | Ga0265314_10130552 | 3300031711 | Bacteria | 1568 |
| 311 | Ga0307416_100001560 | 3300032002 | Bacteria | 12546 |
| 312 | Ga0373953_0009991 | 3300035117 | Bacteria | 3289 |
| 313 | Ga0373957_0001108 | 3300035120 | Bacteria | 7140 |
| 314 | Ga0373943_0064581 | 3300035170 | Bacteria | 1838 |
| 315 | Ga0373946_0009164 | 3300035171 | Bacteria | 3643 |
| 316 | Ga0373946_0019393 | 3300035171 | Bacteria | 2620 |
| 317 | Ga0373946_0072796 | 3300035171 | Bacteria | 1488 |
| 318 | Ga0373955_0103082 | 3300035172 | Bacteria | 1640 |
| 319 | Ga0373924_0000823 | 3300035410 | Bacteria | 9697 |
| 320 | Ga0373935_0030544 | 3300035692 | Bacteria | 3340 |
| 321 | Ga0373935_0046764 | 3300035692 | Bacteria | 2734 |
| 322 | Ga0373927_0009403 | 3300035695 | Bacteria | 6554 |
| 323 | Ga0373927_0050150 | 3300035695 | Bacteria | 2698 |
| 324 | Ga0373933_0015560 | 3300035724 | Bacteria | 4242 |
| 325 | Ga0373933_0036399 | 3300035724 | Bacteria | 2880 |
| 326 | Ga0373937_0013227 | 3300036401 | Bacteria | 7268 |
| 327 | Ga0373937_0060564 | 3300036401 | Bacteria | 3478 |
| 328 | Ga0373925_0023825 | 3300037068 | Bacteria | 4465 |
| 329 | Ga0373925_0038533 | 3300037068 | Bacteria | 3534 |
| 330 | Ga0395899_0000085 | 3300037312 | Bacteria | 159118 |
| 331 | Ga0395899_0004514 | 3300037312 | Bacteria | 10849 |
| 332 | Ga0395899_0007052 | 3300037312 | Bacteria | 8695 |
| 333 | Ga0395899_0010060 | 3300037312 | Bacteria | 7252 |
| 334 | Ga0395899_0011675 | 3300037312 | Bacteria | 6723 |
| 335 | Ga0395899_0014276 | 3300037312 | Bacteria | 6064 |
| 336 | Ga0395899_0024078 | 3300037312 | Bacteria | 4606 |
| 337 | Ga0395900_0001335 | 3300037418 | Bacteria | 29867 |
| 338 | Ga0395900_0003249 | 3300037418 | Bacteria | 17597 |
| 339 | Ga0395900_0013499 | 3300037418 | Bacteria | 8348 |
| 340 | Ga0395900_0014771 | 3300037418 | Bacteria | 7959 |
| 341 | Ga0395900_0022682 | 3300037418 | Bacteria | 6424 |
| 342 | Ga0395900_0041013 | 3300037418 | Bacteria | 4772 |
| 343 | Ga0395900_0044607 | 3300037418 | Bacteria | 4567 |
| 344 | Ga0395900_0324919 | 3300037418 | Bacteria | 1518 |
| 345 | Ga0395900_0450433 | 3300037418 | Bacteria | 1243 |
| 346 | Ga0395898_0074868 | 3300037466 | Bacteria | 3270 |
| 347 | Ga0395898_0359723 | 3300037466 | Bacteria | 1388 |
| 348 | Ga0395905_0001092 | 3300037471 | Bacteria | 34107 |
| 349 | Ga0395905_0017352 | 3300037471 | Bacteria | 6836 |
| 350 | Ga0395905_0068903 | 3300037471 | Bacteria | 3313 |
| 351 | Ga0395905_0070275 | 3300037471 | Bacteria | 3280 |
| 352 | Ga0395905_0089118 | 3300037471 | Bacteria | 2892 |
| 353 | Ga0395905_0185706 | 3300037471 | Bacteria | 1951 |
| 354 | Ga0395905_0195913 | 3300037471 | Bacteria | 1894 |
| 355 | Ga0395901_0000227 | 3300038443 | Bacteria | 70721 |
| 356 | Ga0395901_0012410 | 3300038443 | Bacteria | 8644 |
| 357 | Ga0395901_0172746 | 3300038443 | Bacteria | 2267 |
| 358 | Ga0395901_0526297 | 3300038443 | Bacteria | 1200 |
| 359 | Ga0436361_0094991 | 3300039447 | Bacteria | 18798 |
| 360 | Ga0436361_0152297 | 3300039447 | Bacteria | 5874 |
| 361 | Ga0436361_0340593 | 3300039447 | Bacteria | 6077 |
| 362 | Ga0436361_0632131 | 3300039447 | Bacteria | 10675 |
| 363 | Ga0436361_0768404 | 3300039447 | Bacteria | 16876 |
| 364 | Ga0436361_0851270 | 3300039447 | Bacteria | 59752 |
| 365 | Ga0436361_0953382 | 3300039447 | Bacteria | 8461 |
| 366 | Ga0439448_0001900 | 3300042005 | Bacteria | 5560 |
| 367 | Ga0439448_0023604 | 3300042005 | Bacteria | 1920 |
| 368 | Ga0439450_016155 | 3300042008 | Bacteria | 1539 |
| 369 | Ga0450888_002193 | 3300042126 | Bacteria | 1917 |
| 370 | Ga0450904_000873 | 3300042139 | Bacteria | 4926 |
| 371 | Ga0451577_0065391 | 3300042876 | Bacteria | 3243 |
| 372 | Ga0451577_0384613 | 3300042876 | Bacteria | 1273 |
| 373 | Ga0466972_0000037 | 3300044658 | Bacteria | 137184 |
| 374 | Ga0466972_0000269 | 3300044658 | Bacteria | 33053 |
| 375 | Ga0466972_0001677 | 3300044658 | Bacteria | 10841 |
| 376 | Ga0466972_0003487 | 3300044658 | Bacteria | 7805 |
| 377 | Ga0466965_0008151 | 3300044683 | Bacteria | 4839 |
| 378 | Ga0466965_0012191 | 3300044683 | Bacteria | 4040 |
| 379 | Ga0466965_0016998 | 3300044683 | Bacteria | 3470 |
| 380 | Ga0466965_0084653 | 3300044683 | Bacteria | 1606 |
| 381 | Ga0466966_0002043 | 3300044684 | Bacteria | 13112 |
| 382 | Ga0466966_0029371 | 3300044684 | Bacteria | 3577 |
| 383 | Ga0466964_0000857 | 3300044706 | Bacteria | 9953 |
| 384 | Ga0466964_0008893 | 3300044706 | Bacteria | 3776 |
| 385 | Ga0453684_0115016 | 3300044712 | Bacteria | 3260 |
| 386 | Ga0466971_0030139 | 3300044719 | Bacteria | 2428 |
| 387 | Ga0466971_0069367 | 3300044719 | Bacteria | 1599 |
| 388 | Ga0466968_0005311 | 3300044735 | Bacteria | 4823 |
| 389 | Ga0466968_0005812 | 3300044735 | Bacteria | 4628 |
| 390 | Ga0466968_0019228 | 3300044735 | Bacteria | 2748 |
| 391 | Ga0466957_0000040 | 3300044842 | Bacteria | 47080 |
| 392 | Ga0466957_0126482 | 3300044842 | Bacteria | 1633 |
| 393 | Ga0466959_0018761 | 3300045049 | Bacteria | 5080 |
| 394 | Ga0466959_0040979 | 3300045049 | Bacteria | 3420 |
| 395 | Ga0466959_0187746 | 3300045049 | Bacteria | 1443 |
| 396 | Ga0466958_0068493 | 3300045836 | Bacteria | 2169 |
| 397 | Ga0466967_0015803 | 3300045976 | Bacteria | 5930 |
| 398 | Ga0466967_0156020 | 3300045976 | Bacteria | 2138 |
| 399 | Ga0495617_000011 | 3300046452 | Bacteria | 301936 |
| 400 | Ga0495617_000046 | 3300046452 | Bacteria | 115430 |
| 401 | Ga0495617_001784 | 3300046452 | Bacteria | 9187 |
| 402 | Ga0495617_003526 | 3300046452 | Bacteria | 5857 |
| 403 | Ga0495617_005907 | 3300046452 | Bacteria | 4318 |
| 404 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 405 | Ga0495627_001231 | 3300046453 | Bacteria | 15945 |
| 406 | Ga0495627_005070 | 3300046453 | Bacteria | 5382 |
| 407 | Ga0495592_0007848 | 3300046454 | Bacteria | 7997 |
| 408 | Ga0495603_0015177 | 3300046455 | Bacteria | 4660 |
| 409 | Ga0495603_0025448 | 3300046455 | Bacteria | 3579 |
| 410 | Ga0495590_0000022 | 3300046457 | Bacteria | 205122 |
| 411 | Ga0495590_0000134 | 3300046457 | Bacteria | 43957 |
| 412 | Ga0495590_0000881 | 3300046457 | Bacteria | 13450 |
| 413 | Ga0495590_0011223 | 3300046457 | Bacteria | 3354 |
| 414 | Ga0495590_0017136 | 3300046457 | Bacteria | 2611 |
| 415 | Ga0495591_002085 | 3300046458 | Bacteria | 11521 |
| 416 | Ga0495591_026425 | 3300046458 | Bacteria | 1803 |
| 417 | Ga0495629_0026169 | 3300046459 | Bacteria | 4145 |
| 418 | Ga0495629_0085002 | 3300046459 | Bacteria | 2207 |
| 419 | Ga0495638_0000099 | 3300046460 | Bacteria | 139325 |
| 420 | Ga0495638_0000354 | 3300046460 | Bacteria | 57368 |
| 421 | Ga0495638_0006199 | 3300046460 | Bacteria | 8736 |
| 422 | Ga0495638_0011848 | 3300046460 | Bacteria | 5998 |
| 423 | Ga0495638_0056095 | 3300046460 | Bacteria | 2445 |
| 424 | Ga0495638_0165608 | 3300046460 | Bacteria | 1272 |
| 425 | Ga0495651_0008564 | 3300046462 | Bacteria | 7839 |
| 426 | Ga0495653_0000102 | 3300046463 | Bacteria | 70205 |
| 427 | Ga0495653_0002192 | 3300046463 | Bacteria | 15456 |
| 428 | Ga0495653_0007995 | 3300046463 | Bacteria | 8662 |
| 429 | Ga0495653_0063703 | 3300046463 | Bacteria | 2780 |
| 430 | Ga0495650_0000248 | 3300046471 | Bacteria | 106527 |
| 431 | Ga0495650_0000297 | 3300046471 | Bacteria | 90619 |
| 432 | Ga0495650_0000356 | 3300046471 | Bacteria | 80805 |
| 433 | Ga0495650_0000774 | 3300046471 | Bacteria | 39438 |
| 434 | Ga0495650_0001404 | 3300046471 | Bacteria | 23556 |
| 435 | Ga0495650_0001655 | 3300046471 | Bacteria | 20604 |
| 436 | Ga0495650_0002354 | 3300046471 | Bacteria | 15586 |
| 437 | Ga0495650_0005152 | 3300046471 | Bacteria | 8619 |
| 438 | Ga0495650_0010146 | 3300046471 | Bacteria | 5282 |
| 439 | Ga0495650_0017385 | 3300046471 | Bacteria | 3607 |
| 440 | Ga0495580_0004379 | 3300046472 | Bacteria | 11859 |
| 441 | Ga0495580_0080814 | 3300046472 | Bacteria | 2265 |
| 442 | Ga0495580_0119499 | 3300046472 | Bacteria | 1830 |
| 443 | Ga0495582_0001046 | 3300046473 | Bacteria | 15523 |
| 444 | Ga0495582_0008353 | 3300046473 | Bacteria | 5713 |
| 445 | Ga0495582_0031129 | 3300046473 | Bacteria | 2931 |
| 446 | Ga0495605_0000041 | 3300046474 | Bacteria | 193873 |
| 447 | Ga0495605_0000284 | 3300046474 | Bacteria | 56120 |
| 448 | Ga0495605_0000614 | 3300046474 | Bacteria | 27775 |
| 449 | Ga0495605_0001332 | 3300046474 | Bacteria | 16335 |
| 450 | Ga0495605_0005724 | 3300046474 | Bacteria | 7213 |
| 451 | Ga0495605_0007238 | 3300046474 | Bacteria | 6304 |
| 452 | Ga0495605_0009455 | 3300046474 | Bacteria | 5477 |
| 453 | Ga0495605_0010234 | 3300046474 | Bacteria | 5252 |
| 454 | Ga0495605_0028058 | 3300046474 | Bacteria | 2908 |
| 455 | Ga0495605_0106941 | 3300046474 | Bacteria | 1280 |
| 456 | Ga0495639_0015699 | 3300046475 | Bacteria | 3284 |
| 457 | Ga0495662_0030891 | 3300046476 | Bacteria | 2586 |
| 458 | Ga0495584_0000013 | 3300046491 | Bacteria | 185735 |
| 459 | Ga0495584_0000401 | 3300046491 | Bacteria | 29931 |
| 460 | Ga0495584_0000550 | 3300046491 | Bacteria | 25389 |
| 461 | Ga0495584_0000951 | 3300046491 | Bacteria | 18190 |
| 462 | Ga0495584_0000972 | 3300046491 | Bacteria | 17980 |
| 463 | Ga0495584_0002502 | 3300046491 | Bacteria | 10416 |
| 464 | Ga0495584_0002582 | 3300046491 | Bacteria | 10214 |
| 465 | Ga0495584_0003205 | 3300046491 | Bacteria | 9105 |
| 466 | Ga0495584_0005273 | 3300046491 | Bacteria | 6847 |
| 467 | Ga0495584_0006573 | 3300046491 | Bacteria | 6076 |
| 468 | Ga0495584_0012093 | 3300046491 | Bacteria | 4412 |
| 469 | Ga0495584_0012756 | 3300046491 | Bacteria | 4288 |
| 470 | Ga0495584_0013174 | 3300046491 | Bacteria | 4219 |
| 471 | Ga0495584_0016392 | 3300046491 | Bacteria | 3778 |
| 472 | Ga0495584_0154059 | 3300046491 | Bacteria | 1167 |
| 473 | Ga0495585_0000150 | 3300046492 | Bacteria | 75556 |
| 474 | Ga0495585_0001052 | 3300046492 | Bacteria | 22828 |
| 475 | Ga0495585_0001416 | 3300046492 | Bacteria | 18867 |
| 476 | Ga0495585_0002800 | 3300046492 | Bacteria | 12147 |
| 477 | Ga0495585_0002993 | 3300046492 | Bacteria | 11666 |
| 478 | Ga0495585_0003304 | 3300046492 | Bacteria | 10949 |
| 479 | Ga0495585_0005663 | 3300046492 | Bacteria | 7844 |
| 480 | Ga0495585_0006319 | 3300046492 | Bacteria | 7361 |
| 481 | Ga0495585_0007714 | 3300046492 | Bacteria | 6559 |
| 482 | Ga0495585_0007869 | 3300046492 | Bacteria | 6483 |
| 483 | Ga0495585_0008104 | 3300046492 | Bacteria | 6384 |
| 484 | Ga0495585_0013795 | 3300046492 | Bacteria | 4721 |
| 485 | Ga0495585_0014846 | 3300046492 | Bacteria | 4531 |
| 486 | Ga0495585_0037735 | 3300046492 | Bacteria | 2720 |
| 487 | Ga0495585_0052255 | 3300046492 | Bacteria | 2262 |
| 488 | Ga0495585_0053693 | 3300046492 | Bacteria | 2229 |
| 489 | Ga0495585_0060476 | 3300046492 | Bacteria | 2084 |
| 490 | Ga0495585_0061152 | 3300046492 | Bacteria | 2071 |
| 491 | Ga0495585_0091058 | 3300046492 | Bacteria | 1642 |
| 492 | Ga0495585_0187083 | 3300046492 | Bacteria | 1061 |
| 493 | Ga0495594_0001996 | 3300046499 | Bacteria | 10636 |
| 494 | Ga0495594_0003575 | 3300046499 | Bacteria | 7996 |
| 495 | Ga0495594_0025580 | 3300046499 | Bacteria | 3172 |
| 496 | Ga0495594_0047112 | 3300046499 | Bacteria | 2367 |
| 497 | Ga0495594_0114282 | 3300046499 | Bacteria | 1523 |
| 498 | Ga0495594_0142649 | 3300046499 | Bacteria | 1359 |
| 499 | Ga0495596_0001343 | 3300046500 | Bacteria | 14164 |
| 500 | Ga0495596_0001970 | 3300046500 | Bacteria | 11330 |
| 501 | Ga0495596_0003353 | 3300046500 | Bacteria | 8139 |
| 502 | Ga0495596_0005506 | 3300046500 | Bacteria | 5966 |
| 503 | Ga0495596_0005656 | 3300046500 | Bacteria | 5870 |
| 504 | Ga0495596_0008267 | 3300046500 | Bacteria | 4639 |
| 505 | Ga0495596_0009757 | 3300046500 | Bacteria | 4213 |
| 506 | Ga0495596_0014322 | 3300046500 | Bacteria | 3341 |
| 507 | Ga0495596_0018133 | 3300046500 | Bacteria | 2904 |
| 508 | Ga0495596_0025036 | 3300046500 | Bacteria | 2414 |
| 509 | Ga0495596_0056202 | 3300046500 | Bacteria | 1537 |
| 510 | Ga0495607_0001581 | 3300046501 | Bacteria | 19837 |
| 511 | Ga0495607_0001687 | 3300046501 | Bacteria | 19018 |
| 512 | Ga0495607_0001951 | 3300046501 | Bacteria | 17425 |
| 513 | Ga0495607_0005783 | 3300046501 | Bacteria | 8796 |
| 514 | Ga0495607_0006601 | 3300046501 | Bacteria | 8142 |
| 515 | Ga0495607_0008758 | 3300046501 | Bacteria | 6892 |
| 516 | Ga0495607_0012539 | 3300046501 | Bacteria | 5589 |
| 517 | Ga0495607_0013539 | 3300046501 | Bacteria | 5342 |
| 518 | Ga0495607_0019245 | 3300046501 | Bacteria | 4339 |
| 519 | Ga0495607_0020268 | 3300046501 | Bacteria | 4207 |
| 520 | Ga0495607_0051165 | 3300046501 | Bacteria | 2400 |
| 521 | Ga0495607_0055797 | 3300046501 | Bacteria | 2270 |
| 522 | Ga0495607_0061339 | 3300046501 | Bacteria | 2137 |
| 523 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 524 | Ga0495583_0000063 | 3300046506 | Bacteria | 194362 |
| 525 | Ga0495583_0000161 | 3300046506 | Bacteria | 113144 |
| 526 | Ga0495583_0000220 | 3300046506 | Bacteria | 96267 |
| 527 | Ga0495583_0000573 | 3300046506 | Bacteria | 50614 |
| 528 | Ga0495583_0000839 | 3300046506 | Bacteria | 37397 |
| 529 | Ga0495583_0003352 | 3300046506 | Bacteria | 12345 |
| 530 | Ga0495583_0004154 | 3300046506 | Bacteria | 10584 |
| 531 | Ga0495583_0004198 | 3300046506 | Bacteria | 10489 |
| 532 | Ga0495583_0009524 | 3300046506 | Bacteria | 5791 |
| 533 | Ga0495583_0011302 | 3300046506 | Bacteria | 5134 |
| 534 | Ga0495583_0019210 | 3300046506 | Bacteria | 3572 |
| 535 | Ga0495583_0072164 | 3300046506 | Bacteria | 1515 |
| 536 | Ga0495606_0000169 | 3300046507 | Bacteria | 115434 |
| 537 | Ga0495606_0000187 | 3300046507 | Bacteria | 108140 |
| 538 | Ga0495606_0000494 | 3300046507 | Bacteria | 64410 |
| 539 | Ga0495606_0000609 | 3300046507 | Bacteria | 56606 |
| 540 | Ga0495606_0001166 | 3300046507 | Bacteria | 37155 |
| 541 | Ga0495606_0003491 | 3300046507 | Bacteria | 16650 |
| 542 | Ga0495606_0004057 | 3300046507 | Bacteria | 14915 |
| 543 | Ga0495606_0004324 | 3300046507 | Bacteria | 14290 |
| 544 | Ga0495606_0014062 | 3300046507 | Bacteria | 6270 |
| 545 | Ga0495606_0023156 | 3300046507 | Bacteria | 4509 |
| 546 | Ga0495606_0038285 | 3300046507 | Bacteria | 3246 |
| 547 | Ga0495606_0064683 | 3300046507 | Bacteria | 2326 |
| 548 | Ga0495606_0119697 | 3300046507 | Bacteria | 1577 |
| 549 | Ga0495608_0001695 | 3300046511 | Bacteria | 15804 |
| 550 | Ga0495608_0008843 | 3300046511 | Bacteria | 7047 |
| 551 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 552 | Ga0495610_0001163 | 3300046512 | Bacteria | 23950 |
| 553 | Ga0495610_0001852 | 3300046512 | Bacteria | 18334 |
| 554 | Ga0495610_0002889 | 3300046512 | Bacteria | 13903 |
| 555 | Ga0495610_0003861 | 3300046512 | Bacteria | 11386 |
| 556 | Ga0495610_0012801 | 3300046512 | Bacteria | 5018 |
| 557 | Ga0495616_0000378 | 3300046513 | Bacteria | 34726 |
| 558 | Ga0495616_0000673 | 3300046513 | Bacteria | 25344 |
| 559 | Ga0495616_0000732 | 3300046513 | Bacteria | 24143 |
| 560 | Ga0495616_0000838 | 3300046513 | Bacteria | 22407 |
| 561 | Ga0495616_0004890 | 3300046513 | Bacteria | 8376 |
| 562 | Ga0495616_0007069 | 3300046513 | Bacteria | 6742 |
| 563 | Ga0495616_0007456 | 3300046513 | Bacteria | 6549 |
| 564 | Ga0495616_0016770 | 3300046513 | Bacteria | 4047 |
| 565 | Ga0495616_0017938 | 3300046513 | Bacteria | 3898 |
| 566 | Ga0495616_0020923 | 3300046513 | Bacteria | 3552 |
| 567 | Ga0495616_0028031 | 3300046513 | Bacteria | 2984 |
| 568 | Ga0495616_0030046 | 3300046513 | Bacteria | 2860 |
| 569 | Ga0495616_0047144 | 3300046513 | Bacteria | 2171 |
