F489541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 334 | 2148 | 54 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10176005|Ga0265338_101760053 |
| Length | 60 |
| Sequence | MGETTVKKMMQQFWADESGQDVAEYAVMLAVILVIVIGTVRLIGTNANNVFSQVGSQMAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 123 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 124 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 151 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 152 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 155 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 224 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 225 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 245 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 274 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 315 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.28 |
| Metatranscriptomes | 3.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.93 |
| Rhizosphere | 94.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 29.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10176005 | 3300028800 | Bacteria | 1635 |
| 2 | MBSR1b_contig_4027986 | 2162886012 | Bacteria | 1326 |
| 3 | MBSR1b_contig_8333477 | 2162886012 | Bacteria | 1395 |
| 4 | JGI24741J21665_1043427 | 3300001915 | Unclassified | 662 |
| 5 | JGI24752J21851_1009768 | 3300001976 | Unclassified | 1252 |
| 6 | JGI24737J22298_10066688 | 3300001990 | Eukaryota | 1077 |
| 7 | JGI24737J22298_10087360 | 3300001990 | Bacteria | 926 |
| 8 | JGI24737J22298_10264343 | 3300001990 | Unclassified | 509 |
| 9 | JGI24743J22301_10001159 | 3300001991 | Bacteria | 3544 |
| 10 | JGI24743J22301_10063748 | 3300001991 | Unclassified | 762 |
| 11 | JGI24748J21848_1017408 | 3300002074 | Bacteria | 860 |
| 12 | JGI24034J26672_10043391 | 3300002239 | Bacteria | 759 |
| 13 | JGI24034J26672_10079104 | 3300002239 | Unclassified | 598 |
| 14 | JGI24034J26672_10105268 | 3300002239 | Unclassified | 535 |
| 15 | JGI24751J29686_10002972 | 3300002459 | Bacteria | 3422 |
| 16 | JGI24751J29686_10007429 | 3300002459 | Bacteria | 2239 |
| 17 | JGI24751J29686_10037826 | 3300002459 | Bacteria | 999 |
| 18 | Ga0058861_10003102 | 3300004800 | Unclassified | 520 |
| 19 | Ga0058860_11002774 | 3300004801 | Bacteria | 714 |
| 20 | Ga0058860_12177445 | 3300004801 | Unclassified | 729 |
| 21 | Ga0065704_10261811 | 3300005289 | Unclassified | 963 |
| 22 | Ga0065704_10288517 | 3300005289 | Bacteria | 908 |
| 23 | Ga0065712_10070788 | 3300005290 | Bacteria | 5678 |
| 24 | Ga0065712_10212416 | 3300005290 | Unclassified | 1043 |
| 25 | Ga0065715_10007408 | 3300005293 | Bacteria | 3392 |
| 26 | Ga0065715_10092574 | 3300005293 | Bacteria | 5049 |
| 27 | Ga0065715_10233000 | 3300005293 | Bacteria | 1227 |
| 28 | Ga0065707_10250402 | 3300005295 | Bacteria | 1109 |
| 29 | Ga0065707_10437642 | 3300005295 | Bacteria | 780 |
| 30 | Ga0070658_10106058 | 3300005327 | Bacteria | 2325 |
| 31 | Ga0070658_10202182 | 3300005327 | Bacteria | 1676 |
| 32 | Ga0070658_10873832 | 3300005327 | Unclassified | 781 |
| 33 | Ga0070676_10055122 | 3300005328 | Bacteria | 2345 |
| 34 | Ga0070676_10067522 | 3300005328 | Bacteria | 2138 |
| 35 | Ga0070676_10099922 | 3300005328 | Bacteria | 1791 |
| 36 | Ga0070683_100003197 | 3300005329 | Bacteria | 13220 |
| 37 | Ga0070683_100005844 | 3300005329 | Bacteria | 10293 |
| 38 | Ga0070683_100008880 | 3300005329 | Bacteria | 8560 |
| 39 | Ga0070683_100012847 | 3300005329 | Bacteria | 7286 |
| 40 | Ga0070690_100087851 | 3300005330 | Bacteria | 2043 |
| 41 | Ga0070690_100093222 | 3300005330 | Bacteria | 1986 |
| 42 | Ga0070690_100105475 | 3300005330 | Bacteria | 1873 |
| 43 | Ga0070670_100071125 | 3300005331 | Bacteria | 2987 |
| 44 | Ga0070670_100144406 | 3300005331 | Bacteria | 2058 |
| 45 | Ga0070670_100359172 | 3300005331 | Bacteria | 1281 |
| 46 | Ga0070670_101695046 | 3300005331 | Bacteria | 581 |
| 47 | Ga0070677_10004885 | 3300005333 | Bacteria | 4403 |
| 48 | Ga0070677_10154161 | 3300005333 | Bacteria | 1072 |
| 49 | Ga0070677_10475526 | 3300005333 | Bacteria | 673 |
| 50 | Ga0068869_100001293 | 3300005334 | Bacteria | 14820 |
| 51 | Ga0068869_100038894 | 3300005334 | Bacteria | 3393 |
| 52 | Ga0068869_100067840 | 3300005334 | Bacteria | 2633 |
| 53 | Ga0068869_100332456 | 3300005334 | Unclassified | 1235 |
| 54 | Ga0070666_10022383 | 3300005335 | Bacteria | 4104 |
| 55 | Ga0070666_10051885 | 3300005335 | Bacteria | 2763 |
| 56 | Ga0070666_10070115 | 3300005335 | Bacteria | 2384 |
| 57 | Ga0070680_100050810 | 3300005336 | Bacteria | 3382 |
| 58 | Ga0070682_100007783 | 3300005337 | Bacteria | 6035 |
| 59 | Ga0070682_100676741 | 3300005337 | Unclassified | 824 |
| 60 | Ga0070682_100927252 | 3300005337 | Unclassified | 718 |
| 61 | Ga0068868_100020920 | 3300005338 | Bacteria | 4924 |
| 62 | Ga0068868_100045373 | 3300005338 | Bacteria | 3438 |
| 63 | Ga0068868_100053680 | 3300005338 | Bacteria | 3175 |
| 64 | Ga0068868_100073466 | 3300005338 | Bacteria | 2731 |
| 65 | Ga0068868_100124447 | 3300005338 | Bacteria | 2105 |
| 66 | Ga0068868_100414186 | 3300005338 | Bacteria | 1165 |
| 67 | Ga0068868_100497598 | 3300005338 | Unclassified | 1067 |
| 68 | Ga0068868_100577493 | 3300005338 | Unclassified | 993 |
| 69 | Ga0070660_100004238 | 3300005339 | Bacteria | 9902 |
| 70 | Ga0070660_100015997 | 3300005339 | Bacteria | 5433 |
| 71 | Ga0070660_100412516 | 3300005339 | Bacteria | 1118 |
| 72 | Ga0070660_100474351 | 3300005339 | Bacteria | 1039 |
| 73 | Ga0070689_100001850 | 3300005340 | Bacteria | 13631 |
| 74 | Ga0070689_100011759 | 3300005340 | Bacteria | 6279 |
| 75 | Ga0070689_100038434 | 3300005340 | Bacteria | 3662 |
| 76 | Ga0070689_100250061 | 3300005340 | Bacteria | 1462 |
| 77 | Ga0070691_10011241 | 3300005341 | Bacteria | 4085 |
| 78 | Ga0070687_100080978 | 3300005343 | Bacteria | 1772 |
| 79 | Ga0070687_100975654 | 3300005343 | Unclassified | 612 |
| 80 | Ga0070661_100004259 | 3300005344 | Bacteria | 9868 |
| 81 | Ga0070661_100017115 | 3300005344 | Bacteria | 5138 |
| 82 | Ga0070661_100018668 | 3300005344 | Unclassified | 4934 |
| 83 | Ga0070661_100934229 | 3300005344 | Unclassified | 717 |
| 84 | Ga0070692_10052921 | 3300005345 | Bacteria | 2116 |
| 85 | Ga0070692_11022810 | 3300005345 | Bacteria | 579 |
| 86 | Ga0070668_100011820 | 3300005347 | Bacteria | 6502 |
| 87 | Ga0070668_100013309 | 3300005347 | Bacteria | 6139 |
| 88 | Ga0070668_100798088 | 3300005347 | Unclassified | 838 |
| 89 | Ga0070669_100059579 | 3300005353 | Bacteria | 2803 |
| 90 | Ga0070669_100106176 | 3300005353 | Bacteria | 2125 |
| 91 | Ga0070669_100326882 | 3300005353 | Bacteria | 1240 |
| 92 | Ga0070675_100002561 | 3300005354 | Bacteria | 13609 |
| 93 | Ga0070675_100022584 | 3300005354 | Bacteria | 5027 |
| 94 | Ga0070675_100126635 | 3300005354 | Unclassified | 2173 |
| 95 | Ga0070671_101108258 | 3300005355 | Unclassified | 695 |
| 96 | Ga0070671_101183498 | 3300005355 | Unclassified | 672 |
| 97 | Ga0070674_100233547 | 3300005356 | Bacteria | 1436 |
| 98 | Ga0070674_101082465 | 3300005356 | Unclassified | 707 |
| 99 | Ga0070673_100041389 | 3300005364 | Bacteria | 3543 |
| 100 | Ga0070673_100078846 | 3300005364 | Unclassified | 2665 |
| 101 | Ga0070673_100111609 | 3300005364 | Bacteria | 2268 |
| 102 | Ga0070688_100000516 | 3300005365 | Bacteria | 19541 |
| 103 | Ga0070688_100004344 | 3300005365 | Bacteria | 7372 |
| 104 | Ga0070688_100040384 | 3300005365 | Bacteria | 2859 |
| 105 | Ga0070688_100353942 | 3300005365 | Bacteria | 1076 |
| 106 | Ga0070659_100005697 | 3300005366 | Bacteria | 8966 |
| 107 | Ga0070659_100010194 | 3300005366 | Bacteria | 6914 |
| 108 | Ga0070659_100023103 | 3300005366 | Bacteria | 4754 |
| 109 | Ga0070667_100011015 | 3300005367 | Bacteria | 7479 |
| 110 | Ga0070667_100126289 | 3300005367 | Unclassified | 2229 |
| 111 | Ga0070667_100444918 | 3300005367 | Bacteria | 1184 |
| 112 | Ga0070667_100446504 | 3300005367 | Unclassified | 1181 |
| 113 | Ga0070709_10037109 | 3300005434 | Bacteria | 2974 |
| 114 | Ga0070709_10141716 | 3300005434 | Unclassified | 1652 |
| 115 | Ga0070709_10255262 | 3300005434 | Unclassified | 1265 |
| 116 | Ga0070709_10519210 | 3300005434 | Unclassified | 907 |
| 117 | Ga0070709_10611075 | 3300005434 | Unclassified | 840 |
| 118 | Ga0070714_100085437 | 3300005435 | Bacteria | 2756 |
| 119 | Ga0070714_100447462 | 3300005435 | Unclassified | 1227 |
| 120 | Ga0070714_101154135 | 3300005435 | Unclassified | 755 |
| 121 | Ga0070714_101229836 | 3300005435 | Unclassified | 731 |
| 122 | Ga0070713_100018350 | 3300005436 | Bacteria | 5317 |
| 123 | Ga0070713_100029594 | 3300005436 | Bacteria | 4340 |
| 124 | Ga0070713_100031301 | 3300005436 | Bacteria | 4237 |
| 125 | Ga0070713_100221044 | 3300005436 | Unclassified | 1718 |
| 126 | Ga0070713_100398125 | 3300005436 | Unclassified | 1285 |
| 127 | Ga0070713_100494726 | 3300005436 | Bacteria | 1153 |
| 128 | Ga0070713_100749772 | 3300005436 | Unclassified | 934 |
| 129 | Ga0070713_101165569 | 3300005436 | Bacteria | 745 |
| 130 | Ga0070713_101652281 | 3300005436 | Bacteria | 622 |
| 131 | Ga0070713_102141943 | 3300005436 | Unclassified | 542 |
| 132 | Ga0070710_10017171 | 3300005437 | Unclassified | 3698 |
| 133 | Ga0070710_10089227 | 3300005437 | Bacteria | 1815 |
| 134 | Ga0070710_10133583 | 3300005437 | Unclassified | 1515 |
| 135 | Ga0070701_10224889 | 3300005438 | Bacteria | 1121 |
| 136 | Ga0070711_100002787 | 3300005439 | Bacteria | 10019 |
| 137 | Ga0070711_100036869 | 3300005439 | Bacteria | 3278 |
| 138 | Ga0070711_100414995 | 3300005439 | Unclassified | 1096 |
| 139 | Ga0070711_101893501 | 3300005439 | Unclassified | 524 |
| 140 | Ga0070700_100104671 | 3300005441 | Bacteria | 1870 |
| 141 | Ga0070700_100619395 | 3300005441 | Bacteria | 850 |
| 142 | Ga0070694_100149083 | 3300005444 | Bacteria | 1707 |
| 143 | Ga0070708_100001230 | 3300005445 | Bacteria | 19698 |
| 144 | Ga0070708_100074543 | 3300005445 | Bacteria | 3061 |
| 145 | Ga0070708_100085093 | 3300005445 | Bacteria | 2869 |
| 146 | Ga0070708_100598343 | 3300005445 | Unclassified | 1040 |
| 147 | Ga0070708_100965076 | 3300005445 | Unclassified | 800 |
| 148 | Ga0070708_101913356 | 3300005445 | Unclassified | 550 |
| 149 | Ga0070663_100018653 | 3300005455 | Bacteria | 4553 |
| 150 | Ga0070663_100019750 | 3300005455 | Bacteria | 4449 |
| 151 | Ga0070663_100020623 | 3300005455 | Bacteria | 4365 |
| 152 | Ga0070663_100023426 | 3300005455 | Unclassified | 4139 |
| 153 | Ga0070678_100025809 | 3300005456 | Bacteria | 3961 |
| 154 | Ga0070678_100117908 | 3300005456 | Bacteria | 2088 |
| 155 | Ga0070678_100131470 | 3300005456 | Bacteria | 1989 |
| 156 | Ga0070678_101292897 | 3300005456 | Unclassified | 678 |
| 157 | Ga0070662_100001978 | 3300005457 | Bacteria | 12572 |
| 158 | Ga0070662_100115487 | 3300005457 | Bacteria | 2050 |
| 159 | Ga0070662_100176753 | 3300005457 | Bacteria | 1680 |
| 160 | Ga0070681_10022786 | 3300005458 | Bacteria | 6294 |
| 161 | Ga0070681_10025415 | 3300005458 | Bacteria | 5957 |
| 162 | Ga0070681_10106236 | 3300005458 | Bacteria | 2749 |
| 163 | Ga0070681_10181869 | 3300005458 | Bacteria | 2024 |
| 164 | Ga0070681_10201274 | 3300005458 | Bacteria | 1910 |
| 165 | Ga0070681_10215656 | 3300005458 | Bacteria | 1835 |
| 166 | Ga0068867_100017052 | 3300005459 | Bacteria | 5160 |
| 167 | Ga0068867_100142276 | 3300005459 | Bacteria | 1876 |
| 168 | Ga0068867_100213087 | 3300005459 | Bacteria | 1552 |
| 169 | Ga0068867_101083619 | 3300005459 | Unclassified | 731 |
| 170 | Ga0070685_10006436 | 3300005466 | Bacteria | 5990 |
| 171 | Ga0070685_10009420 | 3300005466 | Bacteria | 5045 |
| 172 | Ga0070685_10115872 | 3300005466 | Bacteria | 1658 |
| 173 | Ga0070685_10215820 | 3300005466 | Bacteria | 1254 |
| 174 | Ga0070706_100053235 | 3300005467 | Bacteria | 3735 |
| 175 | Ga0070706_100126049 | 3300005467 | Bacteria | 2388 |
| 176 | Ga0070706_100204713 | 3300005467 | Bacteria | 1843 |
| 177 | Ga0070706_100407708 | 3300005467 | Unclassified | 1265 |
| 178 | Ga0070706_100765311 | 3300005467 | Unclassified | 894 |
| 179 | Ga0070706_101322250 | 3300005467 | Unclassified | 661 |
| 180 | Ga0070706_101979572 | 3300005467 | Unclassified | 528 |
| 181 | Ga0070707_100101060 | 3300005468 | Bacteria | 2794 |
| 182 | Ga0070707_100249111 | 3300005468 | Bacteria | 1728 |
| 183 | Ga0070707_100704902 | 3300005468 | Bacteria | 972 |
| 184 | Ga0070707_100782172 | 3300005468 | Unclassified | 918 |
| 185 | Ga0070707_101100452 | 3300005468 | Unclassified | 761 |
| 186 | Ga0070707_102149074 | 3300005468 | Unclassified | 526 |
| 187 | Ga0070698_100005509 | 3300005471 | Bacteria | 13822 |
| 188 | Ga0070698_100186398 | 3300005471 | Unclassified | 2013 |
| 189 | Ga0070698_100441555 | 3300005471 | Bacteria | 1236 |
| 190 | Ga0070698_102105900 | 3300005471 | Unclassified | 518 |
| 191 | Ga0070698_102189620 | 3300005471 | Unclassified | 506 |
| 192 | Ga0070699_100006501 | 3300005518 | Bacteria | 10176 |
| 193 | Ga0070699_100028271 | 3300005518 | Bacteria | 4836 |
