F489517

General Info

Members Datasets Scaffolds Average Seq Length
1072 356 2144 128

Family's Representative Sequence

Representative Sequence 3300046536|Ga0495587_0480134|Ga0495587_0480134_177_638
Length 153
Sequence LKQTRELTDGKNKKKELPEETGEGRIMTKSELNKYRNVLEAKQAELVQLVRNRDGIAIEKSPDALDEVQHAAERELAIRNLDRESNLLRNVRAALRRIEEGSFGVCLHCEEDISPKRLAAVPWTAFCIQCQEIADRSQGDSADNLDELLVNAA

Samples

Sample ID Description Type Environment
1 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
205 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
210 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
233 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.27
Metatranscriptomes 35.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 0.93
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 44.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495587_0480134 3300046536 Bacteria 688
2 Ga0007416J51690_1013359 3300003577 Bacteria 560
3 Ga0007416J51690_1025011 3300003577 Unclassified 840
4 Ga0007429J51699_1032875 3300003579 Unclassified 762
5 Ga0032354_1062511 3300003693 Unclassified 567
6 Ga0032354_1129990 3300003693 Unclassified 537
7 Ga0058859_10036752 3300004798 Bacteria 626
8 Ga0058859_11813184 3300004798 Unclassified 630
9 Ga0058863_10006110 3300004799 Bacteria 964
10 Ga0058863_10013946 3300004799 Bacteria 1438
11 Ga0058863_11422661 3300004799 Unclassified 572
12 Ga0058863_11901776 3300004799 Unclassified 855
13 Ga0058863_11909333 3300004799 Unclassified 731
14 Ga0058861_10027171 3300004800 Bacteria 778
15 Ga0058861_10035865 3300004800 Bacteria 893
16 Ga0058861_10036023 3300004800 Unclassified 559
17 Ga0058861_11706520 3300004800 Unclassified 596
18 Ga0058861_11913154 3300004800 Unclassified 534
19 Ga0058861_12073310 3300004800 Bacteria 667
20 Ga0058860_12213440 3300004801 Unclassified 745
21 Ga0058862_10116057 3300004803 Unclassified 562
22 Ga0058862_10228250 3300004803 Bacteria 670
23 Ga0058862_10278851 3300004803 Bacteria 676
24 Ga0058862_12178942 3300004803 Unclassified 570
25 Ga0058862_12428114 3300004803 Bacteria 504
26 Ga0058862_12686673 3300004803 Unclassified 748
27 Ga0058862_12802510 3300004803 Unclassified 584
28 Ga0058862_12804914 3300004803 Bacteria 1518
29 Ga0070658_10008829 3300005327 Bacteria 8104
30 Ga0070658_10226099 3300005327 Bacteria 1583
31 Ga0070658_10519613 3300005327 Bacteria 1029
32 Ga0070683_100000001 3300005329 Bacteria 529385
33 Ga0070683_100022915 3300005329 Bacteria 5582
34 Ga0070683_100038893 3300005329 Unclassified 4363
35 Ga0070683_100054219 3300005329 Bacteria 3718
36 Ga0070683_100061290 3300005329 Bacteria 3498
37 Ga0070683_100244381 3300005329 Bacteria 1707
38 Ga0070683_100656785 3300005329 Bacteria 1004
39 Ga0070683_100657397 3300005329 Bacteria 1003
40 Ga0070690_101244188 3300005330 Unclassified 595
41 Ga0070670_100893190 3300005331 Bacteria 805
42 Ga0068869_100067634 3300005334 Unclassified 2637
43 Ga0068869_100421917 3300005334 Bacteria 1101
44 Ga0068869_100720918 3300005334 Unclassified 852
45 Ga0068869_101424304 3300005334 Bacteria 614
46 Ga0070666_10168301 3300005335 Unclassified 1534
47 Ga0070666_10409305 3300005335 Unclassified 976
48 Ga0070680_100031554 3300005336 Bacteria 4261
49 Ga0070680_100252333 3300005336 Bacteria 1491
50 Ga0070682_100158440 3300005337 Bacteria 1561
51 Ga0068868_100024051 3300005338 Bacteria 4618
52 Ga0068868_100439309 3300005338 Bacteria 1133
53 Ga0070660_100014980 3300005339 Bacteria 5592
54 Ga0070689_100442340 3300005340 Bacteria 1105
55 Ga0070691_10006445 3300005341 Bacteria 5365
56 Ga0070691_10355526 3300005341 Unclassified 815
57 Ga0070687_100167317 3300005343 Unclassified 1305
58 Ga0070661_100703345 3300005344 Bacteria 824
59 Ga0070692_10219952 3300005345 Bacteria 1122
60 Ga0070668_101378446 3300005347 Unclassified 642
61 Ga0070671_101239316 3300005355 Unclassified 657
62 Ga0070673_100334150 3300005364 Bacteria 1341
63 Ga0070673_100765047 3300005364 Unclassified 890
64 Ga0070659_101615453 3300005366 Unclassified 579
65 Ga0070667_100092216 3300005367 Bacteria 2606
66 Ga0070667_100182268 3300005367 Unclassified 1857
67 Ga0070709_10092478 3300005434 Bacteria 1998
68 Ga0070709_10126660 3300005434 Bacteria 1738
69 Ga0070709_10206798 3300005434 Bacteria 1393
70 Ga0070709_10256376 3300005434 Bacteria 1262
71 Ga0070709_10297640 3300005434 Bacteria 1178
72 Ga0070709_10320184 3300005434 Unclassified 1138
73 Ga0070714_100025710 3300005435 Bacteria 4861
74 Ga0070714_100169245 3300005435 Bacteria 1982
75 Ga0070714_100257901 3300005435 Bacteria 1614
76 Ga0070714_100435930 3300005435 Bacteria 1243
77 Ga0070714_100441594 3300005435 Unclassified 1235
78 Ga0070713_100074305 3300005436 Unclassified 2880
79 Ga0070713_100110137 3300005436 Viruses 2400
80 Ga0070713_101081401 3300005436 Bacteria 775
81 Ga0070713_101095892 3300005436 Unclassified 770
82 Ga0070713_101487743 3300005436 Bacteria 657
83 Ga0070713_101895228 3300005436 Unclassified 578
84 Ga0070710_11199849 3300005437 Unclassified 561
85 Ga0070701_10553390 3300005438 Unclassified 755
86 Ga0070711_100004562 3300005439 Bacteria 8195
87 Ga0070711_100044240 3300005439 Bacteria 3021
88 Ga0070711_100064146 3300005439 Unclassified 2566
89 Ga0070711_100174741 3300005439 Unclassified 1640
90 Ga0070711_100226766 3300005439 Bacteria 1455
91 Ga0070711_100444574 3300005439 Bacteria 1060
92 Ga0070711_101398209 3300005439 Unclassified 609
93 Ga0070705_101071906 3300005440 Unclassified 658
94 Ga0070694_101224232 3300005444 Unclassified 630
95 Ga0070708_101124760 3300005445 Unclassified 735
96 Ga0070663_101315287 3300005455 Unclassified 638
97 Ga0070662_100025113 3300005457 Unclassified 4111
98 Ga0070681_10001226 3300005458 Bacteria 22320
99 Ga0070681_10193737 3300005458 Bacteria 1952
100 Ga0070681_10244197 3300005458 Bacteria 1709
101 Ga0070681_10367054 3300005458 Bacteria 1350
102 Ga0070681_11762422 3300005458 Unclassified 546
103 Ga0068867_100057154 3300005459 Unclassified 2889
104 Ga0068867_100179015 3300005459 Bacteria 1684
105 Ga0068867_100994803 3300005459 Unclassified 760
106 Ga0068867_102349879 3300005459 Bacteria 507
107 Ga0070679_100004342 3300005530 Bacteria 13093
108 Ga0070679_100034644 3300005530 Bacteria 5003
109 Ga0070684_100000055 3300005535 Bacteria 76528
110 Ga0070684_100000804 3300005535 Bacteria 21845
111 Ga0070684_100028183 3300005535 Bacteria 4749
112 Ga0070684_100288429 3300005535 Bacteria 1504
113 Ga0070684_100539954 3300005535 Bacteria 1081
114 Ga0070684_100567628 3300005535 Bacteria 1054
115 Ga0070684_101244647 3300005535 Bacteria 700
116 Ga0068853_100009043 3300005539 Bacteria 8023
117 Ga0068853_100009601 3300005539 Bacteria 7795
118 Ga0068853_100068604 3300005539 Bacteria 3083
119 Ga0068853_100386265 3300005539 Unclassified 1308
120 Ga0068853_100871243 3300005539 Bacteria 864
121 Ga0068853_101631797 3300005539 Bacteria 625
122 Ga0070695_101569537 3300005545 Unclassified 549
123 Ga0070696_100668232 3300005546 Unclassified 844
124 Ga0070696_101768278 3300005546 Bacteria 534
125 Ga0070693_101567328 3300005547 Bacteria 516
126 Ga0070665_100013006 3300005548 Bacteria 8382
127 Ga0070665_101368567 3300005548 Unclassified 717
128 Ga0068855_100002589 3300005563 Bacteria 22290
129 Ga0068855_100036280 3300005563 Bacteria 5869
130 Ga0068855_100040037 3300005563 Bacteria 5563
131 Ga0068855_100049370 3300005563 Bacteria 4963
132 Ga0068855_100083019 3300005563 Unclassified 3712
133 Ga0068855_100271247 3300005563 Unclassified 1887
134 Ga0068855_100316386 3300005563 Bacteria 1726
135 Ga0068855_101563392 3300005563 Bacteria 676
136 Ga0070664_100346943 3300005564 Unclassified 1349
137 Ga0070664_100439754 3300005564 Unclassified 1196
138 Ga0070664_101110834 3300005564 Bacteria 745
139 Ga0068857_100002208 3300005577 Bacteria 15847
140 Ga0068857_100107611 3300005577 Bacteria 2504
141 Ga0068854_100830986 3300005578 Unclassified 807
142 Ga0068854_101440149 3300005578 Bacteria 624
143 Ga0068856_100001254 3300005614 Bacteria 26685
144 Ga0068856_100107869 3300005614 Bacteria 2780
145 Ga0068856_100115246 3300005614 Unclassified 2687
146 Ga0068856_100188706 3300005614 Bacteria 2075
147 Ga0068856_100266548 3300005614 Bacteria 1729
148 Ga0068856_100608086 3300005614 Bacteria 1114
149 Ga0068856_102257916 3300005614 Unclassified 553
150 Ga0068852_100011174 3300005616 Bacteria 6745
151 Ga0068852_100223223 3300005616 Bacteria 1793
152 Ga0068852_100351687 3300005616 Bacteria 1439
153 Ga0068859_100168351 3300005617 Unclassified 2271
154 Ga0068859_100350553 3300005617 Bacteria 1571
155 Ga0068859_100367690 3300005617 Bacteria 1533
156 Ga0068859_100633120 3300005617 Bacteria 1162
157 Ga0068859_101154522 3300005617 Unclassified 853
158 Ga0068859_101412919 3300005617 Bacteria 768
159 Ga0068864_100021313 3300005618 Bacteria 5429
160 Ga0068851_10058786 3300005834 Unclassified 1965
161 Ga0068851_10184982 3300005834 Bacteria 1156
162 Ga0068851_10304360 3300005834 Bacteria 917
163 Ga0068870_10164181 3300005840 Bacteria 1320
164 Ga0068863_100041419 3300005841 Unclassified 4380
165 Ga0068863_100985331 3300005841 Bacteria 845
166 Ga0068863_101395987 3300005841 Bacteria 708
167 Ga0068858_100006091 3300005842 Bacteria 11764
168 Ga0068858_100056033 3300005842 Bacteria 3644
169 Ga0068858_100389088 3300005842 Bacteria 1339
170 Ga0068858_100480855 3300005842 Bacteria 1199
171 Ga0068858_101051510 3300005842 Unclassified 798
172 Ga0068860_100021448 3300005843 Bacteria 6254
173 Ga0068860_100047825 3300005843 Unclassified 4077
174 Ga0068860_100197021 3300005843 Bacteria 1951
175 Ga0068860_100430205 3300005843 Bacteria 1310
176 Ga0068860_100771280 3300005843 Bacteria 974
177 Ga0070717_10052611 3300006028 Bacteria 3355
178 Ga0070717_10121425 3300006028 Bacteria 2238
179 Ga0070717_10152411 3300006028 Bacteria 2000
180 Ga0070717_11045536 3300006028 Unclassified 744
181 Ga0070715_10138352 3300006163 Unclassified 1180
182 Ga0070715_10270897 3300006163 Bacteria 896
183 Ga0070716_100668203 3300006173 Bacteria 790
184 Ga0070716_101222833 3300006173 Unclassified 604
185 Ga0097621_100102184 3300006237 Unclassified 2413
186 Ga0097621_100116366 3300006237 Bacteria 2264