| 570 | Ga0495616_0063182 | 3300046513 | Bacteria | 1810 |
| 571 | Ga0495618_0010248 | 3300046514 | Bacteria | 5670 |
| 572 | Ga0495628_0001477 | 3300046516 | Bacteria | 21536 |
| 573 | Ga0495630_0050915 | 3300046517 | Bacteria | 3099 |
| 574 | Ga0495631_0003439 | 3300046518 | Bacteria | 8670 |
| 575 | Ga0495631_0003758 | 3300046518 | Bacteria | 8259 |
| 576 | Ga0495631_0005893 | 3300046518 | Bacteria | 6384 |
| 577 | Ga0495631_0006259 | 3300046518 | Bacteria | 6165 |
| 578 | Ga0495631_0008197 | 3300046518 | Bacteria | 5272 |
| 579 | Ga0495631_0011239 | 3300046518 | Bacteria | 4407 |
| 580 | Ga0495631_0020192 | 3300046518 | Bacteria | 3115 |
| 581 | Ga0495631_0025173 | 3300046518 | Bacteria | 2742 |
| 582 | Ga0495631_0042226 | 3300046518 | Bacteria | 2015 |
| 583 | Ga0495632_0000280 | 3300046519 | Bacteria | 50071 |
| 584 | Ga0495632_0000959 | 3300046519 | Bacteria | 25226 |
| 585 | Ga0495632_0001908 | 3300046519 | Bacteria | 16676 |
| 586 | Ga0495632_0003957 | 3300046519 | Bacteria | 10283 |
| 587 | Ga0495632_0006230 | 3300046519 | Bacteria | 7715 |
| 588 | Ga0495637_0000029 | 3300046520 | Bacteria | 143929 |
| 589 | Ga0495637_0001558 | 3300046520 | Bacteria | 13371 |
| 590 | Ga0495637_0019407 | 3300046520 | Bacteria | 3143 |
| 591 | Ga0495643_0000245 | 3300046522 | Bacteria | 80531 |
| 592 | Ga0495643_0000517 | 3300046522 | Bacteria | 48097 |
| 593 | Ga0495643_0001674 | 3300046522 | Bacteria | 19399 |
| 594 | Ga0495643_0002014 | 3300046522 | Bacteria | 16943 |
| 595 | Ga0495643_0008919 | 3300046522 | Bacteria | 6302 |
| 596 | Ga0495643_0041760 | 3300046522 | Bacteria | 2500 |
| 597 | Ga0495643_0041939 | 3300046522 | Bacteria | 2494 |
| 598 | Ga0495643_0060236 | 3300046522 | Bacteria | 2015 |
| 599 | Ga0495644_0002273 | 3300046523 | Bacteria | 7685 |
| 600 | Ga0495644_0002377 | 3300046523 | Bacteria | 7504 |
| 601 | Ga0495644_0003202 | 3300046523 | Bacteria | 6463 |
| 602 | Ga0495644_0006553 | 3300046523 | Bacteria | 4507 |
| 603 | Ga0495644_0012603 | 3300046523 | Bacteria | 3251 |
| 604 | Ga0495644_0026638 | 3300046523 | Bacteria | 2192 |
| 605 | Ga0495644_0031885 | 3300046523 | Bacteria | 1991 |
| 606 | Ga0495648_0000004 | 3300046524 | Bacteria | 373639 |
| 607 | Ga0495648_0000047 | 3300046524 | Bacteria | 166756 |
| 608 | Ga0495648_0001488 | 3300046524 | Bacteria | 22912 |
| 609 | Ga0495648_0002640 | 3300046524 | Bacteria | 16282 |
| 610 | Ga0495648_0004096 | 3300046524 | Bacteria | 12575 |
| 611 | Ga0495648_0009206 | 3300046524 | Bacteria | 7684 |
| 612 | Ga0495648_0010177 | 3300046524 | Bacteria | 7188 |
| 613 | Ga0495648_0012788 | 3300046524 | Bacteria | 6233 |
| 614 | Ga0495648_0013386 | 3300046524 | Bacteria | 6069 |
| 615 | Ga0495648_0017457 | 3300046524 | Bacteria | 5128 |
| 616 | Ga0495648_0031541 | 3300046524 | Bacteria | 3487 |
| 617 | Ga0495648_0045010 | 3300046524 | Bacteria | 2749 |
| 618 | Ga0495648_0047270 | 3300046524 | Bacteria | 2661 |
| 619 | Ga0495663_0019873 | 3300046525 | Bacteria | 1925 |
| 620 | Ga0495666_0003378 | 3300046526 | Bacteria | 8048 |
| 621 | Ga0495666_0005439 | 3300046526 | Bacteria | 6416 |
| 622 | Ga0495666_0005509 | 3300046526 | Bacteria | 6375 |
| 623 | Ga0495666_0032405 | 3300046526 | Bacteria | 2558 |
| 624 | Ga0495642_0000707 | 3300046528 | Bacteria | 16603 |
| 625 | Ga0495642_0000879 | 3300046528 | Bacteria | 14170 |
| 626 | Ga0495642_0000925 | 3300046528 | Bacteria | 13753 |
| 627 | Ga0495642_0006297 | 3300046528 | Bacteria | 4552 |
| 628 | Ga0495642_0009148 | 3300046528 | Bacteria | 3794 |
| 629 | Ga0495642_0009245 | 3300046528 | Bacteria | 3773 |
| 630 | Ga0495642_0011746 | 3300046528 | Bacteria | 3372 |
| 631 | Ga0495642_0016582 | 3300046528 | Bacteria | 2873 |
| 632 | Ga0495642_0020386 | 3300046528 | Bacteria | 2604 |
| 633 | Ga0495642_0021727 | 3300046528 | Bacteria | 2525 |
| 634 | Ga0495642_0033790 | 3300046528 | Bacteria | 2057 |
| 635 | Ga0495642_0052263 | 3300046528 | Bacteria | 1682 |
| 636 | Ga0495652_0044072 | 3300046529 | Bacteria | 3842 |
| 637 | Ga0495652_0053713 | 3300046529 | Bacteria | 3433 |
| 638 | Ga0495654_0000025 | 3300046530 | Bacteria | 236572 |
| 639 | Ga0495654_0004114 | 3300046530 | Bacteria | 8728 |
| 640 | Ga0495654_0005119 | 3300046530 | Bacteria | 7660 |
| 641 | Ga0495654_0006998 | 3300046530 | Bacteria | 6353 |
| 642 | Ga0495654_0015481 | 3300046530 | Bacteria | 4048 |
| 643 | Ga0495654_0024625 | 3300046530 | Bacteria | 3108 |
| 644 | Ga0495665_0003911 | 3300046531 | Bacteria | 8061 |
| 645 | Ga0495665_0004037 | 3300046531 | Bacteria | 7920 |
| 646 | Ga0495665_0020928 | 3300046531 | Bacteria | 3514 |
| 647 | Ga0495665_0025476 | 3300046531 | Bacteria | 3177 |
| 648 | Ga0495665_0072509 | 3300046531 | Bacteria | 1813 |
| 649 | Ga0495586_0017346 | 3300046535 | Bacteria | 3828 |
| 650 | Ga0495587_0056262 | 3300046536 | Bacteria | 2314 |
| 651 | Ga0495587_0067055 | 3300046536 | Bacteria | 2092 |
| 652 | Ga0495587_0085395 | 3300046536 | Bacteria | 1827 |
| 653 | Ga0495587_0100535 | 3300046536 | Bacteria | 1667 |
| 654 | Ga0495609_0000005 | 3300046538 | Bacteria | 439165 |
| 655 | Ga0495609_0001536 | 3300046538 | Bacteria | 15150 |
| 656 | Ga0495609_0001551 | 3300046538 | Bacteria | 15042 |
| 657 | Ga0495609_0001607 | 3300046538 | Bacteria | 14766 |
| 658 | Ga0495609_0002450 | 3300046538 | Bacteria | 11408 |
| 659 | Ga0495609_0002738 | 3300046538 | Bacteria | 10611 |
| 660 | Ga0495609_0004216 | 3300046538 | Bacteria | 7954 |
| 661 | Ga0495609_0010990 | 3300046538 | Bacteria | 4324 |
| 662 | Ga0495609_0014114 | 3300046538 | Bacteria | 3760 |
| 663 | Ga0495609_0023997 | 3300046538 | Bacteria | 2799 |
| 664 | Ga0495609_0040812 | 3300046538 | Bacteria | 2087 |
| 665 | Ga0495621_0016104 | 3300046539 | Bacteria | 2394 |
| 666 | Ga0495597_0000563 | 3300046542 | Bacteria | 30796 |
| 667 | Ga0495597_0002604 | 3300046542 | Bacteria | 11239 |
| 668 | Ga0495597_0002893 | 3300046542 | Bacteria | 10470 |
| 669 | Ga0495597_0003147 | 3300046542 | Bacteria | 9878 |
| 670 | Ga0495597_0003284 | 3300046542 | Bacteria | 9574 |
| 671 | Ga0495597_0005953 | 3300046542 | Bacteria | 6362 |
| 672 | Ga0495597_0007880 | 3300046542 | Bacteria | 5372 |
| 673 | Ga0495597_0012473 | 3300046542 | Bacteria | 4101 |
| 674 | Ga0495597_0018770 | 3300046542 | Bacteria | 3241 |
| 675 | Ga0495597_0020202 | 3300046542 | Bacteria | 3105 |
| 676 | Ga0495597_0051079 | 3300046542 | Bacteria | 1824 |
| 677 | Ga0495645_0031635 | 3300046543 | Bacteria | 3856 |
| 678 | Ga0495645_0043896 | 3300046543 | Bacteria | 3261 |
| 679 | Ga0495622_0000157 | 3300046557 | Bacteria | 57030 |
| 680 | Ga0495622_0000500 | 3300046557 | Bacteria | 24597 |
| 681 | Ga0495622_0002938 | 3300046557 | Bacteria | 8121 |
| 682 | Ga0495622_0033347 | 3300046557 | Bacteria | 2403 |
| 683 | Ga0495633_0000467 | 3300046558 | Bacteria | 41402 |
| 684 | Ga0495633_0000472 | 3300046558 | Bacteria | 40822 |
| 685 | Ga0495633_0003381 | 3300046558 | Bacteria | 10675 |
| 686 | Ga0495633_0003534 | 3300046558 | Bacteria | 10348 |
| 687 | Ga0495633_0005433 | 3300046558 | Bacteria | 7787 |
| 688 | Ga0495633_0006297 | 3300046558 | Bacteria | 7067 |
| 689 | Ga0495633_0006990 | 3300046558 | Bacteria | 6588 |
| 690 | Ga0495633_0007489 | 3300046558 | Bacteria | 6275 |
| 691 | Ga0495633_0008254 | 3300046558 | Bacteria | 5891 |
| 692 | Ga0495633_0010420 | 3300046558 | Bacteria | 5071 |
| 693 | Ga0495633_0011181 | 3300046558 | Bacteria | 4858 |
| 694 | Ga0495633_0016280 | 3300046558 | Bacteria | 3840 |
| 695 | Ga0495633_0033873 | 3300046558 | Bacteria | 2459 |
| 696 | Ga0495633_0067941 | 3300046558 | Bacteria | 1664 |
| 697 | Ga0495667_0087527 | 3300046559 | Bacteria | 2020 |
| 698 | Ga0495656_0004308 | 3300046615 | Bacteria | 4864 |
| 699 | Ga0495656_0019531 | 3300046615 | Bacteria | 2616 |
| 700 | Ga0495656_0102203 | 3300046615 | Bacteria | 1327 |
| 701 | Ga0495668_0000210 | 3300046616 | Bacteria | 84755 |
| 702 | Ga0495668_0000219 | 3300046616 | Bacteria | 83081 |
| 703 | Ga0495668_0000333 | 3300046616 | Bacteria | 64401 |
| 704 | Ga0495668_0001190 | 3300046616 | Bacteria | 26426 |
| 705 | Ga0495668_0004052 | 3300046616 | Bacteria | 10657 |
| 706 | Ga0495668_0004067 | 3300046616 | Bacteria | 10617 |
| 707 | Ga0495668_0004388 | 3300046616 | Bacteria | 10054 |
| 708 | Ga0495668_0005639 | 3300046616 | Bacteria | 8400 |
| 709 | Ga0495668_0007970 | 3300046616 | Bacteria | 6677 |
| 710 | Ga0495668_0014801 | 3300046616 | Bacteria | 4566 |
| 711 | Ga0495668_0017863 | 3300046616 | Bacteria | 4109 |
| 712 | Ga0495668_0025501 | 3300046616 | Bacteria | 3359 |
| 713 | Ga0495668_0043148 | 3300046616 | Bacteria | 2509 |
| 714 | Ga0495634_0010701 | 3300046642 | Bacteria | 6713 |
| 715 | Ga0495634_0029405 | 3300046642 | Bacteria | 3804 |
| 716 | Ga0495611_0000336 | 3300046648 | Bacteria | 30672 |
| 717 | Ga0495611_0001499 | 3300046648 | Bacteria | 11585 |
| 718 | Ga0495611_0001565 | 3300046648 | Bacteria | 11204 |
| 719 | Ga0495611_0005110 | 3300046648 | Bacteria | 5624 |
| 720 | Ga0495611_0007237 | 3300046648 | Bacteria | 4715 |
| 721 | Ga0495611_0016478 | 3300046648 | Bacteria | 3159 |
| 722 | Ga0495611_0019707 | 3300046648 | Bacteria | 2898 |
| 723 | Ga0495611_0022196 | 3300046648 | Bacteria | 2745 |
| 724 | Ga0495625_0000412 | 3300046660 | Bacteria | 64883 |
| 725 | Ga0495625_0000821 | 3300046660 | Bacteria | 42765 |
| 726 | Ga0495625_0001604 | 3300046660 | Bacteria | 26732 |
| 727 | Ga0495625_0002389 | 3300046660 | Bacteria | 20388 |
| 728 | Ga0495625_0007845 | 3300046660 | Bacteria | 9197 |
| 729 | Ga0495625_0010280 | 3300046660 | Bacteria | 7758 |
| 730 | Ga0495625_0015331 | 3300046660 | Bacteria | 6073 |
| 731 | Ga0495625_0016886 | 3300046660 | Bacteria | 5729 |
| 732 | Ga0495625_0026294 | 3300046660 | Bacteria | 4400 |
| 733 | Ga0495625_0109889 | 3300046660 | Bacteria | 1885 |
| 734 | Ga0495635_0005531 | 3300046663 | Bacteria | 8790 |
| 735 | Ga0495635_0018783 | 3300046663 | Bacteria | 4823 |
| 736 | Ga0495635_0194618 | 3300046663 | Bacteria | 1376 |
| 737 | Ga0495659_0000010 | 3300046664 | Bacteria | 87574 |
| 738 | Ga0495659_0000526 | 3300046664 | Bacteria | 14120 |
| 739 | Ga0495659_0002619 | 3300046664 | Bacteria | 5803 |
| 740 | Ga0495659_0035642 | 3300046664 | Bacteria | 1754 |
| 741 | Ga0495661_0000613 | 3300046665 | Bacteria | 36356 |
| 742 | Ga0495661_0000794 | 3300046665 | Bacteria | 29925 |
| 743 | Ga0495661_0001195 | 3300046665 | Bacteria | 22541 |
| 744 | Ga0495661_0002649 | 3300046665 | Bacteria | 13700 |
| 745 | Ga0495661_0003348 | 3300046665 | Bacteria | 11881 |
| 746 | Ga0495661_0007511 | 3300046665 | Bacteria | 7598 |
| 747 | Ga0495661_0007838 | 3300046665 | Bacteria | 7428 |
| 748 | Ga0495661_0011228 | 3300046665 | Bacteria | 6079 |
| 749 | Ga0495661_0013468 | 3300046665 | Bacteria | 5490 |
| 750 | Ga0495661_0014914 | 3300046665 | Bacteria | 5194 |
| 751 | Ga0495661_0019387 | 3300046665 | Bacteria | 4456 |
| 752 | Ga0495661_0021272 | 3300046665 | Bacteria | 4230 |
| 753 | Ga0495661_0031092 | 3300046665 | Bacteria | 3392 |
| 754 | Ga0495661_0042801 | 3300046665 | Bacteria | 2789 |
| 755 | Ga0495661_0047890 | 3300046665 | Bacteria | 2600 |
| 756 | Ga0495661_0067099 | 3300046665 | Bacteria | 2108 |
| 757 | Ga0495661_0071556 | 3300046665 | Bacteria | 2026 |
| 758 | Ga0495661_0075531 | 3300046665 | Bacteria | 1958 |
| 759 | Ga0495661_0082832 | 3300046665 | Bacteria | 1845 |
| 760 | Ga0495661_0101300 | 3300046665 | Bacteria | 1620 |
| 761 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 762 | Ga0495588_0002779 | 3300046674 | Bacteria | 7521 |
| 763 | Ga0495588_0014575 | 3300046674 | Bacteria | 3763 |
| 764 | Ga0495588_0015979 | 3300046674 | Bacteria | 3621 |
| 765 | Ga0495588_0049473 | 3300046674 | Bacteria | 2161 |
| 766 | Ga0495588_0051726 | 3300046674 | Bacteria | 2116 |
| 767 | Ga0495657_0015496 | 3300046675 | Bacteria | 5577 |
| 768 | Ga0495657_0192315 | 3300046675 | Bacteria | 1247 |
| 769 | Ga0495599_0032849 | 3300046678 | Bacteria | 3258 |
| 770 | Ga0495623_0007728 | 3300046679 | Bacteria | 6989 |
| 771 | Ga0495623_0014841 | 3300046679 | Bacteria | 5038 |
| 772 | Ga0495623_0015129 | 3300046679 | Bacteria | 4988 |
| 773 | Ga0495623_0064914 | 3300046679 | Bacteria | 2283 |
| 774 | Ga0495646_0001070 | 3300046680 | Bacteria | 15892 |
| 775 | Ga0495646_0007553 | 3300046680 | Bacteria | 6909 |
| 776 | Ga0495646_0007728 | 3300046680 | Bacteria | 6833 |
| 777 | Ga0495646_0033843 | 3300046680 | Bacteria | 3177 |
| 778 | Ga0495647_0007230 | 3300046681 | Bacteria | 3714 |
| 779 | Ga0495658_0133224 | 3300046683 | Bacteria | 1514 |
| 780 | Ga0495669_0000240 | 3300046684 | Bacteria | 32062 |
| 781 | Ga0495669_0000324 | 3300046684 | Bacteria | 26117 |
| 782 | Ga0495669_0001234 | 3300046684 | Bacteria | 10612 |
| 783 | Ga0495669_0004135 | 3300046684 | Bacteria | 5965 |
| 784 | Ga0495669_0007418 | 3300046684 | Bacteria | 4599 |
| 785 | Ga0495669_0010168 | 3300046684 | Bacteria | 3973 |
| 786 | Ga0495624_0050104 | 3300046690 | Bacteria | 2646 |
| 787 | Ga0495670_0003154 | 3300046691 | Bacteria | 8123 |
| 788 | Ga0495670_0006418 | 3300046691 | Bacteria | 5776 |
| 789 | Ga0495670_0008396 | 3300046691 | Bacteria | 5077 |
| 790 | Ga0495670_0031576 | 3300046691 | Bacteria | 2632 |
| 791 | Ga0495670_0034408 | 3300046691 | Bacteria | 2523 |
| 792 | Ga0495670_0046933 | 3300046691 | Bacteria | 2158 |
| 793 | Ga0495670_0068391 | 3300046691 | Bacteria | 1794 |
| 794 | Ga0495670_0077530 | 3300046691 | Bacteria | 1689 |
| 795 | Ga0495671_0000196 | 3300046692 | Bacteria | 53071 |
| 796 | Ga0495671_0000609 | 3300046692 | Bacteria | 26284 |
| 797 | Ga0495671_0000614 | 3300046692 | Bacteria | 26133 |
| 798 | Ga0495671_0002097 | 3300046692 | Bacteria | 12775 |
| 799 | Ga0495671_0155350 | 3300046692 | Bacteria | 1113 |
| 800 | Ga0495649_0000644 | 3300046694 | Bacteria | 28394 |
| 801 | Ga0495649_0003103 | 3300046694 | Bacteria | 11372 |
| 802 | Ga0495649_0003975 | 3300046694 | Bacteria | 9759 |
| 803 | Ga0495649_0019122 | 3300046694 | Bacteria | 3849 |
| 804 | Ga0495589_0000212 | 3300046794 | Bacteria | 49440 |
| 805 | Ga0495589_0000358 | 3300046794 | Bacteria | 35427 |
| 806 | Ga0495589_0001945 | 3300046794 | Bacteria | 11691 |
| 807 | Ga0495589_0008518 | 3300046794 | Bacteria | 5350 |
| 808 | Ga0495589_0010991 | 3300046794 | Bacteria | 4700 |
| 809 | Ga0495589_0015330 | 3300046794 | Bacteria | 3946 |
| 810 | Ga0495589_0017754 | 3300046794 | Bacteria | 3650 |
| 811 | Ga0495589_0068269 | 3300046794 | Bacteria | 1739 |
| 812 | Ga0495589_0087153 | 3300046794 | Bacteria | 1516 |
| 813 | Ga0495600_0010417 | 3300046809 | Bacteria | 5772 |
| 814 | Ga0495600_0023933 | 3300046809 | Bacteria | 3930 |
| 815 | Ga0495660_0000301 | 3300046810 | Bacteria | 44739 |
| 816 | Ga0495660_0000789 | 3300046810 | Bacteria | 23709 |
| 817 | Ga0495660_0001147 | 3300046810 | Bacteria | 18835 |
| 818 | Ga0495660_0002687 | 3300046810 | Bacteria | 11237 |
| 819 | Ga0495660_0002698 | 3300046810 | Bacteria | 11212 |
| 820 | Ga0495660_0002992 | 3300046810 | Bacteria | 10547 |
| 821 | Ga0495660_0006353 | 3300046810 | Bacteria | 7001 |
| 822 | Ga0495660_0052182 | 3300046810 | Bacteria | 2222 |
| 823 | Ga0495660_0054684 | 3300046810 | Bacteria | 2162 |
| 824 | Ga0495660_0063459 | 3300046810 | Bacteria | 1977 |
| 825 | Ga0495660_0075307 | 3300046810 | Bacteria | 1781 |
| 826 | Ga0495581_0001466 | 3300047315 | Bacteria | 13108 |
| 827 | Ga0495581_0013538 | 3300047315 | Bacteria | 4730 |
| 828 | Ga0495581_0029151 | 3300047315 | Bacteria | 3199 |
| 829 | Ga0495604_0004528 | 3300047317 | Bacteria | 11009 |