| 194 | Ga0070699_100449819 | 3300005518 | Bacteria | 1168 |
| 195 | Ga0070699_100635461 | 3300005518 | Bacteria | 974 |
| 196 | Ga0070699_100644426 | 3300005518 | Bacteria | 967 |
| 197 | Ga0070699_100670833 | 3300005518 | Bacteria | 947 |
| 198 | Ga0070699_101522584 | 3300005518 | Unclassified | 613 |
| 199 | Ga0070699_101567675 | 3300005518 | Bacteria | 604 |
| 200 | Ga0070699_101587771 | 3300005518 | Bacteria | 599 |
| 201 | Ga0070699_102056794 | 3300005518 | Unclassified | 522 |
| 202 | Ga0070679_100115168 | 3300005530 | Unclassified | 2674 |
| 203 | Ga0070679_100140930 | 3300005530 | Bacteria | 2390 |
| 204 | Ga0070679_100407203 | 3300005530 | Bacteria | 1306 |
| 205 | Ga0070679_100449336 | 3300005530 | Bacteria | 1234 |
| 206 | Ga0070679_100514923 | 3300005530 | Bacteria | 1140 |
| 207 | Ga0070684_100001221 | 3300005535 | Bacteria | 18446 |
| 208 | Ga0070684_100004762 | 3300005535 | Bacteria | 10370 |
| 209 | Ga0070684_100007834 | 3300005535 | Bacteria | 8332 |
| 210 | Ga0070684_100024296 | 3300005535 | Bacteria | 5082 |
| 211 | Ga0070697_100000195 | 3300005536 | Bacteria | 49351 |
| 212 | Ga0070697_100015094 | 3300005536 | Bacteria | 6064 |
| 213 | Ga0070697_100019283 | 3300005536 | Bacteria | 5387 |
| 214 | Ga0070697_100030279 | 3300005536 | Unclassified | 4348 |
| 215 | Ga0070697_100262556 | 3300005536 | Bacteria | 1479 |
| 216 | Ga0070697_100307836 | 3300005536 | Unclassified | 1363 |
| 217 | Ga0070697_100387964 | 3300005536 | Bacteria | 1210 |
| 218 | Ga0070697_100628787 | 3300005536 | Unclassified | 945 |
| 219 | Ga0070697_100712903 | 3300005536 | Unclassified | 885 |
| 220 | Ga0070697_101510627 | 3300005536 | Unclassified | 600 |
| 221 | Ga0068853_100040624 | 3300005539 | Bacteria | 3970 |
| 222 | Ga0068853_100050463 | 3300005539 | Bacteria | 3579 |
| 223 | Ga0068853_100157132 | 3300005539 | Bacteria | 2049 |
| 224 | Ga0068853_100181862 | 3300005539 | Bacteria | 1907 |
| 225 | Ga0068853_100985557 | 3300005539 | Bacteria | 811 |
| 226 | Ga0068853_101158569 | 3300005539 | Bacteria | 746 |
| 227 | Ga0068853_101550158 | 3300005539 | Unclassified | 642 |
| 228 | Ga0070672_100017612 | 3300005543 | Bacteria | 5146 |
| 229 | Ga0070686_100014722 | 3300005544 | Bacteria | 4514 |
| 230 | Ga0070686_100590965 | 3300005544 | Bacteria | 873 |
| 231 | Ga0070695_100126232 | 3300005545 | Bacteria | 1757 |
| 232 | Ga0070695_100435331 | 3300005545 | Bacteria | 1001 |
| 233 | Ga0070695_100807726 | 3300005545 | Unclassified | 752 |
| 234 | Ga0070695_101374781 | 3300005545 | Unclassified | 585 |
| 235 | Ga0070696_100839457 | 3300005546 | Unclassified | 758 |
| 236 | Ga0070696_101454499 | 3300005546 | Unclassified | 585 |
| 237 | Ga0070693_100005135 | 3300005547 | Bacteria | 6258 |
| 238 | Ga0070693_100075265 | 3300005547 | Bacteria | 1999 |
| 239 | Ga0070693_100796221 | 3300005547 | Unclassified | 700 |
| 240 | Ga0070665_100037624 | 3300005548 | Bacteria | 4865 |
| 241 | Ga0070665_101075344 | 3300005548 | Unclassified | 816 |
| 242 | Ga0070704_100356211 | 3300005549 | Bacteria | 1237 |
| 243 | Ga0068855_100032541 | 3300005563 | Bacteria | 6225 |
| 244 | Ga0068855_100387911 | 3300005563 | Bacteria | 1533 |
| 245 | Ga0068855_100465412 | 3300005563 | Bacteria | 1378 |
| 246 | Ga0068855_100506230 | 3300005563 | Bacteria | 1312 |
| 247 | Ga0068855_101466254 | 3300005563 | Bacteria | 701 |
| 248 | Ga0068855_101943146 | 3300005563 | Unclassified | 595 |
| 249 | Ga0068855_102205845 | 3300005563 | Bacteria | 553 |
| 250 | Ga0070664_100013454 | 3300005564 | Bacteria | 6663 |
| 251 | Ga0070664_100022059 | 3300005564 | Bacteria | 5251 |
| 252 | Ga0070664_100036314 | 3300005564 | Unclassified | 4139 |
| 253 | Ga0070664_100051576 | 3300005564 | Bacteria | 3483 |
| 254 | Ga0068857_100002380 | 3300005577 | Bacteria | 15336 |
| 255 | Ga0068857_100013016 | 3300005577 | Bacteria | 7247 |
| 256 | Ga0068857_100013979 | 3300005577 | Bacteria | 6984 |
| 257 | Ga0068857_100073744 | 3300005577 | Bacteria | 3041 |
| 258 | Ga0068854_100043117 | 3300005578 | Bacteria | 3196 |
| 259 | Ga0068854_100201395 | 3300005578 | Bacteria | 1565 |
| 260 | Ga0068854_101728309 | 3300005578 | Unclassified | 572 |
| 261 | Ga0068856_100021919 | 3300005614 | Bacteria | 6210 |
| 262 | Ga0068856_100021938 | 3300005614 | Bacteria | 6207 |
| 263 | Ga0068856_100058845 | 3300005614 | Bacteria | 3795 |
| 264 | Ga0068856_100153522 | 3300005614 | Bacteria | 2312 |
| 265 | Ga0068856_100352814 | 3300005614 | Bacteria | 1489 |
| 266 | Ga0068856_100520535 | 3300005614 | Unclassified | 1211 |
| 267 | Ga0068856_100863069 | 3300005614 | Bacteria | 924 |
| 268 | Ga0068856_101009002 | 3300005614 | Bacteria | 850 |
| 269 | Ga0070702_100006042 | 3300005615 | Bacteria | 5701 |
| 270 | Ga0068852_100032868 | 3300005616 | Bacteria | 4301 |
| 271 | Ga0068852_100078245 | 3300005616 | Bacteria | 2925 |
| 272 | Ga0068852_100677121 | 3300005616 | Unclassified | 1040 |
| 273 | Ga0068852_100809791 | 3300005616 | Bacteria | 951 |
| 274 | Ga0068859_100025899 | 3300005617 | Bacteria | 5885 |
| 275 | Ga0068859_100073730 | 3300005617 | Bacteria | 3451 |
| 276 | Ga0068864_100037453 | 3300005618 | Unclassified | 4139 |
| 277 | Ga0068864_100069690 | 3300005618 | Bacteria | 3058 |
| 278 | Ga0068864_100493687 | 3300005618 | Unclassified | 1177 |
| 279 | Ga0068864_100684779 | 3300005618 | Bacteria | 1000 |
| 280 | Ga0068866_10004505 | 3300005718 | Bacteria | 5712 |
| 281 | Ga0068866_10007468 | 3300005718 | Bacteria | 4576 |
| 282 | Ga0068866_10023640 | 3300005718 | Bacteria | 2862 |
| 283 | Ga0068866_10031206 | 3300005718 | Bacteria | 2564 |
| 284 | Ga0068861_100019608 | 3300005719 | Bacteria | 4831 |
| 285 | Ga0068861_100074064 | 3300005719 | Bacteria | 2647 |
| 286 | Ga0068861_100135871 | 3300005719 | Bacteria | 2001 |
| 287 | Ga0068861_100186116 | 3300005719 | Bacteria | 1732 |
| 288 | Ga0068861_101698060 | 3300005719 | Bacteria | 624 |
| 289 | Ga0068851_10007219 | 3300005834 | Bacteria | 5094 |
| 290 | Ga0068851_10011989 | 3300005834 | Bacteria | 4078 |
| 291 | Ga0068851_10022275 | 3300005834 | Bacteria | 3084 |
| 292 | Ga0068851_10837583 | 3300005834 | Bacteria | 573 |
| 293 | Ga0068870_10002475 | 3300005840 | Bacteria | 7699 |
| 294 | Ga0068870_10002878 | 3300005840 | Bacteria | 7245 |
| 295 | Ga0068863_100119550 | 3300005841 | Bacteria | 2511 |
| 296 | Ga0068863_100201980 | 3300005841 | Bacteria | 1912 |
| 297 | Ga0068863_100303576 | 3300005841 | Bacteria | 1549 |
| 298 | Ga0068863_100318074 | 3300005841 | Bacteria | 1511 |
| 299 | Ga0068863_100397644 | 3300005841 | Unclassified | 1347 |
| 300 | Ga0068863_100469396 | 3300005841 | Bacteria | 1237 |
| 301 | Ga0068863_100665046 | 3300005841 | Bacteria | 1034 |
| 302 | Ga0068863_101265697 | 3300005841 | Bacteria | 744 |
| 303 | Ga0068858_100014959 | 3300005842 | Bacteria | 7302 |
| 304 | Ga0068858_100061406 | 3300005842 | Bacteria | 3474 |
| 305 | Ga0068858_100126934 | 3300005842 | Bacteria | 2389 |
| 306 | Ga0068858_100442190 | 3300005842 | Bacteria | 1252 |
| 307 | Ga0068858_100769734 | 3300005842 | Unclassified | 938 |
| 308 | Ga0068860_100071702 | 3300005843 | Unclassified | 3291 |
| 309 | Ga0068860_100217761 | 3300005843 | Bacteria | 1853 |
| 310 | Ga0068860_101358827 | 3300005843 | Unclassified | 731 |
| 311 | Ga0068862_100043081 | 3300005844 | Bacteria | 3847 |
| 312 | Ga0068862_100055718 | 3300005844 | Bacteria | 3386 |
| 313 | Ga0068862_100122658 | 3300005844 | Bacteria | 2292 |
| 314 | Ga0068862_100282940 | 3300005844 | Bacteria | 1520 |
| 315 | Ga0068862_100586566 | 3300005844 | Bacteria | 1068 |
| 316 | Ga0081540_1089621 | 3300005983 | Bacteria | 1356 |
| 317 | Ga0070717_10005410 | 3300006028 | Bacteria | 9323 |
| 318 | Ga0070717_10008160 | 3300006028 | Bacteria | 7815 |
| 319 | Ga0070717_10015550 | 3300006028 | Bacteria | 5883 |
| 320 | Ga0070717_10018988 | 3300006028 | Bacteria | 5382 |
| 321 | Ga0070717_10049413 | 3300006028 | Bacteria | 3453 |
| 322 | Ga0070717_10126440 | 3300006028 | Unclassified | 2195 |
| 323 | Ga0070717_10202594 | 3300006028 | Unclassified | 1739 |
| 324 | Ga0070717_10252492 | 3300006028 | Unclassified | 1558 |
| 325 | Ga0070717_10256684 | 3300006028 | Bacteria | 1546 |
| 326 | Ga0070717_10274719 | 3300006028 | Bacteria | 1493 |
| 327 | Ga0070717_10292912 | 3300006028 | Bacteria | 1445 |
| 328 | Ga0070717_10407774 | 3300006028 | Unclassified | 1222 |
| 329 | Ga0070717_10512947 | 3300006028 | Bacteria | 1084 |
| 330 | Ga0070717_10602429 | 3300006028 | Unclassified | 997 |
| 331 | Ga0070717_10642638 | 3300006028 | Unclassified | 963 |
| 332 | Ga0070715_10082566 | 3300006163 | Unclassified | 1462 |
| 333 | Ga0070715_10200563 | 3300006163 | Bacteria | 1013 |
| 334 | Ga0070715_10590648 | 3300006163 | Unclassified | 649 |
| 335 | Ga0070715_10622509 | 3300006163 | Unclassified | 635 |
| 336 | Ga0070716_100022901 | 3300006173 | Bacteria | 3306 |
| 337 | Ga0070716_100089545 | 3300006173 | Bacteria | 1859 |
| 338 | Ga0070716_100201548 | 3300006173 | Bacteria | 1323 |
| 339 | Ga0070716_100308188 | 3300006173 | Bacteria | 1104 |
| 340 | Ga0070716_100648630 | 3300006173 | Unclassified | 800 |
| 341 | Ga0070716_100973581 | 3300006173 | Unclassified | 669 |
| 342 | Ga0070716_101399414 | 3300006173 | Bacteria | 569 |
| 343 | Ga0070712_100004583 | 3300006175 | Bacteria | 8534 |
| 344 | Ga0070712_100006417 | 3300006175 | Bacteria | 7296 |
| 345 | Ga0070712_100105507 | 3300006175 | Bacteria | 2093 |
| 346 | Ga0070712_100316874 | 3300006175 | Bacteria | 1267 |
| 347 | Ga0070712_101110337 | 3300006175 | Unclassified | 686 |
| 348 | Ga0097621_100011169 | 3300006237 | Bacteria | 6610 |
| 349 | Ga0097621_100086269 | 3300006237 | Bacteria | 2619 |
| 350 | Ga0097621_100115313 | 3300006237 | Bacteria | 2273 |
| 351 | Ga0097621_100169449 | 3300006237 | Bacteria | 1881 |
| 352 | Ga0097621_100794345 | 3300006237 | Bacteria | 877 |
| 353 | Ga0097621_101208044 | 3300006237 | Bacteria | 712 |
| 354 | Ga0068871_100165757 | 3300006358 | Bacteria | 1891 |
| 355 | Ga0068871_100347285 | 3300006358 | Bacteria | 1311 |
| 356 | Ga0068871_100442527 | 3300006358 | Bacteria | 1164 |
| 357 | Ga0068871_100801335 | 3300006358 | Unclassified | 868 |
| 358 | Ga0075433_10007525 | 3300006852 | Bacteria | 8642 |
| 359 | Ga0075433_10131909 | 3300006852 | Unclassified | 2220 |
| 360 | Ga0075434_100000048 | 3300006871 | Bacteria | 57433 |
| 361 | Ga0075434_100001909 | 3300006871 | Bacteria | 18051 |
| 362 | Ga0075434_100003171 | 3300006871 | Bacteria | 14661 |
| 363 | Ga0075434_100028077 | 3300006871 | Bacteria | 5526 |
| 364 | Ga0075434_100094016 | 3300006871 | Bacteria | 3002 |
| 365 | Ga0075434_101812381 | 3300006871 | Unclassified | 617 |
| 366 | Ga0068865_100007139 | 3300006881 | Bacteria | 6858 |
| 367 | Ga0068865_100153359 | 3300006881 | Bacteria | 1750 |
| 368 | Ga0068865_100486466 | 3300006881 | Bacteria | 1027 |
| 369 | Ga0068865_100750894 | 3300006881 | Unclassified | 838 |
| 370 | Ga0075436_100027931 | 3300006914 | Unclassified | 3885 |
| 371 | Ga0075436_100100862 | 3300006914 | Bacteria | 2010 |
| 372 | Ga0075436_100683715 | 3300006914 | Unclassified | 759 |
| 373 | Ga0075436_100694230 | 3300006914 | Bacteria | 754 |
| 374 | Ga0097620_100025895 | 3300006931 | Bacteria | 5885 |
| 375 | Ga0097620_100073728 | 3300006931 | Bacteria | 3451 |
| 376 | Ga0075435_100000099 | 3300007076 | Bacteria | 46122 |
| 377 | Ga0075435_100000106 | 3300007076 | Bacteria | 45698 |
| 378 | Ga0075435_100003178 | 3300007076 | Bacteria | 11110 |
| 379 | Ga0075435_100006230 | 3300007076 | Bacteria | 8420 |
| 380 | Ga0075435_100110914 | 3300007076 | Bacteria | 2282 |
| 381 | Ga0075435_100325312 | 3300007076 | Bacteria | 1316 |
| 382 | Ga0075435_100371204 | 3300007076 | Unclassified | 1228 |
| 383 | Ga0099794_10079038 | 3300007265 | Unclassified | 1620 |
| 384 | Ga0099795_10141760 | 3300007788 | Unclassified | 978 |
| 385 | Ga0105251_10054550 | 3300009011 | Bacteria | 1898 |
| 386 | Ga0105251_10203059 | 3300009011 | Bacteria | 893 |
| 387 | Ga0105251_10276160 | 3300009011 | Unclassified | 759 |
| 388 | Ga0105251_10593960 | 3300009011 | Unclassified | 525 |
| 389 | Ga0105244_10423788 | 3300009036 | Unclassified | 612 |
| 390 | Ga0105250_10018252 | 3300009092 | Bacteria | 2845 |
| 391 | Ga0105250_10329089 | 3300009092 | Unclassified | 665 |
| 392 | Ga0105240_10035974 | 3300009093 | Bacteria | 6375 |
| 393 | Ga0105240_10046636 | 3300009093 | Bacteria | 5490 |
| 394 | Ga0105240_10139076 | 3300009093 | Bacteria | 2905 |
| 395 | Ga0105240_11263870 | 3300009093 | Unclassified | 780 |
| 396 | Ga0105240_12753305 | 3300009093 | Bacteria | 506 |
| 397 | Ga0111539_10593179 | 3300009094 | Unclassified | 1290 |
| 398 | Ga0105245_10015098 | 3300009098 | Bacteria | 6728 |
| 399 | Ga0105245_10015410 | 3300009098 | Bacteria | 6664 |
| 400 | Ga0105245_10026784 | 3300009098 | Bacteria | 5076 |
| 401 | Ga0105245_10030316 | 3300009098 | Bacteria | 4782 |
| 402 | Ga0105245_10108448 | 3300009098 | Bacteria | 2579 |
| 403 | Ga0105245_10122668 | 3300009098 | Bacteria | 2429 |