187 Ga0097621_100140014 3300006237 Unclassified 2067
188 Ga0097621_100163492 3300006237 Bacteria 1915
189 Ga0097621_100319702 3300006237 Bacteria 1374
190 Ga0097621_101587200 3300006237 Unclassified 622
191 Ga0097621_102024294 3300006237 Bacteria 550
192 Ga0068871_100024178 3300006358 Unclassified 4708
193 Ga0068871_100040183 3300006358 Bacteria 3746
194 Ga0068871_100064880 3300006358 Unclassified 2990
195 Ga0068871_100108329 3300006358 Bacteria 2335
196 Ga0068871_100326117 3300006358 Bacteria 1353
197 Ga0068871_100542290 3300006358 Unclassified 1053
198 Ga0068871_100618954 3300006358 Bacteria 986
199 Ga0068871_100790804 3300006358 Bacteria 874
200 Ga0068865_100051116 3300006881 Bacteria 2859
201 Ga0068865_101026261 3300006881 Unclassified 723
202 Ga0097620_100168354 3300006931 Unclassified 2271
203 Ga0097620_100350530 3300006931 Bacteria 1571
204 Ga0097620_100367690 3300006931 Bacteria 1533
205 Ga0097620_100633152 3300006931 Bacteria 1162
206 Ga0097620_101154447 3300006931 Unclassified 853
207 Ga0097620_101412936 3300006931 Bacteria 768
208 Ga0105240_10000829 3300009093 Bacteria 55949
209 Ga0105240_10093595 3300009093 Unclassified 3667
210 Ga0105240_10108584 3300009093 Unclassified 3362
211 Ga0105240_10332966 3300009093 Bacteria 1727
212 Ga0105240_10444469 3300009093 Bacteria 1452
213 Ga0105240_11242126 3300009093 Unclassified 788
214 Ga0105245_10020408 3300009098 Bacteria 5812
215 Ga0105245_10058904 3300009098 Unclassified 3458
216 Ga0105245_10083205 3300009098 Unclassified 2929
217 Ga0105245_10223221 3300009098 Bacteria 1819
218 Ga0105245_10248179 3300009098 Unclassified 1728
219 Ga0105245_11042230 3300009098 Bacteria 863
220 Ga0105247_10069579 3300009101 Bacteria 2197
221 Ga0105247_10350240 3300009101 Unclassified 1038
222 Ga0105247_10363326 3300009101 Bacteria 1021
223 Ga0105243_10063119 3300009148 Bacteria 2968
224 Ga0105243_10105483 3300009148 Unclassified 2348
225 Ga0105243_10837275 3300009148 Unclassified 910
226 Ga0105243_12012923 3300009148 Unclassified 612
227 Ga0105241_10025477 3300009174 Unclassified 4395
228 Ga0105241_10078194 3300009174 Unclassified 2584
229 Ga0105241_10127667 3300009174 Bacteria 2055
230 Ga0105242_10049623 3300009176 Unclassified 3416
231 Ga0105242_10074272 3300009176 Unclassified 2829
232 Ga0105242_10094868 3300009176 Bacteria 2517
233 Ga0105242_10157356 3300009176 Bacteria 1986
234 Ga0105242_10220513 3300009176 Bacteria 1695
235 Ga0105242_10346031 3300009176 Bacteria 1371
236 Ga0105242_10563877 3300009176 Bacteria 1094
237 Ga0105242_13045702 3300009176 Unclassified 519
238 Ga0105248_10004753 3300009177 Bacteria 15031
239 Ga0105248_10142004 3300009177 Unclassified 2709
240 Ga0105248_10459438 3300009177 Bacteria 1435
241 Ga0105248_10487646 3300009177 Bacteria 1389
242 Ga0105248_10799619 3300009177 Bacteria 1064
243 Ga0105248_11022121 3300009177 Bacteria 934
244 Ga0105237_10003993 3300009545 Bacteria 17248
245 Ga0105237_10040664 3300009545 Bacteria 4688
246 Ga0105237_10042692 3300009545 Bacteria 4572
247 Ga0105237_10147684 3300009545 Bacteria 2346
248 Ga0105238_10004598 3300009551 Bacteria 13650
249 Ga0105238_10010164 3300009551 Bacteria 9437
250 Ga0105238_10032511 3300009551 Bacteria 5308
251 Ga0105238_10059927 3300009551 Bacteria 3812
252 Ga0105238_10072953 3300009551 Bacteria 3427
253 Ga0105238_10162485 3300009551 Unclassified 2209
254 Ga0105238_10170378 3300009551 Bacteria 2153
255 Ga0105249_10166756 3300009553 Bacteria 2133
256 Ga0099796_10152405 3300010159 Bacteria 911
257 Ga0105239_10000926 3300010375 Bacteria 41589
258 Ga0105239_10022062 3300010375 Bacteria 7019
259 Ga0105239_10056505 3300010375 Unclassified 4305
260 Ga0105239_10085123 3300010375 Bacteria 3484
261 Ga0105239_10146928 3300010375 Unclassified 2630
262 Ga0105239_10197583 3300010375 Unclassified 2253
263 Ga0105239_11844964 3300010375 Unclassified 701
264 Ga0105239_12557853 3300010375 Bacteria 595
265 Ga0105246_10081902 3300011119 Bacteria 2302
266 Ga0105246_10166893 3300011119 Bacteria 1682
267 Ga0105246_10300499 3300011119 Bacteria 1296
268 Ga0105246_10392871 3300011119 Unclassified 1150
269 Ga0105246_10545120 3300011119 Unclassified 993
270 Ga0105246_10683099 3300011119 Unclassified 898
271 Ga0154019_127005 3300013044 Bacteria 757
272 Ga0154016_101392 3300013045 Bacteria 688
273 Ga0154012_152883 3300013059 Bacteria 685
274 Ga0154010_120373 3300013062 Bacteria 757
275 Ga0154010_178522 3300013062 Bacteria 675
276 Ga0157373_10374805 3300013100 Bacteria 1017
277 Ga0157371_10955368 3300013102 Bacteria 652
278 Ga0157370_10002259 3300013104 Bacteria 23408
279 Ga0157370_10006665 3300013104 Bacteria 12681
280 Ga0157370_10015036 3300013104 Bacteria 7888
281 Ga0157370_10658725 3300013104 Bacteria 957
282 Ga0157369_10001763 3300013105 Bacteria 26228
283 Ga0157369_10010501 3300013105 Bacteria 10539
284 Ga0157369_10020251 3300013105 Bacteria 7436
285 Ga0157369_10201472 3300013105 Bacteria 2089
286 Ga0157369_10244220 3300013105 Bacteria 1875
287 Ga0157374_10071396 3300013296 Bacteria 3273
288 Ga0157374_10146595 3300013296 Unclassified 2293
289 Ga0157374_10167973 3300013296 Unclassified 2139
290 Ga0157374_10203395 3300013296 Unclassified 1940
291 Ga0157374_10204469 3300013296 Bacteria 1935
292 Ga0157374_10370856 3300013296 Bacteria 1425
293 Ga0157374_12259327 3300013296 Unclassified 571
294 Ga0157378_10013083 3300013297 Bacteria 7259
295 Ga0157378_10037067 3300013297 Bacteria 4318
296 Ga0157378_10329109 3300013297 Bacteria 1486
297 Ga0157378_10355245 3300013297 Bacteria 1433
298 Ga0157378_10597681 3300013297 Unclassified 1114
299 Ga0157378_10816708 3300013297 Viruses 959
300 Ga0157378_11450252 3300013297 Unclassified 730
301 Ga0157378_11480992 3300013297 Unclassified 723
302 Ga0163162_10000923 3300013306 Bacteria 27271
303 Ga0163162_10005655 3300013306 Bacteria 12076
304 Ga0163162_10402041 3300013306 Bacteria 1502
305 Ga0163162_10629304 3300013306 Unclassified 1198
306 Ga0163162_12530344 3300013306 Unclassified 590
307 Ga0157372_10001934 3300013307 Bacteria 22481
308 Ga0157372_10073578 3300013307 Unclassified 3852
309 Ga0157372_10370841 3300013307 Bacteria 1668
310 Ga0157372_10819539 3300013307 Unclassified 1081
311 Ga0157372_10970089 3300013307 Unclassified 985
312 Ga0157375_10008225 3300013308 Bacteria 9130
313 Ga0157375_10204024 3300013308 Unclassified 2133
314 Ga0157375_10343638 3300013308 Bacteria 1658
315 Ga0157375_12366330 3300013308 Bacteria 634
316 Ga0163163_10003605 3300014325 Bacteria 13155
317 Ga0163163_10055316 3300014325 Bacteria 3922
318 Ga0163163_10509371 3300014325 Bacteria 1265
319 Ga0163163_10514585 3300014325 Bacteria 1259
320 Ga0163163_10778397 3300014325 Bacteria 1020
321 Ga0163163_11248862 3300014325 Bacteria 805
322 Ga0157380_10783863 3300014326 Bacteria 968
323 Ga0157379_10058078 3300014968 Unclassified 3458
324 Ga0157379_10251105 3300014968 Bacteria 1606
325 Ga0157379_10666931 3300014968 Bacteria 974
326 Ga0157376_10443107 3300014969 Bacteria 1265
327 Ga0157376_11169402 3300014969 Bacteria 797
328 Ga0182007_10210276 3300015262 Bacteria 683
329 Ga0182005_1302459 3300015265 Unclassified 505
330 Ga0163161_11603956 3300017792 Bacteria 574
331 Ga0184595_131066 3300019166 Bacteria 616
332 Ga0184596_108050 3300019176 Bacteria 534
333 Ga0184596_122188 3300019176 Unclassified 612
334 Ga0184592_113146 3300019177 Bacteria 751
335 Ga0184592_114756 3300019177 Unclassified 551
336 Ga0184592_115460 3300019177 Unclassified 599
337 Ga0184593_105699 3300019179 Unclassified 534
338 Ga0184593_108382 3300019179 Unclassified 629
339 Ga0184593_119644 3300019179 Bacteria 687
340 Ga0184593_132516 3300019179 Unclassified 629
341 Ga0184594_110722 3300019181 Unclassified 723
342 Ga0184594_122686 3300019181 Unclassified 528
343 Ga0184594_125428 3300019181 Bacteria 759
344 Ga0184598_129099 3300019182 Bacteria 890
345 Ga0184599_139300 3300019188 Bacteria 608
346 Ga0184599_145306 3300019188 Bacteria 598
347 Ga0184599_147059 3300019188 Unclassified 794
348 Ga0184600_102034 3300019190 Unclassified 555
349 Ga0184600_108952 3300019190 Unclassified 727
350 Ga0197907_10163410 3300020069 Unclassified 505
351 Ga0197907_10286402 3300020069 Bacteria 1296
352 Ga0197907_10312743 3300020069 Unclassified 962
353 Ga0197907_10430539 3300020069 Unclassified 799
354 Ga0197907_10476928 3300020069 Unclassified 791
355 Ga0197907_10739022 3300020069 Unclassified 628
356 Ga0197907_10758757 3300020069 Bacteria 682
357 Ga0197907_10823823 3300020069 Unclassified 615
358 Ga0197907_10966821 3300020069 Bacteria 1038
359 Ga0197907_10977523 3300020069 Bacteria 661
360 Ga0197907_11038682 3300020069 Bacteria 709
361 Ga0197907_11098372 3300020069 Unclassified 714
362 Ga0197907_11120220 3300020069 Unclassified 512
363 Ga0197907_11144601 3300020069 Bacteria 777
364 Ga0197907_11251078 3300020069 Unclassified 965
365 Ga0197907_11283622 3300020069 Unclassified 756
366 Ga0197907_11325985 3300020069 Unclassified 637
367 Ga0197907_11350630 3300020069 Unclassified 694
368 Ga0206356_10034966 3300020070 Unclassified 1111
369 Ga0206356_10091394 3300020070 Unclassified 875
370 Ga0206356_10092759 3300020070 Bacteria 644
371 Ga0206356_10244916 3300020070 Unclassified 556
372 Ga0206356_10324049 3300020070 Bacteria 1100
373 Ga0206356_10327438 3300020070 Unclassified 519
374 Ga0206356_10526821 3300020070 Unclassified 664
375 Ga0206356_10547674 3300020070 Unclassified 610
376 Ga0206356_10791083 3300020070 Unclassified 616
377 Ga0206356_11077895 3300020070 Bacteria 559
378 Ga0206356_11177492 3300020070 Unclassified 555
379 Ga0206356_11250494 3300020070 Bacteria 701
380 Ga0206356_11349583 3300020070 Unclassified 621
381 Ga0206356_11604026 3300020070 Bacteria 691
382 Ga0206356_11760482 3300020070 Unclassified 823
383 Ga0206349_1104886 3300020075 Unclassified 571
384 Ga0206349_1114993 3300020075 Unclassified 556
385 Ga0206349_1347378 3300020075 Bacteria 677
386 Ga0206349_1413762 3300020075 Unclassified 842
387 Ga0206349_1438462 3300020075 Unclassified 663
388 Ga0206349_1587264 3300020075 Unclassified 568
389 Ga0206349_1588263 3300020075 Unclassified 573