| 830 | Ga0495604_0009345 | 3300047317 | Bacteria | 7760 |
| 831 | Ga0495604_0013433 | 3300047317 | Bacteria | 6523 |
| 832 | Ga0495604_0130117 | 3300047317 | Bacteria | 1810 |
| 833 | Ga0495636_0002971 | 3300047318 | Bacteria | 6555 |
| 834 | Ga0495636_0009359 | 3300047318 | Bacteria | 3858 |
| 835 | Ga0495636_0011693 | 3300047318 | Bacteria | 3477 |
| 836 | Ga0495636_0035052 | 3300047318 | Bacteria | 2067 |
| 837 | Ga0495674_0006740 | 3300047319 | Bacteria | 10995 |
| 838 | Ga0495672_0000078 | 3300047320 | Bacteria | 164474 |
| 839 | Ga0495672_0000107 | 3300047320 | Bacteria | 132267 |
| 840 | Ga0495672_0000431 | 3300047320 | Bacteria | 50205 |
| 841 | Ga0495672_0001709 | 3300047320 | Bacteria | 21262 |
| 842 | Ga0495672_0001925 | 3300047320 | Bacteria | 19641 |
| 843 | Ga0495672_0002234 | 3300047320 | Bacteria | 18011 |
| 844 | Ga0495672_0002438 | 3300047320 | Bacteria | 17117 |
| 845 | Ga0495672_0007705 | 3300047320 | Bacteria | 8061 |
| 846 | Ga0495672_0009016 | 3300047320 | Bacteria | 7276 |
| 847 | Ga0495672_0014433 | 3300047320 | Bacteria | 5408 |
| 848 | Ga0495672_0033307 | 3300047320 | Bacteria | 3192 |
| 849 | Ga0495672_0058641 | 3300047320 | Bacteria | 2230 |
| 850 | Ga0495676_0000069 | 3300047321 | Bacteria | 78689 |
| 851 | Ga0495680_0009108 | 3300047322 | Bacteria | 8958 |
| 852 | Ga0495683_0000221 | 3300047323 | Bacteria | 53874 |
| 853 | Ga0495683_0000559 | 3300047323 | Bacteria | 28050 |
| 854 | Ga0495683_0001444 | 3300047323 | Bacteria | 15592 |
| 855 | Ga0495683_0002282 | 3300047323 | Bacteria | 11694 |
| 856 | Ga0495683_0003435 | 3300047323 | Bacteria | 9243 |
| 857 | Ga0495683_0003967 | 3300047323 | Bacteria | 8511 |
| 858 | Ga0495683_0011823 | 3300047323 | Bacteria | 4590 |
| 859 | Ga0495683_0048157 | 3300047323 | Bacteria | 2137 |
| 860 | Ga0495683_0074678 | 3300047323 | Bacteria | 1661 |
| 861 | Ga0495687_000221 | 3300047443 | Bacteria | 80968 |
| 862 | Ga0495687_000562 | 3300047443 | Bacteria | 43714 |
| 863 | Ga0495687_000714 | 3300047443 | Bacteria | 36793 |
| 864 | Ga0495687_000828 | 3300047443 | Bacteria | 33075 |
| 865 | Ga0495687_000917 | 3300047443 | Bacteria | 30658 |
| 866 | Ga0495687_001108 | 3300047443 | Bacteria | 26234 |
| 867 | Ga0495687_002375 | 3300047443 | Bacteria | 15204 |
| 868 | Ga0495687_004239 | 3300047443 | Bacteria | 9829 |
| 869 | Ga0495687_004864 | 3300047443 | Bacteria | 8822 |
| 870 | Ga0495687_005631 | 3300047443 | Bacteria | 7913 |
| 871 | Ga0495687_010530 | 3300047443 | Bacteria | 5064 |
| 872 | Ga0495675_0012391 | 3300047444 | Bacteria | 5366 |
| 873 | Ga0495675_0045291 | 3300047444 | Bacteria | 2801 |
| 874 | Ga0495677_0000060 | 3300047445 | Bacteria | 61831 |
| 875 | Ga0495677_0000616 | 3300047445 | Bacteria | 14512 |
| 876 | Ga0495677_0001462 | 3300047445 | Bacteria | 9465 |
| 877 | Ga0495677_0002470 | 3300047445 | Bacteria | 7260 |
| 878 | Ga0495677_0003295 | 3300047445 | Bacteria | 6293 |
| 879 | Ga0495677_0004463 | 3300047445 | Bacteria | 5371 |
| 880 | Ga0495677_0006273 | 3300047445 | Bacteria | 4491 |
| 881 | Ga0495677_0007868 | 3300047445 | Bacteria | 3967 |
| 882 | Ga0495677_0012295 | 3300047445 | Bacteria | 3123 |
| 883 | Ga0495677_0012909 | 3300047445 | Bacteria | 3042 |
| 884 | Ga0495677_0016892 | 3300047445 | Bacteria | 2646 |
| 885 | Ga0495677_0049365 | 3300047445 | Bacteria | 1546 |
| 886 | Ga0495679_003216 | 3300047446 | Bacteria | 7935 |
| 887 | Ga0495679_009937 | 3300047446 | Bacteria | 3770 |
| 888 | Ga0495685_000113 | 3300047447 | Bacteria | 28884 |
| 889 | Ga0495685_000340 | 3300047447 | Bacteria | 14999 |
| 890 | Ga0495685_000345 | 3300047447 | Bacteria | 14907 |
| 891 | Ga0495685_002067 | 3300047447 | Bacteria | 6236 |
| 892 | Ga0495673_0000074 | 3300047469 | Bacteria | 210788 |
| 893 | Ga0495673_0000173 | 3300047469 | Bacteria | 106086 |
| 894 | Ga0495673_0000194 | 3300047469 | Bacteria | 96014 |
| 895 | Ga0495673_0017436 | 3300047469 | Bacteria | 3646 |
| 896 | Ga0495681_0000330 | 3300047470 | Bacteria | 37408 |
| 897 | Ga0495681_0000642 | 3300047470 | Bacteria | 26610 |
| 898 | Ga0495681_0001763 | 3300047470 | Bacteria | 15948 |
| 899 | Ga0495681_0002881 | 3300047470 | Bacteria | 12160 |
| 900 | Ga0495681_0043864 | 3300047470 | Bacteria | 2153 |
| 901 | Ga0495681_0044790 | 3300047470 | Bacteria | 2122 |
| 902 | Ga0495681_0070441 | 3300047470 | Bacteria | 1585 |
| 903 | Ga0495681_0084645 | 3300047470 | Bacteria | 1409 |
| 904 | Ga0495686_0000387 | 3300047472 | Bacteria | 70185 |
| 905 | Ga0495686_0001928 | 3300047472 | Bacteria | 20665 |
| 906 | Ga0495686_0004503 | 3300047472 | Bacteria | 11437 |
| 907 | Ga0495686_0006220 | 3300047472 | Bacteria | 9202 |
| 908 | Ga0495686_0006658 | 3300047472 | Bacteria | 8796 |
| 909 | Ga0495686_0010605 | 3300047472 | Bacteria | 6544 |
| 910 | Ga0495686_0036664 | 3300047472 | Bacteria | 3146 |
| 911 | Ga0495686_0087977 | 3300047472 | Bacteria | 1889 |
| 912 | Ga0495593_0003624 | 3300047673 | Bacteria | 9220 |
| 913 | Ga0495593_0007992 | 3300047673 | Bacteria | 6158 |
| 914 | Ga0495593_0029917 | 3300047673 | Bacteria | 2983 |
| 915 | Ga0495602_0001744 | 3300048088 | Bacteria | 21687 |
| 916 | Ga0495602_0025892 | 3300048088 | Bacteria | 5669 |
| 917 | Ga0495602_0029800 | 3300048088 | Bacteria | 5188 |
| 918 | Ga0495614_0004592 | 3300048089 | Bacteria | 6216 |
| 919 | Ga0495614_0005888 | 3300048089 | Bacteria | 5525 |
| 920 | Ga0495614_0082665 | 3300048089 | Bacteria | 1392 |
| 921 | Ga0495615_0001202 | 3300048090 | Bacteria | 3770 |
| 922 | Ga0495615_0011539 | 3300048090 | Bacteria | 1799 |
| 923 | Ga0495626_0000058 | 3300048091 | Bacteria | 147007 |
| 924 | Ga0495626_0000196 | 3300048091 | Bacteria | 73575 |
| 925 | Ga0495626_0001643 | 3300048091 | Bacteria | 17320 |
| 926 | Ga0495626_0004639 | 3300048091 | Bacteria | 8354 |
| 927 | Ga0495626_0006061 | 3300048091 | Bacteria | 6946 |
| 928 | Ga0495626_0006899 | 3300048091 | Bacteria | 6398 |
| 929 | Ga0495626_0009308 | 3300048091 | Bacteria | 5312 |
| 930 | Ga0495626_0020651 | 3300048091 | Bacteria | 3278 |
| 931 | Ga0495626_0022022 | 3300048091 | Bacteria | 3152 |
| 932 | Ga0495626_0039346 | 3300048091 | Bacteria | 2238 |
| 933 | Ga0495626_0050032 | 3300048091 | Bacteria | 1932 |
| 934 | Ga0496100_0080627 | 3300048903 | Bacteria | 2197 |
| 935 | Ga0496101_0027300 | 3300048904 | Bacteria | 3976 |
| 936 | Ga0496101_0051972 | 3300048904 | Bacteria | 2953 |
| 937 | Ga0496102_0000097 | 3300048905 | Bacteria | 124414 |
| 938 | Ga0496102_0000420 | 3300048905 | Bacteria | 48887 |
| 939 | Ga0496102_0033655 | 3300048905 | Bacteria | 4606 |
| 940 | Ga0496103_0002958 | 3300048906 | Bacteria | 10527 |
| 941 | Ga0496103_0067781 | 3300048906 | Bacteria | 2229 |
| 942 | Ga0496104_0102748 | 3300048907 | Bacteria | 2738 |
| 943 | Ga0496104_0108920 | 3300048907 | Bacteria | 2655 |
| 944 | Ga0496104_0376008 | 3300048907 | Bacteria | 1333 |
| 945 | Ga0496105_0034735 | 3300048908 | Bacteria | 4148 |
| 946 | Ga0496106_0050665 | 3300048909 | Bacteria | 3130 |
| 947 | Ga0496106_0107492 | 3300048909 | Bacteria | 2170 |
| 948 | Ga0496107_0103276 | 3300048910 | Bacteria | 2091 |
| 949 | Ga0496108_0070128 | 3300048911 | Bacteria | 2958 |
| 950 | Ga0496108_0415930 | 3300048911 | Bacteria | 1174 |
| 951 | Ga0496109_0373831 | 3300048912 | Bacteria | 1346 |
| 952 | Ga0496109_0447473 | 3300048912 | Bacteria | 1220 |
| 953 | Ga0496110_0004041 | 3300048913 | Bacteria | 11322 |
| 954 | Ga0496111_0032938 | 3300048914 | Bacteria | 3695 |
| 955 | Ga0496111_0054088 | 3300048914 | Bacteria | 2901 |
| 956 | Ga0496111_0173620 | 3300048914 | Bacteria | 1602 |
| 957 | Ga0496113_0015989 | 3300048916 | Bacteria | 5175 |
| 958 | Ga0496113_0034323 | 3300048916 | Bacteria | 3701 |
| 959 | Ga0496114_0051398 | 3300048917 | Bacteria | 3431 |
| 960 | Ga0496115_0006572 | 3300048918 | Bacteria | 8521 |
| 961 | Ga0496115_0007248 | 3300048918 | Bacteria | 8149 |
| 962 | Ga0496115_0014859 | 3300048918 | Bacteria | 5905 |
| 963 | Ga0496115_0063391 | 3300048918 | Bacteria | 2982 |
| 964 | Ga0496115_0115931 | 3300048918 | Bacteria | 2203 |
| 965 | Ga0496116_0003789 | 3300048919 | Bacteria | 14777 |
| 966 | Ga0496116_0012419 | 3300048919 | Bacteria | 6960 |
| 967 | Ga0496117_0083507 | 3300048920 | Bacteria | 2088 |
| 968 | Ga0496118_0002994 | 3300048921 | Bacteria | 21830 |
| 969 | Ga0496122_0001092 | 3300048925 | Bacteria | 47015 |
| 970 | Ga0496122_0003878 | 3300048925 | Bacteria | 19185 |
| 971 | Ga0496122_0005263 | 3300048925 | Bacteria | 15501 |
| 972 | Ga0496122_0025683 | 3300048925 | Bacteria | 5106 |
| 973 | Ga0496123_0000912 | 3300048926 | Bacteria | 46427 |
| 974 | Ga0496123_0002714 | 3300048926 | Bacteria | 21267 |
| 975 | Ga0496123_0003558 | 3300048926 | Bacteria | 17279 |
| 976 | Ga0496123_0003832 | 3300048926 | Bacteria | 16407 |
| 977 | Ga0496124_0007788 | 3300048927 | Bacteria | 11313 |
| 978 | Ga0496124_0019066 | 3300048927 | Bacteria | 6401 |
| 979 | Ga0496124_0021520 | 3300048927 | Bacteria | 5940 |
| 980 | Ga0496124_0076846 | 3300048927 | Bacteria | 2755 |
| 981 | Ga0496125_0000368 | 3300048928 | Bacteria | 84924 |
| 982 | Ga0496125_0003100 | 3300048928 | Bacteria | 20723 |
| 983 | Ga0496125_0008339 | 3300048928 | Bacteria | 10871 |
| 984 | Ga0496126_0025776 | 3300048929 | Bacteria | 5649 |
| 985 | Ga0495678_000013 | 3300049459 | Bacteria | 316375 |
| 986 | Ga0495678_000146 | 3300049459 | Bacteria | 85995 |
| 987 | Ga0495678_001534 | 3300049459 | Bacteria | 17833 |
| 988 | Ga0495678_003140 | 3300049459 | Bacteria | 10447 |
| 989 | Ga0495678_003408 | 3300049459 | Bacteria | 9870 |
| 990 | Ga0495678_003481 | 3300049459 | Bacteria | 9716 |
| 991 | Ga0495678_005649 | 3300049459 | Bacteria | 6826 |
| 992 | Ga0495678_006090 | 3300049459 | Bacteria | 6491 |
| 993 | Ga0495678_007836 | 3300049459 | Bacteria | 5488 |
| 994 | Ga0495678_010397 | 3300049459 | Bacteria | 4527 |
| 995 | Ga0495678_048240 | 3300049459 | Bacteria | 1662 |
| 996 | Ga0495678_062852 | 3300049459 | Bacteria | 1388 |
| 997 | Ga0495682_0001101 | 3300049460 | Bacteria | 15713 |
| 998 | Ga0495682_0001326 | 3300049460 | Bacteria | 13739 |
| 999 | Ga0495682_0002294 | 3300049460 | Bacteria | 9141 |
| 1000 | Ga0495682_0002626 | 3300049460 | Bacteria | 8411 |
| 1001 | Ga0495682_0003910 | 3300049460 | Bacteria | 6505 |
| 1002 | Ga0495682_0011240 | 3300049460 | Bacteria | 3446 |
| 1003 | Ga0495682_0040067 | 3300049460 | Bacteria | 1718 |
| 1004 | Ga0501249_012850 | 3300049679 | Bacteria | 1774 |
| 1005 | Ga0501269_000446 | 3300049766 | Bacteria | 9103 |
| 1006 | Ga0501279_004692 | 3300049775 | Bacteria | 1794 |
| 1007 | Ga0501279_005671 | 3300049775 | Bacteria | 1644 |
| 1008 | Ga0501035_0007367 | 3300049822 | Bacteria | 10283 |
| 1009 | nmdc:mga0n895_374590_c1 | 3300050512 | Bacteria | 1441 |
| 1010 | nmdc:mga08x19_225778_c1 | 3300050514 | Bacteria | 1288 |
| 1011 | nmdc:mga0a205_12156_c1 | 3300050515 | Bacteria | 7959 |
| 1012 | Ga0495601_0005679 | 3300053077 | Bacteria | 7273 |
| 1013 | Ga0500595_005622 | 3300053119 | Bacteria | 5450 |
| 1014 | Ga0500618_000437 | 3300053125 | Bacteria | 27382 |
| 1015 | Ga0500574_021706 | 3300053141 | Bacteria | 1629 |
| 1016 | Ga0500586_006285 | 3300053145 | Bacteria | 3074 |
| 1017 | Ga0500586_011320 | 3300053145 | Bacteria | 2551 |
| 1018 | Ga0466962_0071573 | 3300061719 | Bacteria | 1656 |
| 1019 | Ga0466962_0073054 | 3300061719 | Bacteria | 1639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100053621 | Ga0070659_1000536211 | 305 |
| 2 | 3300025981 | Ga0207640_10049762 | Ga0207640_100497622 | 305 |
| 3 | 3300026041 | Ga0207639_10104150 | Ga0207639_101041501 | 305 |
| 4 | 3300035724 | Ga0373933_0015560 | Ga0373933_0015560_2986_4098 | 306 |
| 5 | 3300036401 | Ga0373937_0013227 | Ga0373937_0013227_3791_4903 | 306 |
| 6 | 3300046675 | Ga0495657_0192315 | Ga0495657_0192315_47_1159 | 306 |
| 7 | 3300046492 | Ga0495585_0187083 | Ga0495585_0187083_53_1006 | 317 |
| 8 | 3300046531 | Ga0495665_0003911 | Ga0495665_0003911_5359_6312 | 317 |
| 9 | 3300046810 | Ga0495660_0006353 | Ga0495660_0006353_6014_6979 | 321 |
| 10 | 3300048906 | Ga0496103_0067781 | Ga0496103_0067781_1170_2213 | 330 |
| 11 | 3300046454 | Ga0495592_0007848 | Ga0495592_0007848_3933_4931 | 332 |
| 12 | 3300046518 | Ga0495631_0011239 | Ga0495631_0011239_20_1018 | 332 |
| 13 | 3300002987 | JGI25159J45721_1007516 | JGI25159J45721_10075161 | 334 |
| 14 | 3300035170 | Ga0373943_0064581 | Ga0373943_0064581_132_1244 | 337 |
| 15 | 3300035171 | Ga0373946_0009164 | Ga0373946_0009164_1446_2558 | 337 |
| 16 | 3300035692 | Ga0373935_0030544 | Ga0373935_0030544_1125_2237 | 337 |
| 17 | 3300013105 | Ga0157369_10196718 | Ga0157369_101967183 | 339 |
| 18 | 3300005334 | Ga0068869_100046178 | Ga0068869_1000461783 | 344 |
| 19 | 3300005340 | Ga0070689_100012684 | Ga0070689_1000126843 | 344 |
| 20 | 3300005354 | Ga0070675_100197349 | Ga0070675_1001973491 | 344 |
| 21 | 3300005356 | Ga0070674_100007079 | Ga0070674_1000070794 | 344 |
| 22 | 3300005364 | Ga0070673_100112224 | Ga0070673_1001122242 | 344 |
| 23 | 3300005365 | Ga0070688_100026044 | Ga0070688_1000260442 | 344 |
| 24 | 3300005436 | Ga0070713_100103012 | Ga0070713_1001030123 | 344 |
| 25 | 3300005437 | Ga0070710_10040804 | Ga0070710_100408043 | 344 |
| 26 | 3300005438 | Ga0070701_10175462 | Ga0070701_101754621 | 344 |
| 27 | 3300005439 | Ga0070711_100007512 | Ga0070711_1000075127 | 344 |
| 28 | 3300005455 | Ga0070663_100108327 | Ga0070663_1001083272 | 344 |
| 29 | 3300005456 | Ga0070678_100003601 | Ga0070678_1000036013 | 344 |
| 30 | 3300005457 | Ga0070662_100008580 | Ga0070662_1000085804 | 344 |
| 31 | 3300005466 | Ga0070685_10001242 | Ga0070685_1000124212 | 344 |
| 32 | 3300005546 | Ga0070696_100020672 | Ga0070696_1000206723 | 344 |
| 33 | 3300005547 | Ga0070693_100013520 | Ga0070693_1000135204 | 344 |
| 34 | 3300005548 | Ga0070665_100138353 | Ga0070665_1001383533 | 344 |
| 35 | 3300005578 | Ga0068854_100009651 | Ga0068854_1000096514 | 344 |
| 36 | 3300005718 | Ga0068866_10001450 | Ga0068866_100014507 | 344 |
| 37 | 3300005841 | Ga0068863_100003727 | Ga0068863_1000037278 | 344 |
| 38 | 3300005842 | Ga0068858_100062410 | Ga0068858_1000624102 | 344 |
| 39 | 3300006163 | Ga0070715_10015827 | Ga0070715_100158272 | 344 |
| 40 | 3300006173 | Ga0070716_100009211 | Ga0070716_1000092111 | 344 |
| 41 | 3300006358 | Ga0068871_100023493 | Ga0068871_1000234934 | 344 |
| 42 | 3300006881 | Ga0068865_100164266 | Ga0068865_1001642661 | 344 |
| 43 | 3300009177 | Ga0105248_10125724 | Ga0105248_101257242 | 344 |
| 44 | 3300010375 | Ga0105239_10124092 | Ga0105239_101240923 | 344 |
| 45 | 3300013296 | Ga0157374_10005077 | Ga0157374_100050778 | 344 |
| 46 | 3300014325 | Ga0163163_10073735 | Ga0163163_100737353 | 344 |
| 47 | 3300014968 | Ga0157379_10054036 | Ga0157379_100540363 | 344 |
| 48 | 3300025898 | Ga0207692_10149482 | Ga0207692_101494821 | 344 |
| 49 | 3300025908 | Ga0207643_10071845 | Ga0207643_100718453 | 344 |
| 50 | 3300025911 | Ga0207654_10046094 | Ga0207654_100460942 | 344 |
| 51 | 3300025915 | Ga0207693_10001364 | Ga0207693_100013644 | 344 |
| 52 | 3300025933 | Ga0207706_10016465 | Ga0207706_100164654 | 344 |
| 53 | 3300025934 | Ga0207686_10000089 | Ga0207686_1000008968 | 344 |
| 54 | 3300025936 | Ga0207670_10029481 | Ga0207670_100294812 | 344 |
| 55 | 3300025938 | Ga0207704_10022183 | Ga0207704_100221832 | 344 |
| 56 | 3300025939 | Ga0207665_10003701 | Ga0207665_100037019 | 344 |
| 57 | 3300025941 | Ga0207711_10002173 | Ga0207711_100021739 | 344 |
| 58 | 3300025942 | Ga0207689_10009449 | Ga0207689_100094495 | 344 |