| 404 | Ga0105247_10002828 | 3300009101 | Bacteria | 11585 |
| 405 | Ga0105247_10004431 | 3300009101 | Bacteria | 8965 |
| 406 | Ga0105247_10045138 | 3300009101 | Bacteria | 2704 |
| 407 | Ga0105247_10697705 | 3300009101 | Unclassified | 764 |
| 408 | Ga0114129_10268502 | 3300009147 | Bacteria | 2283 |
| 409 | Ga0114129_10312113 | 3300009147 | Bacteria | 2093 |
| 410 | Ga0114129_11198715 | 3300009147 | Unclassified | 946 |
| 411 | Ga0105243_10009988 | 3300009148 | Bacteria | 7214 |
| 412 | Ga0105241_10014848 | 3300009174 | Bacteria | 5702 |
| 413 | Ga0105241_10017386 | 3300009174 | Bacteria | 5284 |
| 414 | Ga0105241_10168250 | 3300009174 | Bacteria | 1808 |
| 415 | Ga0105241_10689701 | 3300009174 | Bacteria | 931 |
| 416 | Ga0105241_10853936 | 3300009174 | Unclassified | 842 |
| 417 | Ga0105241_10961504 | 3300009174 | Bacteria | 797 |
| 418 | Ga0105241_11399605 | 3300009174 | Unclassified | 670 |
| 419 | Ga0105242_10012199 | 3300009176 | Bacteria | 6613 |
| 420 | Ga0105242_10110710 | 3300009176 | Bacteria | 2340 |
| 421 | Ga0105242_10701783 | 3300009176 | Unclassified | 990 |
| 422 | Ga0105248_10006559 | 3300009177 | Bacteria | 12763 |
| 423 | Ga0105248_10028881 | 3300009177 | Bacteria | 6183 |
| 424 | Ga0105248_10330414 | 3300009177 | Bacteria | 1717 |
| 425 | Ga0105248_11234907 | 3300009177 | Unclassified | 845 |
| 426 | Ga0105248_11352422 | 3300009177 | Unclassified | 806 |
| 427 | Ga0105248_12297841 | 3300009177 | Unclassified | 614 |
| 428 | Ga0105237_10134690 | 3300009545 | Bacteria | 2465 |
| 429 | Ga0105237_10356043 | 3300009545 | Bacteria | 1468 |
| 430 | Ga0105237_10622161 | 3300009545 | Bacteria | 1087 |
| 431 | Ga0105237_10678371 | 3300009545 | Bacteria | 1037 |
| 432 | Ga0105237_10720899 | 3300009545 | Unclassified | 1004 |
| 433 | Ga0105237_11492318 | 3300009545 | Bacteria | 683 |
| 434 | Ga0105237_12612098 | 3300009545 | Unclassified | 516 |
| 435 | Ga0105238_10031520 | 3300009551 | Bacteria | 5397 |
| 436 | Ga0105238_10098225 | 3300009551 | Bacteria | 2912 |
| 437 | Ga0105238_10158798 | 3300009551 | Bacteria | 2237 |
| 438 | Ga0105238_10917959 | 3300009551 | Bacteria | 894 |
| 439 | Ga0105249_10016767 | 3300009553 | Bacteria | 6500 |
| 440 | Ga0105249_10059002 | 3300009553 | Bacteria | 3518 |
| 441 | Ga0105249_10208517 | 3300009553 | Bacteria | 1916 |
| 442 | Ga0105249_12744319 | 3300009553 | Unclassified | 564 |
| 443 | Ga0099796_10042656 | 3300010159 | Bacteria | 1542 |
| 444 | Ga0099796_10136852 | 3300010159 | Unclassified | 954 |
| 445 | Ga0105239_10136413 | 3300010375 | Bacteria | 2732 |
| 446 | Ga0105239_10225827 | 3300010375 | Bacteria | 2101 |
| 447 | Ga0105246_10001108 | 3300011119 | Bacteria | 15655 |
| 448 | Ga0105246_10003080 | 3300011119 | Bacteria | 10130 |
| 449 | Ga0105246_10111088 | 3300011119 | Bacteria | 2014 |
| 450 | Ga0105246_10202563 | 3300011119 | Unclassified | 1544 |
| 451 | Ga0105246_11297933 | 3300011119 | Unclassified | 674 |
| 452 | Ga0157337_1024014 | 3300012483 | Bacteria | 583 |
| 453 | Ga0157324_1052301 | 3300012506 | Unclassified | 535 |
| 454 | Ga0157338_1048671 | 3300012515 | Unclassified | 601 |
| 455 | Ga0157373_10004129 | 3300013100 | Bacteria | 10951 |
| 456 | Ga0157373_10026008 | 3300013100 | Bacteria | 4229 |
| 457 | Ga0157373_10050892 | 3300013100 | Bacteria | 2950 |
| 458 | Ga0157373_10088558 | 3300013100 | Bacteria | 2181 |
| 459 | Ga0157373_10987668 | 3300013100 | Unclassified | 628 |
| 460 | Ga0157373_11010742 | 3300013100 | Unclassified | 621 |
| 461 | Ga0157373_11387661 | 3300013100 | Unclassified | 534 |
| 462 | Ga0157371_10010554 | 3300013102 | Bacteria | 7178 |
| 463 | Ga0157371_10020957 | 3300013102 | Bacteria | 4807 |
| 464 | Ga0157370_10072937 | 3300013104 | Bacteria | 3239 |
| 465 | Ga0157369_10008057 | 3300013105 | Bacteria | 12082 |
| 466 | Ga0157369_10035817 | 3300013105 | Bacteria | 5441 |
| 467 | Ga0157369_10038849 | 3300013105 | Bacteria | 5203 |
| 468 | Ga0157369_10084157 | 3300013105 | Bacteria | 3400 |
| 469 | Ga0157369_10795554 | 3300013105 | Bacteria | 972 |
| 470 | Ga0157369_11234182 | 3300013105 | Unclassified | 763 |
| 471 | Ga0157374_10014161 | 3300013296 | Bacteria | 6973 |
| 472 | Ga0157374_10015015 | 3300013296 | Bacteria | 6789 |
| 473 | Ga0157374_10244265 | 3300013296 | Bacteria | 1766 |
| 474 | Ga0157374_11129105 | 3300013296 | Unclassified | 804 |
| 475 | Ga0157374_11429916 | 3300013296 | Unclassified | 714 |
| 476 | Ga0157374_12361144 | 3300013296 | Unclassified | 559 |
| 477 | Ga0157378_10024382 | 3300013297 | Bacteria | 5322 |
| 478 | Ga0157378_10122165 | 3300013297 | Bacteria | 2402 |
| 479 | Ga0157378_10341439 | 3300013297 | Bacteria | 1460 |
| 480 | Ga0157378_11007762 | 3300013297 | Unclassified | 867 |
| 481 | Ga0157378_11091496 | 3300013297 | Bacteria | 835 |
| 482 | Ga0157378_13058757 | 3300013297 | Bacteria | 519 |
| 483 | Ga0163162_10004362 | 3300013306 | Bacteria | 13618 |
| 484 | Ga0163162_10006695 | 3300013306 | Bacteria | 11170 |
| 485 | Ga0163162_11530724 | 3300013306 | Unclassified | 760 |
| 486 | Ga0163162_12839681 | 3300013306 | Unclassified | 557 |
| 487 | Ga0163162_13221804 | 3300013306 | Unclassified | 524 |
| 488 | Ga0157372_10015052 | 3300013307 | Bacteria | 8280 |
| 489 | Ga0157372_10045544 | 3300013307 | Bacteria | 4867 |
| 490 | Ga0157372_10089561 | 3300013307 | Bacteria | 3496 |
| 491 | Ga0157372_10130131 | 3300013307 | Bacteria | 2895 |
| 492 | Ga0157372_10244329 | 3300013307 | Bacteria | 2083 |
| 493 | Ga0157372_10660939 | 3300013307 | Bacteria | 1217 |
| 494 | Ga0157372_12725501 | 3300013307 | Unclassified | 567 |
| 495 | Ga0157375_10039554 | 3300013308 | Bacteria | 4540 |
| 496 | Ga0163163_10007365 | 3300014325 | Bacteria | 9710 |
| 497 | Ga0163163_10015229 | 3300014325 | Bacteria | 7104 |
| 498 | Ga0163163_10015812 | 3300014325 | Bacteria | 6990 |
| 499 | Ga0163163_10144020 | 3300014325 | Bacteria | 2426 |
| 500 | Ga0163163_10156015 | 3300014325 | Bacteria | 2327 |
| 501 | Ga0163163_10337086 | 3300014325 | Bacteria | 1563 |
| 502 | Ga0163163_11771196 | 3300014325 | Unclassified | 678 |
| 503 | Ga0163163_11803774 | 3300014325 | Bacteria | 672 |
| 504 | Ga0157380_10016063 | 3300014326 | Bacteria | 5514 |
| 505 | Ga0157380_10071080 | 3300014326 | Bacteria | 2814 |
| 506 | Ga0157380_13010819 | 3300014326 | Bacteria | 537 |
| 507 | Ga0182008_10296973 | 3300014497 | Unclassified | 844 |
| 508 | Ga0182008_10350676 | 3300014497 | Unclassified | 783 |
| 509 | Ga0157377_10002535 | 3300014745 | Bacteria | 8100 |
| 510 | Ga0157377_10005156 | 3300014745 | Bacteria | 6110 |
| 511 | Ga0157377_10238479 | 3300014745 | Bacteria | 1173 |
| 512 | Ga0157377_10258309 | 3300014745 | Unclassified | 1132 |
| 513 | Ga0157377_10436923 | 3300014745 | Bacteria | 900 |
| 514 | Ga0157379_10063952 | 3300014968 | Bacteria | 3289 |
| 515 | Ga0157379_10132114 | 3300014968 | Bacteria | 2247 |
| 516 | Ga0157379_10224046 | 3300014968 | Bacteria | 1704 |
| 517 | Ga0157379_10604696 | 3300014968 | Bacteria | 1024 |
| 518 | Ga0157379_10813265 | 3300014968 | Bacteria | 883 |
| 519 | Ga0157379_11499355 | 3300014968 | Unclassified | 656 |
| 520 | Ga0157376_10065246 | 3300014969 | Bacteria | 3073 |
| 521 | Ga0157376_10165949 | 3300014969 | Bacteria | 2006 |
| 522 | Ga0157376_10309786 | 3300014969 | Bacteria | 1497 |
| 523 | Ga0157376_10341542 | 3300014969 | Bacteria | 1430 |
| 524 | Ga0157376_10735834 | 3300014969 | Bacteria | 994 |
| 525 | Ga0157376_10878707 | 3300014969 | Unclassified | 913 |
| 526 | Ga0157376_10990634 | 3300014969 | Unclassified | 863 |
| 527 | Ga0157376_11739853 | 3300014969 | Unclassified | 659 |
| 528 | Ga0157376_12270490 | 3300014969 | Bacteria | 582 |
| 529 | Ga0182006_1052663 | 3300015261 | Bacteria | 1563 |
| 530 | Ga0182007_10009668 | 3300015262 | Bacteria | 3869 |
| 531 | Ga0182007_10019936 | 3300015262 | Bacteria | 2402 |
| 532 | Ga0182007_10069677 | 3300015262 | Bacteria | 1152 |
| 533 | Ga0182005_1034728 | 3300015265 | Unclassified | 1371 |
| 534 | Ga0182005_1172553 | 3300015265 | Unclassified | 639 |
| 535 | Ga0182005_1291805 | 3300015265 | Unclassified | 513 |
| 536 | Ga0163161_10014659 | 3300017792 | Bacteria | 5458 |
| 537 | Ga0163161_10108832 | 3300017792 | Bacteria | 2070 |
| 538 | Ga0163161_11313776 | 3300017792 | Unclassified | 629 |
| 539 | Ga0184596_113244 | 3300019176 | Unclassified | 1172 |
| 540 | Ga0184599_148826 | 3300019188 | Unclassified | 565 |
| 541 | Ga0184600_134185 | 3300019190 | Unclassified | 674 |
| 542 | Ga0184603_144311 | 3300019192 | Unclassified | 517 |
| 543 | Ga0206349_1642661 | 3300020075 | Bacteria | 618 |
| 544 | Ga0224712_10639171 | 3300022467 | Unclassified | 521 |
| 545 | Ga0224570_102594 | 3300022730 | Unclassified | 1197 |
| 546 | Ga0224569_105555 | 3300022732 | Unclassified | 934 |
| 547 | Ga0247554_104626 | 3300023547 | Unclassified | 568 |
| 548 | Ga0247553_103521 | 3300023672 | Unclassified | 767 |
| 549 | Ga0228598_1002673 | 3300024227 | Viruses | 3864 |
| 550 | Ga0207672_1003895 | 3300025223 | Bacteria | 848 |
| 551 | Ga0207697_10003226 | 3300025315 | Bacteria | 8108 |
| 552 | Ga0207697_10007278 | 3300025315 | Unclassified | 4943 |
| 553 | Ga0207697_10022438 | 3300025315 | Bacteria | 2586 |
| 554 | Ga0207656_10009919 | 3300025321 | Bacteria | 3547 |
| 555 | Ga0207656_10010807 | 3300025321 | Bacteria | 3432 |
| 556 | Ga0207656_10111314 | 3300025321 | Bacteria | 1265 |
| 557 | Ga0207656_10578714 | 3300025321 | Bacteria | 573 |
| 558 | Ga0207696_1158425 | 3300025711 | Unclassified | 603 |
| 559 | Ga0207682_10004561 | 3300025893 | Bacteria | 5771 |
| 560 | Ga0207682_10019273 | 3300025893 | Bacteria | 2671 |
| 561 | Ga0207682_10024315 | 3300025893 | Bacteria | 2398 |
| 562 | Ga0207692_10025672 | 3300025898 | Unclassified | 2756 |
| 563 | Ga0207692_10055169 | 3300025898 | Bacteria | 2033 |
| 564 | Ga0207692_10094958 | 3300025898 | Bacteria | 1625 |
| 565 | Ga0207692_10101836 | 3300025898 | Bacteria | 1578 |
| 566 | Ga0207692_10101862 | 3300025898 | Unclassified | 1578 |
| 567 | Ga0207692_10297210 | 3300025898 | Unclassified | 982 |
| 568 | Ga0207692_11114167 | 3300025898 | Unclassified | 523 |
| 569 | Ga0207642_10083209 | 3300025899 | Bacteria | 1560 |
| 570 | Ga0207642_10250795 | 3300025899 | Bacteria | 1004 |
| 571 | Ga0207642_10564692 | 3300025899 | Unclassified | 704 |
| 572 | Ga0207642_10812169 | 3300025899 | Bacteria | 595 |
| 573 | Ga0207710_10025729 | 3300025900 | Bacteria | 2541 |
| 574 | Ga0207710_10048051 | 3300025900 | Bacteria | 1909 |
| 575 | Ga0207710_10201696 | 3300025900 | Bacteria | 983 |
| 576 | Ga0207710_10404818 | 3300025900 | Unclassified | 701 |
| 577 | Ga0207710_10649455 | 3300025900 | Unclassified | 552 |
| 578 | Ga0207688_10008709 | 3300025901 | Bacteria | 5523 |
| 579 | Ga0207688_10011106 | 3300025901 | Bacteria | 4900 |
| 580 | Ga0207688_10139009 | 3300025901 | Bacteria | 1429 |
| 581 | Ga0207680_10028726 | 3300025903 | Bacteria | 3115 |
| 582 | Ga0207680_10097295 | 3300025903 | Bacteria | 1884 |
| 583 | Ga0207680_10099185 | 3300025903 | Bacteria | 1868 |
| 584 | Ga0207680_10343947 | 3300025903 | Bacteria | 1047 |
| 585 | Ga0207680_10676766 | 3300025903 | Bacteria | 739 |
| 586 | Ga0207647_10002670 | 3300025904 | Bacteria | 13467 |
| 587 | Ga0207647_10009519 | 3300025904 | Bacteria | 6900 |
| 588 | Ga0207647_10020873 | 3300025904 | Bacteria | 4384 |
| 589 | Ga0207647_10023842 | 3300025904 | Bacteria | 4041 |
| 590 | Ga0207647_10037809 | 3300025904 | Bacteria | 3057 |
| 591 | Ga0207685_10086675 | 3300025905 | Bacteria | 1309 |
| 592 | Ga0207685_10416427 | 3300025905 | Bacteria | 692 |
| 593 | Ga0207699_10050009 | 3300025906 | Bacteria | 2463 |
| 594 | Ga0207699_10546206 | 3300025906 | Unclassified | 840 |
| 595 | Ga0207699_10648359 | 3300025906 | Unclassified | 771 |
| 596 | Ga0207699_10764275 | 3300025906 | Bacteria | 709 |
| 597 | Ga0207645_10001236 | 3300025907 | Bacteria | 21017 |
| 598 | Ga0207645_10006872 | 3300025907 | Bacteria | 8119 |
| 599 | Ga0207645_10037732 | 3300025907 | Bacteria | 3100 |
| 600 | Ga0207643_10000367 | 3300025908 | Bacteria | 30268 |
| 601 | Ga0207643_10000887 | 3300025908 | Bacteria | 18020 |
| 602 | Ga0207643_10003601 | 3300025908 | Bacteria | 8345 |
| 603 | Ga0207643_10021889 | 3300025908 | Unclassified | 3517 |
| 604 | Ga0207705_10331317 | 3300025909 | Unclassified | 1171 |
| 605 | Ga0207705_10359944 | 3300025909 | Bacteria | 1122 |
| 606 | Ga0207684_10000260 | 3300025910 | Bacteria | 78456 |
| 607 | Ga0207684_10001132 | 3300025910 | Bacteria | 29813 |
| 608 | Ga0207684_10099671 | 3300025910 | Bacteria | 2482 |
| 609 | Ga0207684_10132461 | 3300025910 | Viruses | 2140 |
| 610 | Ga0207684_10236333 | 3300025910 | Bacteria | 1576 |
| 611 | Ga0207684_11490460 | 3300025910 | Unclassified | 551 |
| 612 | Ga0207654_10021430 | 3300025911 | Bacteria | 3437 |
| 613 | Ga0207654_10230194 | 3300025911 | Bacteria | 1234 |
| 614 | Ga0207654_10390242 | 3300025911 | Unclassified | 966 |
| 615 | Ga0207654_10423000 | 3300025911 | Bacteria | 930 |
| 616 | Ga0207654_10551548 | 3300025911 | Unclassified | 819 |