390 Ga0206349_1643279 3300020075 Unclassified 614
391 Ga0206349_1726888 3300020075 Bacteria 635
392 Ga0206349_1803995 3300020075 Bacteria 790
393 Ga0206349_1889273 3300020075 Unclassified 952
394 Ga0206355_1203027 3300020076 Unclassified 640
395 Ga0206355_1419348 3300020076 Unclassified 606
396 Ga0206355_1428624 3300020076 Unclassified 901
397 Ga0206355_1432907 3300020076 Bacteria 508
398 Ga0206355_1522010 3300020076 Unclassified 567
399 Ga0206355_1523680 3300020076 Unclassified 626
400 Ga0206355_1552828 3300020076 Unclassified 1264
401 Ga0206355_1621660 3300020076 Bacteria 896
402 Ga0206355_1634635 3300020076 Unclassified 748
403 Ga0206355_1659624 3300020076 Bacteria 1086
404 Ga0206351_10061856 3300020077 Unclassified 626
405 Ga0206351_10083253 3300020077 Unclassified 756
406 Ga0206351_10092054 3300020077 Bacteria 703
407 Ga0206351_10106405 3300020077 Unclassified 639
408 Ga0206351_10113413 3300020077 Unclassified 595
409 Ga0206351_10150188 3300020077 Bacteria 597
410 Ga0206351_10287561 3300020077 Unclassified 607
411 Ga0206351_10308606 3300020077 Unclassified 660
412 Ga0206351_10395597 3300020077 Bacteria 798
413 Ga0206351_10514131 3300020077 Bacteria 561
414 Ga0206351_10551231 3300020077 Unclassified 700
415 Ga0206351_10686524 3300020077 Unclassified 606
416 Ga0206351_10931400 3300020077 Unclassified 863
417 Ga0206352_10038551 3300020078 Unclassified 620
418 Ga0206352_10042034 3300020078 Unclassified 625
419 Ga0206352_10079511 3300020078 Bacteria 686
420 Ga0206352_10097143 3300020078 Unclassified 1529
421 Ga0206352_10141324 3300020078 Bacteria 999
422 Ga0206352_10325671 3300020078 Unclassified 912
423 Ga0206352_10375107 3300020078 Unclassified 607
424 Ga0206352_10398875 3300020078 Bacteria 555
425 Ga0206352_10403950 3300020078 Unclassified 570
426 Ga0206352_10495749 3300020078 Bacteria 690
427 Ga0206352_10509139 3300020078 Unclassified 578
428 Ga0206352_10520289 3300020078 Unclassified 839
429 Ga0206352_10710552 3300020078 Bacteria 638
430 Ga0206352_10734954 3300020078 Unclassified 702
431 Ga0206352_11197174 3300020078 Unclassified 523
432 Ga0206352_11224948 3300020078 Unclassified 700
433 Ga0206352_11263999 3300020078 Unclassified 636
434 Ga0206350_10002123 3300020080 Unclassified 601
435 Ga0206350_10186125 3300020080 Bacteria 830
436 Ga0206350_10271673 3300020080 Unclassified 1047
437 Ga0206350_10277469 3300020080 Bacteria 760
438 Ga0206350_10280083 3300020080 Unclassified 624
439 Ga0206350_10314210 3300020080 Unclassified 603
440 Ga0206350_10347331 3300020080 Unclassified 576
441 Ga0206350_10568611 3300020080 Unclassified 606
442 Ga0206350_10672396 3300020080 Unclassified 695
443 Ga0206350_10707583 3300020080 Unclassified 689
444 Ga0206350_10901464 3300020080 Unclassified 555
445 Ga0206350_10972182 3300020080 Unclassified 676
446 Ga0206350_11196424 3300020080 Unclassified 573
447 Ga0206350_11240623 3300020080 Unclassified 580
448 Ga0206350_11359846 3300020080 Unclassified 639
449 Ga0206350_11630401 3300020080 Unclassified 637
450 Ga0206354_10093064 3300020081 Unclassified 573
451 Ga0206354_10289752 3300020081 Unclassified 703
452 Ga0206354_10475303 3300020081 Unclassified 909
453 Ga0206354_10814056 3300020081 Bacteria 670
454 Ga0206354_10890264 3300020081 Bacteria 718
455 Ga0206354_11213096 3300020081 Unclassified 662
456 Ga0206354_11296545 3300020081 Bacteria 1082
457 Ga0206354_11479014 3300020081 Unclassified 630
458 Ga0206354_11493054 3300020081 Unclassified 735
459 Ga0206354_11647079 3300020081 Bacteria 553
460 Ga0206354_11706144 3300020081 Bacteria 624
461 Ga0206353_10158651 3300020082 Bacteria 703
462 Ga0206353_10572510 3300020082 Unclassified 610
463 Ga0206353_10866201 3300020082 Unclassified 679
464 Ga0206353_10976632 3300020082 Unclassified 619
465 Ga0206353_11042202 3300020082 Unclassified 578
466 Ga0206353_11337192 3300020082 Bacteria 1219
467 Ga0206353_11566893 3300020082 Unclassified 858
468 Ga0206353_11707724 3300020082 Unclassified 562
469 Ga0206353_11840281 3300020082 Unclassified 683
470 Ga0154015_1016038 3300020610 Unclassified 552
471 Ga0154015_1049429 3300020610 Unclassified 899
472 Ga0154015_1067378 3300020610 Bacteria 707
473 Ga0154015_1072462 3300020610 Unclassified 671
474 Ga0154015_1087282 3300020610 Unclassified 573
475 Ga0154015_1335253 3300020610 Bacteria 552
476 Ga0154015_1352349 3300020610 Bacteria 801
477 Ga0154015_1376847 3300020610 Bacteria 1733
478 Ga0154015_1510902 3300020610 Unclassified 551
479 Ga0154015_1550972 3300020610 Unclassified 637
480 Ga0154015_1638450 3300020610 Bacteria 1202
481 Ga0154015_1691846 3300020610 Unclassified 607
482 Ga0213875_10007485 3300021388 Bacteria 5630
483 Ga0213875_10260284 3300021388 Unclassified 819
484 Ga0224712_10105281 3300022467 Unclassified 1203
485 Ga0224712_10142192 3300022467 Bacteria 1057
486 Ga0224712_10150481 3300022467 Unclassified 1031
487 Ga0224712_10208253 3300022467 Unclassified 891
488 Ga0224712_10223459 3300022467 Bacteria 863
489 Ga0224712_10227935 3300022467 Bacteria 855
490 Ga0224712_10247429 3300022467 Bacteria 823
491 Ga0224712_10262858 3300022467 Bacteria 800
492 Ga0224712_10286167 3300022467 Unclassified 768
493 Ga0224712_10288503 3300022467 Bacteria 765
494 Ga0224712_10338083 3300022467 Unclassified 710
495 Ga0224712_10363854 3300022467 Unclassified 685
496 Ga0224712_10365560 3300022467 Unclassified 684
497 Ga0224712_10367148 3300022467 Bacteria 682
498 Ga0224712_10367804 3300022467 Bacteria 682
499 Ga0224712_10406662 3300022467 Unclassified 649
500 Ga0224712_10453664 3300022467 Unclassified 616
501 Ga0224712_10513098 3300022467 Unclassified 580
502 Ga0224712_10523685 3300022467 Bacteria 574
503 Ga0224712_10564328 3300022467 Unclassified 554
504 Ga0247551_103423 3300023552 Unclassified 608
505 Ga0247551_105418 3300023552 Unclassified 530
506 Ga0247553_111119 3300023672 Bacteria 523
507 Ga0207656_10262907 3300025321 Bacteria 848
508 Ga0207710_10100248 3300025900 Unclassified 1365
509 Ga0207710_10222260 3300025900 Unclassified 938
510 Ga0207680_10239761 3300025903 Bacteria 1249
511 Ga0207680_10382069 3300025903 Unclassified 993
512 Ga0207685_10558980 3300025905 Unclassified 609
513 Ga0207699_10331229 3300025906 Bacteria 1070
514 Ga0207699_10390028 3300025906 Bacteria 990
515 Ga0207699_10608186 3300025906 Bacteria 796
516 Ga0207699_10635269 3300025906 Unclassified 779
517 Ga0207699_10714513 3300025906 Bacteria 734
518 Ga0207645_10418558 3300025907 Unclassified 902
519 Ga0207705_10215742 3300025909 Bacteria 1456
520 Ga0207684_10895795 3300025910 Unclassified 746
521 Ga0207654_10009344 3300025911 Unclassified 4977
522 Ga0207654_10017392 3300025911 Unclassified 3757
523 Ga0207654_10023665 3300025911 Unclassified 3293
524 Ga0207654_10197787 3300025911 Bacteria 1322
525 Ga0207707_10037603 3300025912 Bacteria 4230
526 Ga0207707_10428463 3300025912 Bacteria 1133
527 Ga0207707_11449010 3300025912 Unclassified 546
528 Ga0207695_10001355 3300025913 Bacteria 41546
529 Ga0207695_10006537 3300025913 Bacteria 15093
530 Ga0207695_10024661 3300025913 Bacteria 6756
531 Ga0207695_10075817 3300025913 Bacteria 3421
532 Ga0207695_10371909 3300025913 Unclassified 1315
533 Ga0207695_11183479 3300025913 Unclassified 644
534 Ga0207671_10081536 3300025914 Bacteria 2426
535 Ga0207671_10106286 3300025914 Bacteria 2131
536 Ga0207671_11328503 3300025914 Bacteria 559
537 Ga0207693_10415347 3300025915 Bacteria 1052
538 Ga0207663_10035710 3300025916 Bacteria 2984
539 Ga0207663_10075867 3300025916 Bacteria 2183
540 Ga0207663_10170153 3300025916 Unclassified 1547
541 Ga0207663_10211060 3300025916 Unclassified 1407
542 Ga0207663_10315906 3300025916 Unclassified 1172
543 Ga0207663_10340171 3300025916 Bacteria 1133
544 Ga0207663_10473217 3300025916 Bacteria 969
545 Ga0207660_10046329 3300025917 Bacteria 3068
546 Ga0207657_10020879 3300025919 Bacteria 6181
547 Ga0207657_10038937 3300025919 Unclassified 4227
548 Ga0207657_10260454 3300025919 Bacteria 1380
549 Ga0207657_10437745 3300025919 Unclassified 1026
550 Ga0207649_10123326 3300025920 Bacteria 1750
551 Ga0207649_10283281 3300025920 Unclassified 1206
552 Ga0207649_11242558 3300025920 Unclassified 589
553 Ga0207652_10052648 3300025921 Bacteria 3495
554 Ga0207681_11693893 3300025923 Unclassified 528
555 Ga0207694_10000486 3300025924 Bacteria 36102
556 Ga0207694_10008252 3300025924 Bacteria 7872
557 Ga0207694_10036963 3300025924 Bacteria 3748
558 Ga0207694_10057844 3300025924 Bacteria 3015
559 Ga0207694_10077794 3300025924 Bacteria 2600
560 Ga0207694_10128618 3300025924 Bacteria 2028
561 Ga0207650_10757229 3300025925 Bacteria 822
562 Ga0207687_10003031 3300025927 Bacteria 11386
563 Ga0207687_10009317 3300025927 Bacteria 6422
564 Ga0207687_10055636 3300025927 Unclassified 2773
565 Ga0207687_10406608 3300025927 Unclassified 1121
566 Ga0207687_10577098 3300025927 Bacteria 946
567 Ga0207700_10009283 3300025928 Bacteria 6137
568 Ga0207700_10047296 3300025928 Bacteria 3188
569 Ga0207700_10130289 3300025928 Bacteria 2052
570 Ga0207700_10209698 3300025928 Bacteria 1646
571 Ga0207664_10010090 3300025929 Bacteria 6658
572 Ga0207664_10294525 3300025929 Bacteria 1427
573 Ga0207644_10256437 3300025931 Unclassified 1397
574 Ga0207644_10391657 3300025931 Unclassified 1134
575 Ga0207690_11302999 3300025932 Bacteria 607
576 Ga0207686_10024798 3300025934 Bacteria 3480
577 Ga0207686_10034301 3300025934 Bacteria 3036
578 Ga0207686_10080074 3300025934 Unclassified 2129
579 Ga0207686_10095777 3300025934 Bacteria 1970
580 Ga0207686_10109803 3300025934 Bacteria 1858
581 Ga0207686_10236013 3300025934 Bacteria 1328
582 Ga0207686_11265091 3300025934 Unclassified 605
583 Ga0207709_10039104 3300025935 Bacteria 2831
584 Ga0207709_10614814 3300025935 Unclassified 862
585 Ga0207709_10908798 3300025935 Unclassified 716
586 Ga0207709_11796403 3300025935 Unclassified 510
587 Ga0207670_10784218 3300025936 Unclassified 793
588 Ga0207669_10295227 3300025937 Unclassified 1229
589 Ga0207704_10882377 3300025938 Bacteria 751
590 Ga0207704_11249553 3300025938 Unclassified 634
591 Ga0207665_10306055 3300025939 Bacteria 1189
592 Ga0207665_10510214 3300025939 Unclassified 930
593 Ga0207665_10654607 3300025939 Bacteria 824
594 Ga0207665_11166410 3300025939 Bacteria 614
595 Ga0207711_10004077 3300025941 Bacteria 12536
596 Ga0207711_10938176 3300025941 Bacteria 804
597 Ga0207689_10100874 3300025942 Unclassified 2371
598 Ga0207689_10505756 3300025942 Bacteria 1012
599 Ga0207689_10713638 3300025942 Bacteria 846
600 Ga0207661_10000005 3300025944 Bacteria 557888
601 Ga0207661_10025795 3300025944 Bacteria 4472
602 Ga0207661_10050703 3300025944 Unclassified 3308
603 Ga0207661_10188557 3300025944 Bacteria 1806
604 Ga0207661_10393579 3300025944 Bacteria 1256
605 Ga0207679_10175003 3300025945 Unclassified 1771
606 Ga0207679_11391241 3300025945 Bacteria 644
607 Ga0207667_10002176 3300025949 Bacteria 24579
608 Ga0207667_10003779 3300025949 Bacteria 18654
609 Ga0207667_10051139 3300025949 Unclassified 4357
610 Ga0207667_10071077 3300025949 Bacteria 3620
611 Ga0207667_10088668 3300025949 Unclassified 3198
612 Ga0207667_10144205 3300025949 Bacteria 2452
613 Ga0207667_10306893 3300025949 Unclassified 1621
614 Ga0207667_10854959 3300025949 Bacteria 904
615 Ga0207651_10318233 3300025960 Bacteria 1300
616 Ga0207651_10602773 3300025960 Unclassified 960
617 Ga0207651_11325089 3300025960 Unclassified 647
618 Ga0207712_10145673 3300025961 Bacteria 1823
619 Ga0207712_10505903 3300025961 Bacteria 1033
620 Ga0207640_11261932 3300025981 Bacteria 659
621 Ga0207640_11515428 3300025981 Bacteria 603
622 Ga0207658_10244451 3300025986 Bacteria 1522
623 Ga0207658_10545478 3300025986 Unclassified 1037
624 Ga0207677_10317416 3300026023 Unclassified 1294
625 Ga0207677_10810944 3300026023 Unclassified 838
626 Ga0207677_11495811 3300026023 Unclassified 623
627 Ga0207703_10026180 3300026035 Bacteria 4589
628 Ga0207703_10028191 3300026035 Bacteria 4424
629 Ga0207703_10483307 3300026035 Bacteria 1161
630 Ga0207703_10732030 3300026035 Bacteria 942
631 Ga0207703_11474770 3300026035 Unclassified 654
632 Ga0207639_10031691 3300026041 Bacteria 3887
633 Ga0207639_10510184 3300026041 Bacteria 1100
634 Ga0207639_10672018 3300026041 Bacteria 959
635 Ga0207639_10827326 3300026041 Bacteria 864
636 Ga0207678_10668483 3300026067 Unclassified 913
637 Ga0207708_10962309 3300026075 Unclassified 741
638 Ga0207702_10006005 3300026078 Bacteria 10542
639 Ga0207702_10085210 3300026078 Unclassified 2753
640 Ga0207702_10242169 3300026078 Unclassified 1690
641 Ga0207702_10624992 3300026078 Bacteria 1058
642 Ga0207702_10666763 3300026078 Bacteria 1024
643 Ga0207702_11818994 3300026078 Unclassified 601
644 Ga0207641_10031537 3300026088 Unclassified 4396
645 Ga0207641_10920370 3300026088 Bacteria 869
646 Ga0207648_10114069 3300026089 Unclassified 2374
647 Ga0207648_10295481 3300026089 Bacteria 1451
648 Ga0207648_11589517 3300026089 Unclassified 614
649 Ga0207648_11826327 3300026089 Unclassified 569
650 Ga0207676_10019659 3300026095 Bacteria 4931
651 Ga0207674_10000361 3300026116 Bacteria 58920
652 Ga0207674_10002055 3300026116 Bacteria 25558
653 Ga0207674_10024159 3300026116 Bacteria 6498
654 Ga0207674_10697052 3300026116 Bacteria 980
655 Ga0207675_100472765 3300026118 Bacteria 1245
656 Ga0207698_10001862 3300026142 Bacteria 12313
657 Ga0207698_10048734 3300026142 Bacteria 3218
658 Ga0207698_10289891 3300026142 Bacteria 1518
659 Ga0207698_10733726 3300026142 Unclassified 985
660 Ga0207698_11211148 3300026142 Bacteria 769
661 Ga0268266_10007479 3300028379 Bacteria 9846
662 Ga0268266_11176573 3300028379 Unclassified 742
663 Ga0268264_10064789 3300028381 Unclassified 3077
664 Ga0268264_10285804 3300028381 Bacteria 1547
665 Ga0268264_10302641 3300028381 Bacteria 1506
666 Ga0268264_11181187 3300028381 Unclassified 774
667 Ga0265323_10001695 3300028653 Bacteria 10527
668 Ga0265338_10159741 3300028800 Bacteria 1742
669 Ga0265762_1016992 3300030760 Unclassified 1322
670 Ga0265762_1081893 3300030760 Unclassified 692
671 Ga0265762_1145244 3300030760 Bacteria 561
672 Ga0265775_114080 3300030762 Unclassified 528
673 Ga0265767_105531 3300030836 Unclassified 768
674 Ga0265767_106996 3300030836 Bacteria 712
675 Ga0265767_113693 3300030836 Unclassified 571
676 Ga0265766_1005331 3300030863 Bacteria 813
677 Ga0265766_1011308 3300030863 Unclassified 647
678 Ga0265766_1012062 3300030863 Unclassified 635
679 Ga0265766_1015637 3300030863 Bacteria 588
680 Ga0265766_1022342 3300030863 Bacteria 528
681 Ga0265777_112541 3300030877 Unclassified 639
682 Ga0265777_113152 3300030877 Unclassified 629
683 Ga0265777_121229 3300030877 Unclassified 538
684 Ga0265776_104550 3300030880 Bacteria 708
685 Ga0265776_111230 3300030880 Bacteria 538
686 Ga0265764_108395 3300030882 Bacteria 624
687 Ga0265764_110609 3300030882 Unclassified 584
688 Ga0265772_103116 3300030886 Bacteria 675
689 Ga0265769_109336 3300030888 Unclassified 657
690 Ga0265769_117898 3300030888 Unclassified 545
691 Ga0265769_118683 3300030888 Bacteria 538
692 Ga0265761_104165 3300030889 Unclassified 730
693 Ga0247549_101811 3300030942 Unclassified 732
694 Ga0247549_102985 3300030942 Unclassified 614
695 Ga0265768_102420 3300030963 Bacteria 951
696 Ga0265768_103921 3300030963 Unclassified 819
697 Ga0265768_104251 3300030963 Bacteria 801
698 Ga0265768_105373 3300030963 Unclassified 744
699 Ga0265768_105600 3300030963 Unclassified 733
700 Ga0265768_107355 3300030963 Bacteria 669
701 Ga0265768_108783 3300030963 Unclassified 632
702 Ga0265768_110710 3300030963 Bacteria 592
703 Ga0265768_113662 3300030963 Bacteria 551
704 Ga0265768_116321 3300030963 Unclassified 521
705 Ga0265768_117686 3300030963 Unclassified 507
706 Ga0265771_1018396 3300031010 Unclassified 587
707 Ga0265771_1027765 3300031010 Unclassified 527
708 Ga0265774_106374 3300031011 Bacteria 529
709 Ga0265773_1003870 3300031018 Unclassified 1007
710 Ga0265773_1024359 3300031018 Unclassified 616
711 Ga0265760_10067456 3300031090 Bacteria 1094
712 Ga0265760_10209722 3300031090 Unclassified 661
713 Ga0265760_10303651 3300031090 Unclassified 566
714 Ga0265760_10307115 3300031090 Unclassified 563
715 Ga0265328_10180763 3300031239 Unclassified 798
716 Ga0265325_10125088 3300031241 Bacteria 1236
717 Ga0265339_10065374 3300031249 Unclassified 1950
718 Ga0265331_10230953 3300031250 Bacteria 831
719 Ga0265316_10014783 3300031344 Bacteria 6852
720 Ga0265316_10038490 3300031344 Bacteria 3853
721 Ga0265316_10196052 3300031344 Bacteria 1499
722 Ga0265316_10198072 3300031344 Unclassified 1490
723 Ga0265316_10450397 3300031344 Unclassified 923
724 Ga0265313_10007638 3300031595 Bacteria 7333
725 Ga0265313_10255839 3300031595 Bacteria 713
726 Ga0310103_139079 3300031614 Unclassified 549
727 Ga0310111_133895 3300031667 Unclassified 585
728 Ga0265314_10011041 3300031711 Bacteria 7489
729 Ga0265314_10282918 3300031711 Unclassified 937
730 Ga0265314_10362416 3300031711 Unclassified 794
731 Ga0265342_10146176 3300031712 Unclassified 1316
732 Ga0265342_10225076 3300031712 Bacteria 1009
733 Ga0247548_104373 3300031814 Unclassified 653
734 Ga0247548_104387 3300031814 Unclassified 653
735 Ga0247548_105395 3300031814 Unclassified 605
736 Ga0247548_107682 3300031814 Bacteria 539
737 Ga0316042_120450 3300031816 Unclassified 710
738 Ga0316042_124683 3300031816 Bacteria 599
739 Ga0316043_123481 3300031828 Unclassified 662
740 Ga0307411_12286721 3300032005 Unclassified 508
741 Ga0316053_107474 3300032120 Bacteria 726
742 Ga0316053_112606 3300032120 Unclassified 607
743 Ga0316053_112983 3300032120 Unclassified 601
744 Ga0316053_119800 3300032120 Unclassified 522
745 Ga0373926_0260165 3300035083 Unclassified 674
746 Ga0373926_0448359 3300035083 Unclassified 512
747 Ga0373934_0006374 3300035086 Unclassified 4376
748 Ga0373934_0026633 3300035086 Bacteria 2243
749 Ga0373934_0052051 3300035086 Unclassified 1623
750 Ga0373934_0187541 3300035086 Bacteria 850
751 Ga0373944_0042562 3300035089 Unclassified 1409
752 Ga0373923_0011794 3300035111 Bacteria 3217
753 Ga0373923_0034984 3300035111 Bacteria 2042
754 Ga0373923_0256953 3300035111 Bacteria 819
755 Ga0373936_0229698 3300035113 Bacteria 825
756 Ga0373936_0605373 3300035113 Bacteria 515
757 Ga0373941_0470512 3300035115 Unclassified 530
758 Ga0373953_0027981 3300035117 Bacteria 2170
759 Ga0373953_0102277 3300035117 Unclassified 1207
760 Ga0373953_0283290 3300035117 Unclassified 722
761 Ga0373953_0349863 3300035117 Bacteria 647
762 Ga0373953_0462313 3300035117 Unclassified 561
763 Ga0373954_0035650 3300035118 Bacteria 2308
764 Ga0373954_0047998 3300035118 Bacteria 2000
765 Ga0373954_0051631 3300035118 Bacteria 1931
766 Ga0373954_0103732 3300035118 Bacteria 1373
767 Ga0373954_0313979 3300035118 Unclassified 773
768 Ga0373956_0085248 3300035119 Unclassified 1453
769 Ga0373956_0095264 3300035119 Bacteria 1376
770 Ga0373943_0034131 3300035170 Unclassified 2426
771 Ga0373943_0572867 3300035170 Bacteria 663
772 Ga0373946_0154161 3300035171 Bacteria 1074
773 Ga0373955_0026031 3300035172 Bacteria 3009
774 Ga0373955_0041996 3300035172 Bacteria 2454
775 Ga0373955_0188013 3300035172 Bacteria 1227
776 Ga0373955_0219194 3300035172 Bacteria 1136
777 Ga0373955_0322560 3300035172 Bacteria 933
778 Ga0373955_0724206 3300035172 Bacteria 611
779 Ga0373924_0103536 3300035410 Bacteria 1226
780 Ga0373924_0119838 3300035410 Unclassified 1141
781 Ga0373924_0153523 3300035410 Bacteria 1008
782 Ga0373924_0153887 3300035410 Unclassified 1007
783 Ga0373935_0049020 3300035692 Bacteria 2676
784 Ga0373935_0125561 3300035692 Bacteria 1719
785 Ga0373935_0197072 3300035692 Bacteria 1390
786 Ga0373935_0353913 3300035692 Unclassified 1047
787 Ga0373935_0645587 3300035692 Bacteria 776
788 Ga0373927_0009527 3300035695 Bacteria 6513
789 Ga0373927_0009834 3300035695 Bacteria 6410
790 Ga0373927_0202633 3300035695 Bacteria 1303
791 Ga0373927_0470575 3300035695 Unclassified 830
792 Ga0373927_0585743 3300035695 Bacteria 737
793 Ga0373927_0613715 3300035695 Unclassified 719
794 Ga0373933_0096385 3300035724 Bacteria 1831
795 Ga0373933_0245989 3300035724 Unclassified 1151
796 Ga0373933_0308105 3300035724 Bacteria 1026
797 Ga0373933_0361868 3300035724 Bacteria 943
798 Ga0373933_0374373 3300035724 Bacteria 927
799 Ga0373947_0057530 3300035725 Unclassified 2353
800 Ga0373947_0099908 3300035725 Bacteria 1822
801 Ga0373947_0180196 3300035725 Bacteria 1375
802 Ga0373947_0266469 3300035725 Unclassified 1136
803 Ga0373947_0270836 3300035725 Bacteria 1127
804 Ga0373947_0298871 3300035725 Bacteria 1073
805 Ga0373937_0001443 3300036401 Bacteria 19880
806 Ga0373937_0033209 3300036401 Bacteria 4685
807 Ga0373937_0047511 3300036401 Bacteria 3927
808 Ga0373937_0111072 3300036401 Bacteria 2550
809 Ga0373937_0115609 3300036401 Bacteria 2498
810 Ga0373937_0178912 3300036401 Bacteria 1991
811 Ga0373937_0214781 3300036401 Bacteria 1810
812 Ga0373937_0369841 3300036401 Unclassified 1359
813 Ga0373937_0505633 3300036401 Unclassified 1148
814 Ga0373937_1445312 3300036401 Bacteria 635
815 Ga0265778_034197 3300036457 Bacteria 664
816 Ga0265778_034457 3300036457 Unclassified 662
817 Ga0265778_035199 3300036457 Bacteria 657
818 Ga0265778_035321 3300036457 Bacteria 656
819 Ga0265778_049605 3300036457 Unclassified 572
820 Ga0265778_052249 3300036457 Unclassified 561
821 Ga0265778_055338 3300036457 Bacteria 549
822 Ga0265778_059524 3300036457 Unclassified 533
823 Ga0265778_062280 3300036457 Bacteria 523
824 Ga0265778_063876 3300036457 Bacteria 517
825 Ga0372808_062442 3300036459 Unclassified 536
826 Ga0310109_029066 3300036534 Unclassified 735
827 Ga0373925_0014727 3300037068 Bacteria 5650
828 Ga0373925_0050539 3300037068 Unclassified 3101
829 Ga0373925_0156161 3300037068 Bacteria 1795
830 Ga0373925_0193112 3300037068 Bacteria 1616
831 Ga0373925_0571288 3300037068 Unclassified 930
832 Ga0436364_0483352 3300037853 Unclassified 880
833 Ga0436364_1424611 3300037853 Unclassified 3357
834 Ga0436361_0609805 3300039447 Unclassified 634
835 Ga0436362_0834658 3300039453 Unclassified 660
836 Ga0451839_1486827 3300041496 Bacteria 960
837 Ga0451577_0744043 3300042876 Unclassified 887
838 Ga0453683_0665519 3300044673 Bacteria 681
839 Ga0453683_1181748 3300044673 Bacteria 512
840 Ga0451576_0093362 3300045051 Unclassified 3129
841 Ga0451576_0216282 3300045051 Unclassified 2001
842 Ga0495592_0037718 3300046454 Bacteria 3637
843 Ga0495603_0439947 3300046455 Unclassified 747
844 Ga0495651_0088399 3300046462 Bacteria 2328
845 Ga0495651_0231365 3300046462 Bacteria 1273
846 Ga0495651_0269354 3300046462 Bacteria 1155
847 Ga0495653_0357491 3300046463 Unclassified 938
848 Ga0495653_0495917 3300046463 Bacteria 762
849 Ga0495580_0002824 3300046472 Bacteria 14930
850 Ga0495580_0014057 3300046472 Bacteria 6087
851 Ga0495580_0073559 3300046472 Bacteria 2386
852 Ga0495580_0093911 3300046472 Unclassified 2087
853 Ga0495580_0149751 3300046472 Bacteria 1617
854 Ga0495580_0314626 3300046472 Unclassified 1065
855 Ga0495580_0865340 3300046472 Unclassified 583
856 Ga0495582_0024647 3300046473 Bacteria 3292
857 Ga0495639_0065672 3300046475 Unclassified 1669
858 Ga0495664_0009808 3300046477 Bacteria 5368
859 Ga0495584_0380670 3300046491 Unclassified 717
860 Ga0495594_0135237 3300046499 Unclassified 1397
861 Ga0495608_0097082 3300046511 Bacteria 1903
862 Ga0495608_0256644 3300046511 Bacteria 1089
863 Ga0495608_0317436 3300046511 Unclassified 963
864 Ga0495618_0057915 3300046514 Bacteria 2454
865 Ga0495628_0056689 3300046516 Bacteria 3083
866 Ga0495628_0230076 3300046516 Bacteria 1390
867 Ga0495628_0563263 3300046516 Bacteria 817
868 Ga0495628_0601798 3300046516 Unclassified 785
869 Ga0495630_0158571 3300046517 Bacteria 1723
870 Ga0495666_0259402 3300046526 Unclassified 791
871 Ga0495666_0314441 3300046526 Unclassified 707
872 Ga0495666_0528245 3300046526 Unclassified 527
873 Ga0495652_0054747 3300046529 Bacteria 3396
874 Ga0495665_0085093 3300046531 Unclassified 1662
875 Ga0495665_0130196 3300046531 Bacteria 1317
876 Ga0495665_0276636 3300046531 Unclassified 861
877 Ga0495665_0594338 3300046531 Bacteria 553
878 Ga0495640_0042576 3300046533 Bacteria 3166
879 Ga0495586_0137070 3300046535 Unclassified 1372
880 Ga0495587_0002664 3300046536 Bacteria 11919
881 Ga0495587_0100531 3300046536 Unclassified 1667
882 Ga0495598_0282068 3300046537 Bacteria 624
883 Ga0495645_0009769 3300046543 Bacteria 6713
884 Ga0495645_0149465 3300046543 Unclassified 1624
885 Ga0495645_0191205 3300046543 Unclassified 1395
886 Ga0495645_0445545 3300046543 Bacteria 817
887 Ga0495667_0018037 3300046559 Bacteria 4768
888 Ga0495667_0063533 3300046559 Bacteria 2416
889 Ga0495667_0105123 3300046559 Bacteria 1825
890 Ga0495634_0082539 3300046642 Bacteria 2100
891 Ga0495635_0057514 3300046663 Bacteria 2675
892 Ga0495635_0368607 3300046663 Unclassified 957
893 Ga0495588_0397347 3300046674 Bacteria 724
894 Ga0495599_0018742 3300046678 Unclassified 4313
895 Ga0495599_0055259 3300046678 Unclassified 2487
896 Ga0495623_0176017 3300046679 Bacteria 1246
897 Ga0495623_0261789 3300046679 Bacteria 969
898 Ga0495646_0171974 3300046680 Bacteria 1193
899 Ga0495613_0047957 3300046689 Bacteria 3155
900 Ga0495624_0700896 3300046690 Unclassified 601
901 Ga0495600_0044898 3300046809 Bacteria 2882
902 Ga0495581_0237527 3300047315 Bacteria 1066
903 Ga0495581_0497618 3300047315 Unclassified 709
904 Ga0495604_0359783 3300047317 Bacteria 965
905 Ga0495636_0183151 3300047318 Bacteria 951
906 Ga0495674_0011815 3300047319 Bacteria 8232
907 Ga0495674_0037580 3300047319 Bacteria 4351
908 Ga0495674_0321693 3300047319 Bacteria 1260
909 Ga0495680_0059182 3300047322 Bacteria 2959
910 Ga0495680_0228717 3300047322 Bacteria 1325
911 Ga0495675_0076480 3300047444 Bacteria 2110
912 Ga0495675_0381919 3300047444 Bacteria 824
913 Ga0495675_0393300 3300047444 Unclassified 809
914 Ga0495684_0008037 3300047471 Bacteria 8157
915 Ga0495684_0031099 3300047471 Bacteria 4098
916 Ga0495684_0077934 3300047471 Bacteria 2515
917 Ga0495684_0120513 3300047471 Unclassified 1976
918 Ga0495684_0639423 3300047471 Bacteria 713
919 Ga0495593_0648413 3300047673 Bacteria 530
920 Ga0495602_0051852 3300048088 Bacteria 3650
921 Ga0495602_0093611 3300048088 Bacteria 2486
922 Ga0496104_0101947 3300048907 Bacteria 2749
923 Ga0496104_0438639 3300048907 Unclassified 1218
924 Ga0496104_1882721 3300048907 Bacteria 500
925 Ga0496106_0308257 3300048909 Bacteria 1270
926 Ga0496109_1602131 3300048912 Bacteria 585
927 Ga0496112_0995844 3300048915 Unclassified 758
928 Ga0496112_1368449 3300048915 Bacteria 623
929 Ga0496115_0121493 3300048918 Bacteria 2149
930 Ga0496115_0198712 3300048918 Bacteria 1656
931 Ga0496115_0239406 3300048918 Unclassified 1496
932 Ga0501315_026868 3300049531 Unclassified 809
933 Ga0501315_081096 3300049531 Unclassified 551
934 Ga0501317_083756 3300049533 Unclassified 555
935 Ga0501318_067550 3300049534 Unclassified 559
936 Ga0501031_0130126 3300049568 Bacteria 1644
937 Ga0501032_0004512 3300049569 Bacteria 10477
938 Ga0501033_0018380 3300049570 Bacteria 5279
939 Ga0501033_0884578 3300049570 Unclassified 601
940 Ga0501034_0055543 3300049571 Bacteria 3984
941 Ga0501036_0000169 3300049572 Bacteria 43136
942 Ga0501037_0011724 3300049573 Bacteria 6453
943 Ga0501038_0002204 3300049574 Bacteria 18117
944 Ga0501039_0175851 3300049575 Bacteria 1683
945 Ga0501043_0003790 3300049579 Bacteria 12424
946 Ga0501046_0002817 3300049580 Bacteria 16196
947 Ga0501047_0017475 3300049581 Bacteria 6870
948 Ga0501048_0025322 3300049582 Bacteria 4324
949 Ga0501067_0003565 3300049583 Bacteria 8569
950 Ga0501068_0005161 3300049584 Bacteria 7120
951 Ga0501069_0001178 3300049585 Bacteria 12696
952 Ga0501070_0050742 3300049586 Bacteria 3443
953 Ga0501072_0000228 3300049588 Bacteria 41400
954 Ga0501072_0406388 3300049588 Bacteria 1080
955 Ga0501073_0193908 3300049589 Bacteria 1405
956 Ga0501074_0197581 3300049590 Bacteria 1433
957 Ga0501076_0928061 3300049592 Unclassified 717
958 Ga0501077_0028626 3300049593 Bacteria 3541
959 Ga0501079_0014673 3300049741 Bacteria 5973
960 Ga0501080_0004398 3300049742 Bacteria 12521
961 Ga0501083_0002357 3300049744 Bacteria 12934
962 Ga0501035_0136922 3300049822 Bacteria 2131
963 Ga0501044_0116689 3300049823 Bacteria 2674
964 Ga0495601_0794973 3300053077 Bacteria 601
965 Ga0495595_0306611 3300053084 Bacteria 799
966 Ga0495619_0752095 3300053085 Bacteria 661
967 Ga0500568_0001338 3300053139 Bacteria 16133
968 Ga0501084_0092592 3300054114 Bacteria 2537
969 Ga0587084_090064 3300059477 Unclassified 607
970 Ga0587093_047786 3300059478 Unclassified 667
971 Ga0587093_050051 3300059478 Bacteria 657
972 Ga0587093_065788 3300059478 Unclassified 600
973 Ga0587093_068119 3300059478 Bacteria 593
974 Ga0587066_061551 3300059490 Bacteria 767
975 Ga0587066_102918 3300059490 Bacteria 651
976 Ga0587066_104024 3300059490 Unclassified 649
977 Ga0587066_146328 3300059490 Unclassified 582
978 Ga0587066_153999 3300059490 Bacteria 572
979 Ga0587073_0052707 3300059492 Unclassified 928
980 Ga0587073_0069974 3300059492 Unclassified 845
981 Ga0587073_0109333 3300059492 Unclassified 730
982 Ga0587073_0126078 3300059492 Bacteria 697
983 Ga0587073_0146779 3300059492 Unclassified 663
984 Ga0587073_0190954 3300059492 Unclassified 608
985 Ga0587073_0193838 3300059492 Bacteria 605
986 Ga0587073_0260070 3300059492 Unclassified 548
987 Ga0587073_0265993 3300059492 Unclassified 544
988 Ga0587077_040997 3300059493 Unclassified 929
989 Ga0587077_097589 3300059493 Unclassified 701
990 Ga0587077_100953 3300059493 Bacteria 693
991 Ga0587080_094101 3300059503 Unclassified 632
992 Ga0587080_135879 3300059503 Unclassified 558
993 Ga0587082_088263 3300059504 Unclassified 657
994 Ga0587082_104567 3300059504 Unclassified 621
995 Ga0587082_123694 3300059504 Unclassified 587
996 Ga0587083_0168097 3300059505 Unclassified 605
997 Ga0587083_0168412 3300059505 Bacteria 605
998 Ga0587083_0206380 3300059505 Unclassified 564
999 Ga0587083_0237041 3300059505 Unclassified 538
1000 Ga0587083_0258100 3300059505 Unclassified 522
1001 Ga0587085_105987 3300059506 Unclassified 600
1002 Ga0587085_120242 3300059506 Bacteria 576
1003 Ga0587085_141271 3300059506 Bacteria 547
1004 Ga0587086_055793 3300059507 Unclassified 647
1005 Ga0587086_068505 3300059507 Unclassified 605