| 59 | 3300025981 | Ga0207640_10023515 | Ga0207640_100235154 | 344 |
| 60 | 3300026023 | Ga0207677_10002574 | Ga0207677_100025748 | 344 |
| 61 | 3300026035 | Ga0207703_10005182 | Ga0207703_100051828 | 344 |
| 62 | 3300026078 | Ga0207702_10337900 | Ga0207702_103379002 | 344 |
| 63 | 3300026095 | Ga0207676_10000724 | Ga0207676_1000072415 | 344 |
| 64 | 3300026121 | Ga0207683_10000354 | Ga0207683_100003549 | 344 |
| 65 | 3300026142 | Ga0207698_10068026 | Ga0207698_100680262 | 344 |
| 66 | 3300035117 | Ga0373953_0009991 | Ga0373953_0009991_875_1987 | 344 |
| 67 | 3300035120 | Ga0373957_0001108 | Ga0373957_0001108_3050_4162 | 344 |
| 68 | 3300035171 | Ga0373946_0019393 | Ga0373946_0019393_589_1701 | 344 |
| 69 | 3300035171 | Ga0373946_0072796 | Ga0373946_0072796_352_1464 | 344 |
| 70 | 3300035172 | Ga0373955_0103082 | Ga0373955_0103082_54_1166 | 344 |
| 71 | 3300035692 | Ga0373935_0046764 | Ga0373935_0046764_492_1604 | 344 |
| 72 | 3300035695 | Ga0373927_0009403 | Ga0373927_0009403_4681_5793 | 344 |
| 73 | 3300035724 | Ga0373933_0036399 | Ga0373933_0036399_1203_2315 | 344 |
| 74 | 3300036401 | Ga0373937_0060564 | Ga0373937_0060564_1121_2233 | 344 |
| 75 | 3300037068 | Ga0373925_0023825 | Ga0373925_0023825_44_1156 | 344 |
| 76 | 3300037068 | Ga0373925_0038533 | Ga0373925_0038533_1117_2229 | 344 |
| 77 | 3300046459 | Ga0495629_0085002 | Ga0495629_0085002_745_1857 | 344 |
| 78 | 3300046472 | Ga0495580_0080814 | Ga0495580_0080814_346_1458 | 344 |
| 79 | 3300046473 | Ga0495582_0031129 | Ga0495582_0031129_1162_2274 | 344 |
| 80 | 3300046476 | Ga0495662_0030891 | Ga0495662_0030891_505_1617 | 344 |
| 81 | 3300046491 | Ga0495584_0016392 | Ga0495584_0016392_530_1570 | 344 |
| 82 | 3300046499 | Ga0495594_0142649 | Ga0495594_0142649_127_1239 | 344 |
| 83 | 3300046526 | Ga0495666_0032405 | Ga0495666_0032405_637_1749 | 344 |
| 84 | 3300046536 | Ga0495587_0100535 | Ga0495587_0100535_351_1463 | 344 |
| 85 | 3300046539 | Ga0495621_0016104 | Ga0495621_0016104_1168_2280 | 344 |
| 86 | 3300046543 | Ga0495645_0043896 | Ga0495645_0043896_339_1451 | 344 |
| 87 | 3300046559 | Ga0495667_0087527 | Ga0495667_0087527_350_1462 | 344 |
| 88 | 3300046663 | Ga0495635_0018783 | Ga0495635_0018783_1288_2400 | 344 |
| 89 | 3300046681 | Ga0495647_0007230 | Ga0495647_0007230_1471_2583 | 344 |
| 90 | 3300046683 | Ga0495658_0133224 | Ga0495658_0133224_130_1242 | 344 |
| 91 | 3300047315 | Ga0495581_0029151 | Ga0495581_0029151_640_1752 | 344 |
| 92 | 3300047673 | Ga0495593_0029917 | Ga0495593_0029917_1591_2703 | 344 |
| 93 | 3300048903 | Ga0496100_0080627 | Ga0496100_0080627_799_1911 | 344 |
| 94 | 3300048907 | Ga0496104_0108920 | Ga0496104_0108920_1492_2604 | 344 |
| 95 | 3300048908 | Ga0496105_0034735 | Ga0496105_0034735_373_1485 | 344 |
| 96 | 3300048911 | Ga0496108_0415930 | Ga0496108_0415930_21_1133 | 344 |
| 97 | 3300048918 | Ga0496115_0063391 | Ga0496115_0063391_1073_2185 | 344 |
| 98 | 3300042005 | Ga0439448_0023604 | Ga0439448_0023604_402_1514 | 345 |
| 99 | 3300005339 | Ga0070660_100044166 | Ga0070660_1000441663 | 346 |
| 100 | 3300005344 | Ga0070661_100048867 | Ga0070661_1000488672 | 346 |
| 101 | 3300005434 | Ga0070709_10062075 | Ga0070709_100620752 | 346 |
| 102 | 3300005444 | Ga0070694_100040466 | Ga0070694_1000404662 | 346 |
| 103 | 3300005467 | Ga0070706_100067702 | Ga0070706_1000677023 | 346 |
| 104 | 3300005471 | Ga0070698_100198347 | Ga0070698_1001983472 | 346 |
| 105 | 3300005518 | Ga0070699_100004479 | Ga0070699_1000044792 | 346 |
| 106 | 3300005535 | Ga0070684_100037077 | Ga0070684_1000370772 | 346 |
| 107 | 3300005536 | Ga0070697_100106790 | Ga0070697_1001067902 | 346 |
| 108 | 3300005546 | Ga0070696_100045904 | Ga0070696_1000459042 | 346 |
| 109 | 3300005564 | Ga0070664_100045233 | Ga0070664_1000452333 | 346 |
| 110 | 3300005578 | Ga0068854_100041525 | Ga0068854_1000415254 | 346 |
| 111 | 3300006175 | Ga0070712_100160332 | Ga0070712_1001603322 | 346 |
| 112 | 3300009093 | Ga0105240_10089082 | Ga0105240_100890822 | 346 |
| 113 | 3300009174 | Ga0105241_10134519 | Ga0105241_101345192 | 346 |
| 114 | 3300009551 | Ga0105238_10032510 | Ga0105238_100325101 | 346 |
| 115 | 3300025321 | Ga0207656_10066502 | Ga0207656_100665022 | 346 |
| 116 | 3300025915 | Ga0207693_10177221 | Ga0207693_101772213 | 346 |
| 117 | 3300025919 | Ga0207657_10003005 | Ga0207657_1000300511 | 346 |
| 118 | 3300025920 | Ga0207649_10148807 | Ga0207649_101488072 | 346 |
| 119 | 3300025927 | Ga0207687_10117514 | Ga0207687_101175142 | 346 |
| 120 | 3300025929 | Ga0207664_10004770 | Ga0207664_100047708 | 346 |
| 121 | 3300025932 | Ga0207690_10182748 | Ga0207690_101827482 | 346 |
| 122 | 3300025939 | Ga0207665_10113445 | Ga0207665_101134452 | 346 |
| 123 | 3300025944 | Ga0207661_10271960 | Ga0207661_102719602 | 346 |
| 124 | 3300026078 | Ga0207702_10068207 | Ga0207702_100682072 | 346 |
| 125 | 3300026116 | Ga0207674_10015863 | Ga0207674_100158632 | 346 |
| 126 | 3300026118 | Ga0207675_100105461 | Ga0207675_1001054612 | 346 |
| 127 | 3300035410 | Ga0373924_0000823 | Ga0373924_0000823_2200_3303 | 346 |
| 128 | 3300046660 | Ga0495625_0109889 | Ga0495625_0109889_649_1692 | 346 |
| 129 | 3300048909 | Ga0496106_0107492 | Ga0496106_0107492_157_1269 | 346 |
| 130 | 3300050514 | nmdc:mga08x19_225778_c1 | nmdc:mga08x19_225778_c1_10_1053 | 346 |
| 131 | 3300030731 | Ga0316177_1076590 | Ga0316177_10765902 | 347 |
| 132 | 3300039447 | Ga0436361_0094991 | Ga0436361_0094991_5820_6896 | 348 |
| 133 | 3300039447 | Ga0436361_0953382 | Ga0436361_0953382_3979_5058 | 348 |
| 134 | 3300046455 | Ga0495603_0025448 | Ga0495603_0025448_1142_2257 | 351 |
| 135 | 3300046492 | Ga0495585_0052255 | Ga0495585_0052255_671_1786 | 351 |
| 136 | 3300046499 | Ga0495594_0001996 | Ga0495594_0001996_4931_6046 | 351 |
| 137 | 3300046507 | Ga0495606_0000187 | Ga0495606_0000187_32329_33438 | 351 |
| 138 | 3300046691 | Ga0495670_0077530 | Ga0495670_0077530_522_1637 | 351 |
| 139 | 3300047472 | Ga0495686_0036664 | Ga0495686_0036664_1223_2332 | 351 |
| 140 | 3300046499 | Ga0495594_0114282 | Ga0495594_0114282_24_1085 | 353 |
| 141 | 3300047320 | Ga0495672_0000078 | Ga0495672_0000078_129974_131053 | 353 |
| 142 | iso_pu_bacteria | 2857564685 | 2857569501 | 354 |
| 143 | 3300046491 | Ga0495584_0002582 | Ga0495584_0002582_5122_6237 | 356 |
| 144 | 3300046530 | Ga0495654_0024625 | Ga0495654_0024625_1490_2605 | 356 |
| 145 | 3300046557 | Ga0495622_0000500 | Ga0495622_0000500_19102_20214 | 356 |
| 146 | 3300046616 | Ga0495668_0014801 | Ga0495668_0014801_3426_4541 | 356 |
| 147 | 3300047320 | Ga0495672_0007705 | Ga0495672_0007705_4029_5144 | 356 |
| 148 | 3300003775 | Ga0055524_1000049 | Ga0055524_1000049134 | 357 |
| 149 | 3300006948 | Ga0099826_10000005 | Ga0099826_10000005199 | 357 |
| 150 | 3300013102 | Ga0157371_10000153 | Ga0157371_1000015332 | 357 |
| 151 | 3300025295 | Ga0209564_1010725 | Ga0209564_10107252 | 357 |
| 152 | 3300025299 | Ga0209256_1000040 | Ga0209256_1000040199 | 357 |
| 153 | 3300027666 | Ga0209282_1000003 | Ga0209282_1000003601 | 357 |
| 154 | 3300031711 | Ga0265314_10130552 | Ga0265314_101305521 | 357 |
| 155 | 3300046471 | Ga0495650_0000297 | Ga0495650_0000297_37509_38621 | 357 |
| 156 | 3300046542 | Ga0495597_0005953 | Ga0495597_0005953_884_1999 | 357 |
| 157 | 3300003316 | rootH1_10086751 | rootH1_100867512 | 358 |
| 158 | 3300003775 | Ga0055524_1000022 | Ga0055524_100002244 | 358 |
| 159 | 3300005366 | Ga0070659_100001264 | Ga0070659_10000126421 | 358 |
| 160 | 3300009036 | Ga0105244_10002568 | Ga0105244_1000256810 | 358 |
| 161 | 3300025920 | Ga0207649_10071884 | Ga0207649_100718842 | 358 |
| 162 | 3300025932 | Ga0207690_10005914 | Ga0207690_100059142 | 358 |
| 163 | 3300025945 | Ga0207679_10018193 | Ga0207679_100181932 | 358 |
| 164 | 3300046452 | Ga0495617_000011 | Ga0495617_000011_254704_255780 | 358 |
| 165 | 3300046460 | Ga0495638_0000354 | Ga0495638_0000354_53599_54678 | 358 |
| 166 | 3300046463 | Ga0495653_0000102 | Ga0495653_0000102_21092_22168 | 358 |
| 167 | 3300046471 | Ga0495650_0000356 | Ga0495650_0000356_46279_47358 | 358 |
| 168 | 3300046471 | Ga0495650_0000774 | Ga0495650_0000774_21767_22843 | 358 |
| 169 | 3300046471 | Ga0495650_0001404 | Ga0495650_0001404_18109_19188 | 358 |
| 170 | 3300046474 | Ga0495605_0000041 | Ga0495605_0000041_48139_49218 | 358 |
| 171 | 3300046491 | Ga0495584_0154059 | Ga0495584_0154059_55_1134 | 358 |
| 172 | 3300046492 | Ga0495585_0002800 | Ga0495585_0002800_1834_2910 | 358 |
| 173 | 3300046501 | Ga0495607_0005783 | Ga0495607_0005783_505_1584 | 358 |
| 174 | 3300046501 | Ga0495607_0008758 | Ga0495607_0008758_5209_6288 | 358 |
| 175 | 3300046506 | Ga0495583_0000063 | Ga0495583_0000063_29587_30666 | 358 |
| 176 | 3300046507 | Ga0495606_0000169 | Ga0495606_0000169_7684_8760 | 358 |
| 177 | 3300046507 | Ga0495606_0000494 | Ga0495606_0000494_7413_8492 | 358 |
| 178 | 3300046512 | Ga0495610_0000007 | Ga0495610_0000007_773239_774315 | 358 |
| 179 | 3300046512 | Ga0495610_0001852 | Ga0495610_0001852_5875_6954 | 358 |
| 180 | 3300046524 | Ga0495648_0004096 | Ga0495648_0004096_2024_3103 | 358 |
| 181 | 3300046524 | Ga0495648_0010177 | Ga0495648_0010177_5371_6447 | 358 |
| 182 | 3300046530 | Ga0495654_0000025 | Ga0495654_0000025_40887_41963 | 358 |
| 183 | 3300046530 | Ga0495654_0005119 | Ga0495654_0005119_3497_4573 | 358 |
| 184 | 3300046530 | Ga0495654_0015481 | Ga0495654_0015481_2349_3428 | 358 |
| 185 | 3300046538 | Ga0495609_0002738 | Ga0495609_0002738_5759_6838 | 358 |
| 186 | 3300046542 | Ga0495597_0012473 | Ga0495597_0012473_1196_2275 | 358 |
| 187 | 3300046558 | Ga0495633_0007489 | Ga0495633_0007489_4586_5665 | 358 |
| 188 | 3300046558 | Ga0495633_0016280 | Ga0495633_0016280_1631_2707 | 358 |
| 189 | 3300046615 | Ga0495656_0102203 | Ga0495656_0102203_24_1103 | 358 |
| 190 | 3300046616 | Ga0495668_0000219 | Ga0495668_0000219_51827_52906 | 358 |
| 191 | 3300046616 | Ga0495668_0004388 | Ga0495668_0004388_5061_6140 | 358 |
| 192 | 3300046616 | Ga0495668_0005639 | Ga0495668_0005639_2757_3833 | 358 |
| 193 | 3300046660 | Ga0495625_0000821 | Ga0495625_0000821_34419_35498 | 358 |
| 194 | 3300046664 | Ga0495659_0000010 | Ga0495659_0000010_56063_57142 | 358 |
| 195 | 3300046664 | Ga0495659_0035642 | Ga0495659_0035642_481_1560 | 358 |
| 196 | 3300046665 | Ga0495661_0047890 | Ga0495661_0047890_995_2071 | 358 |
| 197 | 3300046665 | Ga0495661_0075531 | Ga0495661_0075531_376_1455 | 358 |
| 198 | 3300046692 | Ga0495671_0000196 | Ga0495671_0000196_9496_10572 | 358 |
| 199 | 3300046692 | Ga0495671_0000614 | Ga0495671_0000614_6410_7489 | 358 |
| 200 | 3300046692 | Ga0495671_0155350 | Ga0495671_0155350_11_1087 | 358 |
| 201 | 3300046694 | Ga0495649_0019122 | Ga0495649_0019122_2476_3591 | 358 |
| 202 | 3300047318 | Ga0495636_0011693 | Ga0495636_0011693_2374_3453 | 358 |
| 203 | 3300047320 | Ga0495672_0000107 | Ga0495672_0000107_100747_101826 | 358 |
| 204 | 3300047320 | Ga0495672_0058641 | Ga0495672_0058641_1139_2218 | 358 |
| 205 | 3300047323 | Ga0495683_0001444 | Ga0495683_0001444_13015_14094 | 358 |
| 206 | 3300047443 | Ga0495687_000562 | Ga0495687_000562_25237_26316 | 358 |
| 207 | 3300047445 | Ga0495677_0006273 | Ga0495677_0006273_574_1653 | 358 |
| 208 | 3300047469 | Ga0495673_0000173 | Ga0495673_0000173_47724_48800 | 358 |
| 209 | 3300047469 | Ga0495673_0017436 | Ga0495673_0017436_573_1652 | 358 |
| 210 | 3300048905 | Ga0496102_0000097 | Ga0496102_0000097_34372_35448 | 358 |
| 211 | 3300048906 | Ga0496103_0002958 | Ga0496103_0002958_4069_5181 | 358 |
| 212 | 3300048919 | Ga0496116_0012419 | Ga0496116_0012419_3313_4392 | 358 |
| 213 | 3300048926 | Ga0496123_0003832 | Ga0496123_0003832_15216_16292 | 358 |
| 214 | 3300048929 | Ga0496126_0025776 | Ga0496126_0025776_2975_4054 | 358 |
| 215 | 3300049460 | Ga0495682_0001101 | Ga0495682_0001101_14604_15683 | 358 |
| 216 | 3300049775 | Ga0501279_004692 | Ga0501279_004692_174_1253 | 358 |
| 217 | 3300049775 | Ga0501279_005671 | Ga0501279_005671_252_1331 | 358 |
| 218 | 3300053125 | Ga0500618_000437 | Ga0500618_000437_282_1358 | 358 |
| 219 | 3300053145 | Ga0500586_006285 | Ga0500586_006285_1812_2888 | 358 |
| 220 | 3300021361 | Ga0213872_10000065 | Ga0213872_1000006561 | 359 |
| 221 | 3300021361 | Ga0213872_10001325 | Ga0213872_100013258 | 359 |
| 222 | 3300021361 | Ga0213872_10019758 | Ga0213872_100197582 | 359 |
| 223 | 3300021361 | Ga0213872_10042999 | Ga0213872_100429992 | 359 |
| 224 | 3300021361 | Ga0213872_10045535 | Ga0213872_100455352 | 359 |
| 225 | 3300025250 | Ga0209026_1004565 | Ga0209026_10045652 | 359 |
| 226 | 3300039447 | Ga0436361_0152297 | Ga0436361_0152297_2841_3956 | 359 |
| 227 | 3300039447 | Ga0436361_0340593 | Ga0436361_0340593_4802_5917 | 359 |
| 228 | 3300039447 | Ga0436361_0851270 | Ga0436361_0851270_19279_20361 | 359 |
| 229 | 3300046525 | Ga0495663_0019873 | Ga0495663_0019873_676_1788 | 359 |
| 230 | 3300048090 | Ga0495615_0001202 | Ga0495615_0001202_21_1133 | 359 |
| 231 | 3300049459 | Ga0495678_048240 | Ga0495678_048240_397_1479 | 359 |
| 232 | 3300003759 | Ga0055525_1000179 | Ga0055525_100017924 | 360 |
| 233 | 3300005327 | Ga0070658_10076930 | Ga0070658_100769302 | 360 |
| 234 | 3300005327 | Ga0070658_10238587 | Ga0070658_102385871 | 360 |
| 235 | 3300005339 | Ga0070660_100070378 | Ga0070660_1000703782 | 360 |
| 236 | 3300005366 | Ga0070659_100051729 | Ga0070659_1000517292 | 360 |
| 237 | 3300005563 | Ga0068855_100033221 | Ga0068855_1000332212 | 360 |
| 238 | 3300006237 | Ga0097621_100197464 | Ga0097621_1001974642 | 360 |
| 239 | 3300009098 | Ga0105245_10069028 | Ga0105245_100690282 | 360 |
| 240 | 3300009148 | Ga0105243_10054586 | Ga0105243_100545863 | 360 |
| 241 | 3300009174 | Ga0105241_10086633 | Ga0105241_100866332 | 360 |
| 242 | 3300009545 | Ga0105237_10354181 | Ga0105237_103541812 | 360 |
| 243 | 3300025230 | Ga0209563_100143 | Ga0209563_10014352 | 360 |
| 244 | 3300025909 | Ga0207705_10000950 | Ga0207705_100009509 | 360 |
| 245 | 3300025913 | Ga0207695_10198968 | Ga0207695_101989682 | 360 |
| 246 | 3300025919 | Ga0207657_10003467 | Ga0207657_100034674 | 360 |
| 247 | 3300025919 | Ga0207657_10053529 | Ga0207657_100535292 | 360 |
| 248 | 3300025932 | Ga0207690_10016991 | Ga0207690_100169913 | 360 |
| 249 | 3300025933 | Ga0207706_10030268 | Ga0207706_100302683 | 360 |
| 250 | 3300025942 | Ga0207689_10145731 | Ga0207689_101457312 | 360 |
| 251 | 3300026078 | Ga0207702_10157009 | Ga0207702_101570091 | 360 |
| 252 | 3300026116 | Ga0207674_10134891 | Ga0207674_101348912 | 360 |
| 253 | 3300037312 | Ga0395899_0014276 | Ga0395899_0014276_4542_5657 | 360 |
| 254 | 3300037312 | Ga0395899_0024078 | Ga0395899_0024078_1932_3047 | 360 |
| 255 | 3300037418 | Ga0395900_0003249 | Ga0395900_0003249_4429_5544 | 360 |
| 256 | 3300037418 | Ga0395900_0014771 | Ga0395900_0014771_2573_3688 | 360 |
| 257 | 3300037418 | Ga0395900_0022682 | Ga0395900_0022682_3510_4625 | 360 |
| 258 | 3300037466 | Ga0395898_0074868 | Ga0395898_0074868_32_1147 | 360 |
| 259 | 3300037471 | Ga0395905_0185706 | Ga0395905_0185706_811_1926 | 360 |
| 260 | 3300038443 | Ga0395901_0012410 | Ga0395901_0012410_56_1171 | 360 |
| 261 | 3300042005 | Ga0439448_0001900 | Ga0439448_0001900_518_1633 | 360 |
| 262 | 3300042008 | Ga0439450_016155 | Ga0439450_016155_293_1408 | 360 |
| 263 | 3300044658 | Ga0466972_0001677 | Ga0466972_0001677_5372_6487 | 360 |
| 264 | 3300044683 | Ga0466965_0016998 | Ga0466965_0016998_1177_2292 | 360 |
| 265 | 3300044683 | Ga0466965_0084653 | Ga0466965_0084653_106_1221 | 360 |
| 266 | 3300044684 | Ga0466966_0002043 | Ga0466966_0002043_8993_10108 | 360 |