| 617 | Ga0207654_10579852 | 3300025911 | Unclassified | 799 |
| 618 | Ga0207707_10006647 | 3300025912 | Bacteria | 10085 |
| 619 | Ga0207707_10014533 | 3300025912 | Bacteria | 6856 |
| 620 | Ga0207707_10159574 | 3300025912 | Bacteria | 1972 |
| 621 | Ga0207707_10322296 | 3300025912 | Bacteria | 1334 |
| 622 | Ga0207707_10838628 | 3300025912 | Bacteria | 763 |
| 623 | Ga0207707_11531381 | 3300025912 | Unclassified | 527 |
| 624 | Ga0207695_10023396 | 3300025913 | Bacteria | 6981 |
| 625 | Ga0207695_10087884 | 3300025913 | Bacteria | 3130 |
| 626 | Ga0207695_10160952 | 3300025913 | Bacteria | 2176 |
| 627 | Ga0207695_10247425 | 3300025913 | Bacteria | 1683 |
| 628 | Ga0207671_10063611 | 3300025914 | Bacteria | 2742 |
| 629 | Ga0207671_10181635 | 3300025914 | Bacteria | 1637 |
| 630 | Ga0207671_10183699 | 3300025914 | Bacteria | 1628 |
| 631 | Ga0207671_10488047 | 3300025914 | Unclassified | 982 |
| 632 | Ga0207671_11082203 | 3300025914 | Unclassified | 630 |
| 633 | Ga0207693_10002214 | 3300025915 | Bacteria | 16949 |
| 634 | Ga0207693_10030377 | 3300025915 | Bacteria | 4267 |
| 635 | Ga0207693_10139747 | 3300025915 | Bacteria | 1905 |
| 636 | Ga0207663_10238206 | 3300025916 | Bacteria | 1333 |
| 637 | Ga0207663_10437019 | 3300025916 | Unclassified | 1007 |
| 638 | Ga0207663_10511899 | 3300025916 | Unclassified | 934 |
| 639 | Ga0207663_10879404 | 3300025916 | Bacteria | 716 |
| 640 | Ga0207660_10261285 | 3300025917 | Bacteria | 1369 |
| 641 | Ga0207662_10001892 | 3300025918 | Bacteria | 10317 |
| 642 | Ga0207662_10012475 | 3300025918 | Bacteria | 4733 |
| 643 | Ga0207657_10002208 | 3300025919 | Bacteria | 21110 |
| 644 | Ga0207657_10002438 | 3300025919 | Bacteria | 20083 |
| 645 | Ga0207657_10004803 | 3300025919 | Bacteria | 14251 |
| 646 | Ga0207657_10023076 | 3300025919 | Bacteria | 5802 |
| 647 | Ga0207649_10000259 | 3300025920 | Bacteria | 42071 |
| 648 | Ga0207649_10003191 | 3300025920 | Bacteria | 8987 |
| 649 | Ga0207652_10168148 | 3300025921 | Bacteria | 1967 |
| 650 | Ga0207652_10182009 | 3300025921 | Bacteria | 1889 |
| 651 | Ga0207652_10317302 | 3300025921 | Unclassified | 1407 |
| 652 | Ga0207652_10938819 | 3300025921 | Bacteria | 763 |
| 653 | Ga0207646_10001376 | 3300025922 | Bacteria | 30159 |
| 654 | Ga0207646_10019251 | 3300025922 | Bacteria | 6346 |
| 655 | Ga0207646_10308122 | 3300025922 | Bacteria | 1431 |
| 656 | Ga0207646_10766158 | 3300025922 | Bacteria | 861 |
| 657 | Ga0207646_11041385 | 3300025922 | Bacteria | 722 |
| 658 | Ga0207646_11163975 | 3300025922 | Unclassified | 677 |
| 659 | Ga0207646_11486348 | 3300025922 | Unclassified | 587 |
| 660 | Ga0207646_11576947 | 3300025922 | Unclassified | 567 |
| 661 | Ga0207646_11920307 | 3300025922 | Unclassified | 504 |
| 662 | Ga0207681_10146574 | 3300025923 | Unclassified | 1764 |
| 663 | Ga0207681_10316251 | 3300025923 | Bacteria | 1240 |
| 664 | Ga0207681_10905962 | 3300025923 | Bacteria | 738 |
| 665 | Ga0207694_10119441 | 3300025924 | Bacteria | 2104 |
| 666 | Ga0207694_11355420 | 3300025924 | Bacteria | 601 |
| 667 | Ga0207650_10000042 | 3300025925 | Bacteria | 191592 |
| 668 | Ga0207650_10000058 | 3300025925 | Bacteria | 153056 |
| 669 | Ga0207650_10000107 | 3300025925 | Bacteria | 109863 |
| 670 | Ga0207650_10243969 | 3300025925 | Bacteria | 1452 |
| 671 | Ga0207650_11659033 | 3300025925 | Unclassified | 542 |
| 672 | Ga0207659_10030725 | 3300025926 | Bacteria | 3672 |
| 673 | Ga0207659_10045373 | 3300025926 | Bacteria | 3099 |
| 674 | Ga0207659_10640105 | 3300025926 | Unclassified | 908 |
| 675 | Ga0207687_10020252 | 3300025927 | Bacteria | 4413 |
| 676 | Ga0207687_10105077 | 3300025927 | Bacteria | 2086 |
| 677 | Ga0207687_10149338 | 3300025927 | Bacteria | 1781 |
| 678 | Ga0207687_10237863 | 3300025927 | Unclassified | 1442 |
| 679 | Ga0207700_10012700 | 3300025928 | Bacteria | 5444 |
| 680 | Ga0207700_10968321 | 3300025928 | Unclassified | 762 |
| 681 | Ga0207700_11070096 | 3300025928 | Bacteria | 721 |
| 682 | Ga0207700_11139065 | 3300025928 | Unclassified | 697 |
| 683 | Ga0207700_11309261 | 3300025928 | Bacteria | 645 |
| 684 | Ga0207700_11464392 | 3300025928 | Unclassified | 606 |
| 685 | Ga0207700_11468735 | 3300025928 | Unclassified | 605 |
| 686 | Ga0207664_10066377 | 3300025929 | Bacteria | 2892 |
| 687 | Ga0207664_10147212 | 3300025929 | Bacteria | 1998 |
| 688 | Ga0207664_10540863 | 3300025929 | Bacteria | 1045 |
| 689 | Ga0207664_10630290 | 3300025929 | Unclassified | 963 |
| 690 | Ga0207664_10687553 | 3300025929 | Bacteria | 920 |
| 691 | Ga0207664_10869559 | 3300025929 | Bacteria | 810 |
| 692 | Ga0207664_11217788 | 3300025929 | Bacteria | 671 |
| 693 | Ga0207664_11431686 | 3300025929 | Unclassified | 612 |
| 694 | Ga0207644_10021381 | 3300025931 | Unclassified | 4406 |
| 695 | Ga0207644_10052207 | 3300025931 | Bacteria | 2937 |
| 696 | Ga0207644_10174694 | 3300025931 | Bacteria | 1679 |
| 697 | Ga0207690_10035360 | 3300025932 | Bacteria | 3226 |
| 698 | Ga0207690_10433852 | 3300025932 | Bacteria | 1053 |
| 699 | Ga0207690_10992885 | 3300025932 | Bacteria | 698 |
| 700 | Ga0207706_10000075 | 3300025933 | Bacteria | 102980 |
| 701 | Ga0207706_10002290 | 3300025933 | Bacteria | 18670 |
| 702 | Ga0207706_10009574 | 3300025933 | Bacteria | 8894 |
| 703 | Ga0207686_10214791 | 3300025934 | Bacteria | 1385 |
| 704 | Ga0207686_10449263 | 3300025934 | Unclassified | 991 |
| 705 | Ga0207686_10765790 | 3300025934 | Unclassified | 772 |
| 706 | Ga0207686_11206389 | 3300025934 | Bacteria | 619 |
| 707 | Ga0207670_10011132 | 3300025936 | Bacteria | 5210 |
| 708 | Ga0207670_10034066 | 3300025936 | Bacteria | 3287 |
| 709 | Ga0207670_10082372 | 3300025936 | Bacteria | 2254 |
| 710 | Ga0207670_10124653 | 3300025936 | Bacteria | 1878 |
| 711 | Ga0207669_10086675 | 3300025937 | Bacteria | 2026 |
| 712 | Ga0207669_11167629 | 3300025937 | Bacteria | 651 |
| 713 | Ga0207669_11231130 | 3300025937 | Unclassified | 635 |
| 714 | Ga0207704_10079297 | 3300025938 | Bacteria | 2115 |
| 715 | Ga0207704_10917708 | 3300025938 | Bacteria | 737 |
| 716 | Ga0207704_11548565 | 3300025938 | Unclassified | 569 |
| 717 | Ga0207665_10059235 | 3300025939 | Bacteria | 2591 |
| 718 | Ga0207665_10491189 | 3300025939 | Unclassified | 947 |
| 719 | Ga0207665_10502182 | 3300025939 | Unclassified | 937 |
| 720 | Ga0207665_10792083 | 3300025939 | Unclassified | 749 |
| 721 | Ga0207665_10857340 | 3300025939 | Unclassified | 719 |
| 722 | Ga0207665_10905954 | 3300025939 | Bacteria | 700 |
| 723 | Ga0207665_11332943 | 3300025939 | Unclassified | 572 |
| 724 | Ga0207691_10004777 | 3300025940 | Bacteria | 13103 |
| 725 | Ga0207691_10006982 | 3300025940 | Bacteria | 10894 |
| 726 | Ga0207691_10018448 | 3300025940 | Bacteria | 6612 |
| 727 | Ga0207711_10002811 | 3300025941 | Bacteria | 15301 |
| 728 | Ga0207711_10016527 | 3300025941 | Bacteria | 6129 |
| 729 | Ga0207711_10122381 | 3300025941 | Bacteria | 2324 |
| 730 | Ga0207711_10259016 | 3300025941 | Bacteria | 1598 |
| 731 | Ga0207711_11077253 | 3300025941 | Unclassified | 744 |
| 732 | Ga0207689_10000627 | 3300025942 | Bacteria | 33683 |
| 733 | Ga0207689_10000904 | 3300025942 | Bacteria | 28476 |
| 734 | Ga0207689_10002067 | 3300025942 | Bacteria | 18943 |
| 735 | Ga0207689_10011267 | 3300025942 | Bacteria | 7673 |
| 736 | Ga0207689_10154212 | 3300025942 | Unclassified | 1894 |
| 737 | Ga0207661_10000133 | 3300025944 | Bacteria | 47313 |
| 738 | Ga0207661_10000160 | 3300025944 | Bacteria | 43294 |
| 739 | Ga0207661_10000244 | 3300025944 | Bacteria | 35445 |
| 740 | Ga0207661_10189076 | 3300025944 | Bacteria | 1804 |
| 741 | Ga0207661_12102997 | 3300025944 | Unclassified | 511 |
| 742 | Ga0207679_10000050 | 3300025945 | Bacteria | 112411 |
| 743 | Ga0207679_10000058 | 3300025945 | Bacteria | 101602 |
| 744 | Ga0207679_10000397 | 3300025945 | Bacteria | 31199 |
| 745 | Ga0207679_11390895 | 3300025945 | Unclassified | 644 |
| 746 | Ga0207667_10128201 | 3300025949 | Bacteria | 2613 |
| 747 | Ga0207667_10329054 | 3300025949 | Bacteria | 1560 |
| 748 | Ga0207667_10365371 | 3300025949 | Bacteria | 1471 |
| 749 | Ga0207667_10433180 | 3300025949 | Bacteria | 1337 |
| 750 | Ga0207667_10543212 | 3300025949 | Bacteria | 1176 |
| 751 | Ga0207667_10794418 | 3300025949 | Bacteria | 943 |
| 752 | Ga0207651_10010652 | 3300025960 | Bacteria | 5106 |
| 753 | Ga0207651_10124655 | 3300025960 | Unclassified | 1960 |
| 754 | Ga0207651_11032039 | 3300025960 | Bacteria | 735 |
| 755 | Ga0207712_10038374 | 3300025961 | Bacteria | 3275 |
| 756 | Ga0207712_10091565 | 3300025961 | Bacteria | 2240 |
| 757 | Ga0207712_10386547 | 3300025961 | Bacteria | 1173 |
| 758 | Ga0207712_10799349 | 3300025961 | Bacteria | 829 |
| 759 | Ga0207712_11156665 | 3300025961 | Unclassified | 690 |
| 760 | Ga0207668_10021444 | 3300025972 | Bacteria | 4120 |
| 761 | Ga0207668_10482690 | 3300025972 | Bacteria | 1063 |
| 762 | Ga0207668_10836693 | 3300025972 | Unclassified | 816 |
| 763 | Ga0207640_10041532 | 3300025981 | Bacteria | 2926 |
| 764 | Ga0207640_10651176 | 3300025981 | Unclassified | 898 |
| 765 | Ga0207658_11021342 | 3300025986 | Unclassified | 754 |
| 766 | Ga0207658_11490379 | 3300025986 | Bacteria | 619 |
| 767 | Ga0207658_11711213 | 3300025986 | Unclassified | 574 |
| 768 | Ga0207677_10020732 | 3300026023 | Bacteria | 3998 |
| 769 | Ga0207677_10023502 | 3300026023 | Bacteria | 3810 |
| 770 | Ga0207677_10029215 | 3300026023 | Bacteria | 3499 |
| 771 | Ga0207677_10042122 | 3300026023 | Bacteria | 3025 |
| 772 | Ga0207677_10051751 | 3300026023 | Bacteria | 2786 |
| 773 | Ga0207677_10098912 | 3300026023 | Bacteria | 2141 |
| 774 | Ga0207677_10157819 | 3300026023 | Bacteria | 1759 |
| 775 | Ga0207677_10205009 | 3300026023 | Bacteria | 1570 |
| 776 | Ga0207677_10617298 | 3300026023 | Unclassified | 953 |
| 777 | Ga0207703_10009459 | 3300026035 | Bacteria | 7653 |
| 778 | Ga0207703_10017008 | 3300026035 | Bacteria | 5671 |
| 779 | Ga0207703_10103864 | 3300026035 | Bacteria | 2413 |
| 780 | Ga0207703_10125829 | 3300026035 | Bacteria | 2206 |
| 781 | Ga0207639_10033487 | 3300026041 | Bacteria | 3791 |
| 782 | Ga0207639_10036498 | 3300026041 | Bacteria | 3643 |
| 783 | Ga0207639_10067041 | 3300026041 | Bacteria | 2792 |
| 784 | Ga0207639_10213290 | 3300026041 | Unclassified | 1663 |
| 785 | Ga0207639_11188448 | 3300026041 | Bacteria | 716 |
| 786 | Ga0207639_12043036 | 3300026041 | Unclassified | 534 |
| 787 | Ga0207678_10000023 | 3300026067 | Bacteria | 126241 |
| 788 | Ga0207678_10001363 | 3300026067 | Bacteria | 22522 |
| 789 | Ga0207678_10001554 | 3300026067 | Bacteria | 21069 |
| 790 | Ga0207708_10029850 | 3300026075 | Bacteria | 4134 |
| 791 | Ga0207708_10146115 | 3300026075 | Bacteria | 1858 |
| 792 | Ga0207708_10717588 | 3300026075 | Bacteria | 856 |
| 793 | Ga0207702_10019523 | 3300026078 | Bacteria | 5608 |
| 794 | Ga0207702_10020646 | 3300026078 | Bacteria | 5452 |
| 795 | Ga0207702_10022284 | 3300026078 | Bacteria | 5250 |
| 796 | Ga0207702_10208875 | 3300026078 | Bacteria | 1814 |
| 797 | Ga0207702_10265413 | 3300026078 | Unclassified | 1618 |
| 798 | Ga0207702_10574617 | 3300026078 | Bacteria | 1104 |
| 799 | Ga0207702_10996337 | 3300026078 | Unclassified | 831 |
| 800 | Ga0207641_10000059 | 3300026088 | Bacteria | 164728 |
| 801 | Ga0207641_10000141 | 3300026088 | Bacteria | 104338 |
| 802 | Ga0207641_10000163 | 3300026088 | Bacteria | 94033 |
| 803 | Ga0207641_10121764 | 3300026088 | Bacteria | 2329 |
| 804 | Ga0207641_10202643 | 3300026088 | Bacteria | 1830 |
| 805 | Ga0207641_10276971 | 3300026088 | Bacteria | 1576 |
| 806 | Ga0207641_10399553 | 3300026088 | Bacteria | 1319 |
| 807 | Ga0207641_11086426 | 3300026088 | Bacteria | 798 |
| 808 | Ga0207641_12144820 | 3300026088 | Unclassified | 559 |
| 809 | Ga0207641_12192647 | 3300026088 | Unclassified | 553 |
| 810 | Ga0207648_10001268 | 3300026089 | Bacteria | 28177 |
| 811 | Ga0207648_10002964 | 3300026089 | Bacteria | 17943 |
| 812 | Ga0207648_10076495 | 3300026089 | Bacteria | 2918 |
| 813 | Ga0207648_10149432 | 3300026089 | Bacteria | 2061 |
| 814 | Ga0207648_10562381 | 3300026089 | Bacteria | 1048 |
| 815 | Ga0207676_10000534 | 3300026095 | Bacteria | 31940 |
| 816 | Ga0207676_10001918 | 3300026095 | Bacteria | 15191 |
| 817 | Ga0207676_10006470 | 3300026095 | Bacteria | 8274 |
| 818 | Ga0207676_10934084 | 3300026095 | Unclassified | 852 |
| 819 | Ga0207676_11903265 | 3300026095 | Bacteria | 593 |
| 820 | Ga0207674_10000708 | 3300026116 | Bacteria | 43511 |
| 821 | Ga0207674_10001553 | 3300026116 | Bacteria | 29587 |
| 822 | Ga0207674_10003115 | 3300026116 | Bacteria | 20465 |
| 823 | Ga0207674_10089456 | 3300026116 | Bacteria | 3071 |
| 824 | Ga0207675_100003916 | 3300026118 | Bacteria | 14458 |
| 825 | Ga0207675_100028509 | 3300026118 | Bacteria | 5199 |
| 826 | Ga0207675_100347690 | 3300026118 | Bacteria | 1452 |
| 827 | Ga0207675_100535847 | 3300026118 | Bacteria | 1169 |
| 828 | Ga0207683_10001409 | 3300026121 | Bacteria | 21710 |