1006 Ga0587086_086595 3300059507 Unclassified 560
1007 Ga0587089_074111 3300059509 Unclassified 583
1008 Ga0587089_078824 3300059509 Unclassified 570
1009 Ga0587089_110288 3300059509 Unclassified 507
1010 Ga0587090_065786 3300059510 Unclassified 698
1011 Ga0587090_081775 3300059510 Unclassified 648
1012 Ga0587090_124410 3300059510 Bacteria 562
1013 Ga0587091_078069 3300059511 Unclassified 738
1014 Ga0587091_082016 3300059511 Bacteria 725
1015 Ga0587091_137550 3300059511 Unclassified 609
1016 Ga0587091_140650 3300059511 Unclassified 604
1017 Ga0587091_150925 3300059511 Unclassified 590
1018 Ga0587091_173606 3300059511 Bacteria 562
1019 Ga0587091_188868 3300059511 Unclassified 546
1020 Ga0587091_194360 3300059511 Bacteria 541
1021 Ga0587091_201551 3300059511 Unclassified 535
1022 Ga0587092_067731 3300059512 Unclassified 681
1023 Ga0587094_057810 3300059513 Unclassified 672
1024 Ga0587094_067914 3300059513 Bacteria 636
1025 Ga0587094_081792 3300059513 Unclassified 598
1026 Ga0587094_089939 3300059513 Bacteria 579
1027 Ga0587106_060438 3300059605 Bacteria 695
1028 Ga0587106_065488 3300059605 Unclassified 677
1029 Ga0587101_061231 3300059623 Bacteria 673
1030 Ga0587101_144055 3300059623 Bacteria 511
1031 Ga0587109_108740 3300059624 Unclassified 646
1032 Ga0587109_109504 3300059624 Unclassified 644
1033 Ga0587109_115197 3300059624 Bacteria 633
1034 Ga0587113_030418 3300059625 Unclassified 610
1035 Ga0587113_042682 3300059625 Unclassified 547
1036 Ga0587115_047786 3300059626 Bacteria 687
1037 Ga0587115_057442 3300059626 Bacteria 645
1038 Ga0587117_073614 3300059627 Unclassified 610
1039 Ga0587117_112923 3300059627 Bacteria 530
1040 Ga0587128_076503 3300059630 Bacteria 662
1041 Ga0587130_046106 3300059631 Unclassified 537
1042 Ga0587067_109173 3300059640 Unclassified 650
1043 Ga0587067_163176 3300059640 Unclassified 568
1044 Ga0587067_165199 3300059640 Unclassified 566
1045 Ga0587068_103913 3300059641 Unclassified 599
1046 Ga0587069_092722 3300059642 Unclassified 606
1047 Ga0587069_125654 3300059642 Bacteria 548
1048 Ga0587069_129958 3300059642 Unclassified 542
1049 Ga0587072_084270 3300059643 Unclassified 691
1050 Ga0587072_100957 3300059643 Unclassified 648
1051 Ga0587072_128880 3300059643 Bacteria 594
1052 Ga0587075_070050 3300059644 Unclassified 650
1053 Ga0587075_077047 3300059644 Unclassified 630
1054 Ga0587075_083655 3300059644 Unclassified 613
1055 Ga0587075_118425 3300059644 Bacteria 546
1056 Ga0587076_085433 3300059645 Unclassified 681
1057 Ga0587076_094687 3300059645 Unclassified 658
1058 Ga0587078_050123 3300059646 Unclassified 610
1059 Ga0587078_069344 3300059646 Unclassified 548
1060 Ga0587079_077455 3300059647 Bacteria 754
1061 Ga0587079_092227 3300059647 Unclassified 710
1062 Ga0587079_102913 3300059647 Unclassified 684
1063 Ga0587114_062209 3300059655 Unclassified 657
1064 Ga0587120_027023 3300059659 Unclassified 572
1065 Ga0587071_067916 3300060344 Bacteria 770
1066 Ga0587071_086753 3300060344 Unclassified 705
1067 Ga0587071_139071 3300060344 Unclassified 595
1068 Ga0587071_223528 3300060344 Unclassified 502
1069 Ga0587111_0225910 3300060346 Unclassified 543
1070 Ga0587111_0276795 3300060346 Bacteria 506
1071 Ga0501082_0001011 3300060353 Bacteria 24862
1072 Ga0501082_0191781 3300060353 Bacteria 1777
1073 Ga0495587_0480134
1074 Ga0007416J51690_1013359
1075 Ga0007416J51690_1025011
1076 Ga0007429J51699_1032875
1077 Ga0032354_1062511
1078 Ga0032354_1129990
1079 Ga0058859_10036752
1080 Ga0058859_11813184
1081 Ga0058863_10006110
1082 Ga0058863_10013946
1083 Ga0058863_11422661
1084 Ga0058863_11901776
1085 Ga0058863_11909333
1086 Ga0058861_10027171
1087 Ga0058861_10035865
1088 Ga0058861_10036023
1089 Ga0058861_11706520
1090 Ga0058861_11913154
1091 Ga0058861_12073310
1092 Ga0058860_12213440
1093 Ga0058862_10116057
1094 Ga0058862_10228250
1095 Ga0058862_10278851
1096 Ga0058862_12178942
1097 Ga0058862_12428114
1098 Ga0058862_12686673
1099 Ga0058862_12802510
1100 Ga0058862_12804914
1101 Ga0070658_10008829
1102 Ga0070658_10226099
1103 Ga0070658_10519613
1104 Ga0070683_100000001
1105 Ga0070683_100022915
1106 Ga0070683_100038893
1107 Ga0070683_100054219
1108 Ga0070683_100061290
1109 Ga0070683_100244381
1110 Ga0070683_100656785
1111 Ga0070683_100657397
1112 Ga0070690_101244188
1113 Ga0070670_100893190
1114 Ga0068869_100067634
1115 Ga0068869_100421917
1116 Ga0068869_100720918
1117 Ga0068869_101424304
1118 Ga0070666_10168301
1119 Ga0070666_10409305
1120 Ga0070680_100031554
1121 Ga0070680_100252333
1122 Ga0070682_100158440
1123 Ga0068868_100024051
1124 Ga0068868_100439309
1125 Ga0070660_100014980
1126 Ga0070689_100442340
1127 Ga0070691_10006445
1128 Ga0070691_10355526
1129 Ga0070687_100167317
1130 Ga0070661_100703345
1131 Ga0070692_10219952
1132 Ga0070668_101378446
1133 Ga0070671_101239316
1134 Ga0070673_100334150
1135 Ga0070673_100765047
1136 Ga0070659_101615453
1137 Ga0070667_100092216
1138 Ga0070667_100182268
1139 Ga0070709_10092478
1140 Ga0070709_10126660
1141 Ga0070709_10206798
1142 Ga0070709_10256376
1143 Ga0070709_10297640
1144 Ga0070709_10320184
1145 Ga0070714_100025710
1146 Ga0070714_100169245
1147 Ga0070714_100257901
1148 Ga0070714_100435930
1149 Ga0070714_100441594
1150 Ga0070713_100074305
1151 Ga0070713_100110137
1152 Ga0070713_101081401
1153 Ga0070713_101095892
1154 Ga0070713_101487743
1155 Ga0070713_101895228
1156 Ga0070710_11199849
1157 Ga0070701_10553390
1158 Ga0070711_100004562
1159 Ga0070711_100044240
1160 Ga0070711_100064146
1161 Ga0070711_100174741
1162 Ga0070711_100226766
1163 Ga0070711_100444574
1164 Ga0070711_101398209
1165 Ga0070705_101071906
1166 Ga0070694_101224232
1167 Ga0070708_101124760
1168 Ga0070663_101315287
1169 Ga0070662_100025113
1170 Ga0070681_10001226
1171 Ga0070681_10193737
1172 Ga0070681_10244197
1173 Ga0070681_10367054
1174 Ga0070681_11762422
1175 Ga0068867_100057154
1176 Ga0068867_100179015
1177 Ga0068867_100994803
1178 Ga0068867_102349879
1179 Ga0070679_100004342
1180 Ga0070679_100034644
1181 Ga0070684_100000055
1182 Ga0070684_100000804
1183 Ga0070684_100028183
1184 Ga0070684_100288429
1185 Ga0070684_100539954
1186 Ga0070684_100567628
1187 Ga0070684_101244647
1188 Ga0068853_100009043
1189 Ga0068853_100009601
1190 Ga0068853_100068604
1191 Ga0068853_100386265
1192 Ga0068853_100871243
1193 Ga0068853_101631797
1194 Ga0070695_101569537
1195 Ga0070696_100668232
1196 Ga0070696_101768278
1197 Ga0070693_101567328
1198 Ga0070665_100013006
1199 Ga0070665_101368567
1200 Ga0068855_100002589
1201 Ga0068855_100036280
1202 Ga0068855_100040037
1203 Ga0068855_100049370
1204 Ga0068855_100083019
1205 Ga0068855_100271247
1206 Ga0068855_100316386
1207 Ga0068855_101563392
1208 Ga0070664_100346943
1209 Ga0070664_100439754
1210 Ga0070664_101110834
1211 Ga0068857_100002208
1212 Ga0068857_100107611
1213 Ga0068854_100830986
1214 Ga0068854_101440149
1215 Ga0068856_100001254
1216 Ga0068856_100107869
1217 Ga0068856_100115246
1218 Ga0068856_100188706
1219 Ga0068856_100266548
1220 Ga0068856_100608086
1221 Ga0068856_102257916
1222 Ga0068852_100011174
1223 Ga0068852_100223223
1224 Ga0068852_100351687
1225 Ga0068859_100168351
1226 Ga0068859_100350553
1227 Ga0068859_100367690
1228 Ga0068859_100633120
1229 Ga0068859_101154522
1230 Ga0068859_101412919
1231 Ga0068864_100021313
1232 Ga0068851_10058786
1233 Ga0068851_10184982
1234 Ga0068851_10304360
1235 Ga0068870_10164181
1236 Ga0068863_100041419
1237 Ga0068863_100985331
1238 Ga0068863_101395987
1239 Ga0068858_100006091
1240 Ga0068858_100056033
1241 Ga0068858_100389088
1242 Ga0068858_100480855
1243 Ga0068858_101051510
1244 Ga0068860_100021448
1245 Ga0068860_100047825
1246 Ga0068860_100197021
1247 Ga0068860_100430205
1248 Ga0068860_100771280
1249 Ga0070717_10052611
1250 Ga0070717_10121425
1251 Ga0070717_10152411
1252 Ga0070717_11045536
1253 Ga0070715_10138352
1254 Ga0070715_10270897
1255 Ga0070716_100668203
1256 Ga0070716_101222833
1257 Ga0097621_100102184
1258 Ga0097621_100116366
1259 Ga0097621_100140014
1260 Ga0097621_100163492
1261 Ga0097621_100319702
1262 Ga0097621_101587200
1263 Ga0097621_102024294
1264 Ga0068871_100024178
1265 Ga0068871_100040183
1266 Ga0068871_100064880
1267 Ga0068871_100108329
1268 Ga0068871_100326117
1269 Ga0068871_100542290
1270 Ga0068871_100618954
1271 Ga0068871_100790804
1272 Ga0068865_100051116
1273 Ga0068865_101026261
1274 Ga0097620_100168354
1275 Ga0097620_100350530
1276 Ga0097620_100367690
1277 Ga0097620_100633152
1278 Ga0097620_101154447
1279 Ga0097620_101412936
1280 Ga0105240_10000829
1281 Ga0105240_10093595
1282 Ga0105240_10108584
1283 Ga0105240_10332966
1284 Ga0105240_10444469
1285 Ga0105240_11242126
1286 Ga0105245_10020408
1287 Ga0105245_10058904
1288 Ga0105245_10083205
1289 Ga0105245_10223221
1290 Ga0105245_10248179
1291 Ga0105245_11042230
1292 Ga0105247_10069579
1293 Ga0105247_10350240
1294 Ga0105247_10363326
1295 Ga0105243_10063119
1296 Ga0105243_10105483
1297 Ga0105243_10837275
1298 Ga0105243_12012923
1299 Ga0105241_10025477
1300 Ga0105241_10078194
1301 Ga0105241_10127667
1302 Ga0105242_10049623
1303 Ga0105242_10074272
1304 Ga0105242_10094868
1305 Ga0105242_10157356
1306 Ga0105242_10220513
1307 Ga0105242_10346031
1308 Ga0105242_10563877
1309 Ga0105242_13045702
1310 Ga0105248_10004753
1311 Ga0105248_10142004
1312 Ga0105248_10459438
1313 Ga0105248_10487646
1314 Ga0105248_10799619
1315 Ga0105248_11022121
1316 Ga0105237_10003993
1317 Ga0105237_10040664
1318 Ga0105237_10042692
1319 Ga0105237_10147684
1320 Ga0105238_10004598
1321 Ga0105238_10010164
1322 Ga0105238_10032511
1323 Ga0105238_10059927
1324 Ga0105238_10072953
1325 Ga0105238_10162485
1326 Ga0105238_10170378
1327 Ga0105249_10166756
1328 Ga0099796_10152405
1329 Ga0105239_10000926
1330 Ga0105239_10022062
1331 Ga0105239_10056505
1332 Ga0105239_10085123
1333 Ga0105239_10146928
1334 Ga0105239_10197583
1335 Ga0105239_11844964
1336 Ga0105239_12557853
1337 Ga0105246_10081902
1338 Ga0105246_10166893
1339 Ga0105246_10300499
1340 Ga0105246_10392871
1341 Ga0105246_10545120
1342 Ga0105246_10683099
1343 Ga0154019_127005
1344 Ga0154016_101392
1345 Ga0154012_152883
1346 Ga0154010_120373
1347 Ga0154010_178522
1348 Ga0157373_10374805
1349 Ga0157371_10955368
1350 Ga0157370_10002259
1351 Ga0157370_10006665
1352 Ga0157370_10015036
1353 Ga0157370_10658725
1354 Ga0157369_10001763
1355 Ga0157369_10010501
1356 Ga0157369_10020251
1357 Ga0157369_10201472
1358 Ga0157369_10244220
1359 Ga0157374_10071396
1360 Ga0157374_10146595
1361 Ga0157374_10167973
1362 Ga0157374_10203395
1363 Ga0157374_10204469
1364 Ga0157374_10370856
1365 Ga0157374_12259327
1366 Ga0157378_10013083
1367 Ga0157378_10037067
1368 Ga0157378_10329109
1369 Ga0157378_10355245
1370 Ga0157378_10597681
1371 Ga0157378_10816708
1372 Ga0157378_11450252
1373 Ga0157378_11480992
1374 Ga0163162_10000923
1375 Ga0163162_10005655
1376 Ga0163162_10402041
1377 Ga0163162_10629304
1378 Ga0163162_12530344
1379 Ga0157372_10001934
1380 Ga0157372_10073578
1381 Ga0157372_10370841
1382 Ga0157372_10819539
1383 Ga0157372_10970089
1384 Ga0157375_10008225
1385 Ga0157375_10204024
1386 Ga0157375_10343638
1387 Ga0157375_12366330
1388 Ga0163163_10003605
1389 Ga0163163_10055316
1390 Ga0163163_10509371
1391 Ga0163163_10514585
1392 Ga0163163_10778397
1393 Ga0163163_11248862
1394 Ga0157380_10783863
1395 Ga0157379_10058078
1396 Ga0157379_10251105
1397 Ga0157379_10666931
1398 Ga0157376_10443107
1399 Ga0157376_11169402
1400 Ga0182007_10210276
1401 Ga0182005_1302459
1402 Ga0163161_11603956
1403 Ga0184595_131066
1404 Ga0184596_108050
1405 Ga0184596_122188
1406 Ga0184592_113146
1407 Ga0184592_114756
1408 Ga0184592_115460
1409 Ga0184593_105699
1410 Ga0184593_108382
1411 Ga0184593_119644
1412 Ga0184593_132516
1413 Ga0184594_110722
1414 Ga0184594_122686
1415 Ga0184594_125428
1416 Ga0184598_129099
1417 Ga0184599_139300
1418 Ga0184599_145306
1419 Ga0184599_147059
1420 Ga0184600_102034
1421 Ga0184600_108952
1422 Ga0197907_10163410
1423 Ga0197907_10286402
1424 Ga0197907_10312743
1425 Ga0197907_10430539
1426 Ga0197907_10476928
1427 Ga0197907_10739022
1428 Ga0197907_10758757
1429 Ga0197907_10823823
1430 Ga0197907_10966821
1431 Ga0197907_10977523
1432 Ga0197907_11038682
1433 Ga0197907_11098372
1434 Ga0197907_11120220
1435 Ga0197907_11144601
1436 Ga0197907_11251078
1437 Ga0197907_11283622
1438 Ga0197907_11325985
1439 Ga0197907_11350630
1440 Ga0206356_10034966
1441 Ga0206356_10091394
1442 Ga0206356_10092759
1443 Ga0206356_10244916
1444 Ga0206356_10324049
1445 Ga0206356_10327438
1446 Ga0206356_10526821
1447 Ga0206356_10547674
1448 Ga0206356_10791083
1449 Ga0206356_11077895
1450 Ga0206356_11177492
1451 Ga0206356_11250494
1452 Ga0206356_11349583
1453 Ga0206356_11604026
1454 Ga0206356_11760482
1455 Ga0206349_1104886
1456 Ga0206349_1114993
1457 Ga0206349_1347378
1458 Ga0206349_1413762
1459 Ga0206349_1438462
1460 Ga0206349_1587264
1461 Ga0206349_1588263
1462 Ga0206349_1643279
1463 Ga0206349_1726888
1464 Ga0206349_1803995
1465 Ga0206349_1889273
1466 Ga0206355_1203027
1467 Ga0206355_1419348
1468 Ga0206355_1428624
1469 Ga0206355_1432907
1470 Ga0206355_1522010
1471 Ga0206355_1523680
1472 Ga0206355_1552828
1473 Ga0206355_1621660
1474 Ga0206355_1634635
1475 Ga0206355_1659624
1476 Ga0206351_10061856
1477 Ga0206351_10083253
1478 Ga0206351_10092054
1479 Ga0206351_10106405
1480 Ga0206351_10113413
1481 Ga0206351_10150188
1482 Ga0206351_10287561
1483 Ga0206351_10308606
1484 Ga0206351_10395597
1485 Ga0206351_10514131
1486 Ga0206351_10551231
1487 Ga0206351_10686524
1488 Ga0206351_10931400
1489 Ga0206352_10038551
1490 Ga0206352_10042034
1491 Ga0206352_10079511
1492 Ga0206352_10097143
1493 Ga0206352_10141324
1494 Ga0206352_10325671
1495 Ga0206352_10375107
1496 Ga0206352_10398875
1497 Ga0206352_10403950
1498 Ga0206352_10495749
1499 Ga0206352_10509139
1500 Ga0206352_10520289
1501 Ga0206352_10710552
1502 Ga0206352_10734954
1503 Ga0206352_11197174
1504 Ga0206352_11224948
1505 Ga0206352_11263999
1506 Ga0206350_10002123
1507 Ga0206350_10186125
1508 Ga0206350_10271673
1509 Ga0206350_10277469
1510 Ga0206350_10280083
1511 Ga0206350_10314210
1512 Ga0206350_10347331
1513 Ga0206350_10568611
1514 Ga0206350_10672396
1515 Ga0206350_10707583
1516 Ga0206350_10901464
1517 Ga0206350_10972182
1518 Ga0206350_11196424
1519 Ga0206350_11240623
1520 Ga0206350_11359846
1521 Ga0206350_11630401
1522 Ga0206354_10093064
1523 Ga0206354_10289752
1524 Ga0206354_10475303
1525 Ga0206354_10814056
1526 Ga0206354_10890264
1527 Ga0206354_11213096
1528 Ga0206354_11296545
1529 Ga0206354_11479014
1530 Ga0206354_11493054
1531 Ga0206354_11647079
1532 Ga0206354_11706144
1533 Ga0206353_10158651
1534 Ga0206353_10572510
1535 Ga0206353_10866201
1536 Ga0206353_10976632
1537 Ga0206353_11042202
1538 Ga0206353_11337192
1539 Ga0206353_11566893
1540 Ga0206353_11707724
1541 Ga0206353_11840281
1542 Ga0154015_1016038
1543 Ga0154015_1049429
1544 Ga0154015_1067378
1545 Ga0154015_1072462
1546 Ga0154015_1087282
1547 Ga0154015_1335253
1548 Ga0154015_1352349
1549 Ga0154015_1376847
1550 Ga0154015_1510902
1551 Ga0154015_1550972
1552 Ga0154015_1638450
1553 Ga0154015_1691846
1554 Ga0213875_10007485
1555 Ga0213875_10260284
1556 Ga0224712_10105281
1557 Ga0224712_10142192
1558 Ga0224712_10150481
1559 Ga0224712_10208253
1560 Ga0224712_10223459
1561 Ga0224712_10227935
1562 Ga0224712_10247429
1563 Ga0224712_10262858
1564 Ga0224712_10286167
1565 Ga0224712_10288503
1566 Ga0224712_10338083
1567 Ga0224712_10363854
1568 Ga0224712_10365560
1569 Ga0224712_10367148
1570 Ga0224712_10367804
1571 Ga0224712_10406662
1572 Ga0224712_10453664
1573 Ga0224712_10513098
1574 Ga0224712_10523685
1575 Ga0224712_10564328
1576 Ga0247551_103423
1577 Ga0247551_105418
1578 Ga0247553_111119
1579 Ga0207656_10262907
1580 Ga0207710_10100248
1581 Ga0207710_10222260
1582 Ga0207680_10239761
1583 Ga0207680_10382069
1584 Ga0207685_10558980
1585 Ga0207699_10331229
1586 Ga0207699_10390028
1587 Ga0207699_10608186
1588 Ga0207699_10635269
1589 Ga0207699_10714513
1590 Ga0207645_10418558
1591 Ga0207705_10215742
1592 Ga0207684_10895795
1593 Ga0207654_10009344
1594 Ga0207654_10017392
1595 Ga0207654_10023665
1596 Ga0207654_10197787
1597 Ga0207707_10037603
1598 Ga0207707_10428463
1599 Ga0207707_11449010
1600 Ga0207695_10001355
1601 Ga0207695_10006537
1602 Ga0207695_10024661
1603 Ga0207695_10075817
1604 Ga0207695_10371909
1605 Ga0207695_11183479
1606 Ga0207671_10081536
1607 Ga0207671_10106286
1608 Ga0207671_11328503
1609 Ga0207693_10415347
1610 Ga0207663_10035710
1611 Ga0207663_10075867
1612 Ga0207663_10170153
1613 Ga0207663_10211060
1614 Ga0207663_10315906
1615 Ga0207663_10340171
1616 Ga0207663_10473217
1617 Ga0207660_10046329
1618 Ga0207657_10020879
1619 Ga0207657_10038937
1620 Ga0207657_10260454
1621 Ga0207657_10437745
1622 Ga0207649_10123326
1623 Ga0207649_10283281
1624 Ga0207649_11242558
1625 Ga0207652_10052648
1626 Ga0207681_11693893
1627 Ga0207694_10000486
1628 Ga0207694_10008252
1629 Ga0207694_10036963
1630 Ga0207694_10057844
1631 Ga0207694_10077794
1632 Ga0207694_10128618
1633 Ga0207650_10757229
1634 Ga0207687_10003031
1635 Ga0207687_10009317
1636 Ga0207687_10055636
1637 Ga0207687_10406608
1638 Ga0207687_10577098
1639 Ga0207700_10009283
1640 Ga0207700_10047296
1641 Ga0207700_10130289
1642 Ga0207700_10209698
1643 Ga0207664_10010090
1644 Ga0207664_10294525
1645 Ga0207644_10256437
1646 Ga0207644_10391657
1647 Ga0207690_11302999
1648 Ga0207686_10024798
1649 Ga0207686_10034301
1650 Ga0207686_10080074
1651 Ga0207686_10095777
1652 Ga0207686_10109803
1653 Ga0207686_10236013
1654 Ga0207686_11265091
1655 Ga0207709_10039104
1656 Ga0207709_10614814
1657 Ga0207709_10908798
1658 Ga0207709_11796403
1659 Ga0207670_10784218
1660 Ga0207669_10295227
1661 Ga0207704_10882377
1662 Ga0207704_11249553
1663 Ga0207665_10306055
1664 Ga0207665_10510214
1665 Ga0207665_10654607
1666 Ga0207665_11166410
1667 Ga0207711_10004077
1668 Ga0207711_10938176
1669 Ga0207689_10100874
1670 Ga0207689_10505756
1671 Ga0207689_10713638
1672 Ga0207661_10000005
1673 Ga0207661_10025795
1674 Ga0207661_10050703
1675 Ga0207661_10188557
1676 Ga0207661_10393579
1677 Ga0207679_10175003
1678 Ga0207679_11391241
1679 Ga0207667_10002176
1680 Ga0207667_10003779
1681 Ga0207667_10051139
1682 Ga0207667_10071077
1683 Ga0207667_10088668
1684 Ga0207667_10144205
1685 Ga0207667_10306893
1686 Ga0207667_10854959
1687 Ga0207651_10318233
1688 Ga0207651_10602773
1689 Ga0207651_11325089
1690 Ga0207712_10145673
1691 Ga0207712_10505903
1692 Ga0207640_11261932
1693 Ga0207640_11515428
1694 Ga0207658_10244451
1695 Ga0207658_10545478
1696 Ga0207677_10317416
1697 Ga0207677_10810944
1698 Ga0207677_11495811
1699 Ga0207703_10026180
1700 Ga0207703_10028191
1701 Ga0207703_10483307
1702 Ga0207703_10732030
1703 Ga0207703_11474770
1704 Ga0207639_10031691
1705 Ga0207639_10510184
1706 Ga0207639_10672018
1707 Ga0207639_10827326
1708 Ga0207678_10668483
1709 Ga0207708_10962309
1710 Ga0207702_10006005
1711 Ga0207702_10085210
1712 Ga0207702_10242169
1713 Ga0207702_10624992
1714 Ga0207702_10666763
1715 Ga0207702_11818994
1716 Ga0207641_10031537
1717 Ga0207641_10920370
1718 Ga0207648_10114069
1719 Ga0207648_10295481
1720 Ga0207648_11589517
1721 Ga0207648_11826327
1722 Ga0207676_10019659
1723 Ga0207674_10000361
1724 Ga0207674_10002055
1725 Ga0207674_10024159
1726 Ga0207674_10697052
1727 Ga0207675_100472765
1728 Ga0207698_10001862
1729 Ga0207698_10048734
1730 Ga0207698_10289891
1731 Ga0207698_10733726
1732 Ga0207698_11211148
1733 Ga0268266_10007479
1734 Ga0268266_11176573
1735 Ga0268264_10064789
1736 Ga0268264_10285804
1737 Ga0268264_10302641
1738 Ga0268264_11181187
1739 Ga0265323_10001695
1740 Ga0265338_10159741
1741 Ga0265762_1016992
1742 Ga0265762_1081893
1743 Ga0265762_1145244
1744 Ga0265775_114080
1745 Ga0265767_105531
1746 Ga0265767_106996
1747 Ga0265767_113693
1748 Ga0265766_1005331
1749 Ga0265766_1011308
1750 Ga0265766_1012062
1751 Ga0265766_1015637
1752 Ga0265766_1022342
1753 Ga0265777_112541
1754 Ga0265777_113152
1755 Ga0265777_121229
1756 Ga0265776_104550
1757 Ga0265776_111230
1758 Ga0265764_108395
1759 Ga0265764_110609
1760 Ga0265772_103116
1761 Ga0265769_109336
1762 Ga0265769_117898
1763 Ga0265769_118683
1764 Ga0265761_104165
1765 Ga0247549_101811
1766 Ga0247549_102985
1767 Ga0265768_102420
1768 Ga0265768_103921
1769 Ga0265768_104251
1770 Ga0265768_105373
1771 Ga0265768_105600
1772 Ga0265768_107355
1773 Ga0265768_108783
1774 Ga0265768_110710
1775 Ga0265768_113662
1776 Ga0265768_116321
1777 Ga0265768_117686
1778 Ga0265771_1018396
1779 Ga0265771_1027765
1780 Ga0265774_106374
1781 Ga0265773_1003870
1782 Ga0265773_1024359
1783 Ga0265760_10067456
1784 Ga0265760_10209722
1785 Ga0265760_10303651
1786 Ga0265760_10307115
1787 Ga0265328_10180763
1788 Ga0265325_10125088
1789 Ga0265339_10065374
1790 Ga0265331_10230953
1791 Ga0265316_10014783
1792 Ga0265316_10038490
1793 Ga0265316_10196052
1794 Ga0265316_10198072
1795 Ga0265316_10450397
1796 Ga0265313_10007638
1797 Ga0265313_10255839
1798 Ga0310103_139079
1799 Ga0310111_133895
1800 Ga0265314_10011041
1801 Ga0265314_10282918
1802 Ga0265314_10362416
1803 Ga0265342_10146176
1804 Ga0265342_10225076
1805 Ga0247548_104373
1806 Ga0247548_104387
1807 Ga0247548_105395
1808 Ga0247548_107682
1809 Ga0316042_120450
1810 Ga0316042_124683
1811 Ga0316043_123481
1812 Ga0307411_12286721
1813 Ga0316053_107474
1814 Ga0316053_112606
1815 Ga0316053_112983
1816 Ga0316053_119800
1817 Ga0373926_0260165
1818 Ga0373926_0448359
1819 Ga0373934_0006374
1820 Ga0373934_0026633
1821 Ga0373934_0052051
1822 Ga0373934_0187541
1823 Ga0373944_0042562
1824 Ga0373923_0011794
1825 Ga0373923_0034984
1826 Ga0373923_0256953
1827 Ga0373936_0229698
1828 Ga0373936_0605373
1829 Ga0373941_0470512
1830 Ga0373953_0027981
1831 Ga0373953_0102277
1832 Ga0373953_0283290
1833 Ga0373953_0349863
1834 Ga0373953_0462313
1835 Ga0373954_0035650
1836 Ga0373954_0047998
1837 Ga0373954_0051631
1838 Ga0373954_0103732
1839 Ga0373954_0313979
1840 Ga0373956_0085248
1841 Ga0373956_0095264
1842 Ga0373943_0034131
1843 Ga0373943_0572867
1844 Ga0373946_0154161
1845 Ga0373955_0026031
1846 Ga0373955_0041996
1847 Ga0373955_0188013
1848 Ga0373955_0219194
1849 Ga0373955_0322560
1850 Ga0373955_0724206
1851 Ga0373924_0103536
1852 Ga0373924_0119838
1853 Ga0373924_0153523
1854 Ga0373924_0153887
1855 Ga0373935_0049020
1856 Ga0373935_0125561
1857 Ga0373935_0197072
1858 Ga0373935_0353913
1859 Ga0373935_0645587
1860 Ga0373927_0009527
1861 Ga0373927_0009834
1862 Ga0373927_0202633
1863 Ga0373927_0470575
1864 Ga0373927_0585743
1865 Ga0373927_0613715
1866 Ga0373933_0096385
1867 Ga0373933_0245989
1868 Ga0373933_0308105
1869 Ga0373933_0361868
1870 Ga0373933_0374373
1871 Ga0373947_0057530
1872 Ga0373947_0099908
1873 Ga0373947_0180196
1874 Ga0373947_0266469
1875 Ga0373947_0270836
1876 Ga0373947_0298871
1877 Ga0373937_0001443
1878 Ga0373937_0033209
1879 Ga0373937_0047511
1880 Ga0373937_0111072
1881 Ga0373937_0115609
1882 Ga0373937_0178912
1883 Ga0373937_0214781
1884 Ga0373937_0369841
1885 Ga0373937_0505633
1886 Ga0373937_1445312
1887 Ga0265778_034197
1888 Ga0265778_034457
1889 Ga0265778_035199
1890 Ga0265778_035321
1891 Ga0265778_049605
1892 Ga0265778_052249
1893 Ga0265778_055338
1894 Ga0265778_059524
1895 Ga0265778_062280
1896 Ga0265778_063876
1897 Ga0372808_062442
1898 Ga0310109_029066
1899 Ga0373925_0014727
1900 Ga0373925_0050539
1901 Ga0373925_0156161
1902 Ga0373925_0193112
1903 Ga0373925_0571288
1904 Ga0436364_0483352
1905 Ga0436364_1424611
1906 Ga0436361_0609805
1907 Ga0436362_0834658
1908 Ga0451839_1486827
1909 Ga0451577_0744043
1910 Ga0453683_0665519
1911 Ga0453683_1181748
1912 Ga0451576_0093362
1913 Ga0451576_0216282
1914 Ga0495592_0037718
1915 Ga0495603_0439947
1916 Ga0495651_0088399
1917 Ga0495651_0231365
1918 Ga0495651_0269354
1919 Ga0495653_0357491
1920 Ga0495653_0495917
1921 Ga0495580_0002824
1922 Ga0495580_0014057
1923 Ga0495580_0073559
1924 Ga0495580_0093911
1925 Ga0495580_0149751
1926 Ga0495580_0314626
1927 Ga0495580_0865340
1928 Ga0495582_0024647
1929 Ga0495639_0065672
1930 Ga0495664_0009808
1931 Ga0495584_0380670
1932 Ga0495594_0135237
1933 Ga0495608_0097082
1934 Ga0495608_0256644
1935 Ga0495608_0317436
1936 Ga0495618_0057915
1937 Ga0495628_0056689
1938 Ga0495628_0230076
1939 Ga0495628_0563263
1940 Ga0495628_0601798
1941 Ga0495630_0158571
1942 Ga0495666_0259402
1943 Ga0495666_0314441
1944 Ga0495666_0528245
1945 Ga0495652_0054747
1946 Ga0495665_0085093
1947 Ga0495665_0130196
1948 Ga0495665_0276636
1949 Ga0495665_0594338
1950 Ga0495640_0042576
1951 Ga0495586_0137070
1952 Ga0495587_0002664
1953 Ga0495587_0100531
1954 Ga0495598_0282068
1955 Ga0495645_0009769
1956 Ga0495645_0149465
1957 Ga0495645_0191205
1958 Ga0495645_0445545
1959 Ga0495667_0018037
1960 Ga0495667_0063533
1961 Ga0495667_0105123
1962 Ga0495634_0082539
1963 Ga0495635_0057514
1964 Ga0495635_0368607
1965 Ga0495588_0397347
1966 Ga0495599_0018742
1967 Ga0495599_0055259
1968 Ga0495623_0176017
1969 Ga0495623_0261789
1970 Ga0495646_0171974
1971 Ga0495613_0047957
1972 Ga0495624_0700896
1973 Ga0495600_0044898
1974 Ga0495581_0237527
1975 Ga0495581_0497618
1976 Ga0495604_0359783
1977 Ga0495636_0183151
1978 Ga0495674_0011815
1979 Ga0495674_0037580
1980 Ga0495674_0321693
1981 Ga0495680_0059182
1982 Ga0495680_0228717
1983 Ga0495675_0076480
1984 Ga0495675_0381919
1985 Ga0495675_0393300
1986 Ga0495684_0008037
1987 Ga0495684_0031099
1988 Ga0495684_0077934
1989 Ga0495684_0120513
1990 Ga0495684_0639423
1991 Ga0495593_0648413
1992 Ga0495602_0051852
1993 Ga0495602_0093611
1994 Ga0496104_0101947
1995 Ga0496104_0438639
1996 Ga0496104_1882721
1997 Ga0496106_0308257
1998 Ga0496109_1602131
1999 Ga0496112_0995844
2000 Ga0496112_1368449
2001 Ga0496115_0121493
2002 Ga0496115_0198712
2003 Ga0496115_0239406
2004 Ga0501315_026868
2005 Ga0501315_081096
2006 Ga0501317_083756
2007 Ga0501318_067550
2008 Ga0501031_0130126
2009 Ga0501032_0004512
2010 Ga0501033_0018380
2011 Ga0501033_0884578
2012 Ga0501034_0055543
2013 Ga0501036_0000169
2014 Ga0501037_0011724
2015 Ga0501038_0002204
2016 Ga0501039_0175851
2017 Ga0501043_0003790
2018 Ga0501046_0002817
2019 Ga0501047_0017475
2020 Ga0501048_0025322
2021 Ga0501067_0003565
2022 Ga0501068_0005161
2023 Ga0501069_0001178
2024 Ga0501070_0050742
2025 Ga0501072_0000228
2026 Ga0501072_0406388
2027 Ga0501073_0193908
2028 Ga0501074_0197581
2029 Ga0501076_0928061
2030 Ga0501077_0028626
2031 Ga0501079_0014673
2032 Ga0501080_0004398
2033 Ga0501083_0002357
2034 Ga0501035_0136922
2035 Ga0501044_0116689
2036 Ga0495601_0794973
2037 Ga0495595_0306611
2038 Ga0495619_0752095
2039 Ga0500568_0001338
2040 Ga0501084_0092592
2041 Ga0587084_090064
2042 Ga0587093_047786
2043 Ga0587093_050051
2044 Ga0587093_065788
2045 Ga0587093_068119
2046 Ga0587066_061551
2047 Ga0587066_102918
2048 Ga0587066_104024
2049 Ga0587066_146328
2050 Ga0587066_153999
2051 Ga0587073_0052707
2052 Ga0587073_0069974
2053 Ga0587073_0109333
2054 Ga0587073_0126078
2055 Ga0587073_0146779
2056 Ga0587073_0190954
2057 Ga0587073_0193838
2058 Ga0587073_0260070
2059 Ga0587073_0265993
2060 Ga0587077_040997
2061 Ga0587077_097589
2062 Ga0587077_100953
2063 Ga0587080_094101
2064 Ga0587080_135879
2065 Ga0587082_088263
2066 Ga0587082_104567
2067 Ga0587082_123694
2068 Ga0587083_0168097
2069 Ga0587083_0168412
2070 Ga0587083_0206380
2071 Ga0587083_0237041
2072 Ga0587083_0258100
2073 Ga0587085_105987
2074 Ga0587085_120242
2075 Ga0587085_141271
2076 Ga0587086_055793
2077 Ga0587086_068505
2078 Ga0587086_086595
2079 Ga0587089_074111
2080 Ga0587089_078824
2081 Ga0587089_110288
2082 Ga0587090_065786
2083 Ga0587090_081775
2084 Ga0587090_124410
2085 Ga0587091_078069
2086 Ga0587091_082016
2087 Ga0587091_137550
2088 Ga0587091_140650
2089 Ga0587091_150925
2090 Ga0587091_173606
2091 Ga0587091_188868
2092 Ga0587091_194360
2093 Ga0587091_201551
2094 Ga0587092_067731
2095 Ga0587094_057810
2096 Ga0587094_067914
2097 Ga0587094_081792
2098 Ga0587094_089939
2099 Ga0587106_060438
2100 Ga0587106_065488
2101 Ga0587101_061231
2102 Ga0587101_144055
2103 Ga0587109_108740
2104 Ga0587109_109504
2105 Ga0587109_115197
2106 Ga0587113_030418
2107 Ga0587113_042682
2108 Ga0587115_047786
2109 Ga0587115_057442
2110 Ga0587117_073614
2111 Ga0587117_112923
2112 Ga0587128_076503
2113 Ga0587130_046106
2114 Ga0587067_109173
2115 Ga0587067_163176
2116 Ga0587067_165199
2117 Ga0587068_103913
2118 Ga0587069_092722
2119 Ga0587069_125654
2120 Ga0587069_129958
2121 Ga0587072_084270
2122 Ga0587072_100957
2123 Ga0587072_128880
2124 Ga0587075_070050
2125 Ga0587075_077047
2126 Ga0587075_083655
2127 Ga0587075_118425
2128 Ga0587076_085433
2129 Ga0587076_094687
2130 Ga0587078_050123
2131 Ga0587078_069344
2132 Ga0587079_077455
2133 Ga0587079_092227
2134 Ga0587079_102913
2135 Ga0587114_062209
2136 Ga0587120_027023
2137 Ga0587071_067916
2138 Ga0587071_086753
2139 Ga0587071_139071
2140 Ga0587071_223528
2141 Ga0587111_0225910
2142 Ga0587111_0276795
2143 Ga0501082_0001011
2144 Ga0501082_0191781

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

101

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ptg-assembly2.cif.gz_A structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.8919 1 112
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.8836 1 113
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.8453 1 113
6ptg-assembly2.cif.gz_A structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.8431 1 112
7khe-assembly1.cif.gz_M escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp 0.8267 1 118
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.8139 1 112 1.20.120.910
af_E7F021_97_223_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8032 1 74 3.30.40.10
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.7772 1 118 1.20.120.910
af_Q6YZ03_33_177_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.77 1 75 1.20.140.40
4nsmA00 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7534 2 75 6.10.250.2770
ID Description Score Start End GO Terms
AF-A0A350UG21-F1-model_v4 TraR/DksA family transcriptional regulator 0.9775 1 112 GO:0008270
AF-A0A7Y2D351-F1-model_v4 TraR/DksA family transcriptional regulator 0.9542 1 115 GO:0008270
AF-A0A838HDC5-F1-model_v4 TraR/DksA C4-type zinc finger protein 0.9514 4 105 GO:0008270
AF-A0A3M4RXC8-F1-model_v4 Uncharacterized protein 0.944 1 112
AF-E6X2P0-F1-model_v4 Transcriptional regulator, TraR/DksA family 0.9427 1 111 GO:0008270

Map