| 267 | 3300044684 | Ga0466966_0029371 | Ga0466966_0029371_802_1917 | 360 |
| 268 | 3300044706 | Ga0466964_0000857 | Ga0466964_0000857_4261_5376 | 360 |
| 269 | 3300044706 | Ga0466964_0008893 | Ga0466964_0008893_264_1379 | 360 |
| 270 | 3300044719 | Ga0466971_0069367 | Ga0466971_0069367_106_1221 | 360 |
| 271 | 3300044735 | Ga0466968_0019228 | Ga0466968_0019228_1042_2157 | 360 |
| 272 | 3300044842 | Ga0466957_0000040 | Ga0466957_0000040_4141_5256 | 360 |
| 273 | 3300045049 | Ga0466959_0018761 | Ga0466959_0018761_2048_3163 | 360 |
| 274 | 3300045049 | Ga0466959_0040979 | Ga0466959_0040979_1878_2993 | 360 |
| 275 | 3300045049 | Ga0466959_0187746 | Ga0466959_0187746_278_1393 | 360 |
| 276 | 3300045836 | Ga0466958_0068493 | Ga0466958_0068493_545_1660 | 360 |
| 277 | 3300045976 | Ga0466967_0015803 | Ga0466967_0015803_2756_3871 | 360 |
| 278 | 3300045976 | Ga0466967_0156020 | Ga0466967_0156020_1001_2116 | 360 |
| 279 | 3300046491 | Ga0495584_0000550 | Ga0495584_0000550_3896_5011 | 360 |
| 280 | 3300046507 | Ga0495606_0023156 | Ga0495606_0023156_3129_4244 | 360 |
| 281 | 3300046522 | Ga0495643_0041760 | Ga0495643_0041760_537_1652 | 360 |
| 282 | 3300046665 | Ga0495661_0082832 | Ga0495661_0082832_706_1821 | 360 |
| 283 | 3300046674 | Ga0495588_0000059 | Ga0495588_0000059_230519_231634 | 360 |
| 284 | 3300047443 | Ga0495687_000828 | Ga0495687_000828_20271_21386 | 360 |
| 285 | 3300048904 | Ga0496101_0027300 | Ga0496101_0027300_2849_3964 | 360 |
| 286 | 3300048916 | Ga0496113_0015989 | Ga0496113_0015989_2793_3908 | 360 |
| 287 | 3300048925 | Ga0496122_0005263 | Ga0496122_0005263_12164_13279 | 360 |
| 288 | 3300048925 | Ga0496122_0025683 | Ga0496122_0025683_366_1481 | 360 |
| 289 | 3300048926 | Ga0496123_0003558 | Ga0496123_0003558_12832_13947 | 360 |
| 290 | 3300048927 | Ga0496124_0021520 | Ga0496124_0021520_2595_3710 | 360 |
| 291 | 3300049459 | Ga0495678_003408 | Ga0495678_003408_4504_5616 | 360 |
| 292 | 3300061719 | Ga0466962_0071573 | Ga0466962_0071573_118_1233 | 360 |
| 293 | 3300046452 | Ga0495617_005907 | Ga0495617_005907_1460_2563 | 361 |
| 294 | 3300046460 | Ga0495638_0006199 | Ga0495638_0006199_207_1310 | 361 |
| 295 | 3300046474 | Ga0495605_0005724 | Ga0495605_0005724_2697_3800 | 361 |
| 296 | 3300046491 | Ga0495584_0000401 | Ga0495584_0000401_24847_25950 | 361 |
| 297 | 3300046492 | Ga0495585_0003304 | Ga0495585_0003304_1811_2914 | 361 |
| 298 | 3300046492 | Ga0495585_0013795 | Ga0495585_0013795_845_1948 | 361 |
| 299 | 3300046506 | Ga0495583_0000056 | Ga0495583_0000056_112791_113894 | 361 |
| 300 | 3300046513 | Ga0495616_0000378 | Ga0495616_0000378_6516_7619 | 361 |
| 301 | 3300046513 | Ga0495616_0007069 | Ga0495616_0007069_2573_3676 | 361 |
| 302 | 3300046523 | Ga0495644_0003202 | Ga0495644_0003202_3294_4397 | 361 |
| 303 | 3300046524 | Ga0495648_0001488 | Ga0495648_0001488_11433_12536 | 361 |
| 304 | 3300046538 | Ga0495609_0001536 | Ga0495609_0001536_13209_14312 | 361 |
| 305 | 3300046558 | Ga0495633_0003534 | Ga0495633_0003534_1213_2316 | 361 |
| 306 | 3300046615 | Ga0495656_0019531 | Ga0495656_0019531_362_1465 | 361 |
| 307 | 3300046648 | Ga0495611_0005110 | Ga0495611_0005110_3662_4765 | 361 |
| 308 | 3300046660 | Ga0495625_0001604 | Ga0495625_0001604_18012_19100 | 361 |
| 309 | 3300046660 | Ga0495625_0016886 | Ga0495625_0016886_3474_4577 | 361 |
| 310 | 3300046664 | Ga0495659_0000526 | Ga0495659_0000526_1401_2504 | 361 |
| 311 | 3300046665 | Ga0495661_0042801 | Ga0495661_0042801_474_1577 | 361 |
| 312 | 3300046691 | Ga0495670_0003154 | Ga0495670_0003154_4349_5452 | 361 |
| 313 | 3300046691 | Ga0495670_0031576 | Ga0495670_0031576_589_1692 | 361 |
| 314 | 3300047318 | Ga0495636_0009359 | Ga0495636_0009359_777_1880 | 361 |
| 315 | 3300047320 | Ga0495672_0014433 | Ga0495672_0014433_2533_3636 | 361 |
| 316 | 3300047320 | Ga0495672_0033307 | Ga0495672_0033307_87_1190 | 361 |
| 317 | 3300047323 | Ga0495683_0003967 | Ga0495683_0003967_2145_3248 | 361 |
| 318 | 3300047443 | Ga0495687_001108 | Ga0495687_001108_19383_20486 | 361 |
| 319 | 3300047445 | Ga0495677_0001462 | Ga0495677_0001462_5520_6623 | 361 |
| 320 | 3300047447 | Ga0495685_000113 | Ga0495685_000113_4585_5688 | 361 |
| 321 | 3300049459 | Ga0495678_005649 | Ga0495678_005649_1169_2272 | 361 |
| 322 | 3300049460 | Ga0495682_0002626 | Ga0495682_0002626_4569_5672 | 361 |
| 323 | 3300005331 | Ga0070670_100001043 | Ga0070670_10000104316 | 362 |
| 324 | 3300005333 | Ga0070677_10000809 | Ga0070677_100008097 | 362 |
| 325 | 3300005364 | Ga0070673_100022136 | Ga0070673_1000221362 | 362 |
| 326 | 3300005367 | Ga0070667_100115333 | Ga0070667_1001153333 | 362 |
| 327 | 3300005466 | Ga0070685_10154991 | Ga0070685_101549912 | 362 |
| 328 | 3300005467 | Ga0070706_100326848 | Ga0070706_1003268482 | 362 |
| 329 | 3300005468 | Ga0070707_100158560 | Ga0070707_1001585603 | 362 |
| 330 | 3300005543 | Ga0070672_100008921 | Ga0070672_1000089218 | 362 |
| 331 | 3300005548 | Ga0070665_100049754 | Ga0070665_1000497542 | 362 |
| 332 | 3300005618 | Ga0068864_100005652 | Ga0068864_1000056525 | 362 |
| 333 | 3300005840 | Ga0068870_10003957 | Ga0068870_100039579 | 362 |
| 334 | 3300006237 | Ga0097621_100010542 | Ga0097621_1000105427 | 362 |
| 335 | 3300006358 | Ga0068871_100005239 | Ga0068871_1000052399 | 362 |
| 336 | 3300006871 | Ga0075434_100009206 | Ga0075434_1000092065 | 362 |
| 337 | 3300006871 | Ga0075434_100367339 | Ga0075434_1003673392 | 362 |
| 338 | 3300007076 | Ga0075435_100033662 | Ga0075435_1000336624 | 362 |
| 339 | 3300013306 | Ga0163162_10240864 | Ga0163162_102408642 | 362 |
| 340 | 3300014325 | Ga0163163_10198934 | Ga0163163_101989342 | 362 |
| 341 | 3300017792 | Ga0163161_10033109 | Ga0163161_100331093 | 362 |
| 342 | 3300025321 | Ga0207656_10003690 | Ga0207656_100036905 | 362 |
| 343 | 3300025893 | Ga0207682_10000890 | Ga0207682_1000089011 | 362 |
| 344 | 3300025908 | Ga0207643_10005888 | Ga0207643_100058882 | 362 |
| 345 | 3300025910 | Ga0207684_10081163 | Ga0207684_100811632 | 362 |
| 346 | 3300025933 | Ga0207706_10070192 | Ga0207706_100701921 | 362 |
| 347 | 3300025940 | Ga0207691_10000050 | Ga0207691_1000005055 | 362 |
| 348 | 3300025986 | Ga0207658_10051111 | Ga0207658_100511112 | 362 |
| 349 | 3300026088 | Ga0207641_10050383 | Ga0207641_100503832 | 362 |
| 350 | 3300028379 | Ga0268266_10004467 | Ga0268266_100044679 | 362 |
| 351 | 3300035695 | Ga0373927_0050150 | Ga0373927_0050150_254_1366 | 362 |
| 352 | 3300046460 | Ga0495638_0056095 | Ga0495638_0056095_148_1263 | 362 |
| 353 | 3300046472 | Ga0495580_0119499 | Ga0495580_0119499_153_1265 | 362 |
| 354 | 3300046474 | Ga0495605_0106941 | Ga0495605_0106941_52_1167 | 362 |
| 355 | 3300046506 | Ga0495583_0004154 | Ga0495583_0004154_4566_5681 | 362 |
| 356 | 3300046513 | Ga0495616_0000732 | Ga0495616_0000732_2205_3320 | 362 |
| 357 | 3300046522 | Ga0495643_0000517 | Ga0495643_0000517_4699_5814 | 362 |
| 358 | 3300050512 | nmdc:mga0n895_374590_c1 | nmdc:mga0n895_374590_c1_258_1370 | 362 |
| 359 | 3300050515 | nmdc:mga0a205_12156_c1 | nmdc:mga0a205_12156_c1_2831_3943 | 362 |
| 360 | 3300015261 | Ga0182006_1000138 | Ga0182006_100013840 | 363 |
| 361 | 3300015265 | Ga0182005_1000046 | Ga0182005_100004640 | 363 |
| 362 | 3300042139 | Ga0450904_000873 | Ga0450904_000873_2474_3589 | 363 |
| 363 | 3300046524 | Ga0495648_0047270 | Ga0495648_0047270_370_1482 | 363 |
| 364 | 3300046810 | Ga0495660_0075307 | Ga0495660_0075307_328_1443 | 364 |
| 365 | 3300048927 | Ga0496124_0007788 | Ga0496124_0007788_4170_5288 | 364 |
| 366 | iso_pu_bacteria | 2511231003 | 2511250509 | 364 |
| 367 | iso_pu_bacteria | 2511231026 | 2511383441 | 364 |
| 368 | iso_pu_bacteria | 2551306416 | 2553005707 | 364 |
| 369 | iso_pu_bacteria | 2765235838 | 2765571839 | 364 |
| 370 | iso_pu_bacteria | 2808606386 | 2808982160 | 364 |
| 371 | iso_pu_bacteria | 2808606415 | 2809130040 | 364 |
| 372 | iso_pu_bacteria | 2808606419 | 2809148905 | 364 |
| 373 | iso_pu_bacteria | 2818991436 | 2819542239 | 364 |
| 374 | iso_pu_bacteria | 2818991445 | 2819595605 | 364 |
| 375 | iso_pu_bacteria | 2818991449 | 2819617280 | 364 |
| 376 | iso_pu_bacteria | 2839094727 | 2839098440 | 364 |
| 377 | iso_pu_bacteria | 2852618963 | 2852619040 | 364 |
| 378 | iso_pu_bacteria | 2884811622 | 2884816191 | 364 |
| 379 | iso_pu_bacteria | 2884836552 | 2884839366 | 364 |
| 380 | iso_pu_bacteria | 2884852848 | 2884856824 | 364 |
| 381 | iso_pu_bacteria | 2896154374 | 2896158170 | 364 |
| 382 | iso_pu_bacteria | 2904439833 | 2904442919 | 364 |
| 383 | iso_pu_bacteria | 2904530477 | 2904534881 | 364 |
| 384 | iso_pu_bacteria | 2904584206 | 2904588776 | 364 |
| 385 | iso_pu_bacteria | 2904589729 | 2904594150 | 364 |
| 386 | iso_pu_bacteria | 2904601388 | 2904605012 | 364 |
| 387 | iso_pu_bacteria | 2919046199 | 2919048582 | 364 |
| 388 | iso_pu_bacteria | 2919079590 | 2919083246 | 364 |
| 389 | iso_pu_bacteria | 2923510766 | 2923514390 | 364 |
| 390 | iso_pu_bacteria | 2928130867 | 2928133106 | 364 |
| 391 | iso_pu_bacteria | 2643221554 | 2643788934 | 365 |
| 392 | iso_pu_bacteria | 2643221638 | 2644213011 | 365 |
| 393 | iso_pu_bacteria | 2643221645 | 2644250790 | 365 |
| 394 | iso_pu_bacteria | 2643221664 | 2644358313 | 365 |
| 395 | iso_pu_bacteria | 2738541280 | 2738739249 | 365 |
| 396 | iso_pu_bacteria | 2738541297 | 2738827906 | 365 |
| 397 | iso_pu_bacteria | 2738541300 | 2738846969 | 365 |
| 398 | iso_pu_bacteria | 2738541357 | 2739151702 | 365 |
| 399 | iso_pu_bacteria | 2738543003 | 2739193622 | 365 |
| 400 | iso_pu_bacteria | 2738543018 | 2739276027 | 365 |
| 401 | iso_pu_bacteria | 2738543026 | 2739320098 | 365 |
| 402 | iso_pu_bacteria | 2738543029 | 2739338339 | 365 |
| 403 | iso_pu_bacteria | 2738543030 | 2739345071 | 365 |
| 404 | iso_pu_bacteria | 2821131069 | 2821136134 | 365 |
| 405 | iso_pu_bacteria | 2842711865 | 2842717845 | 365 |
| 406 | iso_pu_bacteria | 2857553236 | 2857556654 | 365 |
| 407 | iso_pu_bacteria | 2857558681 | 2857563511 | 365 |
| 408 | iso_pu_bacteria | 2904424332 | 2904429661 | 365 |
| 409 | iso_pu_bacteria | 2919476304 | 2919480594 | 365 |
| 410 | 3300042126 | Ga0450888_002193 | Ga0450888_002193_371_1489 | 366 |
| 411 | 3300042876 | Ga0451577_0065391 | Ga0451577_0065391_1474_2592 | 366 |
| 412 | 3300042876 | Ga0451577_0384613 | Ga0451577_0384613_109_1227 | 366 |
| 413 | 3300044712 | Ga0453684_0115016 | Ga0453684_0115016_691_1809 | 366 |
| 414 | iso_pu_bacteria | 2643221556 | 2643797135 | 366 |
| 415 | iso_pu_bacteria | 2643221684 | 2644469761 | 366 |
| 416 | iso_pu_bacteria | 2808606418 | 2809147440 | 366 |
| 417 | iso_pu_bacteria | 8047673197 | 8047676578 | 366 |
| 418 | 3300002704 | JGI25155J39150_1000140 | JGI25155J39150_100014014 | 367 |
| 419 | 3300002704 | JGI25155J39150_1000167 | JGI25155J39150_100016712 | 367 |
| 420 | 3300002737 | JGI25162J39368_1000023 | JGI25162J39368_1000023178 | 367 |
| 421 | 3300002737 | JGI25162J39368_1005670 | JGI25162J39368_10056702 | 367 |
| 422 | 3300002738 | JGI25154J39366_1000372 | JGI25154J39366_100037220 | 367 |
| 423 | 3300002738 | JGI25154J39366_1000748 | JGI25154J39366_100074811 | 367 |
| 424 | 3300002741 | JGI25157J39369_1000294 | JGI25157J39369_100029415 | 367 |
| 425 | 3300002741 | JGI25157J39369_1000325 | JGI25157J39369_100032530 | 367 |
| 426 | 3300003214 | JGI25165J46597_1000030 | JGI25165J46597_1000030122 | 367 |
| 427 | 3300003751 | Ga0055538_1000017 | Ga0055538_1000017178 | 367 |
| 428 | 3300003751 | Ga0055538_1000024 | Ga0055538_100002492 | 367 |
| 429 | 3300003752 | Ga0055539_1000022 | Ga0055539_1000022178 | 367 |
| 430 | 3300003752 | Ga0055539_1000031 | Ga0055539_100003192 | 367 |
| 431 | 3300003756 | Ga0055533_1000030 | Ga0055533_1000030178 | 367 |
| 432 | 3300003756 | Ga0055533_1000041 | Ga0055533_100004192 | 367 |
| 433 | 3300003758 | Ga0055532_1000074 | Ga0055532_100007428 | 367 |
| 434 | 3300003759 | Ga0055525_1000034 | Ga0055525_1000034178 | 367 |
| 435 | 3300003759 | Ga0055525_1000049 | Ga0055525_100004992 | 367 |
| 436 | 3300003841 | Ga0055541_1000015 | Ga0055541_1000015178 | 367 |
| 437 | 3300003841 | Ga0055541_1000022 | Ga0055541_100002292 | 367 |
| 438 | 3300005331 | Ga0070670_100005639 | Ga0070670_1000056394 | 367 |
| 439 | 3300005563 | Ga0068855_100004477 | Ga0068855_10000447716 | 367 |
| 440 | 3300005563 | Ga0068855_100005723 | Ga0068855_10000572312 | 367 |
| 441 | 3300005578 | Ga0068854_100119647 | Ga0068854_1001196472 | 367 |
| 442 | 3300005614 | Ga0068856_100047465 | Ga0068856_1000474652 | 367 |
| 443 | 3300005616 | Ga0068852_100041477 | Ga0068852_1000414774 | 367 |
| 444 | 3300006058 | Ga0075432_10056982 | Ga0075432_100569822 | 367 |
| 445 | 3300009093 | Ga0105240_10000718 | Ga0105240_1000071828 | 367 |
| 446 | 3300009093 | Ga0105240_10002320 | Ga0105240_1000232013 | 367 |
| 447 | 3300009545 | Ga0105237_10004756 | Ga0105237_100047568 | 367 |
| 448 | 3300009551 | Ga0105238_10000107 | Ga0105238_1000010720 | 367 |
| 449 | 3300010375 | Ga0105239_10000289 | Ga0105239_1000028949 | 367 |
| 450 | 3300015261 | Ga0182006_1004867 | Ga0182006_10048673 | 367 |
| 451 | 3300015261 | Ga0182006_1059205 | Ga0182006_10592052 | 367 |
| 452 | 3300015265 | Ga0182005_1000207 | Ga0182005_100020733 | 367 |
| 453 | 3300025206 | Ga0209435_100055 | Ga0209435_10005528 | 367 |
| 454 | 3300025206 | Ga0209435_100248 | Ga0209435_1002482 | 367 |
| 455 | 3300025207 | Ga0209760_102799 | Ga0209760_1027992 | 367 |
| 456 | 3300025224 | Ga0209784_100018 | Ga0209784_10001889 | 367 |
| 457 | 3300025224 | Ga0209784_100034 | Ga0209784_100034122 | 367 |
| 458 | 3300025225 | Ga0209566_100016 | Ga0209566_10001689 | 367 |
| 459 | 3300025225 | Ga0209566_100038 | Ga0209566_100038177 | 367 |
| 460 | 3300025226 | Ga0209674_100030 | Ga0209674_10003089 | 367 |
| 461 | 3300025226 | Ga0209674_100056 | Ga0209674_100056122 | 367 |
| 462 | 3300025229 | Ga0209147_100097 | Ga0209147_10009762 | 367 |
| 463 | 3300025230 | Ga0209563_100034 | Ga0209563_10003489 | 367 |
| 464 | 3300025230 | Ga0209563_100057 | Ga0209563_100057177 | 367 |
| 465 | 3300025231 | Ga0207427_100929 | Ga0207427_1009297 | 367 |
| 466 | 3300025233 | Ga0209437_100071 | Ga0209437_100071177 | 367 |
| 467 | 3300025233 | Ga0209437_100234 | Ga0209437_10023460 | 367 |
| 468 | 3300025242 | Ga0209258_100192 | Ga0209258_10019228 | 367 |
| 469 | 3300025246 | Ga0209646_1000103 | Ga0209646_100010362 | 367 |
| 470 | 3300025246 | Ga0209646_1000346 | Ga0209646_100034628 | 367 |
| 471 | 3300025250 | Ga0209026_1000134 | Ga0209026_100013428 | 367 |
| 472 | 3300025250 | Ga0209026_1003217 | Ga0209026_10032172 | 367 |
| 473 | 3300025253 | Ga0209677_100019 | Ga0209677_10001989 | 367 |
| 474 | 3300025253 | Ga0209677_100035 | Ga0209677_100035122 | 367 |
| 475 | 3300025256 | Ga0209759_1000091 | Ga0209759_100009162 | 367 |
| 476 | 3300025256 | Ga0209759_1000857 | Ga0209759_100085720 | 367 |
| 477 | 3300025261 | Ga0209233_1000094 | Ga0209233_1000094177 | 367 |
| 478 | 3300025913 | Ga0207695_10001004 | Ga0207695_1000100430 | 367 |
| 479 | 3300025913 | Ga0207695_10009358 | Ga0207695_100093582 | 367 |
| 480 | 3300025913 | Ga0207695_10053518 | Ga0207695_100535184 | 367 |
| 481 | 3300025914 | Ga0207671_10001366 | Ga0207671_1000136612 | 367 |
| 482 | 3300025924 | Ga0207694_10000130 | Ga0207694_1000013068 | 367 |
| 483 | 3300025925 | Ga0207650_10002315 | Ga0207650_100023159 | 367 |
| 484 | 3300025949 | Ga0207667_10000110 | Ga0207667_10000110114 | 367 |
| 485 | 3300025949 | Ga0207667_10003783 | Ga0207667_1000378318 | 367 |
| 486 | 3300025981 | Ga0207640_10004306 | Ga0207640_100043067 | 367 |