| 829 | Ga0207683_10003185 | 3300026121 | Bacteria | 14315 |
| 830 | Ga0207683_10008275 | 3300026121 | Bacteria | 8895 |
| 831 | Ga0207683_10157214 | 3300026121 | Bacteria | 2054 |
| 832 | Ga0207698_10023118 | 3300026142 | Bacteria | 4337 |
| 833 | Ga0207698_10580716 | 3300026142 | Bacteria | 1102 |
| 834 | Ga0207698_10726438 | 3300026142 | Unclassified | 990 |
| 835 | Ga0207698_11016193 | 3300026142 | Bacteria | 840 |
| 836 | Ga0207698_11027911 | 3300026142 | Unclassified | 835 |
| 837 | Ga0265354_1002918 | 3300028016 | Bacteria | 2006 |
| 838 | Ga0265356_1001038 | 3300028017 | Unclassified | 4365 |
| 839 | Ga0265357_1016687 | 3300028023 | Bacteria | 783 |
| 840 | Ga0268266_10010616 | 3300028379 | Bacteria | 8024 |
| 841 | Ga0268266_10016432 | 3300028379 | Bacteria | 6325 |
| 842 | Ga0268266_10022973 | 3300028379 | Bacteria | 5307 |
| 843 | Ga0268266_10069453 | 3300028379 | Bacteria | 3052 |
| 844 | Ga0268266_10612105 | 3300028379 | Unclassified | 1047 |
| 845 | Ga0268265_10008041 | 3300028380 | Bacteria | 7122 |
| 846 | Ga0268265_10010190 | 3300028380 | Bacteria | 6344 |
| 847 | Ga0268265_10011212 | 3300028380 | Bacteria | 6059 |
| 848 | Ga0268265_10064504 | 3300028380 | Bacteria | 2822 |
| 849 | Ga0268265_10173887 | 3300028380 | Bacteria | 1843 |
| 850 | Ga0268265_12575186 | 3300028380 | Unclassified | 514 |
| 851 | Ga0268264_10029462 | 3300028381 | Unclassified | 4496 |
| 852 | Ga0268264_10114613 | 3300028381 | Bacteria | 2367 |
| 853 | Ga0268264_10206729 | 3300028381 | Unclassified | 1799 |
| 854 | Ga0268264_10328737 | 3300028381 | Bacteria | 1448 |
| 855 | Ga0268264_10858783 | 3300028381 | Bacteria | 909 |
| 856 | Ga0268264_11732312 | 3300028381 | Unclassified | 635 |
| 857 | Ga0265338_10366267 | 3300028800 | Unclassified | 1033 |
| 858 | Ga0265338_10664423 | 3300028800 | Bacteria | 721 |
| 859 | Ga0265324_10097092 | 3300029957 | Bacteria | 1002 |
| 860 | Ga0265762_1000907 | 3300030760 | Bacteria | 5283 |
| 861 | Ga0265762_1000968 | 3300030760 | Bacteria | 5164 |
| 862 | Ga0265762_1020333 | 3300030760 | Unclassified | 1220 |
| 863 | Ga0265767_100578 | 3300030836 | Unclassified | 1583 |
| 864 | Ga0265767_106418 | 3300030836 | Unclassified | 732 |
| 865 | Ga0265767_107469 | 3300030836 | Unclassified | 695 |
| 866 | Ga0265767_118022 | 3300030836 | Unclassified | 521 |
| 867 | Ga0265770_1043336 | 3300030878 | Unclassified | 794 |
| 868 | Ga0265765_1033887 | 3300030879 | Bacteria | 660 |
| 869 | Ga0265764_106760 | 3300030882 | Bacteria | 666 |
| 870 | Ga0265764_109953 | 3300030882 | Bacteria | 593 |
| 871 | Ga0265772_102055 | 3300030886 | Unclassified | 774 |
| 872 | Ga0265769_110075 | 3300030888 | Unclassified | 642 |
| 873 | Ga0265761_105066 | 3300030889 | Unclassified | 683 |
| 874 | Ga0265760_10000760 | 3300031090 | Bacteria | 9244 |
| 875 | Ga0265760_10006169 | 3300031090 | Unclassified | 3427 |
| 876 | Ga0265760_10007885 | 3300031090 | Bacteria | 3042 |
| 877 | Ga0265760_10270872 | 3300031090 | Unclassified | 594 |
| 878 | Ga0265760_10391295 | 3300031090 | Unclassified | 501 |
| 879 | Ga0265339_10013837 | 3300031249 | Bacteria | 4880 |
| 880 | Ga0265339_10039057 | 3300031249 | Unclassified | 2645 |
| 881 | Ga0265339_10214360 | 3300031249 | Bacteria | 944 |
| 882 | Ga0265316_10156859 | 3300031344 | Unclassified | 1703 |
| 883 | Ga0265316_10422021 | 3300031344 | Bacteria | 959 |
| 884 | Ga0265342_10034397 | 3300031712 | Bacteria | 3109 |
| 885 | Ga0316214_1042541 | 3300033545 | Unclassified | 653 |
| 886 | Ga0373958_0018336 | 3300034819 | Bacteria | 1268 |
| 887 | Ga0373926_0124230 | 3300035083 | Unclassified | 974 |
| 888 | Ga0373926_0280362 | 3300035083 | Bacteria | 649 |
| 889 | Ga0373928_0244700 | 3300035084 | Unclassified | 532 |
| 890 | Ga0373929_0071676 | 3300035085 | Unclassified | 830 |
| 891 | Ga0373934_0068424 | 3300035086 | Unclassified | 1419 |
| 892 | Ga0373940_0008365 | 3300035088 | Bacteria | 2371 |
| 893 | Ga0373944_0046181 | 3300035089 | Bacteria | 1361 |
| 894 | Ga0373944_0069752 | 3300035089 | Bacteria | 1143 |
| 895 | Ga0373949_0223132 | 3300035090 | Unclassified | 574 |
| 896 | Ga0373952_0047454 | 3300035092 | Bacteria | 1013 |
| 897 | Ga0373923_0043438 | 3300035111 | Bacteria | 1860 |
| 898 | Ga0373923_0402531 | 3300035111 | Unclassified | 659 |
| 899 | Ga0373936_0093679 | 3300035113 | Bacteria | 1261 |
| 900 | Ga0373936_0310168 | 3300035113 | Bacteria | 713 |
| 901 | Ga0373941_0070115 | 3300035115 | Bacteria | 1162 |
| 902 | Ga0373945_0037868 | 3300035116 | Bacteria | 1733 |
| 903 | Ga0373945_0420655 | 3300035116 | Unclassified | 588 |
| 904 | Ga0373953_0011276 | 3300035117 | Bacteria | 3133 |
| 905 | Ga0373954_0018501 | 3300035118 | Bacteria | 3137 |
| 906 | Ga0373956_0004589 | 3300035119 | Bacteria | 5518 |
| 907 | Ga0373960_0005780 | 3300035121 | Bacteria | 2876 |
| 908 | Ga0373943_0004320 | 3300035170 | Bacteria | 6446 |
| 909 | Ga0373943_0135186 | 3300035170 | Bacteria | 1323 |
| 910 | Ga0373943_0153937 | 3300035170 | Bacteria | 1247 |
| 911 | Ga0373946_0177858 | 3300035171 | Bacteria | 1008 |
| 912 | Ga0373955_0016709 | 3300035172 | Bacteria | 3616 |
| 913 | Ga0373924_0003920 | 3300035410 | Bacteria | 5161 |
| 914 | Ga0373924_0564964 | 3300035410 | Unclassified | 513 |
| 915 | Ga0373931_0288387 | 3300035691 | Bacteria | 1010 |
| 916 | Ga0373931_0519192 | 3300035691 | Bacteria | 770 |
| 917 | Ga0373931_1150392 | 3300035691 | Bacteria | 530 |
| 918 | Ga0373935_0019507 | 3300035692 | Bacteria | 4135 |
| 919 | Ga0373935_0044180 | 3300035692 | Unclassified | 2807 |
| 920 | Ga0373935_0143623 | 3300035692 | Unclassified | 1614 |
| 921 | Ga0373935_1140703 | 3300035692 | Bacteria | 581 |
| 922 | Ga0373927_0029401 | 3300035695 | Bacteria | 3581 |
| 923 | Ga0373927_0246544 | 3300035695 | Bacteria | 1174 |
| 924 | Ga0373933_0004804 | 3300035724 | Bacteria | 7388 |
| 925 | Ga0373933_0687072 | 3300035724 | Bacteria | 673 |
| 926 | Ga0373933_0920955 | 3300035724 | Unclassified | 576 |
| 927 | Ga0373947_0003005 | 3300035725 | Bacteria | 10060 |
| 928 | Ga0373947_0078417 | 3300035725 | Bacteria | 2039 |
| 929 | Ga0373947_0142134 | 3300035725 | Bacteria | 1540 |
| 930 | Ga0373947_1097043 | 3300035725 | Bacteria | 543 |
| 931 | Ga0373937_0017007 | 3300036401 | Bacteria | 6468 |
| 932 | Ga0373937_1098433 | 3300036401 | Bacteria | 744 |
| 933 | Ga0373925_0012009 | 3300037068 | Bacteria | 6272 |
| 934 | Ga0373925_0014757 | 3300037068 | Bacteria | 5645 |
| 935 | Ga0373925_0018946 | 3300037068 | Bacteria | 5003 |
| 936 | Ga0373925_0168406 | 3300037068 | Bacteria | 1729 |
| 937 | Ga0373925_0455209 | 3300037068 | Unclassified | 1048 |
| 938 | Ga0373925_0592448 | 3300037068 | Bacteria | 913 |
| 939 | Ga0395905_0728054 | 3300037471 | Unclassified | 894 |
| 940 | Ga0395905_1287508 | 3300037471 | Unclassified | 635 |
| 941 | Ga0395901_1479426 | 3300038443 | Unclassified | 636 |
| 942 | Ga0242420_155402 | 3300038996 | Unclassified | 515 |
| 943 | Ga0453683_0701375 | 3300044673 | Unclassified | 663 |
| 944 | Ga0451576_0104474 | 3300045051 | Bacteria | 2947 |
| 945 | Ga0451576_2545691 | 3300045051 | Unclassified | 522 |
| 946 | Ga0466967_0020158 | 3300045976 | Bacteria | 5380 |
| 947 | Ga0466967_1000592 | 3300045976 | Bacteria | 832 |
| 948 | Ga0495590_0326935 | 3300046457 | Unclassified | 580 |
| 949 | Ga0495629_0238769 | 3300046459 | Bacteria | 1251 |
| 950 | Ga0495653_0170350 | 3300046463 | Bacteria | 1503 |
| 951 | Ga0495653_0423542 | 3300046463 | Bacteria | 842 |
| 952 | Ga0495580_0039772 | 3300046472 | Bacteria | 3364 |
| 953 | Ga0495580_0055891 | 3300046472 | Bacteria | 2780 |
| 954 | Ga0495580_0100516 | 3300046472 | Unclassified | 2012 |
| 955 | Ga0495580_0301439 | 3300046472 | Bacteria | 1091 |
| 956 | Ga0495580_0374294 | 3300046472 | Bacteria | 963 |
| 957 | Ga0495580_0603299 | 3300046472 | Unclassified | 725 |
| 958 | Ga0495582_0712738 | 3300046473 | Unclassified | 581 |
| 959 | Ga0495664_0534623 | 3300046477 | Unclassified | 699 |
| 960 | Ga0495628_1012020 | 3300046516 | Bacteria | 571 |
| 961 | Ga0495630_0456282 | 3300046517 | Unclassified | 979 |
| 962 | Ga0495630_0831662 | 3300046517 | Bacteria | 704 |
| 963 | Ga0495642_0376876 | 3300046528 | Unclassified | 625 |
| 964 | Ga0495652_0458319 | 3300046529 | Bacteria | 891 |
| 965 | Ga0495665_0184111 | 3300046531 | Bacteria | 1085 |
| 966 | Ga0495665_0198157 | 3300046531 | Bacteria | 1041 |
| 967 | Ga0495665_0601106 | 3300046531 | Unclassified | 550 |
| 968 | Ga0495635_0556779 | 3300046663 | Unclassified | 751 |
| 969 | Ga0495657_0216932 | 3300046675 | Unclassified | 1161 |
| 970 | Ga0495657_0383544 | 3300046675 | Unclassified | 829 |
| 971 | Ga0495623_0726755 | 3300046679 | Unclassified | 507 |
| 972 | Ga0495647_0129741 | 3300046681 | Unclassified | 1067 |
| 973 | Ga0495658_0008434 | 3300046683 | Bacteria | 5108 |
| 974 | Ga0495669_0073356 | 3300046684 | Bacteria | 1563 |
| 975 | Ga0495669_0612513 | 3300046684 | Bacteria | 530 |
| 976 | Ga0495581_0096374 | 3300047315 | Bacteria | 1718 |
| 977 | Ga0495674_0018156 | 3300047319 | Bacteria | 6548 |
| 978 | Ga0495680_0854298 | 3300047322 | Unclassified | 591 |
| 979 | Ga0495684_0955521 | 3300047471 | Bacteria | 548 |
| 980 | Ga0495602_0131222 | 3300048088 | Unclassified | 1998 |
| 981 | Ga0496100_0160805 | 3300048903 | Bacteria | 1610 |
| 982 | Ga0496100_0389054 | 3300048903 | Bacteria | 1060 |
| 983 | Ga0496100_0980984 | 3300048903 | Bacteria | 665 |
| 984 | Ga0496101_0104472 | 3300048904 | Bacteria | 2125 |
| 985 | Ga0496101_0212030 | 3300048904 | Bacteria | 1501 |
| 986 | Ga0496102_0047268 | 3300048905 | Bacteria | 3910 |
| 987 | Ga0496102_0090199 | 3300048905 | Bacteria | 2837 |
| 988 | Ga0496102_0312206 | 3300048905 | Bacteria | 1482 |
| 989 | Ga0496102_0490259 | 3300048905 | Bacteria | 1150 |
| 990 | Ga0496102_0660215 | 3300048905 | Bacteria | 969 |
| 991 | Ga0496102_1028105 | 3300048905 | Unclassified | 744 |
| 992 | Ga0496102_1802607 | 3300048905 | Unclassified | 529 |
| 993 | Ga0496103_0205811 | 3300048906 | Bacteria | 1266 |
| 994 | Ga0496103_0334071 | 3300048906 | Bacteria | 975 |
| 995 | Ga0496104_0441686 | 3300048907 | Bacteria | 1213 |
| 996 | Ga0496104_1801783 | 3300048907 | Unclassified | 514 |
| 997 | Ga0496105_0071067 | 3300048908 | Bacteria | 2877 |
| 998 | Ga0496105_0139502 | 3300048908 | Bacteria | 1996 |
| 999 | Ga0496105_0417402 | 3300048908 | Bacteria | 1063 |
| 1000 | Ga0496105_0445402 | 3300048908 | Bacteria | 1023 |
| 1001 | Ga0496106_0138137 | 3300048909 | Bacteria | 1916 |
| 1002 | Ga0496106_0283730 | 3300048909 | Bacteria | 1327 |
| 1003 | Ga0496107_0134040 | 3300048910 | Bacteria | 1830 |
| 1004 | Ga0496107_1286998 | 3300048910 | Unclassified | 523 |
| 1005 | Ga0496108_0000082 | 3300048911 | Bacteria | 101998 |
| 1006 | Ga0496108_0000248 | 3300048911 | Bacteria | 48227 |
| 1007 | Ga0496108_0380075 | 3300048911 | Bacteria | 1233 |
| 1008 | Ga0496108_0692321 | 3300048911 | Bacteria | 884 |
| 1009 | Ga0496109_0000059 | 3300048912 | Bacteria | 118169 |
| 1010 | Ga0496109_0000263 | 3300048912 | Bacteria | 50562 |
| 1011 | Ga0496109_0029932 | 3300048912 | Bacteria | 4880 |
| 1012 | Ga0496109_1634394 | 3300048912 | Unclassified | 578 |
| 1013 | Ga0496110_0002489 | 3300048913 | Bacteria | 13815 |
| 1014 | Ga0496110_0019038 | 3300048913 | Bacteria | 5770 |
| 1015 | Ga0496110_0125790 | 3300048913 | Bacteria | 2313 |
| 1016 | Ga0496111_0009375 | 3300048914 | Bacteria | 6528 |
| 1017 | Ga0496111_0050364 | 3300048914 | Bacteria | 3004 |
| 1018 | Ga0496112_0000027 | 3300048915 | Bacteria | 139514 |
| 1019 | Ga0496112_0000093 | 3300048915 | Bacteria | 58124 |
| 1020 | Ga0496112_0026932 | 3300048915 | Bacteria | 5541 |
| 1021 | Ga0496112_0030102 | 3300048915 | Bacteria | 5253 |
| 1022 | Ga0496112_0218977 | 3300048915 | Unclassified | 1860 |
| 1023 | Ga0496112_0339207 | 3300048915 | Bacteria | 1446 |
| 1024 | Ga0496112_0504572 | 3300048915 | Bacteria | 1145 |
| 1025 | Ga0496112_1151349 | 3300048915 | Unclassified | 693 |
| 1026 | Ga0496112_1160394 | 3300048915 | Bacteria | 690 |
| 1027 | Ga0496112_1332541 | 3300048915 | Unclassified | 633 |
| 1028 | Ga0496113_0024975 | 3300048916 | Unclassified | 4255 |
| 1029 | Ga0496113_0034739 | 3300048916 | Bacteria | 3681 |
| 1030 | Ga0496113_0260941 | 3300048916 | Bacteria | 1384 |
| 1031 | Ga0496115_0025352 | 3300048918 | Unclassified | 4616 |
| 1032 | Ga0496115_1084333 | 3300048918 | Unclassified | 608 |
| 1033 | Ga0496115_1114716 | 3300048918 | Bacteria | 597 |
| 1034 | Ga0501296_011190 | 3300049519 | Bacteria | 1071 |
| 1035 | Ga0501297_022773 | 3300049520 | Unclassified | 793 |
| 1036 | Ga0501083_0092313 | 3300049744 | Bacteria | 1999 |
| 1037 | nmdc:mga05p37_1331553_c1 | 3300050507 | Unclassified | 729 |
| 1038 | nmdc:mga05p37_140451_c1 | 3300050507 | Bacteria | 2959 |
| 1039 | nmdc:mga05p37_1558011_c1 | 3300050507 | Unclassified | 654 |
| 1040 | nmdc:mga0n895_1386519_c1 | 3300050512 | Unclassified | 672 |
| 1041 | nmdc:mga0n895_18567_c1 | 3300050512 | Bacteria | 6439 |
| 1042 | nmdc:mga0n895_2407_c1 | 3300050512 | Bacteria | 14583 |