| 487 | 3300026142 | Ga0207698_10006700 | Ga0207698_100067005 | 367 |
| 488 | 3300039447 | Ga0436361_0768404 | Ga0436361_0768404_7411_8520 | 367 |
| 489 | 3300044842 | Ga0466957_0126482 | Ga0466957_0126482_199_1305 | 367 |
| 490 | 3300046463 | Ga0495653_0002192 | Ga0495653_0002192_12745_13857 | 367 |
| 491 | 3300046511 | Ga0495608_0001695 | Ga0495608_0001695_7644_8756 | 367 |
| 492 | 3300046514 | Ga0495618_0010248 | Ga0495618_0010248_2798_3910 | 367 |
| 493 | 3300046516 | Ga0495628_0001477 | Ga0495628_0001477_10965_12077 | 367 |
| 494 | 3300046529 | Ga0495652_0044072 | Ga0495652_0044072_1331_2443 | 367 |
| 495 | 3300046675 | Ga0495657_0015496 | Ga0495657_0015496_766_1878 | 367 |
| 496 | 3300046678 | Ga0495599_0032849 | Ga0495599_0032849_376_1488 | 367 |
| 497 | 3300046679 | Ga0495623_0014841 | Ga0495623_0014841_185_1297 | 367 |
| 498 | 3300046680 | Ga0495646_0007728 | Ga0495646_0007728_2951_4063 | 367 |
| 499 | 3300046690 | Ga0495624_0050104 | Ga0495624_0050104_1431_2543 | 367 |
| 500 | 3300046809 | Ga0495600_0010417 | Ga0495600_0010417_78_1190 | 367 |
| 501 | 3300047317 | Ga0495604_0004528 | Ga0495604_0004528_937_2049 | 367 |
| 502 | 3300048919 | Ga0496116_0003789 | Ga0496116_0003789_6577_7686 | 367 |
| 503 | 3300048925 | Ga0496122_0003878 | Ga0496122_0003878_13541_14650 | 367 |
| 504 | 3300048926 | Ga0496123_0000912 | Ga0496123_0000912_13669_14778 | 367 |
| 505 | 3300048928 | Ga0496125_0003100 | Ga0496125_0003100_17930_19039 | 367 |
| 506 | 3300053077 | Ga0495601_0005679 | Ga0495601_0005679_4000_5112 | 367 |
| 507 | 3300053119 | Ga0500595_005622 | Ga0500595_005622_217_1329 | 367 |
| 508 | 3300053141 | Ga0500574_021706 | Ga0500574_021706_113_1225 | 367 |
| 509 | iso_pu_bacteria | 2521172590 | 2521560587 | 367 |
| 510 | 3300006175 | Ga0070712_100087600 | Ga0070712_1000876002 | 368 |
| 511 | 3300037312 | Ga0395899_0004514 | Ga0395899_0004514_7587_8708 | 368 |
| 512 | 3300037312 | Ga0395899_0007052 | Ga0395899_0007052_403_1524 | 368 |
| 513 | 3300037312 | Ga0395899_0010060 | Ga0395899_0010060_2329_3441 | 368 |
| 514 | 3300037418 | Ga0395900_0013499 | Ga0395900_0013499_219_1331 | 368 |
| 515 | 3300037418 | Ga0395900_0044607 | Ga0395900_0044607_2334_3455 | 368 |
| 516 | 3300037418 | Ga0395900_0324919 | Ga0395900_0324919_256_1368 | 368 |
| 517 | 3300037471 | Ga0395905_0001092 | Ga0395905_0001092_17792_18904 | 368 |
| 518 | 3300037471 | Ga0395905_0017352 | Ga0395905_0017352_1951_3063 | 368 |
| 519 | 3300037471 | Ga0395905_0070275 | Ga0395905_0070275_767_1879 | 368 |
| 520 | 3300038443 | Ga0395901_0526297 | Ga0395901_0526297_11_1132 | 368 |
| 521 | 3300044658 | Ga0466972_0000037 | Ga0466972_0000037_79675_80814 | 368 |
| 522 | 3300044658 | Ga0466972_0000269 | Ga0466972_0000269_20310_21422 | 368 |
| 523 | 3300044658 | Ga0466972_0003487 | Ga0466972_0003487_2480_3595 | 368 |
| 524 | 3300044683 | Ga0466965_0008151 | Ga0466965_0008151_656_1771 | 368 |
| 525 | 3300044719 | Ga0466971_0030139 | Ga0466971_0030139_30_1142 | 368 |
| 526 | 3300044735 | Ga0466968_0005311 | Ga0466968_0005311_2697_3812 | 368 |
| 527 | 3300044735 | Ga0466968_0005812 | Ga0466968_0005812_527_1642 | 368 |
| 528 | 3300046462 | Ga0495651_0008564 | Ga0495651_0008564_4076_5188 | 368 |
| 529 | 3300046511 | Ga0495608_0008843 | Ga0495608_0008843_2175_3287 | 368 |
| 530 | 3300046528 | Ga0495642_0033790 | Ga0495642_0033790_352_1464 | 368 |
| 531 | 3300046616 | Ga0495668_0025501 | Ga0495668_0025501_734_1846 | 368 |
| 532 | 3300046665 | Ga0495661_0003348 | Ga0495661_0003348_4313_5425 | 368 |
| 533 | 3300046679 | Ga0495623_0007728 | Ga0495623_0007728_2251_3363 | 368 |
| 534 | 3300047443 | Ga0495687_004239 | Ga0495687_004239_4427_5539 | 368 |
| 535 | 3300047472 | Ga0495686_0000387 | Ga0495686_0000387_30252_31361 | 368 |
| 536 | 3300048088 | Ga0495602_0029800 | Ga0495602_0029800_4027_5139 | 368 |
| 537 | 3300048907 | Ga0496104_0376008 | Ga0496104_0376008_97_1209 | 368 |
| 538 | 3300048909 | Ga0496106_0050665 | Ga0496106_0050665_1657_2769 | 368 |
| 539 | 3300048911 | Ga0496108_0070128 | Ga0496108_0070128_1382_2494 | 368 |
| 540 | 3300048912 | Ga0496109_0447473 | Ga0496109_0447473_23_1135 | 368 |
| 541 | 3300048914 | Ga0496111_0054088 | Ga0496111_0054088_1112_2224 | 368 |
| 542 | 3300061719 | Ga0466962_0073054 | Ga0466962_0073054_500_1612 | 368 |
| 543 | 3300002738 | JGI25154J39366_1002151 | JGI25154J39366_10021513 | 369 |
| 544 | 3300002773 | JGI25152J39213_1000994 | JGI25152J39213_10009949 | 369 |
| 545 | 3300002774 | JGI25150J39212_1000726 | JGI25150J39212_10007265 | 369 |
| 546 | 3300002774 | JGI25150J39212_1000752 | JGI25150J39212_10007525 | 369 |
| 547 | 3300002987 | JGI25159J45721_1017559 | JGI25159J45721_10175592 | 369 |
| 548 | 3300003354 | JGI25160J50197_1000548 | JGI25160J50197_10005487 | 369 |
| 549 | 3300003374 | JGI25161J50226_1000872 | JGI25161J50226_10008729 | 369 |
| 550 | 3300003762 | Ga0055542_1013195 | Ga0055542_10131951 | 369 |
| 551 | 3300003763 | Ga0055529_1000027 | Ga0055529_100002766 | 369 |
| 552 | 3300003771 | Ga0055526_1001365 | Ga0055526_100136514 | 369 |
| 553 | 3300003771 | Ga0055526_1001772 | Ga0055526_10017725 | 369 |
| 554 | 3300003771 | Ga0055526_1002513 | Ga0055526_10025139 | 369 |
| 555 | 3300003771 | Ga0055526_1004528 | Ga0055526_10045283 | 369 |
| 556 | 3300003773 | Ga0055537_1000172 | Ga0055537_100017242 | 369 |
| 557 | 3300003775 | Ga0055524_1001210 | Ga0055524_10012104 | 369 |
| 558 | 3300003775 | Ga0055524_1001582 | Ga0055524_10015825 | 369 |
| 559 | 3300003775 | Ga0055524_1002507 | Ga0055524_10025078 | 369 |
| 560 | 3300003784 | Ga0055534_1000169 | Ga0055534_100016912 | 369 |
| 561 | 3300003784 | Ga0055534_1001643 | Ga0055534_10016432 | 369 |
| 562 | 3300003790 | Ga0055528_1000482 | Ga0055528_100048223 | 369 |
| 563 | 3300003790 | Ga0055528_1000486 | Ga0055528_100048612 | 369 |
| 564 | 3300003790 | Ga0055528_1003257 | Ga0055528_10032575 | 369 |
| 565 | 3300003794 | Ga0055531_10004385 | Ga0055531_100043852 | 369 |
| 566 | 3300005262 | Ga0065165_1000882 | Ga0065165_10008829 | 369 |
| 567 | 3300005262 | Ga0065165_1004612 | Ga0065165_10046123 | 369 |
| 568 | 3300005262 | Ga0065165_1029628 | Ga0065165_10296282 | 369 |
| 569 | 3300005288 | Ga0065714_10024661 | Ga0065714_100246611 | 369 |
| 570 | 3300005293 | Ga0065715_10173908 | Ga0065715_101739082 | 369 |
| 571 | 3300009036 | Ga0105244_10009443 | Ga0105244_100094433 | 369 |
| 572 | 3300013296 | Ga0157374_10268083 | Ga0157374_102680831 | 369 |
| 573 | 3300013307 | Ga0157372_10154334 | Ga0157372_101543342 | 369 |
| 574 | 3300021361 | Ga0213872_10000403 | Ga0213872_1000040315 | 369 |
| 575 | 3300025208 | Ga0209436_100389 | Ga0209436_1003897 | 369 |
| 576 | 3300025208 | Ga0209436_100991 | Ga0209436_1009919 | 369 |
| 577 | 3300025208 | Ga0209436_106134 | Ga0209436_1061342 | 369 |
| 578 | 3300025245 | Ga0207425_1000013 | Ga0207425_100001346 | 369 |
| 579 | 3300025245 | Ga0207425_1000152 | Ga0207425_100015236 | 369 |
| 580 | 3300025245 | Ga0207425_1000675 | Ga0207425_100067514 | 369 |
| 581 | 3300025246 | Ga0209646_1000120 | Ga0209646_100012079 | 369 |
| 582 | 3300025254 | Ga0209148_1000229 | Ga0209148_100022939 | 369 |
| 583 | 3300025258 | Ga0209129_1000152 | Ga0209129_100015247 | 369 |
| 584 | 3300025258 | Ga0209129_1014454 | Ga0209129_10144542 | 369 |
| 585 | 3300025263 | Ga0209565_1000159 | Ga0209565_100015942 | 369 |
| 586 | 3300025263 | Ga0209565_1000671 | Ga0209565_10006717 | 369 |
| 587 | 3300025263 | Ga0209565_1001875 | Ga0209565_10018758 | 369 |
| 588 | 3300025263 | Ga0209565_1002041 | Ga0209565_10020415 | 369 |
| 589 | 3300025263 | Ga0209565_1003700 | Ga0209565_10037002 | 369 |
| 590 | 3300025272 | Ga0209455_1000033 | Ga0209455_1000033378 | 369 |
| 591 | 3300025273 | Ga0209673_1000006 | Ga0209673_100000642 | 369 |
| 592 | 3300025284 | Ga0209130_1000425 | Ga0209130_100042518 | 369 |
| 593 | 3300025284 | Ga0209130_1000521 | Ga0209130_10005219 | 369 |
| 594 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005729 | 369 |
| 595 | 3300025291 | Ga0209675_1001647 | Ga0209675_100164710 | 369 |
| 596 | 3300025291 | Ga0209675_1002204 | Ga0209675_10022048 | 369 |
| 597 | 3300025295 | Ga0209564_1000028 | Ga0209564_1000028428 | 369 |
| 598 | 3300025295 | Ga0209564_1000154 | Ga0209564_1000154113 | 369 |
| 599 | 3300025295 | Ga0209564_1000604 | Ga0209564_100060452 | 369 |
| 600 | 3300025295 | Ga0209564_1000774 | Ga0209564_100077410 | 369 |
| 601 | 3300025295 | Ga0209564_1005527 | Ga0209564_10055274 | 369 |
| 602 | 3300025295 | Ga0209564_1030062 | Ga0209564_10300622 | 369 |
| 603 | 3300025297 | Ga0209758_1000031 | Ga0209758_1000031418 | 369 |
| 604 | 3300025297 | Ga0209758_1000354 | Ga0209758_100035440 | 369 |
| 605 | 3300025298 | Ga0209050_1015337 | Ga0209050_10153371 | 369 |
| 606 | 3300025299 | Ga0209256_1000035 | Ga0209256_100003544 | 369 |
| 607 | 3300025299 | Ga0209256_1000274 | Ga0209256_100027442 | 369 |
| 608 | 3300025299 | Ga0209256_1000414 | Ga0209256_10004145 | 369 |
| 609 | 3300025299 | Ga0209256_1000426 | Ga0209256_100042635 | 369 |
| 610 | 3300025299 | Ga0209256_1003215 | Ga0209256_10032155 | 369 |
| 611 | 3300025302 | Ga0207426_1001125 | Ga0207426_100112521 | 369 |
| 612 | 3300025304 | Ga0209257_1000157 | Ga0209257_1000157140 | 369 |
| 613 | 3300025728 | Ga0207655_1003180 | Ga0207655_10031803 | 369 |
| 614 | 3300025728 | Ga0207655_1006901 | Ga0207655_10069015 | 369 |
| 615 | 3300025909 | Ga0207705_10216202 | Ga0207705_102162022 | 369 |
| 616 | 3300027666 | Ga0209282_1000003 | Ga0209282_10000035 | 369 |
| 617 | 3300028794 | Ga0307515_10161474 | Ga0307515_101614742 | 369 |
| 618 | 3300031548 | Ga0307408_100000129 | Ga0307408_10000012941 | 369 |
| 619 | 3300031548 | Ga0307408_100000610 | Ga0307408_10000061032 | 369 |
| 620 | 3300031548 | Ga0307408_100010855 | Ga0307408_1000108551 | 369 |
| 621 | 3300031548 | Ga0307408_100038053 | Ga0307408_1000380532 | 369 |
| 622 | 3300032002 | Ga0307416_100001560 | Ga0307416_1000015602 | 369 |
| 623 | 3300037312 | Ga0395899_0000085 | Ga0395899_0000085_45504_46622 | 369 |
| 624 | 3300037312 | Ga0395899_0011675 | Ga0395899_0011675_3132_4247 | 369 |
| 625 | 3300037418 | Ga0395900_0001335 | Ga0395900_0001335_8957_10072 | 369 |
| 626 | 3300037418 | Ga0395900_0041013 | Ga0395900_0041013_1878_2993 | 369 |
| 627 | 3300037418 | Ga0395900_0450433 | Ga0395900_0450433_54_1172 | 369 |
| 628 | 3300037466 | Ga0395898_0359723 | Ga0395898_0359723_25_1143 | 369 |
| 629 | 3300037471 | Ga0395905_0068903 | Ga0395905_0068903_2147_3265 | 369 |
| 630 | 3300037471 | Ga0395905_0089118 | Ga0395905_0089118_1694_2812 | 369 |
| 631 | 3300037471 | Ga0395905_0195913 | Ga0395905_0195913_555_1670 | 369 |
| 632 | 3300038443 | Ga0395901_0000227 | Ga0395901_0000227_33095_34210 | 369 |
| 633 | 3300038443 | Ga0395901_0172746 | Ga0395901_0172746_24_1139 | 369 |
| 634 | 3300039447 | Ga0436361_0632131 | Ga0436361_0632131_5765_6880 | 369 |
| 635 | 3300044683 | Ga0466965_0012191 | Ga0466965_0012191_196_1311 | 369 |
| 636 | 3300046452 | Ga0495617_000046 | Ga0495617_000046_76010_77128 | 369 |
| 637 | 3300046452 | Ga0495617_001784 | Ga0495617_001784_3661_4773 | 369 |
| 638 | 3300046452 | Ga0495617_003526 | Ga0495617_003526_4448_5566 | 369 |
| 639 | 3300046453 | Ga0495627_000006 | Ga0495627_000006_537458_538570 | 369 |
| 640 | 3300046453 | Ga0495627_001231 | Ga0495627_001231_4077_5195 | 369 |
| 641 | 3300046453 | Ga0495627_005070 | Ga0495627_005070_1703_2821 | 369 |
| 642 | 3300046455 | Ga0495603_0015177 | Ga0495603_0015177_2802_3920 | 369 |
| 643 | 3300046457 | Ga0495590_0000022 | Ga0495590_0000022_152168_153280 | 369 |
| 644 | 3300046457 | Ga0495590_0000134 | Ga0495590_0000134_1778_2896 | 369 |
| 645 | 3300046457 | Ga0495590_0000881 | Ga0495590_0000881_4306_5421 | 369 |
| 646 | 3300046457 | Ga0495590_0011223 | Ga0495590_0011223_1387_2505 | 369 |
| 647 | 3300046457 | Ga0495590_0017136 | Ga0495590_0017136_1149_2264 | 369 |
| 648 | 3300046458 | Ga0495591_002085 | Ga0495591_002085_6038_7156 | 369 |
| 649 | 3300046458 | Ga0495591_026425 | Ga0495591_026425_48_1166 | 369 |
| 650 | 3300046459 | Ga0495629_0026169 | Ga0495629_0026169_798_1913 | 369 |
| 651 | 3300046460 | Ga0495638_0000099 | Ga0495638_0000099_59570_60682 | 369 |
| 652 | 3300046460 | Ga0495638_0011848 | Ga0495638_0011848_472_1590 | 369 |
| 653 | 3300046460 | Ga0495638_0165608 | Ga0495638_0165608_106_1224 | 369 |
| 654 | 3300046463 | Ga0495653_0007995 | Ga0495653_0007995_6975_8093 | 369 |
| 655 | 3300046463 | Ga0495653_0063703 | Ga0495653_0063703_405_1520 | 369 |
| 656 | 3300046471 | Ga0495650_0000248 | Ga0495650_0000248_48104_49216 | 369 |
| 657 | 3300046471 | Ga0495650_0001655 | Ga0495650_0001655_4530_5645 | 369 |
| 658 | 3300046471 | Ga0495650_0002354 | Ga0495650_0002354_9936_11048 | 369 |
| 659 | 3300046471 | Ga0495650_0005152 | Ga0495650_0005152_5460_6572 | 369 |
| 660 | 3300046471 | Ga0495650_0010146 | Ga0495650_0010146_2078_3190 | 369 |
| 661 | 3300046471 | Ga0495650_0017385 | Ga0495650_0017385_207_1325 | 369 |
| 662 | 3300046473 | Ga0495582_0001046 | Ga0495582_0001046_4267_5382 | 369 |
| 663 | 3300046473 | Ga0495582_0008353 | Ga0495582_0008353_153_1271 | 369 |
| 664 | 3300046474 | Ga0495605_0000284 | Ga0495605_0000284_38303_39421 | 369 |
| 665 | 3300046474 | Ga0495605_0000614 | Ga0495605_0000614_4466_5581 | 369 |
| 666 | 3300046474 | Ga0495605_0001332 | Ga0495605_0001332_10836_11951 | 369 |
| 667 | 3300046474 | Ga0495605_0007238 | Ga0495605_0007238_5125_6243 | 369 |
| 668 | 3300046474 | Ga0495605_0009455 | Ga0495605_0009455_2775_3893 | 369 |
| 669 | 3300046474 | Ga0495605_0010234 | Ga0495605_0010234_2032_3147 | 369 |
| 670 | 3300046474 | Ga0495605_0028058 | Ga0495605_0028058_526_1644 | 369 |
| 671 | 3300046475 | Ga0495639_0015699 | Ga0495639_0015699_1449_2561 | 369 |
| 672 | 3300046491 | Ga0495584_0000013 | Ga0495584_0000013_4157_5275 | 369 |
| 673 | 3300046491 | Ga0495584_0000951 | Ga0495584_0000951_14823_15941 | 369 |
| 674 | 3300046491 | Ga0495584_0000972 | Ga0495584_0000972_6798_7913 | 369 |
| 675 | 3300046491 | Ga0495584_0002502 | Ga0495584_0002502_5127_6242 | 369 |
| 676 | 3300046491 | Ga0495584_0003205 | Ga0495584_0003205_7750_8868 | 369 |
| 677 | 3300046491 | Ga0495584_0005273 | Ga0495584_0005273_3003_4118 | 369 |
| 678 | 3300046491 | Ga0495584_0006573 | Ga0495584_0006573_74_1189 | 369 |
| 679 | 3300046491 | Ga0495584_0012093 | Ga0495584_0012093_1170_2288 | 369 |
| 680 | 3300046491 | Ga0495584_0012756 | Ga0495584_0012756_2643_3758 | 369 |
| 681 | 3300046491 | Ga0495584_0013174 | Ga0495584_0013174_2667_3785 | 369 |
| 682 | 3300046492 | Ga0495585_0000150 | Ga0495585_0000150_37744_38862 | 369 |
| 683 | 3300046492 | Ga0495585_0001052 | Ga0495585_0001052_4419_5537 | 369 |
| 684 | 3300046492 | Ga0495585_0001416 | Ga0495585_0001416_13785_14903 | 369 |
| 685 | 3300046492 | Ga0495585_0002993 | Ga0495585_0002993_6162_7280 | 369 |
| 686 | 3300046492 | Ga0495585_0005663 | Ga0495585_0005663_1035_2150 | 369 |
| 687 | 3300046492 | Ga0495585_0006319 | Ga0495585_0006319_3595_4713 | 369 |
| 688 | 3300046492 | Ga0495585_0007714 | Ga0495585_0007714_2306_3424 | 369 |
| 689 | 3300046492 | Ga0495585_0007869 | Ga0495585_0007869_3921_5036 | 369 |
| 690 | 3300046492 | Ga0495585_0008104 | Ga0495585_0008104_1264_2382 | 369 |
| 691 | 3300046492 | Ga0495585_0014846 | Ga0495585_0014846_2979_4094 | 369 |
| 692 | 3300046492 | Ga0495585_0037735 | Ga0495585_0037735_1423_2541 | 369 |
| 693 | 3300046492 | Ga0495585_0053693 | Ga0495585_0053693_874_1992 | 369 |
| 694 | 3300046492 | Ga0495585_0060476 | Ga0495585_0060476_315_1430 | 369 |
| 695 | 3300046492 | Ga0495585_0061152 | Ga0495585_0061152_847_1962 | 369 |
| 696 | 3300046492 | Ga0495585_0091058 | Ga0495585_0091058_78_1193 | 369 |
| 697 | 3300046499 | Ga0495594_0003575 | Ga0495594_0003575_2938_4056 | 369 |
| 698 | 3300046499 | Ga0495594_0025580 | Ga0495594_0025580_718_1833 | 369 |
| 699 | 3300046499 | Ga0495594_0047112 | Ga0495594_0047112_384_1499 | 369 |
| 700 | 3300046500 | Ga0495596_0001343 | Ga0495596_0001343_11628_12746 | 369 |
| 701 | 3300046500 | Ga0495596_0001970 | Ga0495596_0001970_3835_4950 | 369 |
| 702 | 3300046500 | Ga0495596_0003353 | Ga0495596_0003353_4008_5126 | 369 |
| 703 | 3300046500 | Ga0495596_0005506 | Ga0495596_0005506_2820_3938 | 369 |
| 704 | 3300046500 | Ga0495596_0005656 | Ga0495596_0005656_1157_2272 | 369 |
| 705 | 3300046500 | Ga0495596_0008267 | Ga0495596_0008267_1340_2458 | 369 |
| 706 | 3300046500 | Ga0495596_0009757 | Ga0495596_0009757_1996_3111 | 369 |
| 707 | 3300046500 | Ga0495596_0014322 | Ga0495596_0014322_631_1749 | 369 |
| 708 | 3300046500 | Ga0495596_0018133 | Ga0495596_0018133_535_1650 | 369 |
| 709 | 3300046500 | Ga0495596_0025036 | Ga0495596_0025036_427_1545 | 369 |
| 710 | 3300046500 | Ga0495596_0056202 | Ga0495596_0056202_365_1483 | 369 |
| 711 | 3300046501 | Ga0495607_0001581 | Ga0495607_0001581_18173_19288 | 369 |
| 712 | 3300046501 | Ga0495607_0001687 | Ga0495607_0001687_3556_4668 | 369 |
| 713 | 3300046501 | Ga0495607_0001951 | Ga0495607_0001951_4548_5663 | 369 |
| 714 | 3300046501 | Ga0495607_0006601 | Ga0495607_0006601_2165_3280 | 369 |
| 715 | 3300046501 | Ga0495607_0012539 | Ga0495607_0012539_4027_5142 | 369 |
| 716 | 3300046501 | Ga0495607_0013539 | Ga0495607_0013539_2539_3654 | 369 |
| 717 | 3300046501 | Ga0495607_0019245 | Ga0495607_0019245_1836_2954 | 369 |
| 718 | 3300046501 | Ga0495607_0020268 | Ga0495607_0020268_1608_2723 | 369 |
| 719 | 3300046501 | Ga0495607_0051165 | Ga0495607_0051165_382_1500 | 369 |
| 720 | 3300046501 | Ga0495607_0055797 | Ga0495607_0055797_664_1782 | 369 |
| 721 | 3300046501 | Ga0495607_0061339 | Ga0495607_0061339_909_2024 | 369 |
| 722 | 3300046506 | Ga0495583_0000161 | Ga0495583_0000161_54390_55508 | 369 |
| 723 | 3300046506 | Ga0495583_0000220 | Ga0495583_0000220_91032_92144 | 369 |
| 724 | 3300046506 | Ga0495583_0000573 | Ga0495583_0000573_4305_5420 | 369 |
| 725 | 3300046506 | Ga0495583_0000839 | Ga0495583_0000839_4269_5384 | 369 |
| 726 | 3300046506 | Ga0495583_0003352 | Ga0495583_0003352_7087_8205 | 369 |
| 727 | 3300046506 | Ga0495583_0004198 | Ga0495583_0004198_1645_2760 | 369 |
| 728 | 3300046506 | Ga0495583_0011302 | Ga0495583_0011302_3162_4280 | 369 |
| 729 | 3300046506 | Ga0495583_0019210 | Ga0495583_0019210_300_1418 | 369 |
| 730 | 3300046506 | Ga0495583_0072164 | Ga0495583_0072164_375_1490 | 369 |
| 731 | 3300046507 | Ga0495606_0000609 | Ga0495606_0000609_4207_5319 | 369 |
| 732 | 3300046507 | Ga0495606_0001166 | Ga0495606_0001166_3983_5095 | 369 |
| 733 | 3300046507 | Ga0495606_0003491 | Ga0495606_0003491_4391_5506 | 369 |
| 734 | 3300046507 | Ga0495606_0004057 | Ga0495606_0004057_9571_10695 | 369 |
| 735 | 3300046507 | Ga0495606_0004324 | Ga0495606_0004324_4334_5446 | 369 |
| 736 | 3300046507 | Ga0495606_0014062 | Ga0495606_0014062_2231_3346 | 369 |
| 737 | 3300046507 | Ga0495606_0038285 | Ga0495606_0038285_471_1589 | 369 |
| 738 | 3300046507 | Ga0495606_0064683 | Ga0495606_0064683_941_2059 | 369 |
| 739 | 3300046507 | Ga0495606_0119697 | Ga0495606_0119697_361_1479 | 369 |
| 740 | 3300046512 | Ga0495610_0001163 | Ga0495610_0001163_16659_17777 | 369 |
| 741 | 3300046512 | Ga0495610_0002889 | Ga0495610_0002889_3463_4575 | 369 |
| 742 | 3300046512 | Ga0495610_0003861 | Ga0495610_0003861_821_1933 | 369 |
| 743 | 3300046512 | Ga0495610_0012801 | Ga0495610_0012801_3531_4643 | 369 |
| 744 | 3300046513 | Ga0495616_0000673 | Ga0495616_0000673_20240_21358 | 369 |
| 745 | 3300046513 | Ga0495616_0000838 | Ga0495616_0000838_16237_17352 | 369 |
| 746 | 3300046513 | Ga0495616_0004890 | Ga0495616_0004890_6112_7230 | 369 |
| 747 | 3300046513 | Ga0495616_0007456 | Ga0495616_0007456_1332_2447 | 369 |
| 748 | 3300046513 | Ga0495616_0016770 | Ga0495616_0016770_510_1628 | 369 |
| 749 | 3300046513 | Ga0495616_0017938 | Ga0495616_0017938_2151_3266 | 369 |
| 750 | 3300046513 | Ga0495616_0020923 | Ga0495616_0020923_536_1651 | 369 |
| 751 | 3300046513 | Ga0495616_0028031 | Ga0495616_0028031_741_1856 | 369 |
| 752 | 3300046513 | Ga0495616_0030046 | Ga0495616_0030046_923_2041 | 369 |
| 753 | 3300046513 | Ga0495616_0047144 | Ga0495616_0047144_315_1430 | 369 |
| 754 | 3300046513 | Ga0495616_0063182 | Ga0495616_0063182_507_1625 | 369 |
| 755 | 3300046517 | Ga0495630_0050915 | Ga0495630_0050915_96_1211 | 369 |
| 756 | 3300046518 | Ga0495631_0003439 | Ga0495631_0003439_3546_4664 | 369 |
| 757 | 3300046518 | Ga0495631_0003758 | Ga0495631_0003758_6269_7387 | 369 |
| 758 | 3300046518 | Ga0495631_0005893 | Ga0495631_0005893_1626_2744 | 369 |
| 759 | 3300046518 | Ga0495631_0006259 | Ga0495631_0006259_1253_2371 | 369 |
| 760 | 3300046518 | Ga0495631_0008197 | Ga0495631_0008197_3325_4440 | 369 |
| 761 | 3300046518 | Ga0495631_0020192 | Ga0495631_0020192_1008_2123 | 369 |
| 762 | 3300046518 | Ga0495631_0025173 | Ga0495631_0025173_246_1364 | 369 |
| 763 | 3300046518 | Ga0495631_0042226 | Ga0495631_0042226_435_1553 | 369 |
| 764 | 3300046519 | Ga0495632_0000280 | Ga0495632_0000280_41088_42203 | 369 |
| 765 | 3300046519 | Ga0495632_0000959 | Ga0495632_0000959_20214_21332 | 369 |
| 766 | 3300046519 | Ga0495632_0001908 | Ga0495632_0001908_11508_12626 | 369 |
| 767 | 3300046519 | Ga0495632_0003957 | Ga0495632_0003957_906_2021 | 369 |
| 768 | 3300046519 | Ga0495632_0006230 | Ga0495632_0006230_4059_5177 | 369 |
| 769 | 3300046520 | Ga0495637_0000029 | Ga0495637_0000029_137052_138170 | 369 |
| 770 | 3300046520 | Ga0495637_0001558 | Ga0495637_0001558_9846_10958 | 369 |
| 771 | 3300046520 | Ga0495637_0019407 | Ga0495637_0019407_1027_2145 | 369 |
| 772 | 3300046522 | Ga0495643_0000245 | Ga0495643_0000245_23024_24136 | 369 |
| 773 | 3300046522 | Ga0495643_0001674 | Ga0495643_0001674_4020_5135 | 369 |
| 774 | 3300046522 | Ga0495643_0002014 | Ga0495643_0002014_4232_5344 | 369 |
| 775 | 3300046522 | Ga0495643_0008919 | Ga0495643_0008919_1542_2657 | 369 |
| 776 | 3300046522 | Ga0495643_0041939 | Ga0495643_0041939_677_1795 | 369 |
| 777 | 3300046522 | Ga0495643_0060236 | Ga0495643_0060236_589_1704 | 369 |
| 778 | 3300046523 | Ga0495644_0002273 | Ga0495644_0002273_2931_4046 | 369 |
| 779 | 3300046523 | Ga0495644_0002377 | Ga0495644_0002377_1685_2803 | 369 |
| 780 | 3300046523 | Ga0495644_0006553 | Ga0495644_0006553_2332_3447 | 369 |
| 781 | 3300046523 | Ga0495644_0012603 | Ga0495644_0012603_65_1183 | 369 |
| 782 | 3300046523 | Ga0495644_0026638 | Ga0495644_0026638_901_2019 | 369 |
| 783 | 3300046523 | Ga0495644_0031885 | Ga0495644_0031885_831_1949 | 369 |
| 784 | 3300046524 | Ga0495648_0000004 | Ga0495648_0000004_328039_329151 | 369 |
| 785 | 3300046524 | Ga0495648_0000047 | Ga0495648_0000047_4380_5498 | 369 |
| 786 | 3300046524 | Ga0495648_0002640 | Ga0495648_0002640_3972_5090 | 369 |
| 787 | 3300046524 | Ga0495648_0009206 | Ga0495648_0009206_1138_2253 | 369 |
| 788 | 3300046524 | Ga0495648_0012788 | Ga0495648_0012788_4210_5325 | 369 |
| 789 | 3300046524 | Ga0495648_0013386 | Ga0495648_0013386_979_2094 | 369 |
| 790 | 3300046524 | Ga0495648_0017457 | Ga0495648_0017457_2984_4099 | 369 |
| 791 | 3300046524 | Ga0495648_0031541 | Ga0495648_0031541_1378_2496 | 369 |
| 792 | 3300046524 | Ga0495648_0045010 | Ga0495648_0045010_1624_2736 | 369 |
| 793 | 3300046526 | Ga0495666_0003378 | Ga0495666_0003378_5340_6455 | 369 |
| 794 | 3300046526 | Ga0495666_0005439 | Ga0495666_0005439_4249_5367 | 369 |
| 795 | 3300046526 | Ga0495666_0005509 | Ga0495666_0005509_4315_5433 | 369 |
| 796 | 3300046528 | Ga0495642_0000707 | Ga0495642_0000707_6610_7728 | 369 |
| 797 | 3300046528 | Ga0495642_0000879 | Ga0495642_0000879_1054_2169 | 369 |
| 798 | 3300046528 | Ga0495642_0000925 | Ga0495642_0000925_3894_5012 | 369 |
| 799 | 3300046528 | Ga0495642_0006297 | Ga0495642_0006297_1702_2817 | 369 |
| 800 | 3300046528 | Ga0495642_0009148 | Ga0495642_0009148_1370_2485 | 369 |
| 801 | 3300046528 | Ga0495642_0009245 | Ga0495642_0009245_1260_2375 | 369 |
| 802 | 3300046528 | Ga0495642_0011746 | Ga0495642_0011746_422_1537 | 369 |
| 803 | 3300046528 | Ga0495642_0016582 | Ga0495642_0016582_1194_2312 | 369 |
| 804 | 3300046528 | Ga0495642_0020386 | Ga0495642_0020386_1339_2457 | 369 |
| 805 | 3300046528 | Ga0495642_0021727 | Ga0495642_0021727_228_1346 | 369 |
| 806 | 3300046528 | Ga0495642_0052263 | Ga0495642_0052263_432_1550 | 369 |
| 807 | 3300046529 | Ga0495652_0053713 | Ga0495652_0053713_1450_2565 | 369 |
| 808 | 3300046530 | Ga0495654_0004114 | Ga0495654_0004114_4056_5174 | 369 |
| 809 | 3300046530 | Ga0495654_0006998 | Ga0495654_0006998_186_1304 | 369 |
| 810 | 3300046531 | Ga0495665_0004037 | Ga0495665_0004037_3843_4961 | 369 |
| 811 | 3300046531 | Ga0495665_0020928 | Ga0495665_0020928_1648_2763 | 369 |
| 812 | 3300046531 | Ga0495665_0025476 | Ga0495665_0025476_437_1552 | 369 |
| 813 | 3300046531 | Ga0495665_0072509 | Ga0495665_0072509_671_1789 | 369 |
| 814 | 3300046535 | Ga0495586_0017346 | Ga0495586_0017346_319_1434 | 369 |
| 815 | 3300046536 | Ga0495587_0056262 | Ga0495587_0056262_1050_2168 | 369 |
| 816 | 3300046536 | Ga0495587_0067055 | Ga0495587_0067055_635_1753 | 369 |
| 817 | 3300046536 | Ga0495587_0085395 | Ga0495587_0085395_282_1400 | 369 |
| 818 | 3300046538 | Ga0495609_0000005 | Ga0495609_0000005_392095_393210 | 369 |
| 819 | 3300046538 | Ga0495609_0001551 | Ga0495609_0001551_9734_10846 | 369 |
| 820 | 3300046538 | Ga0495609_0001607 | Ga0495609_0001607_2346_3461 | 369 |
| 821 | 3300046538 | Ga0495609_0002450 | Ga0495609_0002450_4099_5214 | 369 |
| 822 | 3300046538 | Ga0495609_0004216 | Ga0495609_0004216_2735_3850 | 369 |
| 823 | 3300046538 | Ga0495609_0010990 | Ga0495609_0010990_1719_2837 | 369 |
| 824 | 3300046538 | Ga0495609_0014114 | Ga0495609_0014114_1928_3040 | 369 |
| 825 | 3300046538 | Ga0495609_0023997 | Ga0495609_0023997_1320_2435 | 369 |
| 826 | 3300046538 | Ga0495609_0040812 | Ga0495609_0040812_165_1283 | 369 |
| 827 | 3300046542 | Ga0495597_0000563 | Ga0495597_0000563_4286_5398 | 369 |
| 828 | 3300046542 | Ga0495597_0002604 | Ga0495597_0002604_4052_5167 | 369 |
| 829 | 3300046542 | Ga0495597_0002893 | Ga0495597_0002893_8188_9306 | 369 |
| 830 | 3300046542 | Ga0495597_0003147 | Ga0495597_0003147_6726_7838 | 369 |
| 831 | 3300046542 | Ga0495597_0003284 | Ga0495597_0003284_6332_7450 | 369 |
| 832 | 3300046542 | Ga0495597_0007880 | Ga0495597_0007880_361_1476 | 369 |
| 833 | 3300046542 | Ga0495597_0018770 | Ga0495597_0018770_1248_2366 | 369 |
| 834 | 3300046542 | Ga0495597_0020202 | Ga0495597_0020202_181_1296 | 369 |
| 835 | 3300046542 | Ga0495597_0051079 | Ga0495597_0051079_458_1573 | 369 |
| 836 | 3300046543 | Ga0495645_0031635 | Ga0495645_0031635_1081_2196 | 369 |
| 837 | 3300046557 | Ga0495622_0000157 | Ga0495622_0000157_4267_5379 | 369 |
| 838 | 3300046557 | Ga0495622_0002938 | Ga0495622_0002938_5359_6474 | 369 |
| 839 | 3300046557 | Ga0495622_0033347 | Ga0495622_0033347_1172_2287 | 369 |
| 840 | 3300046558 | Ga0495633_0000467 | Ga0495633_0000467_34321_35433 | 369 |
| 841 | 3300046558 | Ga0495633_0000472 | Ga0495633_0000472_35560_36672 | 369 |
| 842 | 3300046558 | Ga0495633_0003381 | Ga0495633_0003381_5627_6742 | 369 |
| 843 | 3300046558 | Ga0495633_0005433 | Ga0495633_0005433_2546_3664 | 369 |
| 844 | 3300046558 | Ga0495633_0006297 | Ga0495633_0006297_4264_5379 | 369 |
| 845 | 3300046558 | Ga0495633_0006990 | Ga0495633_0006990_5057_6175 | 369 |
| 846 | 3300046558 | Ga0495633_0008254 | Ga0495633_0008254_3251_4366 | 369 |
| 847 | 3300046558 | Ga0495633_0010420 | Ga0495633_0010420_3914_5029 | 369 |
| 848 | 3300046558 | Ga0495633_0011181 | Ga0495633_0011181_3137_4255 | 369 |
| 849 | 3300046558 | Ga0495633_0033873 | Ga0495633_0033873_1158_2273 | 369 |
| 850 | 3300046558 | Ga0495633_0067941 | Ga0495633_0067941_299_1414 | 369 |
| 851 | 3300046615 | Ga0495656_0004308 | Ga0495656_0004308_2482_3600 | 369 |
| 852 | 3300046616 | Ga0495668_0000210 | Ga0495668_0000210_49255_50370 | 369 |
| 853 | 3300046616 | Ga0495668_0000333 | Ga0495668_0000333_58951_60063 | 369 |
| 854 | 3300046616 | Ga0495668_0001190 | Ga0495668_0001190_4015_5133 | 369 |
| 855 | 3300046616 | Ga0495668_0004052 | Ga0495668_0004052_4187_5305 | 369 |
| 856 | 3300046616 | Ga0495668_0004067 | Ga0495668_0004067_355_1470 | 369 |
| 857 | 3300046616 | Ga0495668_0007970 | Ga0495668_0007970_2774_3889 | 369 |
| 858 | 3300046616 | Ga0495668_0017863 | Ga0495668_0017863_505_1620 | 369 |
| 859 | 3300046616 | Ga0495668_0043148 | Ga0495668_0043148_1381_2496 | 369 |
| 860 | 3300046642 | Ga0495634_0010701 | Ga0495634_0010701_2624_3742 | 369 |
| 861 | 3300046642 | Ga0495634_0029405 | Ga0495634_0029405_2324_3439 | 369 |
| 862 | 3300046648 | Ga0495611_0000336 | Ga0495611_0000336_5946_7064 | 369 |
| 863 | 3300046648 | Ga0495611_0001499 | Ga0495611_0001499_6221_7336 | 369 |
| 864 | 3300046648 | Ga0495611_0001565 | Ga0495611_0001565_5985_7103 | 369 |
| 865 | 3300046648 | Ga0495611_0007237 | Ga0495611_0007237_1247_2362 | 369 |
| 866 | 3300046648 | Ga0495611_0016478 | Ga0495611_0016478_1902_3017 | 369 |
| 867 | 3300046648 | Ga0495611_0019707 | Ga0495611_0019707_1210_2325 | 369 |
| 868 | 3300046648 | Ga0495611_0022196 | Ga0495611_0022196_571_1686 | 369 |
| 869 | 3300046660 | Ga0495625_0000412 | Ga0495625_0000412_59551_60663 | 369 |
| 870 | 3300046660 | Ga0495625_0002389 | Ga0495625_0002389_15046_16161 | 369 |
| 871 | 3300046660 | Ga0495625_0007845 | Ga0495625_0007845_1488_2600 | 369 |
| 872 | 3300046660 | Ga0495625_0010280 | Ga0495625_0010280_2161_3279 | 369 |
| 873 | 3300046660 | Ga0495625_0015331 | Ga0495625_0015331_4064_5179 | 369 |
| 874 | 3300046660 | Ga0495625_0026294 | Ga0495625_0026294_2879_3991 | 369 |
| 875 | 3300046663 | Ga0495635_0005531 | Ga0495635_0005531_4300_5418 | 369 |
| 876 | 3300046663 | Ga0495635_0194618 | Ga0495635_0194618_245_1360 | 369 |
| 877 | 3300046664 | Ga0495659_0002619 | Ga0495659_0002619_3400_4515 | 369 |
| 878 | 3300046665 | Ga0495661_0000613 | Ga0495661_0000613_31273_32388 | 369 |
| 879 | 3300046665 | Ga0495661_0000794 | Ga0495661_0000794_16683_17798 | 369 |
| 880 | 3300046665 | Ga0495661_0001195 | Ga0495661_0001195_19284_20402 | 369 |
| 881 | 3300046665 | Ga0495661_0002649 | Ga0495661_0002649_3970_5085 | 369 |
| 882 | 3300046665 | Ga0495661_0007511 | Ga0495661_0007511_2350_3468 | 369 |
| 883 | 3300046665 | Ga0495661_0007838 | Ga0495661_0007838_796_1914 | 369 |
| 884 | 3300046665 | Ga0495661_0011228 | Ga0495661_0011228_2672_3790 | 369 |
| 885 | 3300046665 | Ga0495661_0013468 | Ga0495661_0013468_2809_3927 | 369 |
| 886 | 3300046665 | Ga0495661_0014914 | Ga0495661_0014914_3992_5107 | 369 |
| 887 | 3300046665 | Ga0495661_0019387 | Ga0495661_0019387_983_2098 | 369 |
| 888 | 3300046665 | Ga0495661_0021272 | Ga0495661_0021272_463_1578 | 369 |
| 889 | 3300046665 | Ga0495661_0031092 | Ga0495661_0031092_648_1766 | 369 |
| 890 | 3300046665 | Ga0495661_0067099 | Ga0495661_0067099_966_2081 | 369 |
| 891 | 3300046665 | Ga0495661_0071556 | Ga0495661_0071556_306_1421 | 369 |
| 892 | 3300046665 | Ga0495661_0101300 | Ga0495661_0101300_99_1214 | 369 |
| 893 | 3300046674 | Ga0495588_0002779 | Ga0495588_0002779_1845_2963 | 369 |
| 894 | 3300046674 | Ga0495588_0014575 | Ga0495588_0014575_2627_3745 | 369 |
| 895 | 3300046674 | Ga0495588_0015979 | Ga0495588_0015979_1089_2207 | 369 |