| 1043 | nmdc:mga0n895_536053_c1 | 3300050512 | Bacteria | 1177 |
| 1044 | nmdc:mga0n895_597_c1 | 3300050512 | Bacteria | 24970 |
| 1045 | nmdc:mga0n895_658297_c1 | 3300050512 | Unclassified | 1046 |
| 1046 | nmdc:mga0n895_919590_c1 | 3300050512 | Unclassified | 859 |
| 1047 | nmdc:mga0rr50_1065906_c1 | 3300050513 | Unclassified | 688 |
| 1048 | nmdc:mga0rr50_11425_c1 | 3300050513 | Bacteria | 5686 |
| 1049 | nmdc:mga0rr50_130690_c1 | 3300050513 | Bacteria | 2010 |
| 1050 | nmdc:mga0rr50_1664430_c1 | 3300050513 | Unclassified | 538 |
| 1051 | nmdc:mga0rr50_63279_c1 | 3300050513 | Bacteria | 2793 |
| 1052 | nmdc:mga0rr50_86509_c1 | 3300050513 | Unclassified | 2431 |
| 1053 | nmdc:mga0rr50_88346_c1 | 3300050513 | Bacteria | 2408 |
| 1054 | nmdc:mga08x19_150186_c1 | 3300050514 | Unclassified | 1577 |
| 1055 | nmdc:mga08x19_839434_c1 | 3300050514 | Unclassified | 653 |
| 1056 | nmdc:mga0a205_112080_c1 | 3300050515 | Bacteria | 2627 |
| 1057 | nmdc:mga0a205_128200_c1 | 3300050515 | Bacteria | 2437 |
| 1058 | nmdc:mga0a205_24861_c2 | 3300050515 | Bacteria | 2652 |
| 1059 | nmdc:mga0a205_4427_c1 | 3300050515 | Bacteria | 12608 |
| 1060 | nmdc:mga0a205_8827_c1 | 3300050515 | Bacteria | 9180 |
| 1061 | Ga0495601_0186966 | 3300053077 | Unclassified | 1354 |
| 1062 | Ga0495612_0318982 | 3300053078 | Unclassified | 699 |
| 1063 | Ga0495619_0100542 | 3300053085 | Bacteria | 1968 |
| 1064 | Ga0495619_1169390 | 3300053085 | Bacteria | 510 |
| 1065 | Ga0587093_039738 | 3300059478 | Bacteria | 709 |
| 1066 | Ga0587083_0163463 | 3300059505 | Unclassified | 611 |
| 1067 | Ga0587088_114181 | 3300059508 | Unclassified | 618 |
| 1068 | Ga0587128_108391 | 3300059630 | Unclassified | 591 |
| 1069 | Ga0587062_038339 | 3300059639 | Unclassified | 767 |
| 1070 | Ga0587067_150974 | 3300059640 | Unclassified | 583 |
| 1071 | Ga0587076_076568 | 3300059645 | Bacteria | 705 |
| 1072 | Ga0587079_041339 | 3300059647 | Bacteria | 932 |
| 1073 | Ga0587114_088008 | 3300059655 | Unclassified | 588 |
| 1074 | Ga0587111_0041384 | 3300060346 | Unclassified | 983 |
| 1075 | Ga0265338_10176005 | |||
| 1076 | MBSR1b_contig_4027986 | |||
| 1077 | MBSR1b_contig_8333477 | |||
| 1078 | JGI24741J21665_1043427 | |||
| 1079 | JGI24752J21851_1009768 | |||
| 1080 | JGI24737J22298_10066688 | |||
| 1081 | JGI24737J22298_10087360 | |||
| 1082 | JGI24737J22298_10264343 | |||
| 1083 | JGI24743J22301_10001159 | |||
| 1084 | JGI24743J22301_10063748 | |||
| 1085 | JGI24748J21848_1017408 | |||
| 1086 | JGI24034J26672_10043391 | |||
| 1087 | JGI24034J26672_10079104 | |||
| 1088 | JGI24034J26672_10105268 | |||
| 1089 | JGI24751J29686_10002972 | |||
| 1090 | JGI24751J29686_10007429 | |||
| 1091 | JGI24751J29686_10037826 | |||
| 1092 | Ga0058861_10003102 | |||
| 1093 | Ga0058860_11002774 | |||
| 1094 | Ga0058860_12177445 | |||
| 1095 | Ga0065704_10261811 | |||
| 1096 | Ga0065704_10288517 | |||
| 1097 | Ga0065712_10070788 | |||
| 1098 | Ga0065712_10212416 | |||
| 1099 | Ga0065715_10007408 | |||
| 1100 | Ga0065715_10092574 | |||
| 1101 | Ga0065715_10233000 | |||
| 1102 | Ga0065707_10250402 | |||
| 1103 | Ga0065707_10437642 | |||
| 1104 | Ga0070658_10106058 | |||
| 1105 | Ga0070658_10202182 | |||
| 1106 | Ga0070658_10873832 | |||
| 1107 | Ga0070676_10055122 | |||
| 1108 | Ga0070676_10067522 | |||
| 1109 | Ga0070676_10099922 | |||
| 1110 | Ga0070683_100003197 | |||
| 1111 | Ga0070683_100005844 | |||
| 1112 | Ga0070683_100008880 | |||
| 1113 | Ga0070683_100012847 | |||
| 1114 | Ga0070690_100087851 | |||
| 1115 | Ga0070690_100093222 | |||
| 1116 | Ga0070690_100105475 | |||
| 1117 | Ga0070670_100071125 | |||
| 1118 | Ga0070670_100144406 | |||
| 1119 | Ga0070670_100359172 | |||
| 1120 | Ga0070670_101695046 | |||
| 1121 | Ga0070677_10004885 | |||
| 1122 | Ga0070677_10154161 | |||
| 1123 | Ga0070677_10475526 | |||
| 1124 | Ga0068869_100001293 | |||
| 1125 | Ga0068869_100038894 | |||
| 1126 | Ga0068869_100067840 | |||
| 1127 | Ga0068869_100332456 | |||
| 1128 | Ga0070666_10022383 | |||
| 1129 | Ga0070666_10051885 | |||
| 1130 | Ga0070666_10070115 | |||
| 1131 | Ga0070680_100050810 | |||
| 1132 | Ga0070682_100007783 | |||
| 1133 | Ga0070682_100676741 | |||
| 1134 | Ga0070682_100927252 | |||
| 1135 | Ga0068868_100020920 | |||
| 1136 | Ga0068868_100045373 | |||
| 1137 | Ga0068868_100053680 | |||
| 1138 | Ga0068868_100073466 | |||
| 1139 | Ga0068868_100124447 | |||
| 1140 | Ga0068868_100414186 | |||
| 1141 | Ga0068868_100497598 | |||
| 1142 | Ga0068868_100577493 | |||
| 1143 | Ga0070660_100004238 | |||
| 1144 | Ga0070660_100015997 | |||
| 1145 | Ga0070660_100412516 | |||
| 1146 | Ga0070660_100474351 | |||
| 1147 | Ga0070689_100001850 | |||
| 1148 | Ga0070689_100011759 | |||
| 1149 | Ga0070689_100038434 | |||
| 1150 | Ga0070689_100250061 | |||
| 1151 | Ga0070691_10011241 | |||
| 1152 | Ga0070687_100080978 | |||
| 1153 | Ga0070687_100975654 | |||
| 1154 | Ga0070661_100004259 | |||
| 1155 | Ga0070661_100017115 | |||
| 1156 | Ga0070661_100018668 | |||
| 1157 | Ga0070661_100934229 | |||
| 1158 | Ga0070692_10052921 | |||
| 1159 | Ga0070692_11022810 | |||
| 1160 | Ga0070668_100011820 | |||
| 1161 | Ga0070668_100013309 | |||
| 1162 | Ga0070668_100798088 | |||
| 1163 | Ga0070669_100059579 | |||
| 1164 | Ga0070669_100106176 | |||
| 1165 | Ga0070669_100326882 | |||
| 1166 | Ga0070675_100002561 | |||
| 1167 | Ga0070675_100022584 | |||
| 1168 | Ga0070675_100126635 | |||
| 1169 | Ga0070671_101108258 | |||
| 1170 | Ga0070671_101183498 | |||
| 1171 | Ga0070674_100233547 | |||
| 1172 | Ga0070674_101082465 | |||
| 1173 | Ga0070673_100041389 | |||
| 1174 | Ga0070673_100078846 | |||
| 1175 | Ga0070673_100111609 | |||
| 1176 | Ga0070688_100000516 | |||
| 1177 | Ga0070688_100004344 | |||
| 1178 | Ga0070688_100040384 | |||
| 1179 | Ga0070688_100353942 | |||
| 1180 | Ga0070659_100005697 | |||
| 1181 | Ga0070659_100010194 | |||
| 1182 | Ga0070659_100023103 | |||
| 1183 | Ga0070667_100011015 | |||
| 1184 | Ga0070667_100126289 | |||
| 1185 | Ga0070667_100444918 | |||
| 1186 | Ga0070667_100446504 | |||
| 1187 | Ga0070709_10037109 | |||
| 1188 | Ga0070709_10141716 | |||
| 1189 | Ga0070709_10255262 | |||
| 1190 | Ga0070709_10519210 | |||
| 1191 | Ga0070709_10611075 | |||
| 1192 | Ga0070714_100085437 | |||
| 1193 | Ga0070714_100447462 | |||
| 1194 | Ga0070714_101154135 | |||
| 1195 | Ga0070714_101229836 | |||
| 1196 | Ga0070713_100018350 | |||
| 1197 | Ga0070713_100029594 | |||
| 1198 | Ga0070713_100031301 | |||
| 1199 | Ga0070713_100221044 | |||
| 1200 | Ga0070713_100398125 | |||
| 1201 | Ga0070713_100494726 | |||
| 1202 | Ga0070713_100749772 | |||
| 1203 | Ga0070713_101165569 | |||
| 1204 | Ga0070713_101652281 | |||
| 1205 | Ga0070713_102141943 | |||
| 1206 | Ga0070710_10017171 | |||
| 1207 | Ga0070710_10089227 | |||
| 1208 | Ga0070710_10133583 | |||
| 1209 | Ga0070701_10224889 | |||
| 1210 | Ga0070711_100002787 | |||
| 1211 | Ga0070711_100036869 | |||
| 1212 | Ga0070711_100414995 | |||
| 1213 | Ga0070711_101893501 | |||
| 1214 | Ga0070700_100104671 | |||
| 1215 | Ga0070700_100619395 | |||
| 1216 | Ga0070694_100149083 | |||
| 1217 | Ga0070708_100001230 | |||
| 1218 | Ga0070708_100074543 | |||
| 1219 | Ga0070708_100085093 | |||
| 1220 | Ga0070708_100598343 | |||
| 1221 | Ga0070708_100965076 | |||
| 1222 | Ga0070708_101913356 | |||
| 1223 | Ga0070663_100018653 | |||
| 1224 | Ga0070663_100019750 | |||
| 1225 | Ga0070663_100020623 | |||
| 1226 | Ga0070663_100023426 | |||
| 1227 | Ga0070678_100025809 | |||
| 1228 | Ga0070678_100117908 | |||
| 1229 | Ga0070678_100131470 | |||
| 1230 | Ga0070678_101292897 | |||
| 1231 | Ga0070662_100001978 | |||
| 1232 | Ga0070662_100115487 | |||
| 1233 | Ga0070662_100176753 | |||
| 1234 | Ga0070681_10022786 | |||
| 1235 | Ga0070681_10025415 | |||
| 1236 | Ga0070681_10106236 | |||
| 1237 | Ga0070681_10181869 | |||
| 1238 | Ga0070681_10201274 | |||
| 1239 | Ga0070681_10215656 | |||
| 1240 | Ga0068867_100017052 | |||
| 1241 | Ga0068867_100142276 | |||
| 1242 | Ga0068867_100213087 | |||
| 1243 | Ga0068867_101083619 | |||
| 1244 | Ga0070685_10006436 | |||
| 1245 | Ga0070685_10009420 | |||
| 1246 | Ga0070685_10115872 | |||
| 1247 | Ga0070685_10215820 | |||
| 1248 | Ga0070706_100053235 | |||
| 1249 | Ga0070706_100126049 | |||
| 1250 | Ga0070706_100204713 | |||
| 1251 | Ga0070706_100407708 | |||
| 1252 | Ga0070706_100765311 | |||
| 1253 | Ga0070706_101322250 | |||
| 1254 | Ga0070706_101979572 | |||
| 1255 | Ga0070707_100101060 | |||
| 1256 | Ga0070707_100249111 | |||
| 1257 | Ga0070707_100704902 | |||
| 1258 | Ga0070707_100782172 | |||
| 1259 | Ga0070707_101100452 | |||
| 1260 | Ga0070707_102149074 | |||
| 1261 | Ga0070698_100005509 | |||
| 1262 | Ga0070698_100186398 | |||
| 1263 | Ga0070698_100441555 | |||
| 1264 | Ga0070698_102105900 | |||
| 1265 | Ga0070698_102189620 | |||
| 1266 | Ga0070699_100006501 | |||
| 1267 | Ga0070699_100028271 | |||
| 1268 | Ga0070699_100449819 | |||
| 1269 | Ga0070699_100635461 | |||
| 1270 | Ga0070699_100644426 | |||
| 1271 | Ga0070699_100670833 | |||
| 1272 | Ga0070699_101522584 | |||
| 1273 | Ga0070699_101567675 | |||
| 1274 | Ga0070699_101587771 | |||
| 1275 | Ga0070699_102056794 | |||
| 1276 | Ga0070679_100115168 | |||
| 1277 | Ga0070679_100140930 | |||
| 1278 | Ga0070679_100407203 | |||
| 1279 | Ga0070679_100449336 | |||
| 1280 | Ga0070679_100514923 | |||
| 1281 | Ga0070684_100001221 | |||
| 1282 | Ga0070684_100004762 | |||
| 1283 | Ga0070684_100007834 | |||
| 1284 | Ga0070684_100024296 | |||
| 1285 | Ga0070697_100000195 | |||
| 1286 | Ga0070697_100015094 | |||
| 1287 | Ga0070697_100019283 | |||
| 1288 | Ga0070697_100030279 | |||
| 1289 | Ga0070697_100262556 | |||
| 1290 | Ga0070697_100307836 | |||
| 1291 | Ga0070697_100387964 | |||
| 1292 | Ga0070697_100628787 | |||
| 1293 | Ga0070697_100712903 | |||
| 1294 | Ga0070697_101510627 | |||
| 1295 | Ga0068853_100040624 | |||
| 1296 | Ga0068853_100050463 | |||
| 1297 | Ga0068853_100157132 | |||
| 1298 | Ga0068853_100181862 | |||
| 1299 | Ga0068853_100985557 | |||
| 1300 | Ga0068853_101158569 | |||
| 1301 | Ga0068853_101550158 | |||
| 1302 | Ga0070672_100017612 | |||
| 1303 | Ga0070686_100014722 | |||
| 1304 | Ga0070686_100590965 | |||
| 1305 | Ga0070695_100126232 | |||
| 1306 | Ga0070695_100435331 | |||
| 1307 | Ga0070695_100807726 | |||
| 1308 | Ga0070695_101374781 | |||
| 1309 | Ga0070696_100839457 | |||
| 1310 | Ga0070696_101454499 | |||
| 1311 | Ga0070693_100005135 | |||
| 1312 | Ga0070693_100075265 | |||
| 1313 | Ga0070693_100796221 | |||
| 1314 | Ga0070665_100037624 | |||
| 1315 | Ga0070665_101075344 | |||
| 1316 | Ga0070704_100356211 | |||
| 1317 | Ga0068855_100032541 | |||
| 1318 | Ga0068855_100387911 | |||
| 1319 | Ga0068855_100465412 | |||
| 1320 | Ga0068855_100506230 | |||
| 1321 | Ga0068855_101466254 | |||
| 1322 | Ga0068855_101943146 | |||
| 1323 | Ga0068855_102205845 | |||
| 1324 | Ga0070664_100013454 | |||
| 1325 | Ga0070664_100022059 | |||
| 1326 | Ga0070664_100036314 | |||
| 1327 | Ga0070664_100051576 | |||
| 1328 | Ga0068857_100002380 | |||
| 1329 | Ga0068857_100013016 | |||
| 1330 | Ga0068857_100013979 | |||
| 1331 | Ga0068857_100073744 | |||
| 1332 | Ga0068854_100043117 | |||
| 1333 | Ga0068854_100201395 | |||
| 1334 | Ga0068854_101728309 | |||
| 1335 | Ga0068856_100021919 | |||
| 1336 | Ga0068856_100021938 | |||
| 1337 | Ga0068856_100058845 | |||
| 1338 | Ga0068856_100153522 | |||
| 1339 | Ga0068856_100352814 | |||
| 1340 | Ga0068856_100520535 | |||
| 1341 | Ga0068856_100863069 | |||
| 1342 | Ga0068856_101009002 | |||
| 1343 | Ga0070702_100006042 | |||
| 1344 | Ga0068852_100032868 | |||
| 1345 | Ga0068852_100078245 | |||
| 1346 | Ga0068852_100677121 | |||
| 1347 | Ga0068852_100809791 | |||
| 1348 | Ga0068859_100025899 | |||
| 1349 | Ga0068859_100073730 | |||
| 1350 | Ga0068864_100037453 | |||
| 1351 | Ga0068864_100069690 | |||
| 1352 | Ga0068864_100493687 | |||
| 1353 | Ga0068864_100684779 | |||
| 1354 | Ga0068866_10004505 | |||
| 1355 | Ga0068866_10007468 | |||
| 1356 | Ga0068866_10023640 | |||
| 1357 | Ga0068866_10031206 | |||
| 1358 | Ga0068861_100019608 | |||
| 1359 | Ga0068861_100074064 | |||
| 1360 | Ga0068861_100135871 | |||
| 1361 | Ga0068861_100186116 | |||
| 1362 | Ga0068861_101698060 | |||
| 1363 | Ga0068851_10007219 | |||
| 1364 | Ga0068851_10011989 | |||
| 1365 | Ga0068851_10022275 | |||
| 1366 | Ga0068851_10837583 | |||
| 1367 | Ga0068870_10002475 | |||
| 1368 | Ga0068870_10002878 | |||
| 1369 | Ga0068863_100119550 | |||
| 1370 | Ga0068863_100201980 | |||
| 1371 | Ga0068863_100303576 | |||
| 1372 | Ga0068863_100318074 | |||
| 1373 | Ga0068863_100397644 | |||
| 1374 | Ga0068863_100469396 | |||
| 1375 | Ga0068863_100665046 | |||
| 1376 | Ga0068863_101265697 | |||
| 1377 | Ga0068858_100014959 | |||
| 1378 | Ga0068858_100061406 | |||
| 1379 | Ga0068858_100126934 | |||
| 1380 | Ga0068858_100442190 | |||
| 1381 | Ga0068858_100769734 | |||
| 1382 | Ga0068860_100071702 | |||
| 1383 | Ga0068860_100217761 | |||
| 1384 | Ga0068860_101358827 | |||
| 1385 | Ga0068862_100043081 | |||
| 1386 | Ga0068862_100055718 | |||
| 1387 | Ga0068862_100122658 | |||
| 1388 | Ga0068862_100282940 | |||
| 1389 | Ga0068862_100586566 | |||
| 1390 | Ga0081540_1089621 | |||
| 1391 | Ga0070717_10005410 | |||
| 1392 | Ga0070717_10008160 | |||
| 1393 | Ga0070717_10015550 | |||
| 1394 | Ga0070717_10018988 | |||
| 1395 | Ga0070717_10049413 | |||
| 1396 | Ga0070717_10126440 | |||
| 1397 | Ga0070717_10202594 | |||
| 1398 | Ga0070717_10252492 | |||
| 1399 | Ga0070717_10256684 | |||
| 1400 | Ga0070717_10274719 | |||
| 1401 | Ga0070717_10292912 | |||
| 1402 | Ga0070717_10407774 | |||
| 1403 | Ga0070717_10512947 | |||
| 1404 | Ga0070717_10602429 | |||
| 1405 | Ga0070717_10642638 | |||
| 1406 | Ga0070715_10082566 | |||
| 1407 | Ga0070715_10200563 | |||
| 1408 | Ga0070715_10590648 | |||
| 1409 | Ga0070715_10622509 | |||
| 1410 | Ga0070716_100022901 | |||
| 1411 | Ga0070716_100089545 | |||
| 1412 | Ga0070716_100201548 | |||
| 1413 | Ga0070716_100308188 | |||
| 1414 | Ga0070716_100648630 | |||
| 1415 | Ga0070716_100973581 | |||
| 1416 | Ga0070716_101399414 | |||
| 1417 | Ga0070712_100004583 | |||
| 1418 | Ga0070712_100006417 | |||
| 1419 | Ga0070712_100105507 | |||
| 1420 | Ga0070712_100316874 | |||
| 1421 | Ga0070712_101110337 | |||
| 1422 | Ga0097621_100011169 | |||
| 1423 | Ga0097621_100086269 | |||
| 1424 | Ga0097621_100115313 | |||
| 1425 | Ga0097621_100169449 | |||
| 1426 | Ga0097621_100794345 | |||
| 1427 | Ga0097621_101208044 | |||
| 1428 | Ga0068871_100165757 | |||
| 1429 | Ga0068871_100347285 | |||
| 1430 | Ga0068871_100442527 | |||
| 1431 | Ga0068871_100801335 | |||
| 1432 | Ga0075433_10007525 | |||
| 1433 | Ga0075433_10131909 | |||
| 1434 | Ga0075434_100000048 | |||
| 1435 | Ga0075434_100001909 | |||
| 1436 | Ga0075434_100003171 | |||
| 1437 | Ga0075434_100028077 | |||
| 1438 | Ga0075434_100094016 | |||
| 1439 | Ga0075434_101812381 | |||
| 1440 | Ga0068865_100007139 | |||
| 1441 | Ga0068865_100153359 | |||
| 1442 | Ga0068865_100486466 | |||
| 1443 | Ga0068865_100750894 | |||
| 1444 | Ga0075436_100027931 | |||
| 1445 | Ga0075436_100100862 | |||
| 1446 | Ga0075436_100683715 | |||
| 1447 | Ga0075436_100694230 | |||
| 1448 | Ga0097620_100025895 | |||
| 1449 | Ga0097620_100073728 | |||
| 1450 | Ga0075435_100000099 | |||
| 1451 | Ga0075435_100000106 | |||
| 1452 | Ga0075435_100003178 | |||
| 1453 | Ga0075435_100006230 | |||
| 1454 | Ga0075435_100110914 | |||
| 1455 | Ga0075435_100325312 | |||
| 1456 | Ga0075435_100371204 | |||
| 1457 | Ga0099794_10079038 | |||
| 1458 | Ga0099795_10141760 | |||
| 1459 | Ga0105251_10054550 | |||
| 1460 | Ga0105251_10203059 | |||
| 1461 | Ga0105251_10276160 | |||
| 1462 | Ga0105251_10593960 | |||
| 1463 | Ga0105244_10423788 | |||
| 1464 | Ga0105250_10018252 | |||
| 1465 | Ga0105250_10329089 | |||
| 1466 | Ga0105240_10035974 | |||
| 1467 | Ga0105240_10046636 | |||
| 1468 | Ga0105240_10139076 | |||
| 1469 | Ga0105240_11263870 | |||
| 1470 | Ga0105240_12753305 | |||
| 1471 | Ga0111539_10593179 | |||
| 1472 | Ga0105245_10015098 | |||
| 1473 | Ga0105245_10015410 | |||
| 1474 | Ga0105245_10026784 | |||
| 1475 | Ga0105245_10030316 | |||
| 1476 | Ga0105245_10108448 | |||
| 1477 | Ga0105245_10122668 | |||
| 1478 | Ga0105247_10002828 | |||
| 1479 | Ga0105247_10004431 | |||
| 1480 | Ga0105247_10045138 | |||
| 1481 | Ga0105247_10697705 | |||
| 1482 | Ga0114129_10268502 | |||
| 1483 | Ga0114129_10312113 | |||
| 1484 | Ga0114129_11198715 | |||
| 1485 | Ga0105243_10009988 | |||
| 1486 | Ga0105241_10014848 | |||
| 1487 | Ga0105241_10017386 | |||
| 1488 | Ga0105241_10168250 | |||
| 1489 | Ga0105241_10689701 | |||
| 1490 | Ga0105241_10853936 | |||
| 1491 | Ga0105241_10961504 | |||
| 1492 | Ga0105241_11399605 | |||
| 1493 | Ga0105242_10012199 | |||
| 1494 | Ga0105242_10110710 | |||
| 1495 | Ga0105242_10701783 | |||
| 1496 | Ga0105248_10006559 | |||
| 1497 | Ga0105248_10028881 | |||
| 1498 | Ga0105248_10330414 | |||
| 1499 | Ga0105248_11234907 | |||
| 1500 | Ga0105248_11352422 | |||
| 1501 | Ga0105248_12297841 | |||
| 1502 | Ga0105237_10134690 | |||
| 1503 | Ga0105237_10356043 | |||
| 1504 | Ga0105237_10622161 | |||
| 1505 | Ga0105237_10678371 | |||
| 1506 | Ga0105237_10720899 | |||
| 1507 | Ga0105237_11492318 | |||
| 1508 | Ga0105237_12612098 | |||
| 1509 | Ga0105238_10031520 | |||
| 1510 | Ga0105238_10098225 | |||
| 1511 | Ga0105238_10158798 | |||
| 1512 | Ga0105238_10917959 | |||
| 1513 | Ga0105249_10016767 | |||
| 1514 | Ga0105249_10059002 | |||
| 1515 | Ga0105249_10208517 | |||
| 1516 | Ga0105249_12744319 | |||
| 1517 | Ga0099796_10042656 | |||
| 1518 | Ga0099796_10136852 | |||
| 1519 | Ga0105239_10136413 | |||
| 1520 | Ga0105239_10225827 | |||
| 1521 | Ga0105246_10001108 | |||
| 1522 | Ga0105246_10003080 | |||
| 1523 | Ga0105246_10111088 | |||
| 1524 | Ga0105246_10202563 | |||
| 1525 | Ga0105246_11297933 | |||
| 1526 | Ga0157337_1024014 | |||
| 1527 | Ga0157324_1052301 | |||
| 1528 | Ga0157338_1048671 | |||
| 1529 | Ga0157373_10004129 | |||
| 1530 | Ga0157373_10026008 | |||
| 1531 | Ga0157373_10050892 | |||
| 1532 | Ga0157373_10088558 | |||
| 1533 | Ga0157373_10987668 | |||
| 1534 | Ga0157373_11010742 | |||
| 1535 | Ga0157373_11387661 | |||
| 1536 | Ga0157371_10010554 | |||
| 1537 | Ga0157371_10020957 | |||
| 1538 | Ga0157370_10072937 | |||
| 1539 | Ga0157369_10008057 | |||
| 1540 | Ga0157369_10035817 | |||
| 1541 | Ga0157369_10038849 | |||
| 1542 | Ga0157369_10084157 | |||
| 1543 | Ga0157369_10795554 | |||
| 1544 | Ga0157369_11234182 | |||
| 1545 | Ga0157374_10014161 | |||
| 1546 | Ga0157374_10015015 | |||
| 1547 | Ga0157374_10244265 | |||
| 1548 | Ga0157374_11129105 | |||
| 1549 | Ga0157374_11429916 | |||
| 1550 | Ga0157374_12361144 | |||
| 1551 | Ga0157378_10024382 | |||
| 1552 | Ga0157378_10122165 | |||
| 1553 | Ga0157378_10341439 | |||
| 1554 | Ga0157378_11007762 | |||
| 1555 | Ga0157378_11091496 | |||
| 1556 | Ga0157378_13058757 | |||
| 1557 | Ga0163162_10004362 | |||
| 1558 | Ga0163162_10006695 | |||
| 1559 | Ga0163162_11530724 | |||
| 1560 | Ga0163162_12839681 | |||
| 1561 | Ga0163162_13221804 | |||
| 1562 | Ga0157372_10015052 | |||
| 1563 | Ga0157372_10045544 | |||
| 1564 | Ga0157372_10089561 | |||
| 1565 | Ga0157372_10130131 | |||
| 1566 | Ga0157372_10244329 | |||
| 1567 | Ga0157372_10660939 | |||
| 1568 | Ga0157372_12725501 | |||
| 1569 | Ga0157375_10039554 | |||
| 1570 | Ga0163163_10007365 | |||
| 1571 | Ga0163163_10015229 | |||
| 1572 | Ga0163163_10015812 | |||
| 1573 | Ga0163163_10144020 | |||
| 1574 | Ga0163163_10156015 | |||
| 1575 | Ga0163163_10337086 | |||
| 1576 | Ga0163163_11771196 | |||
| 1577 | Ga0163163_11803774 | |||
| 1578 | Ga0157380_10016063 | |||
| 1579 | Ga0157380_10071080 | |||
| 1580 | Ga0157380_13010819 | |||
| 1581 | Ga0182008_10296973 | |||
| 1582 | Ga0182008_10350676 | |||
| 1583 | Ga0157377_10002535 | |||
| 1584 | Ga0157377_10005156 | |||
| 1585 | Ga0157377_10238479 | |||
| 1586 | Ga0157377_10258309 | |||
| 1587 | Ga0157377_10436923 | |||
| 1588 | Ga0157379_10063952 | |||
| 1589 | Ga0157379_10132114 | |||
| 1590 | Ga0157379_10224046 | |||
| 1591 | Ga0157379_10604696 | |||
| 1592 | Ga0157379_10813265 | |||
| 1593 | Ga0157379_11499355 | |||
| 1594 | Ga0157376_10065246 | |||
| 1595 | Ga0157376_10165949 | |||
| 1596 | Ga0157376_10309786 | |||
| 1597 | Ga0157376_10341542 | |||
| 1598 | Ga0157376_10735834 | |||
| 1599 | Ga0157376_10878707 | |||
| 1600 | Ga0157376_10990634 | |||
| 1601 | Ga0157376_11739853 | |||
| 1602 | Ga0157376_12270490 | |||
| 1603 | Ga0182006_1052663 | |||
| 1604 | Ga0182007_10009668 | |||
| 1605 | Ga0182007_10019936 | |||
| 1606 | Ga0182007_10069677 | |||
| 1607 | Ga0182005_1034728 | |||
| 1608 | Ga0182005_1172553 | |||
| 1609 | Ga0182005_1291805 | |||
| 1610 | Ga0163161_10014659 | |||
| 1611 | Ga0163161_10108832 | |||
| 1612 | Ga0163161_11313776 | |||
| 1613 | Ga0184596_113244 | |||
| 1614 | Ga0184599_148826 | |||
| 1615 | Ga0184600_134185 | |||
| 1616 | Ga0184603_144311 | |||
| 1617 | Ga0206349_1642661 | |||
| 1618 | Ga0224712_10639171 | |||
| 1619 | Ga0224570_102594 | |||
| 1620 | Ga0224569_105555 | |||
| 1621 | Ga0247554_104626 | |||
| 1622 | Ga0247553_103521 | |||
| 1623 | Ga0228598_1002673 | |||
| 1624 | Ga0207672_1003895 | |||
| 1625 | Ga0207697_10003226 | |||
| 1626 | Ga0207697_10007278 | |||
| 1627 | Ga0207697_10022438 | |||
| 1628 | Ga0207656_10009919 | |||
| 1629 | Ga0207656_10010807 | |||
| 1630 | Ga0207656_10111314 | |||
| 1631 | Ga0207656_10578714 | |||
| 1632 | Ga0207696_1158425 | |||
| 1633 | Ga0207682_10004561 | |||
| 1634 | Ga0207682_10019273 | |||
| 1635 | Ga0207682_10024315 | |||
| 1636 | Ga0207692_10025672 | |||
| 1637 | Ga0207692_10055169 | |||
| 1638 | Ga0207692_10094958 | |||
| 1639 | Ga0207692_10101836 | |||
| 1640 | Ga0207692_10101862 | |||
| 1641 | Ga0207692_10297210 | |||
| 1642 | Ga0207692_11114167 | |||
| 1643 | Ga0207642_10083209 | |||
| 1644 | Ga0207642_10250795 | |||
| 1645 | Ga0207642_10564692 | |||
| 1646 | Ga0207642_10812169 | |||
| 1647 | Ga0207710_10025729 | |||
| 1648 | Ga0207710_10048051 | |||
| 1649 | Ga0207710_10201696 | |||
| 1650 | Ga0207710_10404818 | |||
| 1651 | Ga0207710_10649455 | |||
| 1652 | Ga0207688_10008709 | |||
| 1653 | Ga0207688_10011106 | |||
| 1654 | Ga0207688_10139009 | |||
| 1655 | Ga0207680_10028726 | |||
| 1656 | Ga0207680_10097295 | |||
| 1657 | Ga0207680_10099185 | |||
| 1658 | Ga0207680_10343947 | |||
| 1659 | Ga0207680_10676766 | |||
| 1660 | Ga0207647_10002670 | |||
| 1661 | Ga0207647_10009519 | |||
| 1662 | Ga0207647_10020873 | |||
| 1663 | Ga0207647_10023842 | |||
| 1664 | Ga0207647_10037809 | |||
| 1665 | Ga0207685_10086675 | |||
| 1666 | Ga0207685_10416427 | |||
| 1667 | Ga0207699_10050009 | |||
| 1668 | Ga0207699_10546206 | |||
| 1669 | Ga0207699_10648359 | |||
| 1670 | Ga0207699_10764275 | |||
| 1671 | Ga0207645_10001236 | |||
| 1672 | Ga0207645_10006872 | |||
| 1673 | Ga0207645_10037732 | |||
| 1674 | Ga0207643_10000367 | |||
| 1675 | Ga0207643_10000887 | |||
| 1676 | Ga0207643_10003601 | |||
| 1677 | Ga0207643_10021889 | |||
| 1678 | Ga0207705_10331317 | |||
| 1679 | Ga0207705_10359944 | |||
| 1680 | Ga0207684_10000260 | |||
| 1681 | Ga0207684_10001132 | |||
| 1682 | Ga0207684_10099671 | |||
| 1683 | Ga0207684_10132461 | |||
| 1684 | Ga0207684_10236333 | |||
| 1685 | Ga0207684_11490460 | |||
| 1686 | Ga0207654_10021430 | |||
| 1687 | Ga0207654_10230194 | |||
| 1688 | Ga0207654_10390242 | |||
| 1689 | Ga0207654_10423000 | |||
| 1690 | Ga0207654_10551548 | |||
| 1691 | Ga0207654_10579852 | |||
| 1692 | Ga0207707_10006647 | |||
| 1693 | Ga0207707_10014533 | |||
| 1694 | Ga0207707_10159574 | |||
| 1695 | Ga0207707_10322296 | |||
| 1696 | Ga0207707_10838628 | |||
| 1697 | Ga0207707_11531381 | |||
| 1698 | Ga0207695_10023396 | |||
| 1699 | Ga0207695_10087884 | |||
| 1700 | Ga0207695_10160952 | |||
| 1701 | Ga0207695_10247425 | |||
| 1702 | Ga0207671_10063611 | |||
| 1703 | Ga0207671_10181635 | |||
| 1704 | Ga0207671_10183699 | |||
| 1705 | Ga0207671_10488047 | |||
| 1706 | Ga0207671_11082203 | |||
| 1707 | Ga0207693_10002214 | |||
| 1708 | Ga0207693_10030377 | |||
| 1709 | Ga0207693_10139747 | |||
| 1710 | Ga0207663_10238206 | |||
| 1711 | Ga0207663_10437019 | |||
| 1712 | Ga0207663_10511899 | |||
| 1713 | Ga0207663_10879404 | |||
| 1714 | Ga0207660_10261285 | |||
| 1715 | Ga0207662_10001892 | |||
| 1716 | Ga0207662_10012475 | |||
| 1717 | Ga0207657_10002208 | |||
| 1718 | Ga0207657_10002438 | |||
| 1719 | Ga0207657_10004803 | |||
| 1720 | Ga0207657_10023076 | |||
| 1721 | Ga0207649_10000259 | |||
| 1722 | Ga0207649_10003191 | |||
| 1723 | Ga0207652_10168148 | |||
| 1724 | Ga0207652_10182009 | |||
| 1725 | Ga0207652_10317302 | |||
| 1726 | Ga0207652_10938819 | |||
| 1727 | Ga0207646_10001376 | |||
| 1728 | Ga0207646_10019251 | |||
| 1729 | Ga0207646_10308122 | |||
| 1730 | Ga0207646_10766158 | |||
| 1731 | Ga0207646_11041385 | |||
| 1732 | Ga0207646_11163975 | |||
| 1733 | Ga0207646_11486348 | |||
| 1734 | Ga0207646_11576947 | |||
| 1735 | Ga0207646_11920307 | |||
| 1736 | Ga0207681_10146574 | |||
| 1737 | Ga0207681_10316251 | |||
| 1738 | Ga0207681_10905962 | |||
| 1739 | Ga0207694_10119441 | |||
| 1740 | Ga0207694_11355420 | |||
| 1741 | Ga0207650_10000042 | |||
| 1742 | Ga0207650_10000058 | |||
| 1743 | Ga0207650_10000107 | |||
| 1744 | Ga0207650_10243969 | |||
| 1745 | Ga0207650_11659033 | |||
| 1746 | Ga0207659_10030725 | |||
| 1747 | Ga0207659_10045373 | |||
| 1748 | Ga0207659_10640105 | |||
| 1749 | Ga0207687_10020252 | |||
| 1750 | Ga0207687_10105077 | |||
| 1751 | Ga0207687_10149338 | |||
| 1752 | Ga0207687_10237863 | |||
| 1753 | Ga0207700_10012700 | |||
| 1754 | Ga0207700_10968321 | |||
| 1755 | Ga0207700_11070096 | |||
| 1756 | Ga0207700_11139065 | |||
| 1757 | Ga0207700_11309261 | |||
| 1758 | Ga0207700_11464392 | |||
| 1759 | Ga0207700_11468735 | |||
| 1760 | Ga0207664_10066377 | |||
| 1761 | Ga0207664_10147212 | |||
| 1762 | Ga0207664_10540863 | |||
| 1763 | Ga0207664_10630290 | |||
| 1764 | Ga0207664_10687553 | |||
| 1765 | Ga0207664_10869559 | |||
| 1766 | Ga0207664_11217788 | |||
| 1767 | Ga0207664_11431686 | |||
| 1768 | Ga0207644_10021381 | |||
| 1769 | Ga0207644_10052207 | |||
| 1770 | Ga0207644_10174694 | |||
| 1771 | Ga0207690_10035360 | |||
| 1772 | Ga0207690_10433852 | |||
| 1773 | Ga0207690_10992885 | |||
| 1774 | Ga0207706_10000075 | |||
| 1775 | Ga0207706_10002290 | |||
| 1776 | Ga0207706_10009574 | |||
| 1777 | Ga0207686_10214791 | |||
| 1778 | Ga0207686_10449263 | |||
| 1779 | Ga0207686_10765790 | |||
| 1780 | Ga0207686_11206389 | |||
| 1781 | Ga0207670_10011132 | |||
| 1782 | Ga0207670_10034066 | |||
| 1783 | Ga0207670_10082372 | |||
| 1784 | Ga0207670_10124653 | |||
| 1785 | Ga0207669_10086675 | |||
| 1786 | Ga0207669_11167629 | |||
| 1787 | Ga0207669_11231130 | |||
| 1788 | Ga0207704_10079297 | |||
| 1789 | Ga0207704_10917708 | |||
| 1790 | Ga0207704_11548565 | |||
| 1791 | Ga0207665_10059235 | |||
| 1792 | Ga0207665_10491189 | |||
| 1793 | Ga0207665_10502182 | |||
| 1794 | Ga0207665_10792083 | |||
| 1795 | Ga0207665_10857340 | |||
| 1796 | Ga0207665_10905954 | |||
| 1797 | Ga0207665_11332943 | |||
| 1798 | Ga0207691_10004777 | |||
| 1799 | Ga0207691_10006982 | |||
| 1800 | Ga0207691_10018448 | |||
| 1801 | Ga0207711_10002811 | |||
| 1802 | Ga0207711_10016527 | |||
| 1803 | Ga0207711_10122381 | |||
| 1804 | Ga0207711_10259016 | |||
| 1805 | Ga0207711_11077253 | |||
| 1806 | Ga0207689_10000627 | |||
| 1807 | Ga0207689_10000904 | |||
| 1808 | Ga0207689_10002067 | |||
| 1809 | Ga0207689_10011267 | |||
| 1810 | Ga0207689_10154212 | |||
| 1811 | Ga0207661_10000133 | |||
| 1812 | Ga0207661_10000160 | |||
| 1813 | Ga0207661_10000244 | |||
| 1814 | Ga0207661_10189076 | |||
| 1815 | Ga0207661_12102997 | |||
| 1816 | Ga0207679_10000050 | |||
| 1817 | Ga0207679_10000058 | |||
| 1818 | Ga0207679_10000397 | |||
| 1819 | Ga0207679_11390895 | |||
| 1820 | Ga0207667_10128201 | |||
| 1821 | Ga0207667_10329054 | |||
| 1822 | Ga0207667_10365371 | |||
| 1823 | Ga0207667_10433180 | |||
| 1824 | Ga0207667_10543212 | |||
| 1825 | Ga0207667_10794418 | |||
| 1826 | Ga0207651_10010652 | |||
| 1827 | Ga0207651_10124655 | |||
| 1828 | Ga0207651_11032039 | |||
| 1829 | Ga0207712_10038374 | |||
| 1830 | Ga0207712_10091565 | |||
| 1831 | Ga0207712_10386547 | |||
| 1832 | Ga0207712_10799349 | |||
| 1833 | Ga0207712_11156665 | |||
| 1834 | Ga0207668_10021444 | |||
| 1835 | Ga0207668_10482690 | |||
| 1836 | Ga0207668_10836693 | |||
| 1837 | Ga0207640_10041532 | |||
| 1838 | Ga0207640_10651176 | |||
| 1839 | Ga0207658_11021342 | |||
| 1840 | Ga0207658_11490379 | |||
| 1841 | Ga0207658_11711213 | |||
| 1842 | Ga0207677_10020732 | |||
| 1843 | Ga0207677_10023502 | |||
| 1844 | Ga0207677_10029215 | |||
| 1845 | Ga0207677_10042122 | |||
| 1846 | Ga0207677_10051751 | |||
| 1847 | Ga0207677_10098912 | |||
| 1848 | Ga0207677_10157819 | |||
| 1849 | Ga0207677_10205009 | |||
| 1850 | Ga0207677_10617298 | |||
| 1851 | Ga0207703_10009459 | |||
| 1852 | Ga0207703_10017008 | |||
| 1853 | Ga0207703_10103864 | |||
| 1854 | Ga0207703_10125829 | |||
| 1855 | Ga0207639_10033487 | |||
| 1856 | Ga0207639_10036498 | |||
| 1857 | Ga0207639_10067041 | |||
| 1858 | Ga0207639_10213290 | |||
| 1859 | Ga0207639_11188448 | |||
| 1860 | Ga0207639_12043036 | |||
| 1861 | Ga0207678_10000023 | |||
| 1862 | Ga0207678_10001363 | |||
| 1863 | Ga0207678_10001554 | |||
| 1864 | Ga0207708_10029850 | |||
| 1865 | Ga0207708_10146115 | |||
| 1866 | Ga0207708_10717588 | |||
| 1867 | Ga0207702_10019523 | |||
| 1868 | Ga0207702_10020646 | |||
| 1869 | Ga0207702_10022284 | |||
| 1870 | Ga0207702_10208875 | |||
| 1871 | Ga0207702_10265413 | |||
| 1872 | Ga0207702_10574617 | |||
| 1873 | Ga0207702_10996337 | |||
| 1874 | Ga0207641_10000059 | |||
| 1875 | Ga0207641_10000141 | |||
| 1876 | Ga0207641_10000163 | |||
| 1877 | Ga0207641_10121764 | |||
| 1878 | Ga0207641_10202643 | |||
| 1879 | Ga0207641_10276971 | |||
| 1880 | Ga0207641_10399553 | |||
| 1881 | Ga0207641_11086426 | |||
| 1882 | Ga0207641_12144820 | |||
| 1883 | Ga0207641_12192647 | |||
| 1884 | Ga0207648_10001268 | |||
| 1885 | Ga0207648_10002964 | |||
| 1886 | Ga0207648_10076495 | |||
| 1887 | Ga0207648_10149432 | |||
| 1888 | Ga0207648_10562381 | |||
| 1889 | Ga0207676_10000534 | |||
| 1890 | Ga0207676_10001918 | |||
| 1891 | Ga0207676_10006470 | |||
| 1892 | Ga0207676_10934084 | |||
| 1893 | Ga0207676_11903265 | |||
| 1894 | Ga0207674_10000708 | |||
| 1895 | Ga0207674_10001553 | |||
| 1896 | Ga0207674_10003115 | |||
| 1897 | Ga0207674_10089456 | |||
| 1898 | Ga0207675_100003916 | |||
| 1899 | Ga0207675_100028509 | |||
| 1900 | Ga0207675_100347690 | |||
| 1901 | Ga0207675_100535847 | |||
| 1902 | Ga0207683_10001409 | |||
| 1903 | Ga0207683_10003185 | |||
| 1904 | Ga0207683_10008275 | |||
| 1905 | Ga0207683_10157214 | |||
| 1906 | Ga0207698_10023118 | |||
| 1907 | Ga0207698_10580716 | |||
| 1908 | Ga0207698_10726438 | |||
| 1909 | Ga0207698_11016193 | |||
| 1910 | Ga0207698_11027911 | |||
| 1911 | Ga0265354_1002918 | |||
| 1912 | Ga0265356_1001038 | |||
| 1913 | Ga0265357_1016687 | |||
| 1914 | Ga0268266_10010616 | |||
| 1915 | Ga0268266_10016432 | |||
| 1916 | Ga0268266_10022973 | |||
| 1917 | Ga0268266_10069453 | |||
| 1918 | Ga0268266_10612105 | |||
| 1919 | Ga0268265_10008041 | |||
| 1920 | Ga0268265_10010190 | |||
| 1921 | Ga0268265_10011212 | |||
| 1922 | Ga0268265_10064504 | |||
| 1923 | Ga0268265_10173887 | |||
| 1924 | Ga0268265_12575186 | |||
| 1925 | Ga0268264_10029462 | |||
| 1926 | Ga0268264_10114613 | |||
| 1927 | Ga0268264_10206729 | |||
| 1928 | Ga0268264_10328737 | |||
| 1929 | Ga0268264_10858783 | |||
| 1930 | Ga0268264_11732312 | |||
| 1931 | Ga0265338_10366267 | |||
| 1932 | Ga0265338_10664423 | |||
| 1933 | Ga0265324_10097092 | |||
| 1934 | Ga0265762_1000907 | |||
| 1935 | Ga0265762_1000968 | |||
| 1936 | Ga0265762_1020333 | |||
| 1937 | Ga0265767_100578 | |||
| 1938 | Ga0265767_106418 | |||
| 1939 | Ga0265767_107469 | |||
| 1940 | Ga0265767_118022 | |||
| 1941 | Ga0265770_1043336 | |||
| 1942 | Ga0265765_1033887 | |||
| 1943 | Ga0265764_106760 | |||
| 1944 | Ga0265764_109953 | |||
| 1945 | Ga0265772_102055 | |||
| 1946 | Ga0265769_110075 | |||
| 1947 | Ga0265761_105066 | |||
| 1948 | Ga0265760_10000760 | |||
| 1949 | Ga0265760_10006169 | |||
| 1950 | Ga0265760_10007885 | |||
| 1951 | Ga0265760_10270872 | |||
| 1952 | Ga0265760_10391295 | |||
| 1953 | Ga0265339_10013837 | |||
| 1954 | Ga0265339_10039057 | |||
| 1955 | Ga0265339_10214360 | |||
| 1956 | Ga0265316_10156859 | |||
| 1957 | Ga0265316_10422021 | |||
| 1958 | Ga0265342_10034397 | |||
| 1959 | Ga0316214_1042541 | |||
| 1960 | Ga0373958_0018336 | |||
| 1961 | Ga0373926_0124230 | |||
| 1962 | Ga0373926_0280362 | |||
| 1963 | Ga0373928_0244700 | |||
| 1964 | Ga0373929_0071676 | |||
| 1965 | Ga0373934_0068424 | |||
| 1966 | Ga0373940_0008365 | |||
| 1967 | Ga0373944_0046181 | |||
| 1968 | Ga0373944_0069752 | |||
| 1969 | Ga0373949_0223132 | |||
| 1970 | Ga0373952_0047454 | |||
| 1971 | Ga0373923_0043438 | |||
| 1972 | Ga0373923_0402531 | |||
| 1973 | Ga0373936_0093679 | |||
| 1974 | Ga0373936_0310168 | |||
| 1975 | Ga0373941_0070115 | |||
| 1976 | Ga0373945_0037868 | |||
| 1977 | Ga0373945_0420655 | |||
| 1978 | Ga0373953_0011276 | |||
| 1979 | Ga0373954_0018501 | |||
| 1980 | Ga0373956_0004589 | |||
| 1981 | Ga0373960_0005780 | |||
| 1982 | Ga0373943_0004320 | |||
| 1983 | Ga0373943_0135186 | |||
| 1984 | Ga0373943_0153937 | |||
| 1985 | Ga0373946_0177858 | |||
| 1986 | Ga0373955_0016709 | |||
| 1987 | Ga0373924_0003920 | |||
| 1988 | Ga0373924_0564964 | |||
| 1989 | Ga0373931_0288387 | |||
| 1990 | Ga0373931_0519192 | |||
| 1991 | Ga0373931_1150392 | |||
| 1992 | Ga0373935_0019507 | |||
| 1993 | Ga0373935_0044180 | |||
| 1994 | Ga0373935_0143623 | |||
| 1995 | Ga0373935_1140703 | |||
| 1996 | Ga0373927_0029401 | |||
| 1997 | Ga0373927_0246544 | |||
| 1998 | Ga0373933_0004804 | |||
| 1999 | Ga0373933_0687072 | |||
| 2000 | Ga0373933_0920955 | |||
| 2001 | Ga0373947_0003005 | |||
| 2002 | Ga0373947_0078417 | |||
| 2003 | Ga0373947_0142134 | |||
| 2004 | Ga0373947_1097043 | |||
| 2005 | Ga0373937_0017007 | |||
| 2006 | Ga0373937_1098433 | |||
| 2007 | Ga0373925_0012009 | |||
| 2008 | Ga0373925_0014757 | |||
| 2009 | Ga0373925_0018946 | |||
| 2010 | Ga0373925_0168406 | |||
| 2011 | Ga0373925_0455209 | |||
| 2012 | Ga0373925_0592448 | |||
| 2013 | Ga0395905_0728054 | |||
| 2014 | Ga0395905_1287508 | |||
| 2015 | Ga0395901_1479426 | |||
| 2016 | Ga0242420_155402 | |||
| 2017 | Ga0453683_0701375 | |||
| 2018 | Ga0451576_0104474 | |||
| 2019 | Ga0451576_2545691 | |||
| 2020 | Ga0466967_0020158 | |||
| 2021 | Ga0466967_1000592 | |||
| 2022 | Ga0495590_0326935 | |||
| 2023 | Ga0495629_0238769 | |||
| 2024 | Ga0495653_0170350 | |||
| 2025 | Ga0495653_0423542 | |||
| 2026 | Ga0495580_0039772 | |||
| 2027 | Ga0495580_0055891 | |||
| 2028 | Ga0495580_0100516 | |||
| 2029 | Ga0495580_0301439 | |||
| 2030 | Ga0495580_0374294 | |||
| 2031 | Ga0495580_0603299 | |||
| 2032 | Ga0495582_0712738 | |||
| 2033 | Ga0495664_0534623 | |||
| 2034 | Ga0495628_1012020 | |||
| 2035 | Ga0495630_0456282 | |||
| 2036 | Ga0495630_0831662 | |||
| 2037 | Ga0495642_0376876 | |||
| 2038 | Ga0495652_0458319 | |||
| 2039 | Ga0495665_0184111 | |||
| 2040 | Ga0495665_0198157 | |||
| 2041 | Ga0495665_0601106 | |||
| 2042 | Ga0495635_0556779 | |||
| 2043 | Ga0495657_0216932 | |||
| 2044 | Ga0495657_0383544 | |||
| 2045 | Ga0495623_0726755 | |||
| 2046 | Ga0495647_0129741 | |||
| 2047 | Ga0495658_0008434 | |||
| 2048 | Ga0495669_0073356 | |||
| 2049 | Ga0495669_0612513 | |||
| 2050 | Ga0495581_0096374 | |||
| 2051 | Ga0495674_0018156 | |||
| 2052 | Ga0495680_0854298 | |||
| 2053 | Ga0495684_0955521 | |||
| 2054 | Ga0495602_0131222 | |||
| 2055 | Ga0496100_0160805 | |||
| 2056 | Ga0496100_0389054 | |||
| 2057 | Ga0496100_0980984 | |||
| 2058 | Ga0496101_0104472 | |||
| 2059 | Ga0496101_0212030 | |||
| 2060 | Ga0496102_0047268 | |||
| 2061 | Ga0496102_0090199 | |||
| 2062 | Ga0496102_0312206 | |||
| 2063 | Ga0496102_0490259 | |||
| 2064 | Ga0496102_0660215 | |||
| 2065 | Ga0496102_1028105 | |||
| 2066 | Ga0496102_1802607 | |||
| 2067 | Ga0496103_0205811 | |||
| 2068 | Ga0496103_0334071 | |||
| 2069 | Ga0496104_0441686 | |||
| 2070 | Ga0496104_1801783 | |||
| 2071 | Ga0496105_0071067 | |||
| 2072 | Ga0496105_0139502 | |||
| 2073 | Ga0496105_0417402 | |||
| 2074 | Ga0496105_0445402 | |||
| 2075 | Ga0496106_0138137 | |||
| 2076 | Ga0496106_0283730 | |||
| 2077 | Ga0496107_0134040 | |||
| 2078 | Ga0496107_1286998 | |||
| 2079 | Ga0496108_0000082 | |||
| 2080 | Ga0496108_0000248 | |||
| 2081 | Ga0496108_0380075 | |||
| 2082 | Ga0496108_0692321 | |||
| 2083 | Ga0496109_0000059 | |||
| 2084 | Ga0496109_0000263 | |||
| 2085 | Ga0496109_0029932 | |||
| 2086 | Ga0496109_1634394 | |||
| 2087 | Ga0496110_0002489 | |||
| 2088 | Ga0496110_0019038 | |||
| 2089 | Ga0496110_0125790 | |||
| 2090 | Ga0496111_0009375 | |||
| 2091 | Ga0496111_0050364 | |||
| 2092 | Ga0496112_0000027 | |||
| 2093 | Ga0496112_0000093 | |||
| 2094 | Ga0496112_0026932 | |||
| 2095 | Ga0496112_0030102 | |||
| 2096 | Ga0496112_0218977 | |||
| 2097 | Ga0496112_0339207 | |||
| 2098 | Ga0496112_0504572 | |||
| 2099 | Ga0496112_1151349 | |||
| 2100 | Ga0496112_1160394 | |||
| 2101 | Ga0496112_1332541 | |||
| 2102 | Ga0496113_0024975 | |||
| 2103 | Ga0496113_0034739 | |||
| 2104 | Ga0496113_0260941 | |||
| 2105 | Ga0496115_0025352 | |||
| 2106 | Ga0496115_1084333 | |||
| 2107 | Ga0496115_1114716 | |||
| 2108 | Ga0501296_011190 | |||
| 2109 | Ga0501297_022773 | |||
| 2110 | Ga0501083_0092313 | |||
| 2111 | nmdc:mga05p37_1331553_c1 | |||
| 2112 | nmdc:mga05p37_140451_c1 | |||
| 2113 | nmdc:mga05p37_1558011_c1 | |||
| 2114 | nmdc:mga0n895_1386519_c1 | |||
| 2115 | nmdc:mga0n895_18567_c1 | |||
| 2116 | nmdc:mga0n895_2407_c1 | |||
| 2117 | nmdc:mga0n895_536053_c1 | |||
| 2118 | nmdc:mga0n895_597_c1 | |||
| 2119 | nmdc:mga0n895_658297_c1 | |||
| 2120 | nmdc:mga0n895_919590_c1 | |||
| 2121 | nmdc:mga0rr50_1065906_c1 | |||
| 2122 | nmdc:mga0rr50_11425_c1 | |||
| 2123 | nmdc:mga0rr50_130690_c1 | |||
| 2124 | nmdc:mga0rr50_1664430_c1 | |||
| 2125 | nmdc:mga0rr50_63279_c1 | |||
| 2126 | nmdc:mga0rr50_86509_c1 | |||
| 2127 | nmdc:mga0rr50_88346_c1 | |||
| 2128 | nmdc:mga08x19_150186_c1 | |||
| 2129 | nmdc:mga08x19_839434_c1 | |||
| 2130 | nmdc:mga0a205_112080_c1 | |||
| 2131 | nmdc:mga0a205_128200_c1 | |||
| 2132 | nmdc:mga0a205_24861_c2 | |||
| 2133 | nmdc:mga0a205_4427_c1 | |||
| 2134 | nmdc:mga0a205_8827_c1 | |||
| 2135 | Ga0495601_0186966 | |||
| 2136 | Ga0495612_0318982 | |||
| 2137 | Ga0495619_0100542 | |||
| 2138 | Ga0495619_1169390 | |||
| 2139 | Ga0587093_039738 | |||
| 2140 | Ga0587083_0163463 | |||
| 2141 | Ga0587088_114181 | |||
| 2142 | Ga0587128_108391 | |||
| 2143 | Ga0587062_038339 | |||
| 2144 | Ga0587067_150974 | |||
| 2145 | Ga0587076_076568 | |||
| 2146 | Ga0587079_041339 | |||
| 2147 | Ga0587114_088008 | |||
| 2148 | Ga0587111_0041384 |