| 896 | 3300046674 | Ga0495588_0049473 | Ga0495588_0049473_703_1818 | 369 |
| 897 | 3300046674 | Ga0495588_0051726 | Ga0495588_0051726_753_1871 | 369 |
| 898 | 3300046679 | Ga0495623_0015129 | Ga0495623_0015129_1227_2345 | 369 |
| 899 | 3300046679 | Ga0495623_0064914 | Ga0495623_0064914_459_1574 | 369 |
| 900 | 3300046680 | Ga0495646_0001070 | Ga0495646_0001070_4069_5184 | 369 |
| 901 | 3300046680 | Ga0495646_0007553 | Ga0495646_0007553_4074_5192 | 369 |
| 902 | 3300046680 | Ga0495646_0033843 | Ga0495646_0033843_1435_2550 | 369 |
| 903 | 3300046684 | Ga0495669_0000240 | Ga0495669_0000240_11573_12688 | 369 |
| 904 | 3300046684 | Ga0495669_0000324 | Ga0495669_0000324_20726_21841 | 369 |
| 905 | 3300046684 | Ga0495669_0001234 | Ga0495669_0001234_1763_2881 | 369 |
| 906 | 3300046684 | Ga0495669_0004135 | Ga0495669_0004135_2908_4023 | 369 |
| 907 | 3300046684 | Ga0495669_0007418 | Ga0495669_0007418_3430_4548 | 369 |
| 908 | 3300046684 | Ga0495669_0010168 | Ga0495669_0010168_1220_2338 | 369 |
| 909 | 3300046691 | Ga0495670_0006418 | Ga0495670_0006418_334_1449 | 369 |
| 910 | 3300046691 | Ga0495670_0008396 | Ga0495670_0008396_2138_3253 | 369 |
| 911 | 3300046691 | Ga0495670_0034408 | Ga0495670_0034408_1246_2361 | 369 |
| 912 | 3300046691 | Ga0495670_0046933 | Ga0495670_0046933_524_1639 | 369 |
| 913 | 3300046691 | Ga0495670_0068391 | Ga0495670_0068391_457_1575 | 369 |
| 914 | 3300046692 | Ga0495671_0000609 | Ga0495671_0000609_4328_5446 | 369 |
| 915 | 3300046692 | Ga0495671_0002097 | Ga0495671_0002097_8203_9321 | 369 |
| 916 | 3300046694 | Ga0495649_0000644 | Ga0495649_0000644_4236_5354 | 369 |
| 917 | 3300046694 | Ga0495649_0003103 | Ga0495649_0003103_4119_5234 | 369 |
| 918 | 3300046694 | Ga0495649_0003975 | Ga0495649_0003975_7488_8606 | 369 |
| 919 | 3300046794 | Ga0495589_0000212 | Ga0495589_0000212_14623_15738 | 369 |
| 920 | 3300046794 | Ga0495589_0000358 | Ga0495589_0000358_4138_5253 | 369 |
| 921 | 3300046794 | Ga0495589_0001945 | Ga0495589_0001945_4211_5329 | 369 |
| 922 | 3300046794 | Ga0495589_0008518 | Ga0495589_0008518_1824_2939 | 369 |
| 923 | 3300046794 | Ga0495589_0010991 | Ga0495589_0010991_2470_3585 | 369 |
| 924 | 3300046794 | Ga0495589_0015330 | Ga0495589_0015330_2676_3794 | 369 |
| 925 | 3300046794 | Ga0495589_0017754 | Ga0495589_0017754_2433_3551 | 369 |
| 926 | 3300046794 | Ga0495589_0068269 | Ga0495589_0068269_41_1156 | 369 |
| 927 | 3300046794 | Ga0495589_0087153 | Ga0495589_0087153_388_1506 | 369 |
| 928 | 3300046809 | Ga0495600_0023933 | Ga0495600_0023933_2482_3597 | 369 |
| 929 | 3300046810 | Ga0495660_0000301 | Ga0495660_0000301_17507_18622 | 369 |
| 930 | 3300046810 | Ga0495660_0000789 | Ga0495660_0000789_2066_3181 | 369 |
| 931 | 3300046810 | Ga0495660_0001147 | Ga0495660_0001147_15384_16496 | 369 |
| 932 | 3300046810 | Ga0495660_0002687 | Ga0495660_0002687_8109_9221 | 369 |
| 933 | 3300046810 | Ga0495660_0002698 | Ga0495660_0002698_9461_10573 | 369 |
| 934 | 3300046810 | Ga0495660_0002992 | Ga0495660_0002992_6067_7182 | 369 |
| 935 | 3300046810 | Ga0495660_0052182 | Ga0495660_0052182_723_1841 | 369 |
| 936 | 3300046810 | Ga0495660_0054684 | Ga0495660_0054684_770_1888 | 369 |
| 937 | 3300046810 | Ga0495660_0063459 | Ga0495660_0063459_714_1832 | 369 |
| 938 | 3300047315 | Ga0495581_0001466 | Ga0495581_0001466_4294_5409 | 369 |
| 939 | 3300047315 | Ga0495581_0013538 | Ga0495581_0013538_3101_4216 | 369 |
| 940 | 3300047317 | Ga0495604_0009345 | Ga0495604_0009345_4207_5325 | 369 |
| 941 | 3300047317 | Ga0495604_0013433 | Ga0495604_0013433_1460_2575 | 369 |
| 942 | 3300047317 | Ga0495604_0130117 | Ga0495604_0130117_638_1756 | 369 |
| 943 | 3300047318 | Ga0495636_0002971 | Ga0495636_0002971_2606_3721 | 369 |
| 944 | 3300047318 | Ga0495636_0035052 | Ga0495636_0035052_123_1241 | 369 |
| 945 | 3300047320 | Ga0495672_0000431 | Ga0495672_0000431_39558_40670 | 369 |
| 946 | 3300047320 | Ga0495672_0001709 | Ga0495672_0001709_15794_16909 | 369 |
| 947 | 3300047320 | Ga0495672_0001925 | Ga0495672_0001925_14441_15556 | 369 |
| 948 | 3300047320 | Ga0495672_0002234 | Ga0495672_0002234_10783_11898 | 369 |
| 949 | 3300047320 | Ga0495672_0002438 | Ga0495672_0002438_6190_7308 | 369 |
| 950 | 3300047320 | Ga0495672_0009016 | Ga0495672_0009016_5684_6802 | 369 |
| 951 | 3300047321 | Ga0495676_0000069 | Ga0495676_0000069_4240_5358 | 369 |
| 952 | 3300047322 | Ga0495680_0009108 | Ga0495680_0009108_866_1984 | 369 |
| 953 | 3300047323 | Ga0495683_0000221 | Ga0495683_0000221_4350_5468 | 369 |
| 954 | 3300047323 | Ga0495683_0000559 | Ga0495683_0000559_22563_23681 | 369 |
| 955 | 3300047323 | Ga0495683_0002282 | Ga0495683_0002282_9895_11010 | 369 |
| 956 | 3300047323 | Ga0495683_0003435 | Ga0495683_0003435_5198_6313 | 369 |
| 957 | 3300047323 | Ga0495683_0011823 | Ga0495683_0011823_1870_2985 | 369 |
| 958 | 3300047323 | Ga0495683_0048157 | Ga0495683_0048157_906_2024 | 369 |
| 959 | 3300047323 | Ga0495683_0074678 | Ga0495683_0074678_17_1135 | 369 |
| 960 | 3300047443 | Ga0495687_000221 | Ga0495687_000221_46151_47266 | 369 |
| 961 | 3300047443 | Ga0495687_000714 | Ga0495687_000714_7972_9087 | 369 |
| 962 | 3300047443 | Ga0495687_000917 | Ga0495687_000917_25385_26503 | 369 |
| 963 | 3300047443 | Ga0495687_002375 | Ga0495687_002375_3197_4309 | 369 |
| 964 | 3300047443 | Ga0495687_004864 | Ga0495687_004864_4514_5626 | 369 |
| 965 | 3300047443 | Ga0495687_005631 | Ga0495687_005631_2539_3654 | 369 |
| 966 | 3300047443 | Ga0495687_010530 | Ga0495687_010530_2582_3700 | 369 |
| 967 | 3300047444 | Ga0495675_0012391 | Ga0495675_0012391_1869_2987 | 369 |
| 968 | 3300047444 | Ga0495675_0045291 | Ga0495675_0045291_710_1825 | 369 |
| 969 | 3300047445 | Ga0495677_0000060 | Ga0495677_0000060_14712_15827 | 369 |
| 970 | 3300047445 | Ga0495677_0000616 | Ga0495677_0000616_9388_10506 | 369 |
| 971 | 3300047445 | Ga0495677_0002470 | Ga0495677_0002470_4089_5204 | 369 |
| 972 | 3300047445 | Ga0495677_0003295 | Ga0495677_0003295_3838_4956 | 369 |
| 973 | 3300047445 | Ga0495677_0004463 | Ga0495677_0004463_2692_3807 | 369 |
| 974 | 3300047445 | Ga0495677_0007868 | Ga0495677_0007868_1645_2760 | 369 |
| 975 | 3300047445 | Ga0495677_0012295 | Ga0495677_0012295_545_1657 | 369 |
| 976 | 3300047445 | Ga0495677_0012909 | Ga0495677_0012909_1634_2749 | 369 |
| 977 | 3300047445 | Ga0495677_0016892 | Ga0495677_0016892_942_2057 | 369 |
| 978 | 3300047445 | Ga0495677_0049365 | Ga0495677_0049365_123_1241 | 369 |
| 979 | 3300047446 | Ga0495679_003216 | Ga0495679_003216_3044_4162 | 369 |
| 980 | 3300047446 | Ga0495679_009937 | Ga0495679_009937_633_1748 | 369 |
| 981 | 3300047447 | Ga0495685_000340 | Ga0495685_000340_7602_8717 | 369 |
| 982 | 3300047447 | Ga0495685_000345 | Ga0495685_000345_8096_9211 | 369 |
| 983 | 3300047447 | Ga0495685_002067 | Ga0495685_002067_4073_5191 | 369 |
| 984 | 3300047469 | Ga0495673_0000074 | Ga0495673_0000074_158856_159968 | 369 |
| 985 | 3300047469 | Ga0495673_0000194 | Ga0495673_0000194_39548_40663 | 369 |
| 986 | 3300047470 | Ga0495681_0000330 | Ga0495681_0000330_30129_31244 | 369 |
| 987 | 3300047470 | Ga0495681_0000642 | Ga0495681_0000642_23455_24567 | 369 |
| 988 | 3300047470 | Ga0495681_0001763 | Ga0495681_0001763_12364_13479 | 369 |
| 989 | 3300047470 | Ga0495681_0002881 | Ga0495681_0002881_7636_8754 | 369 |
| 990 | 3300047470 | Ga0495681_0043864 | Ga0495681_0043864_17_1132 | 369 |
| 991 | 3300047470 | Ga0495681_0044790 | Ga0495681_0044790_226_1344 | 369 |
| 992 | 3300047470 | Ga0495681_0070441 | Ga0495681_0070441_19_1137 | 369 |
| 993 | 3300047470 | Ga0495681_0084645 | Ga0495681_0084645_100_1218 | 369 |
| 994 | 3300047472 | Ga0495686_0001928 | Ga0495686_0001928_4203_5318 | 369 |
| 995 | 3300047472 | Ga0495686_0004503 | Ga0495686_0004503_6069_7184 | 369 |
| 996 | 3300047472 | Ga0495686_0006220 | Ga0495686_0006220_5709_6827 | 369 |
| 997 | 3300047472 | Ga0495686_0006658 | Ga0495686_0006658_2287_3405 | 369 |
| 998 | 3300047472 | Ga0495686_0010605 | Ga0495686_0010605_2847_3962 | 369 |
| 999 | 3300047472 | Ga0495686_0087977 | Ga0495686_0087977_158_1273 | 369 |
| 1000 | 3300047673 | Ga0495593_0003624 | Ga0495593_0003624_4149_5264 | 369 |
| 1001 | 3300047673 | Ga0495593_0007992 | Ga0495593_0007992_4273_5388 | 369 |
| 1002 | 3300048088 | Ga0495602_0001744 | Ga0495602_0001744_17041_18159 | 369 |
| 1003 | 3300048088 | Ga0495602_0025892 | Ga0495602_0025892_473_1588 | 369 |
| 1004 | 3300048089 | Ga0495614_0004592 | Ga0495614_0004592_4015_5130 | 369 |
| 1005 | 3300048089 | Ga0495614_0005888 | Ga0495614_0005888_3349_4467 | 369 |
| 1006 | 3300048089 | Ga0495614_0082665 | Ga0495614_0082665_67_1182 | 369 |
| 1007 | 3300048090 | Ga0495615_0011539 | Ga0495615_0011539_273_1388 | 369 |
| 1008 | 3300048091 | Ga0495626_0000058 | Ga0495626_0000058_13392_14507 | 369 |
| 1009 | 3300048091 | Ga0495626_0000196 | Ga0495626_0000196_35831_36949 | 369 |
| 1010 | 3300048091 | Ga0495626_0001643 | Ga0495626_0001643_12101_13216 | 369 |
| 1011 | 3300048091 | Ga0495626_0004639 | Ga0495626_0004639_4409_5524 | 369 |
| 1012 | 3300048091 | Ga0495626_0006061 | Ga0495626_0006061_3938_5056 | 369 |
| 1013 | 3300048091 | Ga0495626_0006899 | Ga0495626_0006899_4164_5282 | 369 |
| 1014 | 3300048091 | Ga0495626_0009308 | Ga0495626_0009308_4003_5121 | 369 |
| 1015 | 3300048091 | Ga0495626_0020651 | Ga0495626_0020651_1579_2697 | 369 |
| 1016 | 3300048091 | Ga0495626_0022022 | Ga0495626_0022022_1033_2151 | 369 |
| 1017 | 3300048091 | Ga0495626_0039346 | Ga0495626_0039346_1019_2137 | 369 |
| 1018 | 3300048091 | Ga0495626_0050032 | Ga0495626_0050032_148_1263 | 369 |
| 1019 | 3300048904 | Ga0496101_0051972 | Ga0496101_0051972_588_1706 | 369 |
| 1020 | 3300048905 | Ga0496102_0000420 | Ga0496102_0000420_3993_5111 | 369 |
| 1021 | 3300048905 | Ga0496102_0033655 | Ga0496102_0033655_56_1171 | 369 |
| 1022 | 3300048907 | Ga0496104_0102748 | Ga0496104_0102748_989_2101 | 369 |
| 1023 | 3300048910 | Ga0496107_0103276 | Ga0496107_0103276_172_1287 | 369 |
| 1024 | 3300048912 | Ga0496109_0373831 | Ga0496109_0373831_121_1239 | 369 |
| 1025 | 3300048913 | Ga0496110_0004041 | Ga0496110_0004041_4015_5133 | 369 |
| 1026 | 3300048914 | Ga0496111_0032938 | Ga0496111_0032938_458_1576 | 369 |
| 1027 | 3300048914 | Ga0496111_0173620 | Ga0496111_0173620_403_1521 | 369 |
| 1028 | 3300048916 | Ga0496113_0034323 | Ga0496113_0034323_355_1473 | 369 |
| 1029 | 3300048917 | Ga0496114_0051398 | Ga0496114_0051398_1510_2625 | 369 |
| 1030 | 3300048918 | Ga0496115_0006572 | Ga0496115_0006572_3068_4183 | 369 |
| 1031 | 3300048918 | Ga0496115_0007248 | Ga0496115_0007248_1713_2828 | 369 |
| 1032 | 3300048918 | Ga0496115_0014859 | Ga0496115_0014859_2662_3780 | 369 |
| 1033 | 3300048918 | Ga0496115_0115931 | Ga0496115_0115931_19_1134 | 369 |
| 1034 | 3300048925 | Ga0496122_0001092 | Ga0496122_0001092_735_1853 | 369 |
| 1035 | 3300048926 | Ga0496123_0002714 | Ga0496123_0002714_19415_20533 | 369 |
| 1036 | 3300048927 | Ga0496124_0019066 | Ga0496124_0019066_2624_3739 | 369 |
| 1037 | 3300048927 | Ga0496124_0076846 | Ga0496124_0076846_1097_2212 | 369 |
| 1038 | 3300048928 | Ga0496125_0000368 | Ga0496125_0000368_46715_47830 | 369 |
| 1039 | 3300048928 | Ga0496125_0008339 | Ga0496125_0008339_7041_8159 | 369 |
| 1040 | 3300049459 | Ga0495678_000013 | Ga0495678_000013_272485_273597 | 369 |
| 1041 | 3300049459 | Ga0495678_000146 | Ga0495678_000146_43903_45021 | 369 |
| 1042 | 3300049459 | Ga0495678_001534 | Ga0495678_001534_7155_8267 | 369 |
| 1043 | 3300049459 | Ga0495678_003140 | Ga0495678_003140_4276_5394 | 369 |
| 1044 | 3300049459 | Ga0495678_003481 | Ga0495678_003481_2374_3489 | 369 |
| 1045 | 3300049459 | Ga0495678_006090 | Ga0495678_006090_4472_5587 | 369 |
| 1046 | 3300049459 | Ga0495678_007836 | Ga0495678_007836_4316_5434 | 369 |
| 1047 | 3300049459 | Ga0495678_010397 | Ga0495678_010397_960_2072 | 369 |
| 1048 | 3300049459 | Ga0495678_062852 | Ga0495678_062852_242_1354 | 369 |
| 1049 | 3300049460 | Ga0495682_0001326 | Ga0495682_0001326_4074_5192 | 369 |
| 1050 | 3300049460 | Ga0495682_0002294 | Ga0495682_0002294_7432_8547 | 369 |
| 1051 | 3300049460 | Ga0495682_0003910 | Ga0495682_0003910_4371_5489 | 369 |
| 1052 | 3300049460 | Ga0495682_0011240 | Ga0495682_0011240_1986_3104 | 369 |
| 1053 | 3300049460 | Ga0495682_0040067 | Ga0495682_0040067_57_1175 | 369 |
| 1054 | 3300049679 | Ga0501249_012850 | Ga0501249_012850_368_1480 | 369 |
| 1055 | 3300049766 | Ga0501269_000446 | Ga0501269_000446_5475_6587 | 369 |
| 1056 | 3300049822 | Ga0501035_0007367 | Ga0501035_0007367_4362_5477 | 369 |
| 1057 | 3300053145 | Ga0500586_011320 | Ga0500586_011320_691_1803 | 369 |
| 1058 | iso_pu_bacteria | 2643221603 | 2644028082 | 369 |
| 1059 | iso_pu_bacteria | 2818991450 | 2819624095 | 378 |
| 1060 | iso_pu_bacteria | 2928108538 | 2928112802 | 378 |
| 1061 | iso_pu_bacteria | 2928135762 | 2928141749 | 378 |
| 1062 | iso_pu_bacteria | 2928503688 | 2928508350 | 378 |
| 1063 | 3300001989 | JGI24739J22299_10001831 | JGI24739J22299_100018312 | 382 |
| 1064 | 3300001990 | JGI24737J22298_10019259 | JGI24737J22298_100192592 | 382 |
| 1065 | 3300002067 | JGI24735J21928_10019040 | JGI24735J21928_100190402 | 382 |
| 1066 | 3300005367 | Ga0070667_100219511 | Ga0070667_1002195111 | 382 |
| 1067 | 3300009011 | Ga0105251_10000895 | Ga0105251_1000089525 | 382 |
| 1068 | 3300015262 | Ga0182007_10000169 | Ga0182007_1000016928 | 382 |
| 1069 | 3300025735 | Ga0207713_1000137 | Ga0207713_100013761 | 382 |
| 1070 | 3300025904 | Ga0207647_10009500 | Ga0207647_100095002 | 382 |
| 1071 | 3300046472 | Ga0495580_0004379 | Ga0495580_0004379_10569_11786 | 382 |
| 1072 | 3300046506 | Ga0495583_0009524 | Ga0495583_0009524_2222_3439 | 382 |
| 1073 | 3300047319 | Ga0495674_0006740 | Ga0495674_0006740_8694_9842 | 382 |
| 1074 | 3300048920 | Ga0496117_0083507 | Ga0496117_0083507_13_1161 | 382 |
| 1075 | 3300048921 | Ga0496118_0002994 | Ga0496118_0002994_4250_5398 | 382 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8984 | 19 | 377 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8919 | 19 | 377 |
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8785 | 19 | 377 |
| 8tj3-assembly1.cif.gz_B | structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex | 0.8689 | 15 | 376 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8665 | 19 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MB47_65_296_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3139 | 46 | 249 | 1.25.40.10 |
| af_A0A0R0HMJ0_13_161_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2889 | 81 | 217 | 1.20.1250.20 |
| af_Q54S92_730_1069_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.2773 | 36 | 340 | 1.25.10.10 |
| af_K7MB47_65_296_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2483 | 46 | 249 | 1.25.40.10 |
| af_Q54S92_730_1069_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.2474 | 36 | 340 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7F3V5-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9434 | 9 | 379 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A2R4CCK4-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.942 | 13 | 381 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A6N9HKM6-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.94 | 8 | 381 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A7X7CW87-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9391 | 30 | 380 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A5E4RNR2-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9382 | 1 | 382 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar