F489517
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1072 | 356 | 2144 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300046536|Ga0495587_0480134|Ga0495587_0480134_177_638 |
| Length | 153 |
| Sequence | LKQTRELTDGKNKKKELPEETGEGRIMTKSELNKYRNVLEAKQAELVQLVRNRDGIAIEKSPDALDEVQHAAERELAIRNLDRESNLLRNVRAALRRIEEGSFGVCLHCEEDISPKRLAAVPWTAFCIQCQEIADRSQGDSADNLDELLVNAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300019166 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 205 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031816 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 210 | 3300031828 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 233 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.27 |
| Metatranscriptomes | 35.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 0.93 |
| Rhizosphere | 97.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 44.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495587_0480134 | 3300046536 | Bacteria | 688 |
| 2 | Ga0007416J51690_1013359 | 3300003577 | Bacteria | 560 |
| 3 | Ga0007416J51690_1025011 | 3300003577 | Unclassified | 840 |
| 4 | Ga0007429J51699_1032875 | 3300003579 | Unclassified | 762 |
| 5 | Ga0032354_1062511 | 3300003693 | Unclassified | 567 |
| 6 | Ga0032354_1129990 | 3300003693 | Unclassified | 537 |
| 7 | Ga0058859_10036752 | 3300004798 | Bacteria | 626 |
| 8 | Ga0058859_11813184 | 3300004798 | Unclassified | 630 |
| 9 | Ga0058863_10006110 | 3300004799 | Bacteria | 964 |
| 10 | Ga0058863_10013946 | 3300004799 | Bacteria | 1438 |
| 11 | Ga0058863_11422661 | 3300004799 | Unclassified | 572 |
| 12 | Ga0058863_11901776 | 3300004799 | Unclassified | 855 |
| 13 | Ga0058863_11909333 | 3300004799 | Unclassified | 731 |
| 14 | Ga0058861_10027171 | 3300004800 | Bacteria | 778 |
| 15 | Ga0058861_10035865 | 3300004800 | Bacteria | 893 |
| 16 | Ga0058861_10036023 | 3300004800 | Unclassified | 559 |
| 17 | Ga0058861_11706520 | 3300004800 | Unclassified | 596 |
| 18 | Ga0058861_11913154 | 3300004800 | Unclassified | 534 |
| 19 | Ga0058861_12073310 | 3300004800 | Bacteria | 667 |
| 20 | Ga0058860_12213440 | 3300004801 | Unclassified | 745 |
| 21 | Ga0058862_10116057 | 3300004803 | Unclassified | 562 |
| 22 | Ga0058862_10228250 | 3300004803 | Bacteria | 670 |
| 23 | Ga0058862_10278851 | 3300004803 | Bacteria | 676 |
| 24 | Ga0058862_12178942 | 3300004803 | Unclassified | 570 |
| 25 | Ga0058862_12428114 | 3300004803 | Bacteria | 504 |
| 26 | Ga0058862_12686673 | 3300004803 | Unclassified | 748 |
| 27 | Ga0058862_12802510 | 3300004803 | Unclassified | 584 |
| 28 | Ga0058862_12804914 | 3300004803 | Bacteria | 1518 |
| 29 | Ga0070658_10008829 | 3300005327 | Bacteria | 8104 |
| 30 | Ga0070658_10226099 | 3300005327 | Bacteria | 1583 |
| 31 | Ga0070658_10519613 | 3300005327 | Bacteria | 1029 |
| 32 | Ga0070683_100000001 | 3300005329 | Bacteria | 529385 |
| 33 | Ga0070683_100022915 | 3300005329 | Bacteria | 5582 |
| 34 | Ga0070683_100038893 | 3300005329 | Unclassified | 4363 |
| 35 | Ga0070683_100054219 | 3300005329 | Bacteria | 3718 |
| 36 | Ga0070683_100061290 | 3300005329 | Bacteria | 3498 |
| 37 | Ga0070683_100244381 | 3300005329 | Bacteria | 1707 |
| 38 | Ga0070683_100656785 | 3300005329 | Bacteria | 1004 |
| 39 | Ga0070683_100657397 | 3300005329 | Bacteria | 1003 |
| 40 | Ga0070690_101244188 | 3300005330 | Unclassified | 595 |
| 41 | Ga0070670_100893190 | 3300005331 | Bacteria | 805 |
| 42 | Ga0068869_100067634 | 3300005334 | Unclassified | 2637 |
| 43 | Ga0068869_100421917 | 3300005334 | Bacteria | 1101 |
| 44 | Ga0068869_100720918 | 3300005334 | Unclassified | 852 |
| 45 | Ga0068869_101424304 | 3300005334 | Bacteria | 614 |
| 46 | Ga0070666_10168301 | 3300005335 | Unclassified | 1534 |
| 47 | Ga0070666_10409305 | 3300005335 | Unclassified | 976 |
| 48 | Ga0070680_100031554 | 3300005336 | Bacteria | 4261 |
| 49 | Ga0070680_100252333 | 3300005336 | Bacteria | 1491 |
| 50 | Ga0070682_100158440 | 3300005337 | Bacteria | 1561 |
| 51 | Ga0068868_100024051 | 3300005338 | Bacteria | 4618 |
| 52 | Ga0068868_100439309 | 3300005338 | Bacteria | 1133 |
| 53 | Ga0070660_100014980 | 3300005339 | Bacteria | 5592 |
| 54 | Ga0070689_100442340 | 3300005340 | Bacteria | 1105 |
| 55 | Ga0070691_10006445 | 3300005341 | Bacteria | 5365 |
| 56 | Ga0070691_10355526 | 3300005341 | Unclassified | 815 |
| 57 | Ga0070687_100167317 | 3300005343 | Unclassified | 1305 |
| 58 | Ga0070661_100703345 | 3300005344 | Bacteria | 824 |
| 59 | Ga0070692_10219952 | 3300005345 | Bacteria | 1122 |
| 60 | Ga0070668_101378446 | 3300005347 | Unclassified | 642 |
| 61 | Ga0070671_101239316 | 3300005355 | Unclassified | 657 |
| 62 | Ga0070673_100334150 | 3300005364 | Bacteria | 1341 |
| 63 | Ga0070673_100765047 | 3300005364 | Unclassified | 890 |
| 64 | Ga0070659_101615453 | 3300005366 | Unclassified | 579 |
| 65 | Ga0070667_100092216 | 3300005367 | Bacteria | 2606 |
| 66 | Ga0070667_100182268 | 3300005367 | Unclassified | 1857 |
| 67 | Ga0070709_10092478 | 3300005434 | Bacteria | 1998 |
| 68 | Ga0070709_10126660 | 3300005434 | Bacteria | 1738 |
| 69 | Ga0070709_10206798 | 3300005434 | Bacteria | 1393 |
| 70 | Ga0070709_10256376 | 3300005434 | Bacteria | 1262 |
| 71 | Ga0070709_10297640 | 3300005434 | Bacteria | 1178 |
| 72 | Ga0070709_10320184 | 3300005434 | Unclassified | 1138 |
| 73 | Ga0070714_100025710 | 3300005435 | Bacteria | 4861 |
| 74 | Ga0070714_100169245 | 3300005435 | Bacteria | 1982 |
| 75 | Ga0070714_100257901 | 3300005435 | Bacteria | 1614 |
| 76 | Ga0070714_100435930 | 3300005435 | Bacteria | 1243 |
| 77 | Ga0070714_100441594 | 3300005435 | Unclassified | 1235 |
| 78 | Ga0070713_100074305 | 3300005436 | Unclassified | 2880 |
| 79 | Ga0070713_100110137 | 3300005436 | Viruses | 2400 |
| 80 | Ga0070713_101081401 | 3300005436 | Bacteria | 775 |
| 81 | Ga0070713_101095892 | 3300005436 | Unclassified | 770 |
| 82 | Ga0070713_101487743 | 3300005436 | Bacteria | 657 |
| 83 | Ga0070713_101895228 | 3300005436 | Unclassified | 578 |
| 84 | Ga0070710_11199849 | 3300005437 | Unclassified | 561 |
| 85 | Ga0070701_10553390 | 3300005438 | Unclassified | 755 |
| 86 | Ga0070711_100004562 | 3300005439 | Bacteria | 8195 |
| 87 | Ga0070711_100044240 | 3300005439 | Bacteria | 3021 |
| 88 | Ga0070711_100064146 | 3300005439 | Unclassified | 2566 |
| 89 | Ga0070711_100174741 | 3300005439 | Unclassified | 1640 |
| 90 | Ga0070711_100226766 | 3300005439 | Bacteria | 1455 |
| 91 | Ga0070711_100444574 | 3300005439 | Bacteria | 1060 |
| 92 | Ga0070711_101398209 | 3300005439 | Unclassified | 609 |
| 93 | Ga0070705_101071906 | 3300005440 | Unclassified | 658 |
| 94 | Ga0070694_101224232 | 3300005444 | Unclassified | 630 |
| 95 | Ga0070708_101124760 | 3300005445 | Unclassified | 735 |
| 96 | Ga0070663_101315287 | 3300005455 | Unclassified | 638 |
| 97 | Ga0070662_100025113 | 3300005457 | Unclassified | 4111 |
| 98 | Ga0070681_10001226 | 3300005458 | Bacteria | 22320 |
| 99 | Ga0070681_10193737 | 3300005458 | Bacteria | 1952 |
| 100 | Ga0070681_10244197 | 3300005458 | Bacteria | 1709 |
| 101 | Ga0070681_10367054 | 3300005458 | Bacteria | 1350 |
| 102 | Ga0070681_11762422 | 3300005458 | Unclassified | 546 |
| 103 | Ga0068867_100057154 | 3300005459 | Unclassified | 2889 |
| 104 | Ga0068867_100179015 | 3300005459 | Bacteria | 1684 |
| 105 | Ga0068867_100994803 | 3300005459 | Unclassified | 760 |
| 106 | Ga0068867_102349879 | 3300005459 | Bacteria | 507 |
| 107 | Ga0070679_100004342 | 3300005530 | Bacteria | 13093 |
| 108 | Ga0070679_100034644 | 3300005530 | Bacteria | 5003 |
| 109 | Ga0070684_100000055 | 3300005535 | Bacteria | 76528 |
| 110 | Ga0070684_100000804 | 3300005535 | Bacteria | 21845 |
| 111 | Ga0070684_100028183 | 3300005535 | Bacteria | 4749 |
| 112 | Ga0070684_100288429 | 3300005535 | Bacteria | 1504 |
| 113 | Ga0070684_100539954 | 3300005535 | Bacteria | 1081 |
| 114 | Ga0070684_100567628 | 3300005535 | Bacteria | 1054 |
| 115 | Ga0070684_101244647 | 3300005535 | Bacteria | 700 |
| 116 | Ga0068853_100009043 | 3300005539 | Bacteria | 8023 |
| 117 | Ga0068853_100009601 | 3300005539 | Bacteria | 7795 |
| 118 | Ga0068853_100068604 | 3300005539 | Bacteria | 3083 |
| 119 | Ga0068853_100386265 | 3300005539 | Unclassified | 1308 |
| 120 | Ga0068853_100871243 | 3300005539 | Bacteria | 864 |
| 121 | Ga0068853_101631797 | 3300005539 | Bacteria | 625 |
| 122 | Ga0070695_101569537 | 3300005545 | Unclassified | 549 |
| 123 | Ga0070696_100668232 | 3300005546 | Unclassified | 844 |
| 124 | Ga0070696_101768278 | 3300005546 | Bacteria | 534 |
| 125 | Ga0070693_101567328 | 3300005547 | Bacteria | 516 |
| 126 | Ga0070665_100013006 | 3300005548 | Bacteria | 8382 |
| 127 | Ga0070665_101368567 | 3300005548 | Unclassified | 717 |
| 128 | Ga0068855_100002589 | 3300005563 | Bacteria | 22290 |
| 129 | Ga0068855_100036280 | 3300005563 | Bacteria | 5869 |
| 130 | Ga0068855_100040037 | 3300005563 | Bacteria | 5563 |
| 131 | Ga0068855_100049370 | 3300005563 | Bacteria | 4963 |
| 132 | Ga0068855_100083019 | 3300005563 | Unclassified | 3712 |
| 133 | Ga0068855_100271247 | 3300005563 | Unclassified | 1887 |
| 134 | Ga0068855_100316386 | 3300005563 | Bacteria | 1726 |
| 135 | Ga0068855_101563392 | 3300005563 | Bacteria | 676 |
| 136 | Ga0070664_100346943 | 3300005564 | Unclassified | 1349 |
| 137 | Ga0070664_100439754 | 3300005564 | Unclassified | 1196 |
| 138 | Ga0070664_101110834 | 3300005564 | Bacteria | 745 |
| 139 | Ga0068857_100002208 | 3300005577 | Bacteria | 15847 |
| 140 | Ga0068857_100107611 | 3300005577 | Bacteria | 2504 |
| 141 | Ga0068854_100830986 | 3300005578 | Unclassified | 807 |
| 142 | Ga0068854_101440149 | 3300005578 | Bacteria | 624 |
| 143 | Ga0068856_100001254 | 3300005614 | Bacteria | 26685 |
| 144 | Ga0068856_100107869 | 3300005614 | Bacteria | 2780 |
| 145 | Ga0068856_100115246 | 3300005614 | Unclassified | 2687 |
| 146 | Ga0068856_100188706 | 3300005614 | Bacteria | 2075 |
| 147 | Ga0068856_100266548 | 3300005614 | Bacteria | 1729 |
| 148 | Ga0068856_100608086 | 3300005614 | Bacteria | 1114 |
| 149 | Ga0068856_102257916 | 3300005614 | Unclassified | 553 |
| 150 | Ga0068852_100011174 | 3300005616 | Bacteria | 6745 |
| 151 | Ga0068852_100223223 | 3300005616 | Bacteria | 1793 |
| 152 | Ga0068852_100351687 | 3300005616 | Bacteria | 1439 |
| 153 | Ga0068859_100168351 | 3300005617 | Unclassified | 2271 |
| 154 | Ga0068859_100350553 | 3300005617 | Bacteria | 1571 |
| 155 | Ga0068859_100367690 | 3300005617 | Bacteria | 1533 |
| 156 | Ga0068859_100633120 | 3300005617 | Bacteria | 1162 |
| 157 | Ga0068859_101154522 | 3300005617 | Unclassified | 853 |
| 158 | Ga0068859_101412919 | 3300005617 | Bacteria | 768 |
| 159 | Ga0068864_100021313 | 3300005618 | Bacteria | 5429 |
| 160 | Ga0068851_10058786 | 3300005834 | Unclassified | 1965 |
| 161 | Ga0068851_10184982 | 3300005834 | Bacteria | 1156 |
| 162 | Ga0068851_10304360 | 3300005834 | Bacteria | 917 |
| 163 | Ga0068870_10164181 | 3300005840 | Bacteria | 1320 |
| 164 | Ga0068863_100041419 | 3300005841 | Unclassified | 4380 |
| 165 | Ga0068863_100985331 | 3300005841 | Bacteria | 845 |
| 166 | Ga0068863_101395987 | 3300005841 | Bacteria | 708 |
| 167 | Ga0068858_100006091 | 3300005842 | Bacteria | 11764 |
| 168 | Ga0068858_100056033 | 3300005842 | Bacteria | 3644 |
| 169 | Ga0068858_100389088 | 3300005842 | Bacteria | 1339 |
| 170 | Ga0068858_100480855 | 3300005842 | Bacteria | 1199 |
| 171 | Ga0068858_101051510 | 3300005842 | Unclassified | 798 |
| 172 | Ga0068860_100021448 | 3300005843 | Bacteria | 6254 |
| 173 | Ga0068860_100047825 | 3300005843 | Unclassified | 4077 |
| 174 | Ga0068860_100197021 | 3300005843 | Bacteria | 1951 |
| 175 | Ga0068860_100430205 | 3300005843 | Bacteria | 1310 |
| 176 | Ga0068860_100771280 | 3300005843 | Bacteria | 974 |
| 177 | Ga0070717_10052611 | 3300006028 | Bacteria | 3355 |
| 178 | Ga0070717_10121425 | 3300006028 | Bacteria | 2238 |
| 179 | Ga0070717_10152411 | 3300006028 | Bacteria | 2000 |
| 180 | Ga0070717_11045536 | 3300006028 | Unclassified | 744 |
| 181 | Ga0070715_10138352 | 3300006163 | Unclassified | 1180 |
| 182 | Ga0070715_10270897 | 3300006163 | Bacteria | 896 |
| 183 | Ga0070716_100668203 | 3300006173 | Bacteria | 790 |
| 184 | Ga0070716_101222833 | 3300006173 | Unclassified | 604 |
| 185 | Ga0097621_100102184 | 3300006237 | Unclassified | 2413 |
| 186 | Ga0097621_100116366 | 3300006237 | Bacteria | 2264 |
| 187 | Ga0097621_100140014 | 3300006237 | Unclassified | 2067 |
| 188 | Ga0097621_100163492 | 3300006237 | Bacteria | 1915 |
| 189 | Ga0097621_100319702 | 3300006237 | Bacteria | 1374 |
| 190 | Ga0097621_101587200 | 3300006237 | Unclassified | 622 |
| 191 | Ga0097621_102024294 | 3300006237 | Bacteria | 550 |
| 192 | Ga0068871_100024178 | 3300006358 | Unclassified | 4708 |
| 193 | Ga0068871_100040183 | 3300006358 | Bacteria | 3746 |
| 194 | Ga0068871_100064880 | 3300006358 | Unclassified | 2990 |
| 195 | Ga0068871_100108329 | 3300006358 | Bacteria | 2335 |
| 196 | Ga0068871_100326117 | 3300006358 | Bacteria | 1353 |
| 197 | Ga0068871_100542290 | 3300006358 | Unclassified | 1053 |
| 198 | Ga0068871_100618954 | 3300006358 | Bacteria | 986 |
| 199 | Ga0068871_100790804 | 3300006358 | Bacteria | 874 |
| 200 | Ga0068865_100051116 | 3300006881 | Bacteria | 2859 |
| 201 | Ga0068865_101026261 | 3300006881 | Unclassified | 723 |
| 202 | Ga0097620_100168354 | 3300006931 | Unclassified | 2271 |
| 203 | Ga0097620_100350530 | 3300006931 | Bacteria | 1571 |
| 204 | Ga0097620_100367690 | 3300006931 | Bacteria | 1533 |
| 205 | Ga0097620_100633152 | 3300006931 | Bacteria | 1162 |
| 206 | Ga0097620_101154447 | 3300006931 | Unclassified | 853 |
| 207 | Ga0097620_101412936 | 3300006931 | Bacteria | 768 |
| 208 | Ga0105240_10000829 | 3300009093 | Bacteria | 55949 |
| 209 | Ga0105240_10093595 | 3300009093 | Unclassified | 3667 |
| 210 | Ga0105240_10108584 | 3300009093 | Unclassified | 3362 |
| 211 | Ga0105240_10332966 | 3300009093 | Bacteria | 1727 |
| 212 | Ga0105240_10444469 | 3300009093 | Bacteria | 1452 |
| 213 | Ga0105240_11242126 | 3300009093 | Unclassified | 788 |
| 214 | Ga0105245_10020408 | 3300009098 | Bacteria | 5812 |
| 215 | Ga0105245_10058904 | 3300009098 | Unclassified | 3458 |
| 216 | Ga0105245_10083205 | 3300009098 | Unclassified | 2929 |
| 217 | Ga0105245_10223221 | 3300009098 | Bacteria | 1819 |
| 218 | Ga0105245_10248179 | 3300009098 | Unclassified | 1728 |
| 219 | Ga0105245_11042230 | 3300009098 | Bacteria | 863 |
| 220 | Ga0105247_10069579 | 3300009101 | Bacteria | 2197 |
| 221 | Ga0105247_10350240 | 3300009101 | Unclassified | 1038 |
| 222 | Ga0105247_10363326 | 3300009101 | Bacteria | 1021 |
| 223 | Ga0105243_10063119 | 3300009148 | Bacteria | 2968 |
| 224 | Ga0105243_10105483 | 3300009148 | Unclassified | 2348 |
| 225 | Ga0105243_10837275 | 3300009148 | Unclassified | 910 |
| 226 | Ga0105243_12012923 | 3300009148 | Unclassified | 612 |
| 227 | Ga0105241_10025477 | 3300009174 | Unclassified | 4395 |
| 228 | Ga0105241_10078194 | 3300009174 | Unclassified | 2584 |
| 229 | Ga0105241_10127667 | 3300009174 | Bacteria | 2055 |
| 230 | Ga0105242_10049623 | 3300009176 | Unclassified | 3416 |
| 231 | Ga0105242_10074272 | 3300009176 | Unclassified | 2829 |
| 232 | Ga0105242_10094868 | 3300009176 | Bacteria | 2517 |
| 233 | Ga0105242_10157356 | 3300009176 | Bacteria | 1986 |
| 234 | Ga0105242_10220513 | 3300009176 | Bacteria | 1695 |
| 235 | Ga0105242_10346031 | 3300009176 | Bacteria | 1371 |
| 236 | Ga0105242_10563877 | 3300009176 | Bacteria | 1094 |
| 237 | Ga0105242_13045702 | 3300009176 | Unclassified | 519 |
| 238 | Ga0105248_10004753 | 3300009177 | Bacteria | 15031 |
| 239 | Ga0105248_10142004 | 3300009177 | Unclassified | 2709 |
| 240 | Ga0105248_10459438 | 3300009177 | Bacteria | 1435 |
| 241 | Ga0105248_10487646 | 3300009177 | Bacteria | 1389 |
| 242 | Ga0105248_10799619 | 3300009177 | Bacteria | 1064 |
| 243 | Ga0105248_11022121 | 3300009177 | Bacteria | 934 |
| 244 | Ga0105237_10003993 | 3300009545 | Bacteria | 17248 |
| 245 | Ga0105237_10040664 | 3300009545 | Bacteria | 4688 |
| 246 | Ga0105237_10042692 | 3300009545 | Bacteria | 4572 |
| 247 | Ga0105237_10147684 | 3300009545 | Bacteria | 2346 |
| 248 | Ga0105238_10004598 | 3300009551 | Bacteria | 13650 |
| 249 | Ga0105238_10010164 | 3300009551 | Bacteria | 9437 |
| 250 | Ga0105238_10032511 | 3300009551 | Bacteria | 5308 |
| 251 | Ga0105238_10059927 | 3300009551 | Bacteria | 3812 |
| 252 | Ga0105238_10072953 | 3300009551 | Bacteria | 3427 |
| 253 | Ga0105238_10162485 | 3300009551 | Unclassified | 2209 |
| 254 | Ga0105238_10170378 | 3300009551 | Bacteria | 2153 |
| 255 | Ga0105249_10166756 | 3300009553 | Bacteria | 2133 |
| 256 | Ga0099796_10152405 | 3300010159 | Bacteria | 911 |
| 257 | Ga0105239_10000926 | 3300010375 | Bacteria | 41589 |
| 258 | Ga0105239_10022062 | 3300010375 | Bacteria | 7019 |
| 259 | Ga0105239_10056505 | 3300010375 | Unclassified | 4305 |
| 260 | Ga0105239_10085123 | 3300010375 | Bacteria | 3484 |
| 261 | Ga0105239_10146928 | 3300010375 | Unclassified | 2630 |
| 262 | Ga0105239_10197583 | 3300010375 | Unclassified | 2253 |
| 263 | Ga0105239_11844964 | 3300010375 | Unclassified | 701 |
| 264 | Ga0105239_12557853 | 3300010375 | Bacteria | 595 |
| 265 | Ga0105246_10081902 | 3300011119 | Bacteria | 2302 |
| 266 | Ga0105246_10166893 | 3300011119 | Bacteria | 1682 |
| 267 | Ga0105246_10300499 | 3300011119 | Bacteria | 1296 |
| 268 | Ga0105246_10392871 | 3300011119 | Unclassified | 1150 |
| 269 | Ga0105246_10545120 | 3300011119 | Unclassified | 993 |
| 270 | Ga0105246_10683099 | 3300011119 | Unclassified | 898 |
| 271 | Ga0154019_127005 | 3300013044 | Bacteria | 757 |
| 272 | Ga0154016_101392 | 3300013045 | Bacteria | 688 |
| 273 | Ga0154012_152883 | 3300013059 | Bacteria | 685 |
| 274 | Ga0154010_120373 | 3300013062 | Bacteria | 757 |
| 275 | Ga0154010_178522 | 3300013062 | Bacteria | 675 |
| 276 | Ga0157373_10374805 | 3300013100 | Bacteria | 1017 |
| 277 | Ga0157371_10955368 | 3300013102 | Bacteria | 652 |
| 278 | Ga0157370_10002259 | 3300013104 | Bacteria | 23408 |
| 279 | Ga0157370_10006665 | 3300013104 | Bacteria | 12681 |
| 280 | Ga0157370_10015036 | 3300013104 | Bacteria | 7888 |
| 281 | Ga0157370_10658725 | 3300013104 | Bacteria | 957 |
| 282 | Ga0157369_10001763 | 3300013105 | Bacteria | 26228 |
| 283 | Ga0157369_10010501 | 3300013105 | Bacteria | 10539 |
| 284 | Ga0157369_10020251 | 3300013105 | Bacteria | 7436 |
| 285 | Ga0157369_10201472 | 3300013105 | Bacteria | 2089 |
| 286 | Ga0157369_10244220 | 3300013105 | Bacteria | 1875 |
| 287 | Ga0157374_10071396 | 3300013296 | Bacteria | 3273 |
| 288 | Ga0157374_10146595 | 3300013296 | Unclassified | 2293 |
| 289 | Ga0157374_10167973 | 3300013296 | Unclassified | 2139 |
| 290 | Ga0157374_10203395 | 3300013296 | Unclassified | 1940 |
| 291 | Ga0157374_10204469 | 3300013296 | Bacteria | 1935 |
| 292 | Ga0157374_10370856 | 3300013296 | Bacteria | 1425 |
| 293 | Ga0157374_12259327 | 3300013296 | Unclassified | 571 |
| 294 | Ga0157378_10013083 | 3300013297 | Bacteria | 7259 |
| 295 | Ga0157378_10037067 | 3300013297 | Bacteria | 4318 |
| 296 | Ga0157378_10329109 | 3300013297 | Bacteria | 1486 |
| 297 | Ga0157378_10355245 | 3300013297 | Bacteria | 1433 |
| 298 | Ga0157378_10597681 | 3300013297 | Unclassified | 1114 |
| 299 | Ga0157378_10816708 | 3300013297 | Viruses | 959 |
| 300 | Ga0157378_11450252 | 3300013297 | Unclassified | 730 |
| 301 | Ga0157378_11480992 | 3300013297 | Unclassified | 723 |
| 302 | Ga0163162_10000923 | 3300013306 | Bacteria | 27271 |
| 303 | Ga0163162_10005655 | 3300013306 | Bacteria | 12076 |
| 304 | Ga0163162_10402041 | 3300013306 | Bacteria | 1502 |
| 305 | Ga0163162_10629304 | 3300013306 | Unclassified | 1198 |
| 306 | Ga0163162_12530344 | 3300013306 | Unclassified | 590 |
| 307 | Ga0157372_10001934 | 3300013307 | Bacteria | 22481 |
| 308 | Ga0157372_10073578 | 3300013307 | Unclassified | 3852 |
| 309 | Ga0157372_10370841 | 3300013307 | Bacteria | 1668 |
| 310 | Ga0157372_10819539 | 3300013307 | Unclassified | 1081 |
| 311 | Ga0157372_10970089 | 3300013307 | Unclassified | 985 |
| 312 | Ga0157375_10008225 | 3300013308 | Bacteria | 9130 |
| 313 | Ga0157375_10204024 | 3300013308 | Unclassified | 2133 |
| 314 | Ga0157375_10343638 | 3300013308 | Bacteria | 1658 |
| 315 | Ga0157375_12366330 | 3300013308 | Bacteria | 634 |
| 316 | Ga0163163_10003605 | 3300014325 | Bacteria | 13155 |
| 317 | Ga0163163_10055316 | 3300014325 | Bacteria | 3922 |
| 318 | Ga0163163_10509371 | 3300014325 | Bacteria | 1265 |
| 319 | Ga0163163_10514585 | 3300014325 | Bacteria | 1259 |
| 320 | Ga0163163_10778397 | 3300014325 | Bacteria | 1020 |
| 321 | Ga0163163_11248862 | 3300014325 | Bacteria | 805 |
| 322 | Ga0157380_10783863 | 3300014326 | Bacteria | 968 |
| 323 | Ga0157379_10058078 | 3300014968 | Unclassified | 3458 |
| 324 | Ga0157379_10251105 | 3300014968 | Bacteria | 1606 |
| 325 | Ga0157379_10666931 | 3300014968 | Bacteria | 974 |
| 326 | Ga0157376_10443107 | 3300014969 | Bacteria | 1265 |
| 327 | Ga0157376_11169402 | 3300014969 | Bacteria | 797 |
| 328 | Ga0182007_10210276 | 3300015262 | Bacteria | 683 |
| 329 | Ga0182005_1302459 | 3300015265 | Unclassified | 505 |
| 330 | Ga0163161_11603956 | 3300017792 | Bacteria | 574 |
| 331 | Ga0184595_131066 | 3300019166 | Bacteria | 616 |
| 332 | Ga0184596_108050 | 3300019176 | Bacteria | 534 |
| 333 | Ga0184596_122188 | 3300019176 | Unclassified | 612 |
| 334 | Ga0184592_113146 | 3300019177 | Bacteria | 751 |
| 335 | Ga0184592_114756 | 3300019177 | Unclassified | 551 |
| 336 | Ga0184592_115460 | 3300019177 | Unclassified | 599 |
| 337 | Ga0184593_105699 | 3300019179 | Unclassified | 534 |
| 338 | Ga0184593_108382 | 3300019179 | Unclassified | 629 |
| 339 | Ga0184593_119644 | 3300019179 | Bacteria | 687 |
| 340 | Ga0184593_132516 | 3300019179 | Unclassified | 629 |
| 341 | Ga0184594_110722 | 3300019181 | Unclassified | 723 |
| 342 | Ga0184594_122686 | 3300019181 | Unclassified | 528 |
| 343 | Ga0184594_125428 | 3300019181 | Bacteria | 759 |
| 344 | Ga0184598_129099 | 3300019182 | Bacteria | 890 |
| 345 | Ga0184599_139300 | 3300019188 | Bacteria | 608 |
| 346 | Ga0184599_145306 | 3300019188 | Bacteria | 598 |
| 347 | Ga0184599_147059 | 3300019188 | Unclassified | 794 |
| 348 | Ga0184600_102034 | 3300019190 | Unclassified | 555 |
| 349 | Ga0184600_108952 | 3300019190 | Unclassified | 727 |
| 350 | Ga0197907_10163410 | 3300020069 | Unclassified | 505 |
| 351 | Ga0197907_10286402 | 3300020069 | Bacteria | 1296 |
| 352 | Ga0197907_10312743 | 3300020069 | Unclassified | 962 |
| 353 | Ga0197907_10430539 | 3300020069 | Unclassified | 799 |
| 354 | Ga0197907_10476928 | 3300020069 | Unclassified | 791 |
| 355 | Ga0197907_10739022 | 3300020069 | Unclassified | 628 |
| 356 | Ga0197907_10758757 | 3300020069 | Bacteria | 682 |
| 357 | Ga0197907_10823823 | 3300020069 | Unclassified | 615 |
| 358 | Ga0197907_10966821 | 3300020069 | Bacteria | 1038 |
| 359 | Ga0197907_10977523 | 3300020069 | Bacteria | 661 |
| 360 | Ga0197907_11038682 | 3300020069 | Bacteria | 709 |
| 361 | Ga0197907_11098372 | 3300020069 | Unclassified | 714 |
| 362 | Ga0197907_11120220 | 3300020069 | Unclassified | 512 |
| 363 | Ga0197907_11144601 | 3300020069 | Bacteria | 777 |
| 364 | Ga0197907_11251078 | 3300020069 | Unclassified | 965 |
| 365 | Ga0197907_11283622 | 3300020069 | Unclassified | 756 |
| 366 | Ga0197907_11325985 | 3300020069 | Unclassified | 637 |
| 367 | Ga0197907_11350630 | 3300020069 | Unclassified | 694 |
| 368 | Ga0206356_10034966 | 3300020070 | Unclassified | 1111 |
| 369 | Ga0206356_10091394 | 3300020070 | Unclassified | 875 |
| 370 | Ga0206356_10092759 | 3300020070 | Bacteria | 644 |
| 371 | Ga0206356_10244916 | 3300020070 | Unclassified | 556 |
| 372 | Ga0206356_10324049 | 3300020070 | Bacteria | 1100 |
| 373 | Ga0206356_10327438 | 3300020070 | Unclassified | 519 |
| 374 | Ga0206356_10526821 | 3300020070 | Unclassified | 664 |
| 375 | Ga0206356_10547674 | 3300020070 | Unclassified | 610 |
| 376 | Ga0206356_10791083 | 3300020070 | Unclassified | 616 |
| 377 | Ga0206356_11077895 | 3300020070 | Bacteria | 559 |
| 378 | Ga0206356_11177492 | 3300020070 | Unclassified | 555 |
| 379 | Ga0206356_11250494 | 3300020070 | Bacteria | 701 |
| 380 | Ga0206356_11349583 | 3300020070 | Unclassified | 621 |
| 381 | Ga0206356_11604026 | 3300020070 | Bacteria | 691 |
| 382 | Ga0206356_11760482 | 3300020070 | Unclassified | 823 |
| 383 | Ga0206349_1104886 | 3300020075 | Unclassified | 571 |
| 384 | Ga0206349_1114993 | 3300020075 | Unclassified | 556 |
| 385 | Ga0206349_1347378 | 3300020075 | Bacteria | 677 |
| 386 | Ga0206349_1413762 | 3300020075 | Unclassified | 842 |
| 387 | Ga0206349_1438462 | 3300020075 | Unclassified | 663 |
| 388 | Ga0206349_1587264 | 3300020075 | Unclassified | 568 |
| 389 | Ga0206349_1588263 | 3300020075 | Unclassified | 573 |
| 390 | Ga0206349_1643279 | 3300020075 | Unclassified | 614 |
| 391 | Ga0206349_1726888 | 3300020075 | Bacteria | 635 |
| 392 | Ga0206349_1803995 | 3300020075 | Bacteria | 790 |
| 393 | Ga0206349_1889273 | 3300020075 | Unclassified | 952 |
| 394 | Ga0206355_1203027 | 3300020076 | Unclassified | 640 |
| 395 | Ga0206355_1419348 | 3300020076 | Unclassified | 606 |
| 396 | Ga0206355_1428624 | 3300020076 | Unclassified | 901 |
| 397 | Ga0206355_1432907 | 3300020076 | Bacteria | 508 |
| 398 | Ga0206355_1522010 | 3300020076 | Unclassified | 567 |
| 399 | Ga0206355_1523680 | 3300020076 | Unclassified | 626 |
| 400 | Ga0206355_1552828 | 3300020076 | Unclassified | 1264 |
| 401 | Ga0206355_1621660 | 3300020076 | Bacteria | 896 |
| 402 | Ga0206355_1634635 | 3300020076 | Unclassified | 748 |
| 403 | Ga0206355_1659624 | 3300020076 | Bacteria | 1086 |
| 404 | Ga0206351_10061856 | 3300020077 | Unclassified | 626 |
| 405 | Ga0206351_10083253 | 3300020077 | Unclassified | 756 |
| 406 | Ga0206351_10092054 | 3300020077 | Bacteria | 703 |
| 407 | Ga0206351_10106405 | 3300020077 | Unclassified | 639 |
| 408 | Ga0206351_10113413 | 3300020077 | Unclassified | 595 |
| 409 | Ga0206351_10150188 | 3300020077 | Bacteria | 597 |
| 410 | Ga0206351_10287561 | 3300020077 | Unclassified | 607 |
| 411 | Ga0206351_10308606 | 3300020077 | Unclassified | 660 |
| 412 | Ga0206351_10395597 | 3300020077 | Bacteria | 798 |
| 413 | Ga0206351_10514131 | 3300020077 | Bacteria | 561 |
| 414 | Ga0206351_10551231 | 3300020077 | Unclassified | 700 |
| 415 | Ga0206351_10686524 | 3300020077 | Unclassified | 606 |
| 416 | Ga0206351_10931400 | 3300020077 | Unclassified | 863 |
| 417 | Ga0206352_10038551 | 3300020078 | Unclassified | 620 |
| 418 | Ga0206352_10042034 | 3300020078 | Unclassified | 625 |
| 419 | Ga0206352_10079511 | 3300020078 | Bacteria | 686 |
| 420 | Ga0206352_10097143 | 3300020078 | Unclassified | 1529 |
| 421 | Ga0206352_10141324 | 3300020078 | Bacteria | 999 |
| 422 | Ga0206352_10325671 | 3300020078 | Unclassified | 912 |
| 423 | Ga0206352_10375107 | 3300020078 | Unclassified | 607 |
| 424 | Ga0206352_10398875 | 3300020078 | Bacteria | 555 |
| 425 | Ga0206352_10403950 | 3300020078 | Unclassified | 570 |
| 426 | Ga0206352_10495749 | 3300020078 | Bacteria | 690 |
| 427 | Ga0206352_10509139 | 3300020078 | Unclassified | 578 |
| 428 | Ga0206352_10520289 | 3300020078 | Unclassified | 839 |
| 429 | Ga0206352_10710552 | 3300020078 | Bacteria | 638 |
| 430 | Ga0206352_10734954 | 3300020078 | Unclassified | 702 |
| 431 | Ga0206352_11197174 | 3300020078 | Unclassified | 523 |
| 432 | Ga0206352_11224948 | 3300020078 | Unclassified | 700 |
| 433 | Ga0206352_11263999 | 3300020078 | Unclassified | 636 |
| 434 | Ga0206350_10002123 | 3300020080 | Unclassified | 601 |
| 435 | Ga0206350_10186125 | 3300020080 | Bacteria | 830 |
| 436 | Ga0206350_10271673 | 3300020080 | Unclassified | 1047 |
| 437 | Ga0206350_10277469 | 3300020080 | Bacteria | 760 |
| 438 | Ga0206350_10280083 | 3300020080 | Unclassified | 624 |
| 439 | Ga0206350_10314210 | 3300020080 | Unclassified | 603 |
| 440 | Ga0206350_10347331 | 3300020080 | Unclassified | 576 |
| 441 | Ga0206350_10568611 | 3300020080 | Unclassified | 606 |
| 442 | Ga0206350_10672396 | 3300020080 | Unclassified | 695 |
| 443 | Ga0206350_10707583 | 3300020080 | Unclassified | 689 |
| 444 | Ga0206350_10901464 | 3300020080 | Unclassified | 555 |
| 445 | Ga0206350_10972182 | 3300020080 | Unclassified | 676 |
| 446 | Ga0206350_11196424 | 3300020080 | Unclassified | 573 |
| 447 | Ga0206350_11240623 | 3300020080 | Unclassified | 580 |
| 448 | Ga0206350_11359846 | 3300020080 | Unclassified | 639 |
| 449 | Ga0206350_11630401 | 3300020080 | Unclassified | 637 |
| 450 | Ga0206354_10093064 | 3300020081 | Unclassified | 573 |
| 451 | Ga0206354_10289752 | 3300020081 | Unclassified | 703 |
| 452 | Ga0206354_10475303 | 3300020081 | Unclassified | 909 |
| 453 | Ga0206354_10814056 | 3300020081 | Bacteria | 670 |
| 454 | Ga0206354_10890264 | 3300020081 | Bacteria | 718 |
| 455 | Ga0206354_11213096 | 3300020081 | Unclassified | 662 |
| 456 | Ga0206354_11296545 | 3300020081 | Bacteria | 1082 |
| 457 | Ga0206354_11479014 | 3300020081 | Unclassified | 630 |
| 458 | Ga0206354_11493054 | 3300020081 | Unclassified | 735 |
| 459 | Ga0206354_11647079 | 3300020081 | Bacteria | 553 |
| 460 | Ga0206354_11706144 | 3300020081 | Bacteria | 624 |
| 461 | Ga0206353_10158651 | 3300020082 | Bacteria | 703 |
| 462 | Ga0206353_10572510 | 3300020082 | Unclassified | 610 |
| 463 | Ga0206353_10866201 | 3300020082 | Unclassified | 679 |
| 464 | Ga0206353_10976632 | 3300020082 | Unclassified | 619 |
| 465 | Ga0206353_11042202 | 3300020082 | Unclassified | 578 |
| 466 | Ga0206353_11337192 | 3300020082 | Bacteria | 1219 |
| 467 | Ga0206353_11566893 | 3300020082 | Unclassified | 858 |
| 468 | Ga0206353_11707724 | 3300020082 | Unclassified | 562 |
| 469 | Ga0206353_11840281 | 3300020082 | Unclassified | 683 |
| 470 | Ga0154015_1016038 | 3300020610 | Unclassified | 552 |
| 471 | Ga0154015_1049429 | 3300020610 | Unclassified | 899 |
| 472 | Ga0154015_1067378 | 3300020610 | Bacteria | 707 |
| 473 | Ga0154015_1072462 | 3300020610 | Unclassified | 671 |
| 474 | Ga0154015_1087282 | 3300020610 | Unclassified | 573 |
| 475 | Ga0154015_1335253 | 3300020610 | Bacteria | 552 |
| 476 | Ga0154015_1352349 | 3300020610 | Bacteria | 801 |
| 477 | Ga0154015_1376847 | 3300020610 | Bacteria | 1733 |
| 478 | Ga0154015_1510902 | 3300020610 | Unclassified | 551 |
| 479 | Ga0154015_1550972 | 3300020610 | Unclassified | 637 |
| 480 | Ga0154015_1638450 | 3300020610 | Bacteria | 1202 |
| 481 | Ga0154015_1691846 | 3300020610 | Unclassified | 607 |
| 482 | Ga0213875_10007485 | 3300021388 | Bacteria | 5630 |
| 483 | Ga0213875_10260284 | 3300021388 | Unclassified | 819 |
| 484 | Ga0224712_10105281 | 3300022467 | Unclassified | 1203 |
| 485 | Ga0224712_10142192 | 3300022467 | Bacteria | 1057 |
| 486 | Ga0224712_10150481 | 3300022467 | Unclassified | 1031 |
| 487 | Ga0224712_10208253 | 3300022467 | Unclassified | 891 |
| 488 | Ga0224712_10223459 | 3300022467 | Bacteria | 863 |
| 489 | Ga0224712_10227935 | 3300022467 | Bacteria | 855 |
| 490 | Ga0224712_10247429 | 3300022467 | Bacteria | 823 |
| 491 | Ga0224712_10262858 | 3300022467 | Bacteria | 800 |
| 492 | Ga0224712_10286167 | 3300022467 | Unclassified | 768 |
| 493 | Ga0224712_10288503 | 3300022467 | Bacteria | 765 |
| 494 | Ga0224712_10338083 | 3300022467 | Unclassified | 710 |
| 495 | Ga0224712_10363854 | 3300022467 | Unclassified | 685 |
| 496 | Ga0224712_10365560 | 3300022467 | Unclassified | 684 |
| 497 | Ga0224712_10367148 | 3300022467 | Bacteria | 682 |
| 498 | Ga0224712_10367804 | 3300022467 | Bacteria | 682 |
| 499 | Ga0224712_10406662 | 3300022467 | Unclassified | 649 |
| 500 | Ga0224712_10453664 | 3300022467 | Unclassified | 616 |
| 501 | Ga0224712_10513098 | 3300022467 | Unclassified | 580 |
| 502 | Ga0224712_10523685 | 3300022467 | Bacteria | 574 |
| 503 | Ga0224712_10564328 | 3300022467 | Unclassified | 554 |
| 504 | Ga0247551_103423 | 3300023552 | Unclassified | 608 |
| 505 | Ga0247551_105418 | 3300023552 | Unclassified | 530 |
| 506 | Ga0247553_111119 | 3300023672 | Bacteria | 523 |
| 507 | Ga0207656_10262907 | 3300025321 | Bacteria | 848 |
| 508 | Ga0207710_10100248 | 3300025900 | Unclassified | 1365 |
| 509 | Ga0207710_10222260 | 3300025900 | Unclassified | 938 |
| 510 | Ga0207680_10239761 | 3300025903 | Bacteria | 1249 |
| 511 | Ga0207680_10382069 | 3300025903 | Unclassified | 993 |
| 512 | Ga0207685_10558980 | 3300025905 | Unclassified | 609 |
| 513 | Ga0207699_10331229 | 3300025906 | Bacteria | 1070 |
| 514 | Ga0207699_10390028 | 3300025906 | Bacteria | 990 |
| 515 | Ga0207699_10608186 | 3300025906 | Bacteria | 796 |
| 516 | Ga0207699_10635269 | 3300025906 | Unclassified | 779 |
| 517 | Ga0207699_10714513 | 3300025906 | Bacteria | 734 |
| 518 | Ga0207645_10418558 | 3300025907 | Unclassified | 902 |
| 519 | Ga0207705_10215742 | 3300025909 | Bacteria | 1456 |
| 520 | Ga0207684_10895795 | 3300025910 | Unclassified | 746 |
| 521 | Ga0207654_10009344 | 3300025911 | Unclassified | 4977 |
| 522 | Ga0207654_10017392 | 3300025911 | Unclassified | 3757 |
| 523 | Ga0207654_10023665 | 3300025911 | Unclassified | 3293 |
| 524 | Ga0207654_10197787 | 3300025911 | Bacteria | 1322 |
| 525 | Ga0207707_10037603 | 3300025912 | Bacteria | 4230 |
| 526 | Ga0207707_10428463 | 3300025912 | Bacteria | 1133 |
| 527 | Ga0207707_11449010 | 3300025912 | Unclassified | 546 |
| 528 | Ga0207695_10001355 | 3300025913 | Bacteria | 41546 |
| 529 | Ga0207695_10006537 | 3300025913 | Bacteria | 15093 |
| 530 | Ga0207695_10024661 | 3300025913 | Bacteria | 6756 |
| 531 | Ga0207695_10075817 | 3300025913 | Bacteria | 3421 |
| 532 | Ga0207695_10371909 | 3300025913 | Unclassified | 1315 |
| 533 | Ga0207695_11183479 | 3300025913 | Unclassified | 644 |
| 534 | Ga0207671_10081536 | 3300025914 | Bacteria | 2426 |
| 535 | Ga0207671_10106286 | 3300025914 | Bacteria | 2131 |
| 536 | Ga0207671_11328503 | 3300025914 | Bacteria | 559 |
| 537 | Ga0207693_10415347 | 3300025915 | Bacteria | 1052 |
| 538 | Ga0207663_10035710 | 3300025916 | Bacteria | 2984 |
| 539 | Ga0207663_10075867 | 3300025916 | Bacteria | 2183 |
| 540 | Ga0207663_10170153 | 3300025916 | Unclassified | 1547 |
| 541 | Ga0207663_10211060 | 3300025916 | Unclassified | 1407 |
| 542 | Ga0207663_10315906 | 3300025916 | Unclassified | 1172 |
| 543 | Ga0207663_10340171 | 3300025916 | Bacteria | 1133 |
| 544 | Ga0207663_10473217 | 3300025916 | Bacteria | 969 |
| 545 | Ga0207660_10046329 | 3300025917 | Bacteria | 3068 |
| 546 | Ga0207657_10020879 | 3300025919 | Bacteria | 6181 |
| 547 | Ga0207657_10038937 | 3300025919 | Unclassified | 4227 |
| 548 | Ga0207657_10260454 | 3300025919 | Bacteria | 1380 |
| 549 | Ga0207657_10437745 | 3300025919 | Unclassified | 1026 |
| 550 | Ga0207649_10123326 | 3300025920 | Bacteria | 1750 |
| 551 | Ga0207649_10283281 | 3300025920 | Unclassified | 1206 |
| 552 | Ga0207649_11242558 | 3300025920 | Unclassified | 589 |
| 553 | Ga0207652_10052648 | 3300025921 | Bacteria | 3495 |
| 554 | Ga0207681_11693893 | 3300025923 | Unclassified | 528 |
| 555 | Ga0207694_10000486 | 3300025924 | Bacteria | 36102 |
| 556 | Ga0207694_10008252 | 3300025924 | Bacteria | 7872 |
| 557 | Ga0207694_10036963 | 3300025924 | Bacteria | 3748 |
| 558 | Ga0207694_10057844 | 3300025924 | Bacteria | 3015 |
| 559 | Ga0207694_10077794 | 3300025924 | Bacteria | 2600 |
| 560 | Ga0207694_10128618 | 3300025924 | Bacteria | 2028 |
| 561 | Ga0207650_10757229 | 3300025925 | Bacteria | 822 |
| 562 | Ga0207687_10003031 | 3300025927 | Bacteria | 11386 |
| 563 | Ga0207687_10009317 | 3300025927 | Bacteria | 6422 |
| 564 | Ga0207687_10055636 | 3300025927 | Unclassified | 2773 |
| 565 | Ga0207687_10406608 | 3300025927 | Unclassified | 1121 |
| 566 | Ga0207687_10577098 | 3300025927 | Bacteria | 946 |
| 567 | Ga0207700_10009283 | 3300025928 | Bacteria | 6137 |
| 568 | Ga0207700_10047296 | 3300025928 | Bacteria | 3188 |
| 569 | Ga0207700_10130289 | 3300025928 | Bacteria | 2052 |
| 570 | Ga0207700_10209698 | 3300025928 | Bacteria | 1646 |
| 571 | Ga0207664_10010090 | 3300025929 | Bacteria | 6658 |
| 572 | Ga0207664_10294525 | 3300025929 | Bacteria | 1427 |
| 573 | Ga0207644_10256437 | 3300025931 | Unclassified | 1397 |
| 574 | Ga0207644_10391657 | 3300025931 | Unclassified | 1134 |
| 575 | Ga0207690_11302999 | 3300025932 | Bacteria | 607 |
| 576 | Ga0207686_10024798 | 3300025934 | Bacteria | 3480 |
| 577 | Ga0207686_10034301 | 3300025934 | Bacteria | 3036 |
| 578 | Ga0207686_10080074 | 3300025934 | Unclassified | 2129 |
| 579 | Ga0207686_10095777 | 3300025934 | Bacteria | 1970 |
| 580 | Ga0207686_10109803 | 3300025934 | Bacteria | 1858 |
| 581 | Ga0207686_10236013 | 3300025934 | Bacteria | 1328 |
| 582 | Ga0207686_11265091 | 3300025934 | Unclassified | 605 |
| 583 | Ga0207709_10039104 | 3300025935 | Bacteria | 2831 |
| 584 | Ga0207709_10614814 | 3300025935 | Unclassified | 862 |
| 585 | Ga0207709_10908798 | 3300025935 | Unclassified | 716 |
| 586 | Ga0207709_11796403 | 3300025935 | Unclassified | 510 |
| 587 | Ga0207670_10784218 | 3300025936 | Unclassified | 793 |
| 588 | Ga0207669_10295227 | 3300025937 | Unclassified | 1229 |
| 589 | Ga0207704_10882377 | 3300025938 | Bacteria | 751 |
| 590 | Ga0207704_11249553 | 3300025938 | Unclassified | 634 |
| 591 | Ga0207665_10306055 | 3300025939 | Bacteria | 1189 |
| 592 | Ga0207665_10510214 | 3300025939 | Unclassified | 930 |
| 593 | Ga0207665_10654607 | 3300025939 | Bacteria | 824 |
| 594 | Ga0207665_11166410 | 3300025939 | Bacteria | 614 |
| 595 | Ga0207711_10004077 | 3300025941 | Bacteria | 12536 |
| 596 | Ga0207711_10938176 | 3300025941 | Bacteria | 804 |
| 597 | Ga0207689_10100874 | 3300025942 | Unclassified | 2371 |
| 598 | Ga0207689_10505756 | 3300025942 | Bacteria | 1012 |
| 599 | Ga0207689_10713638 | 3300025942 | Bacteria | 846 |
| 600 | Ga0207661_10000005 | 3300025944 | Bacteria | 557888 |
| 601 | Ga0207661_10025795 | 3300025944 | Bacteria | 4472 |
| 602 | Ga0207661_10050703 | 3300025944 | Unclassified | 3308 |
| 603 | Ga0207661_10188557 | 3300025944 | Bacteria | 1806 |
| 604 | Ga0207661_10393579 | 3300025944 | Bacteria | 1256 |
| 605 | Ga0207679_10175003 | 3300025945 | Unclassified | 1771 |
| 606 | Ga0207679_11391241 | 3300025945 | Bacteria | 644 |
| 607 | Ga0207667_10002176 | 3300025949 | Bacteria | 24579 |
| 608 | Ga0207667_10003779 | 3300025949 | Bacteria | 18654 |
| 609 | Ga0207667_10051139 | 3300025949 | Unclassified | 4357 |
| 610 | Ga0207667_10071077 | 3300025949 | Bacteria | 3620 |
| 611 | Ga0207667_10088668 | 3300025949 | Unclassified | 3198 |
| 612 | Ga0207667_10144205 | 3300025949 | Bacteria | 2452 |
| 613 | Ga0207667_10306893 | 3300025949 | Unclassified | 1621 |
| 614 | Ga0207667_10854959 | 3300025949 | Bacteria | 904 |
| 615 | Ga0207651_10318233 | 3300025960 | Bacteria | 1300 |
| 616 | Ga0207651_10602773 | 3300025960 | Unclassified | 960 |
| 617 | Ga0207651_11325089 | 3300025960 | Unclassified | 647 |
| 618 | Ga0207712_10145673 | 3300025961 | Bacteria | 1823 |
| 619 | Ga0207712_10505903 | 3300025961 | Bacteria | 1033 |
| 620 | Ga0207640_11261932 | 3300025981 | Bacteria | 659 |
| 621 | Ga0207640_11515428 | 3300025981 | Bacteria | 603 |
| 622 | Ga0207658_10244451 | 3300025986 | Bacteria | 1522 |
| 623 | Ga0207658_10545478 | 3300025986 | Unclassified | 1037 |
| 624 | Ga0207677_10317416 | 3300026023 | Unclassified | 1294 |
| 625 | Ga0207677_10810944 | 3300026023 | Unclassified | 838 |
| 626 | Ga0207677_11495811 | 3300026023 | Unclassified | 623 |
| 627 | Ga0207703_10026180 | 3300026035 | Bacteria | 4589 |
| 628 | Ga0207703_10028191 | 3300026035 | Bacteria | 4424 |
| 629 | Ga0207703_10483307 | 3300026035 | Bacteria | 1161 |
| 630 | Ga0207703_10732030 | 3300026035 | Bacteria | 942 |
| 631 | Ga0207703_11474770 | 3300026035 | Unclassified | 654 |
| 632 | Ga0207639_10031691 | 3300026041 | Bacteria | 3887 |
| 633 | Ga0207639_10510184 | 3300026041 | Bacteria | 1100 |
| 634 | Ga0207639_10672018 | 3300026041 | Bacteria | 959 |
| 635 | Ga0207639_10827326 | 3300026041 | Bacteria | 864 |
| 636 | Ga0207678_10668483 | 3300026067 | Unclassified | 913 |
| 637 | Ga0207708_10962309 | 3300026075 | Unclassified | 741 |
| 638 | Ga0207702_10006005 | 3300026078 | Bacteria | 10542 |
| 639 | Ga0207702_10085210 | 3300026078 | Unclassified | 2753 |
| 640 | Ga0207702_10242169 | 3300026078 | Unclassified | 1690 |
| 641 | Ga0207702_10624992 | 3300026078 | Bacteria | 1058 |
| 642 | Ga0207702_10666763 | 3300026078 | Bacteria | 1024 |
| 643 | Ga0207702_11818994 | 3300026078 | Unclassified | 601 |
| 644 | Ga0207641_10031537 | 3300026088 | Unclassified | 4396 |
| 645 | Ga0207641_10920370 | 3300026088 | Bacteria | 869 |
| 646 | Ga0207648_10114069 | 3300026089 | Unclassified | 2374 |
| 647 | Ga0207648_10295481 | 3300026089 | Bacteria | 1451 |
| 648 | Ga0207648_11589517 | 3300026089 | Unclassified | 614 |
| 649 | Ga0207648_11826327 | 3300026089 | Unclassified | 569 |
| 650 | Ga0207676_10019659 | 3300026095 | Bacteria | 4931 |
| 651 | Ga0207674_10000361 | 3300026116 | Bacteria | 58920 |
| 652 | Ga0207674_10002055 | 3300026116 | Bacteria | 25558 |
| 653 | Ga0207674_10024159 | 3300026116 | Bacteria | 6498 |
| 654 | Ga0207674_10697052 | 3300026116 | Bacteria | 980 |
| 655 | Ga0207675_100472765 | 3300026118 | Bacteria | 1245 |
| 656 | Ga0207698_10001862 | 3300026142 | Bacteria | 12313 |
| 657 | Ga0207698_10048734 | 3300026142 | Bacteria | 3218 |
| 658 | Ga0207698_10289891 | 3300026142 | Bacteria | 1518 |
| 659 | Ga0207698_10733726 | 3300026142 | Unclassified | 985 |
| 660 | Ga0207698_11211148 | 3300026142 | Bacteria | 769 |
| 661 | Ga0268266_10007479 | 3300028379 | Bacteria | 9846 |
| 662 | Ga0268266_11176573 | 3300028379 | Unclassified | 742 |
| 663 | Ga0268264_10064789 | 3300028381 | Unclassified | 3077 |
| 664 | Ga0268264_10285804 | 3300028381 | Bacteria | 1547 |
| 665 | Ga0268264_10302641 | 3300028381 | Bacteria | 1506 |
| 666 | Ga0268264_11181187 | 3300028381 | Unclassified | 774 |
| 667 | Ga0265323_10001695 | 3300028653 | Bacteria | 10527 |
| 668 | Ga0265338_10159741 | 3300028800 | Bacteria | 1742 |
| 669 | Ga0265762_1016992 | 3300030760 | Unclassified | 1322 |
| 670 | Ga0265762_1081893 | 3300030760 | Unclassified | 692 |
| 671 | Ga0265762_1145244 | 3300030760 | Bacteria | 561 |
| 672 | Ga0265775_114080 | 3300030762 | Unclassified | 528 |
| 673 | Ga0265767_105531 | 3300030836 | Unclassified | 768 |
| 674 | Ga0265767_106996 | 3300030836 | Bacteria | 712 |
| 675 | Ga0265767_113693 | 3300030836 | Unclassified | 571 |
| 676 | Ga0265766_1005331 | 3300030863 | Bacteria | 813 |
| 677 | Ga0265766_1011308 | 3300030863 | Unclassified | 647 |
| 678 | Ga0265766_1012062 | 3300030863 | Unclassified | 635 |
| 679 | Ga0265766_1015637 | 3300030863 | Bacteria | 588 |
| 680 | Ga0265766_1022342 | 3300030863 | Bacteria | 528 |
| 681 | Ga0265777_112541 | 3300030877 | Unclassified | 639 |
| 682 | Ga0265777_113152 | 3300030877 | Unclassified | 629 |
| 683 | Ga0265777_121229 | 3300030877 | Unclassified | 538 |
| 684 | Ga0265776_104550 | 3300030880 | Bacteria | 708 |
| 685 | Ga0265776_111230 | 3300030880 | Bacteria | 538 |
| 686 | Ga0265764_108395 | 3300030882 | Bacteria | 624 |
| 687 | Ga0265764_110609 | 3300030882 | Unclassified | 584 |
| 688 | Ga0265772_103116 | 3300030886 | Bacteria | 675 |
| 689 | Ga0265769_109336 | 3300030888 | Unclassified | 657 |
| 690 | Ga0265769_117898 | 3300030888 | Unclassified | 545 |
| 691 | Ga0265769_118683 | 3300030888 | Bacteria | 538 |
| 692 | Ga0265761_104165 | 3300030889 | Unclassified | 730 |
| 693 | Ga0247549_101811 | 3300030942 | Unclassified | 732 |
| 694 | Ga0247549_102985 | 3300030942 | Unclassified | 614 |
| 695 | Ga0265768_102420 | 3300030963 | Bacteria | 951 |
| 696 | Ga0265768_103921 | 3300030963 | Unclassified | 819 |
| 697 | Ga0265768_104251 | 3300030963 | Bacteria | 801 |
| 698 | Ga0265768_105373 | 3300030963 | Unclassified | 744 |
| 699 | Ga0265768_105600 | 3300030963 | Unclassified | 733 |
| 700 | Ga0265768_107355 | 3300030963 | Bacteria | 669 |
| 701 | Ga0265768_108783 | 3300030963 | Unclassified | 632 |
| 702 | Ga0265768_110710 | 3300030963 | Bacteria | 592 |
| 703 | Ga0265768_113662 | 3300030963 | Bacteria | 551 |
| 704 | Ga0265768_116321 | 3300030963 | Unclassified | 521 |
| 705 | Ga0265768_117686 | 3300030963 | Unclassified | 507 |
| 706 | Ga0265771_1018396 | 3300031010 | Unclassified | 587 |
| 707 | Ga0265771_1027765 | 3300031010 | Unclassified | 527 |
| 708 | Ga0265774_106374 | 3300031011 | Bacteria | 529 |
| 709 | Ga0265773_1003870 | 3300031018 | Unclassified | 1007 |
| 710 | Ga0265773_1024359 | 3300031018 | Unclassified | 616 |
| 711 | Ga0265760_10067456 | 3300031090 | Bacteria | 1094 |
| 712 | Ga0265760_10209722 | 3300031090 | Unclassified | 661 |
| 713 | Ga0265760_10303651 | 3300031090 | Unclassified | 566 |
| 714 | Ga0265760_10307115 | 3300031090 | Unclassified | 563 |
| 715 | Ga0265328_10180763 | 3300031239 | Unclassified | 798 |
| 716 | Ga0265325_10125088 | 3300031241 | Bacteria | 1236 |
| 717 | Ga0265339_10065374 | 3300031249 | Unclassified | 1950 |
| 718 | Ga0265331_10230953 | 3300031250 | Bacteria | 831 |
| 719 | Ga0265316_10014783 | 3300031344 | Bacteria | 6852 |
| 720 | Ga0265316_10038490 | 3300031344 | Bacteria | 3853 |
| 721 | Ga0265316_10196052 | 3300031344 | Bacteria | 1499 |
| 722 | Ga0265316_10198072 | 3300031344 | Unclassified | 1490 |
| 723 | Ga0265316_10450397 | 3300031344 | Unclassified | 923 |
| 724 | Ga0265313_10007638 | 3300031595 | Bacteria | 7333 |
| 725 | Ga0265313_10255839 | 3300031595 | Bacteria | 713 |
| 726 | Ga0310103_139079 | 3300031614 | Unclassified | 549 |
| 727 | Ga0310111_133895 | 3300031667 | Unclassified | 585 |
| 728 | Ga0265314_10011041 | 3300031711 | Bacteria | 7489 |
| 729 | Ga0265314_10282918 | 3300031711 | Unclassified | 937 |
| 730 | Ga0265314_10362416 | 3300031711 | Unclassified | 794 |
| 731 | Ga0265342_10146176 | 3300031712 | Unclassified | 1316 |
| 732 | Ga0265342_10225076 | 3300031712 | Bacteria | 1009 |
| 733 | Ga0247548_104373 | 3300031814 | Unclassified | 653 |
| 734 | Ga0247548_104387 | 3300031814 | Unclassified | 653 |
| 735 | Ga0247548_105395 | 3300031814 | Unclassified | 605 |
| 736 | Ga0247548_107682 | 3300031814 | Bacteria | 539 |
| 737 | Ga0316042_120450 | 3300031816 | Unclassified | 710 |
| 738 | Ga0316042_124683 | 3300031816 | Bacteria | 599 |
| 739 | Ga0316043_123481 | 3300031828 | Unclassified | 662 |
| 740 | Ga0307411_12286721 | 3300032005 | Unclassified | 508 |
| 741 | Ga0316053_107474 | 3300032120 | Bacteria | 726 |
| 742 | Ga0316053_112606 | 3300032120 | Unclassified | 607 |
| 743 | Ga0316053_112983 | 3300032120 | Unclassified | 601 |
| 744 | Ga0316053_119800 | 3300032120 | Unclassified | 522 |
| 745 | Ga0373926_0260165 | 3300035083 | Unclassified | 674 |
| 746 | Ga0373926_0448359 | 3300035083 | Unclassified | 512 |
| 747 | Ga0373934_0006374 | 3300035086 | Unclassified | 4376 |
| 748 | Ga0373934_0026633 | 3300035086 | Bacteria | 2243 |
| 749 | Ga0373934_0052051 | 3300035086 | Unclassified | 1623 |
| 750 | Ga0373934_0187541 | 3300035086 | Bacteria | 850 |
| 751 | Ga0373944_0042562 | 3300035089 | Unclassified | 1409 |
| 752 | Ga0373923_0011794 | 3300035111 | Bacteria | 3217 |
| 753 | Ga0373923_0034984 | 3300035111 | Bacteria | 2042 |
| 754 | Ga0373923_0256953 | 3300035111 | Bacteria | 819 |
| 755 | Ga0373936_0229698 | 3300035113 | Bacteria | 825 |
| 756 | Ga0373936_0605373 | 3300035113 | Bacteria | 515 |
| 757 | Ga0373941_0470512 | 3300035115 | Unclassified | 530 |
| 758 | Ga0373953_0027981 | 3300035117 | Bacteria | 2170 |
| 759 | Ga0373953_0102277 | 3300035117 | Unclassified | 1207 |
| 760 | Ga0373953_0283290 | 3300035117 | Unclassified | 722 |
| 761 | Ga0373953_0349863 | 3300035117 | Bacteria | 647 |
| 762 | Ga0373953_0462313 | 3300035117 | Unclassified | 561 |
| 763 | Ga0373954_0035650 | 3300035118 | Bacteria | 2308 |
| 764 | Ga0373954_0047998 | 3300035118 | Bacteria | 2000 |
| 765 | Ga0373954_0051631 | 3300035118 | Bacteria | 1931 |
| 766 | Ga0373954_0103732 | 3300035118 | Bacteria | 1373 |
| 767 | Ga0373954_0313979 | 3300035118 | Unclassified | 773 |
| 768 | Ga0373956_0085248 | 3300035119 | Unclassified | 1453 |
| 769 | Ga0373956_0095264 | 3300035119 | Bacteria | 1376 |
| 770 | Ga0373943_0034131 | 3300035170 | Unclassified | 2426 |
| 771 | Ga0373943_0572867 | 3300035170 | Bacteria | 663 |
| 772 | Ga0373946_0154161 | 3300035171 | Bacteria | 1074 |
| 773 | Ga0373955_0026031 | 3300035172 | Bacteria | 3009 |
| 774 | Ga0373955_0041996 | 3300035172 | Bacteria | 2454 |
| 775 | Ga0373955_0188013 | 3300035172 | Bacteria | 1227 |
| 776 | Ga0373955_0219194 | 3300035172 | Bacteria | 1136 |
| 777 | Ga0373955_0322560 | 3300035172 | Bacteria | 933 |
| 778 | Ga0373955_0724206 | 3300035172 | Bacteria | 611 |
| 779 | Ga0373924_0103536 | 3300035410 | Bacteria | 1226 |
| 780 | Ga0373924_0119838 | 3300035410 | Unclassified | 1141 |
| 781 | Ga0373924_0153523 | 3300035410 | Bacteria | 1008 |
| 782 | Ga0373924_0153887 | 3300035410 | Unclassified | 1007 |
| 783 | Ga0373935_0049020 | 3300035692 | Bacteria | 2676 |
| 784 | Ga0373935_0125561 | 3300035692 | Bacteria | 1719 |
| 785 | Ga0373935_0197072 | 3300035692 | Bacteria | 1390 |
| 786 | Ga0373935_0353913 | 3300035692 | Unclassified | 1047 |
| 787 | Ga0373935_0645587 | 3300035692 | Bacteria | 776 |
| 788 | Ga0373927_0009527 | 3300035695 | Bacteria | 6513 |
| 789 | Ga0373927_0009834 | 3300035695 | Bacteria | 6410 |
| 790 | Ga0373927_0202633 | 3300035695 | Bacteria | 1303 |
| 791 | Ga0373927_0470575 | 3300035695 | Unclassified | 830 |
| 792 | Ga0373927_0585743 | 3300035695 | Bacteria | 737 |
| 793 | Ga0373927_0613715 | 3300035695 | Unclassified | 719 |
| 794 | Ga0373933_0096385 | 3300035724 | Bacteria | 1831 |
| 795 | Ga0373933_0245989 | 3300035724 | Unclassified | 1151 |
| 796 | Ga0373933_0308105 | 3300035724 | Bacteria | 1026 |
| 797 | Ga0373933_0361868 | 3300035724 | Bacteria | 943 |
| 798 | Ga0373933_0374373 | 3300035724 | Bacteria | 927 |
| 799 | Ga0373947_0057530 | 3300035725 | Unclassified | 2353 |
| 800 | Ga0373947_0099908 | 3300035725 | Bacteria | 1822 |
| 801 | Ga0373947_0180196 | 3300035725 | Bacteria | 1375 |
| 802 | Ga0373947_0266469 | 3300035725 | Unclassified | 1136 |
| 803 | Ga0373947_0270836 | 3300035725 | Bacteria | 1127 |
| 804 | Ga0373947_0298871 | 3300035725 | Bacteria | 1073 |
| 805 | Ga0373937_0001443 | 3300036401 | Bacteria | 19880 |
| 806 | Ga0373937_0033209 | 3300036401 | Bacteria | 4685 |
| 807 | Ga0373937_0047511 | 3300036401 | Bacteria | 3927 |
| 808 | Ga0373937_0111072 | 3300036401 | Bacteria | 2550 |
| 809 | Ga0373937_0115609 | 3300036401 | Bacteria | 2498 |
| 810 | Ga0373937_0178912 | 3300036401 | Bacteria | 1991 |
| 811 | Ga0373937_0214781 | 3300036401 | Bacteria | 1810 |
| 812 | Ga0373937_0369841 | 3300036401 | Unclassified | 1359 |
| 813 | Ga0373937_0505633 | 3300036401 | Unclassified | 1148 |
| 814 | Ga0373937_1445312 | 3300036401 | Bacteria | 635 |
| 815 | Ga0265778_034197 | 3300036457 | Bacteria | 664 |
| 816 | Ga0265778_034457 | 3300036457 | Unclassified | 662 |
| 817 | Ga0265778_035199 | 3300036457 | Bacteria | 657 |
| 818 | Ga0265778_035321 | 3300036457 | Bacteria | 656 |
| 819 | Ga0265778_049605 | 3300036457 | Unclassified | 572 |
| 820 | Ga0265778_052249 | 3300036457 | Unclassified | 561 |
| 821 | Ga0265778_055338 | 3300036457 | Bacteria | 549 |
| 822 | Ga0265778_059524 | 3300036457 | Unclassified | 533 |
| 823 | Ga0265778_062280 | 3300036457 | Bacteria | 523 |
| 824 | Ga0265778_063876 | 3300036457 | Bacteria | 517 |
| 825 | Ga0372808_062442 | 3300036459 | Unclassified | 536 |
| 826 | Ga0310109_029066 | 3300036534 | Unclassified | 735 |
| 827 | Ga0373925_0014727 | 3300037068 | Bacteria | 5650 |
| 828 | Ga0373925_0050539 | 3300037068 | Unclassified | 3101 |
| 829 | Ga0373925_0156161 | 3300037068 | Bacteria | 1795 |
| 830 | Ga0373925_0193112 | 3300037068 | Bacteria | 1616 |
| 831 | Ga0373925_0571288 | 3300037068 | Unclassified | 930 |
| 832 | Ga0436364_0483352 | 3300037853 | Unclassified | 880 |
| 833 | Ga0436364_1424611 | 3300037853 | Unclassified | 3357 |
| 834 | Ga0436361_0609805 | 3300039447 | Unclassified | 634 |
| 835 | Ga0436362_0834658 | 3300039453 | Unclassified | 660 |
| 836 | Ga0451839_1486827 | 3300041496 | Bacteria | 960 |
| 837 | Ga0451577_0744043 | 3300042876 | Unclassified | 887 |
| 838 | Ga0453683_0665519 | 3300044673 | Bacteria | 681 |
| 839 | Ga0453683_1181748 | 3300044673 | Bacteria | 512 |
| 840 | Ga0451576_0093362 | 3300045051 | Unclassified | 3129 |
| 841 | Ga0451576_0216282 | 3300045051 | Unclassified | 2001 |
| 842 | Ga0495592_0037718 | 3300046454 | Bacteria | 3637 |
| 843 | Ga0495603_0439947 | 3300046455 | Unclassified | 747 |
| 844 | Ga0495651_0088399 | 3300046462 | Bacteria | 2328 |
| 845 | Ga0495651_0231365 | 3300046462 | Bacteria | 1273 |
| 846 | Ga0495651_0269354 | 3300046462 | Bacteria | 1155 |
| 847 | Ga0495653_0357491 | 3300046463 | Unclassified | 938 |
| 848 | Ga0495653_0495917 | 3300046463 | Bacteria | 762 |
| 849 | Ga0495580_0002824 | 3300046472 | Bacteria | 14930 |
| 850 | Ga0495580_0014057 | 3300046472 | Bacteria | 6087 |
| 851 | Ga0495580_0073559 | 3300046472 | Bacteria | 2386 |
| 852 | Ga0495580_0093911 | 3300046472 | Unclassified | 2087 |
| 853 | Ga0495580_0149751 | 3300046472 | Bacteria | 1617 |
| 854 | Ga0495580_0314626 | 3300046472 | Unclassified | 1065 |
| 855 | Ga0495580_0865340 | 3300046472 | Unclassified | 583 |
| 856 | Ga0495582_0024647 | 3300046473 | Bacteria | 3292 |
| 857 | Ga0495639_0065672 | 3300046475 | Unclassified | 1669 |
| 858 | Ga0495664_0009808 | 3300046477 | Bacteria | 5368 |
| 859 | Ga0495584_0380670 | 3300046491 | Unclassified | 717 |
| 860 | Ga0495594_0135237 | 3300046499 | Unclassified | 1397 |
| 861 | Ga0495608_0097082 | 3300046511 | Bacteria | 1903 |
| 862 | Ga0495608_0256644 | 3300046511 | Bacteria | 1089 |
| 863 | Ga0495608_0317436 | 3300046511 | Unclassified | 963 |
| 864 | Ga0495618_0057915 | 3300046514 | Bacteria | 2454 |
| 865 | Ga0495628_0056689 | 3300046516 | Bacteria | 3083 |
| 866 | Ga0495628_0230076 | 3300046516 | Bacteria | 1390 |
| 867 | Ga0495628_0563263 | 3300046516 | Bacteria | 817 |
| 868 | Ga0495628_0601798 | 3300046516 | Unclassified | 785 |
| 869 | Ga0495630_0158571 | 3300046517 | Bacteria | 1723 |
| 870 | Ga0495666_0259402 | 3300046526 | Unclassified | 791 |
| 871 | Ga0495666_0314441 | 3300046526 | Unclassified | 707 |
| 872 | Ga0495666_0528245 | 3300046526 | Unclassified | 527 |
| 873 | Ga0495652_0054747 | 3300046529 | Bacteria | 3396 |
| 874 | Ga0495665_0085093 | 3300046531 | Unclassified | 1662 |
| 875 | Ga0495665_0130196 | 3300046531 | Bacteria | 1317 |
| 876 | Ga0495665_0276636 | 3300046531 | Unclassified | 861 |
| 877 | Ga0495665_0594338 | 3300046531 | Bacteria | 553 |
| 878 | Ga0495640_0042576 | 3300046533 | Bacteria | 3166 |
| 879 | Ga0495586_0137070 | 3300046535 | Unclassified | 1372 |
| 880 | Ga0495587_0002664 | 3300046536 | Bacteria | 11919 |
| 881 | Ga0495587_0100531 | 3300046536 | Unclassified | 1667 |
| 882 | Ga0495598_0282068 | 3300046537 | Bacteria | 624 |
| 883 | Ga0495645_0009769 | 3300046543 | Bacteria | 6713 |
| 884 | Ga0495645_0149465 | 3300046543 | Unclassified | 1624 |
| 885 | Ga0495645_0191205 | 3300046543 | Unclassified | 1395 |
| 886 | Ga0495645_0445545 | 3300046543 | Bacteria | 817 |
| 887 | Ga0495667_0018037 | 3300046559 | Bacteria | 4768 |
| 888 | Ga0495667_0063533 | 3300046559 | Bacteria | 2416 |
| 889 | Ga0495667_0105123 | 3300046559 | Bacteria | 1825 |
| 890 | Ga0495634_0082539 | 3300046642 | Bacteria | 2100 |
| 891 | Ga0495635_0057514 | 3300046663 | Bacteria | 2675 |
| 892 | Ga0495635_0368607 | 3300046663 | Unclassified | 957 |
| 893 | Ga0495588_0397347 | 3300046674 | Bacteria | 724 |
| 894 | Ga0495599_0018742 | 3300046678 | Unclassified | 4313 |
| 895 | Ga0495599_0055259 | 3300046678 | Unclassified | 2487 |
| 896 | Ga0495623_0176017 | 3300046679 | Bacteria | 1246 |
| 897 | Ga0495623_0261789 | 3300046679 | Bacteria | 969 |
| 898 | Ga0495646_0171974 | 3300046680 | Bacteria | 1193 |
| 899 | Ga0495613_0047957 | 3300046689 | Bacteria | 3155 |
| 900 | Ga0495624_0700896 | 3300046690 | Unclassified | 601 |
| 901 | Ga0495600_0044898 | 3300046809 | Bacteria | 2882 |
| 902 | Ga0495581_0237527 | 3300047315 | Bacteria | 1066 |
| 903 | Ga0495581_0497618 | 3300047315 | Unclassified | 709 |
| 904 | Ga0495604_0359783 | 3300047317 | Bacteria | 965 |
| 905 | Ga0495636_0183151 | 3300047318 | Bacteria | 951 |
| 906 | Ga0495674_0011815 | 3300047319 | Bacteria | 8232 |
| 907 | Ga0495674_0037580 | 3300047319 | Bacteria | 4351 |
| 908 | Ga0495674_0321693 | 3300047319 | Bacteria | 1260 |
| 909 | Ga0495680_0059182 | 3300047322 | Bacteria | 2959 |
| 910 | Ga0495680_0228717 | 3300047322 | Bacteria | 1325 |
| 911 | Ga0495675_0076480 | 3300047444 | Bacteria | 2110 |
| 912 | Ga0495675_0381919 | 3300047444 | Bacteria | 824 |
| 913 | Ga0495675_0393300 | 3300047444 | Unclassified | 809 |
| 914 | Ga0495684_0008037 | 3300047471 | Bacteria | 8157 |
| 915 | Ga0495684_0031099 | 3300047471 | Bacteria | 4098 |
| 916 | Ga0495684_0077934 | 3300047471 | Bacteria | 2515 |
| 917 | Ga0495684_0120513 | 3300047471 | Unclassified | 1976 |
| 918 | Ga0495684_0639423 | 3300047471 | Bacteria | 713 |
| 919 | Ga0495593_0648413 | 3300047673 | Bacteria | 530 |
| 920 | Ga0495602_0051852 | 3300048088 | Bacteria | 3650 |
| 921 | Ga0495602_0093611 | 3300048088 | Bacteria | 2486 |
| 922 | Ga0496104_0101947 | 3300048907 | Bacteria | 2749 |
| 923 | Ga0496104_0438639 | 3300048907 | Unclassified | 1218 |
| 924 | Ga0496104_1882721 | 3300048907 | Bacteria | 500 |
| 925 | Ga0496106_0308257 | 3300048909 | Bacteria | 1270 |
| 926 | Ga0496109_1602131 | 3300048912 | Bacteria | 585 |
| 927 | Ga0496112_0995844 | 3300048915 | Unclassified | 758 |
| 928 | Ga0496112_1368449 | 3300048915 | Bacteria | 623 |
| 929 | Ga0496115_0121493 | 3300048918 | Bacteria | 2149 |
| 930 | Ga0496115_0198712 | 3300048918 | Bacteria | 1656 |
| 931 | Ga0496115_0239406 | 3300048918 | Unclassified | 1496 |
| 932 | Ga0501315_026868 | 3300049531 | Unclassified | 809 |
| 933 | Ga0501315_081096 | 3300049531 | Unclassified | 551 |
| 934 | Ga0501317_083756 | 3300049533 | Unclassified | 555 |
| 935 | Ga0501318_067550 | 3300049534 | Unclassified | 559 |
| 936 | Ga0501031_0130126 | 3300049568 | Bacteria | 1644 |
| 937 | Ga0501032_0004512 | 3300049569 | Bacteria | 10477 |
| 938 | Ga0501033_0018380 | 3300049570 | Bacteria | 5279 |
| 939 | Ga0501033_0884578 | 3300049570 | Unclassified | 601 |
| 940 | Ga0501034_0055543 | 3300049571 | Bacteria | 3984 |
| 941 | Ga0501036_0000169 | 3300049572 | Bacteria | 43136 |
| 942 | Ga0501037_0011724 | 3300049573 | Bacteria | 6453 |
| 943 | Ga0501038_0002204 | 3300049574 | Bacteria | 18117 |
| 944 | Ga0501039_0175851 | 3300049575 | Bacteria | 1683 |
| 945 | Ga0501043_0003790 | 3300049579 | Bacteria | 12424 |
| 946 | Ga0501046_0002817 | 3300049580 | Bacteria | 16196 |
| 947 | Ga0501047_0017475 | 3300049581 | Bacteria | 6870 |
| 948 | Ga0501048_0025322 | 3300049582 | Bacteria | 4324 |
| 949 | Ga0501067_0003565 | 3300049583 | Bacteria | 8569 |
| 950 | Ga0501068_0005161 | 3300049584 | Bacteria | 7120 |
| 951 | Ga0501069_0001178 | 3300049585 | Bacteria | 12696 |
| 952 | Ga0501070_0050742 | 3300049586 | Bacteria | 3443 |
| 953 | Ga0501072_0000228 | 3300049588 | Bacteria | 41400 |
| 954 | Ga0501072_0406388 | 3300049588 | Bacteria | 1080 |
| 955 | Ga0501073_0193908 | 3300049589 | Bacteria | 1405 |
| 956 | Ga0501074_0197581 | 3300049590 | Bacteria | 1433 |
| 957 | Ga0501076_0928061 | 3300049592 | Unclassified | 717 |
| 958 | Ga0501077_0028626 | 3300049593 | Bacteria | 3541 |
| 959 | Ga0501079_0014673 | 3300049741 | Bacteria | 5973 |
| 960 | Ga0501080_0004398 | 3300049742 | Bacteria | 12521 |
| 961 | Ga0501083_0002357 | 3300049744 | Bacteria | 12934 |
| 962 | Ga0501035_0136922 | 3300049822 | Bacteria | 2131 |
| 963 | Ga0501044_0116689 | 3300049823 | Bacteria | 2674 |
| 964 | Ga0495601_0794973 | 3300053077 | Bacteria | 601 |
| 965 | Ga0495595_0306611 | 3300053084 | Bacteria | 799 |
| 966 | Ga0495619_0752095 | 3300053085 | Bacteria | 661 |
| 967 | Ga0500568_0001338 | 3300053139 | Bacteria | 16133 |
| 968 | Ga0501084_0092592 | 3300054114 | Bacteria | 2537 |
| 969 | Ga0587084_090064 | 3300059477 | Unclassified | 607 |
| 970 | Ga0587093_047786 | 3300059478 | Unclassified | 667 |
| 971 | Ga0587093_050051 | 3300059478 | Bacteria | 657 |
| 972 | Ga0587093_065788 | 3300059478 | Unclassified | 600 |
| 973 | Ga0587093_068119 | 3300059478 | Bacteria | 593 |
| 974 | Ga0587066_061551 | 3300059490 | Bacteria | 767 |
| 975 | Ga0587066_102918 | 3300059490 | Bacteria | 651 |
| 976 | Ga0587066_104024 | 3300059490 | Unclassified | 649 |
| 977 | Ga0587066_146328 | 3300059490 | Unclassified | 582 |
| 978 | Ga0587066_153999 | 3300059490 | Bacteria | 572 |
| 979 | Ga0587073_0052707 | 3300059492 | Unclassified | 928 |
| 980 | Ga0587073_0069974 | 3300059492 | Unclassified | 845 |
| 981 | Ga0587073_0109333 | 3300059492 | Unclassified | 730 |
| 982 | Ga0587073_0126078 | 3300059492 | Bacteria | 697 |
| 983 | Ga0587073_0146779 | 3300059492 | Unclassified | 663 |
| 984 | Ga0587073_0190954 | 3300059492 | Unclassified | 608 |
| 985 | Ga0587073_0193838 | 3300059492 | Bacteria | 605 |
| 986 | Ga0587073_0260070 | 3300059492 | Unclassified | 548 |
| 987 | Ga0587073_0265993 | 3300059492 | Unclassified | 544 |
| 988 | Ga0587077_040997 | 3300059493 | Unclassified | 929 |
| 989 | Ga0587077_097589 | 3300059493 | Unclassified | 701 |
| 990 | Ga0587077_100953 | 3300059493 | Bacteria | 693 |
| 991 | Ga0587080_094101 | 3300059503 | Unclassified | 632 |
| 992 | Ga0587080_135879 | 3300059503 | Unclassified | 558 |
| 993 | Ga0587082_088263 | 3300059504 | Unclassified | 657 |
| 994 | Ga0587082_104567 | 3300059504 | Unclassified | 621 |
| 995 | Ga0587082_123694 | 3300059504 | Unclassified | 587 |
| 996 | Ga0587083_0168097 | 3300059505 | Unclassified | 605 |
| 997 | Ga0587083_0168412 | 3300059505 | Bacteria | 605 |
| 998 | Ga0587083_0206380 | 3300059505 | Unclassified | 564 |
| 999 | Ga0587083_0237041 | 3300059505 | Unclassified | 538 |
| 1000 | Ga0587083_0258100 | 3300059505 | Unclassified | 522 |
| 1001 | Ga0587085_105987 | 3300059506 | Unclassified | 600 |
| 1002 | Ga0587085_120242 | 3300059506 | Bacteria | 576 |
| 1003 | Ga0587085_141271 | 3300059506 | Bacteria | 547 |
| 1004 | Ga0587086_055793 | 3300059507 | Unclassified | 647 |
| 1005 | Ga0587086_068505 | 3300059507 | Unclassified | 605 |
| 1006 | Ga0587086_086595 | 3300059507 | Unclassified | 560 |
| 1007 | Ga0587089_074111 | 3300059509 | Unclassified | 583 |
| 1008 | Ga0587089_078824 | 3300059509 | Unclassified | 570 |
| 1009 | Ga0587089_110288 | 3300059509 | Unclassified | 507 |
| 1010 | Ga0587090_065786 | 3300059510 | Unclassified | 698 |
| 1011 | Ga0587090_081775 | 3300059510 | Unclassified | 648 |
| 1012 | Ga0587090_124410 | 3300059510 | Bacteria | 562 |
| 1013 | Ga0587091_078069 | 3300059511 | Unclassified | 738 |
| 1014 | Ga0587091_082016 | 3300059511 | Bacteria | 725 |
| 1015 | Ga0587091_137550 | 3300059511 | Unclassified | 609 |
| 1016 | Ga0587091_140650 | 3300059511 | Unclassified | 604 |
| 1017 | Ga0587091_150925 | 3300059511 | Unclassified | 590 |
| 1018 | Ga0587091_173606 | 3300059511 | Bacteria | 562 |
| 1019 | Ga0587091_188868 | 3300059511 | Unclassified | 546 |
| 1020 | Ga0587091_194360 | 3300059511 | Bacteria | 541 |
| 1021 | Ga0587091_201551 | 3300059511 | Unclassified | 535 |
| 1022 | Ga0587092_067731 | 3300059512 | Unclassified | 681 |
| 1023 | Ga0587094_057810 | 3300059513 | Unclassified | 672 |
| 1024 | Ga0587094_067914 | 3300059513 | Bacteria | 636 |
| 1025 | Ga0587094_081792 | 3300059513 | Unclassified | 598 |
| 1026 | Ga0587094_089939 | 3300059513 | Bacteria | 579 |
| 1027 | Ga0587106_060438 | 3300059605 | Bacteria | 695 |
| 1028 | Ga0587106_065488 | 3300059605 | Unclassified | 677 |
| 1029 | Ga0587101_061231 | 3300059623 | Bacteria | 673 |
| 1030 | Ga0587101_144055 | 3300059623 | Bacteria | 511 |
| 1031 | Ga0587109_108740 | 3300059624 | Unclassified | 646 |
| 1032 | Ga0587109_109504 | 3300059624 | Unclassified | 644 |
| 1033 | Ga0587109_115197 | 3300059624 | Bacteria | 633 |
| 1034 | Ga0587113_030418 | 3300059625 | Unclassified | 610 |
| 1035 | Ga0587113_042682 | 3300059625 | Unclassified | 547 |
| 1036 | Ga0587115_047786 | 3300059626 | Bacteria | 687 |
| 1037 | Ga0587115_057442 | 3300059626 | Bacteria | 645 |
| 1038 | Ga0587117_073614 | 3300059627 | Unclassified | 610 |
| 1039 | Ga0587117_112923 | 3300059627 | Bacteria | 530 |
| 1040 | Ga0587128_076503 | 3300059630 | Bacteria | 662 |
| 1041 | Ga0587130_046106 | 3300059631 | Unclassified | 537 |
| 1042 | Ga0587067_109173 | 3300059640 | Unclassified | 650 |
| 1043 | Ga0587067_163176 | 3300059640 | Unclassified | 568 |
| 1044 | Ga0587067_165199 | 3300059640 | Unclassified | 566 |
| 1045 | Ga0587068_103913 | 3300059641 | Unclassified | 599 |
| 1046 | Ga0587069_092722 | 3300059642 | Unclassified | 606 |
| 1047 | Ga0587069_125654 | 3300059642 | Bacteria | 548 |
| 1048 | Ga0587069_129958 | 3300059642 | Unclassified | 542 |
| 1049 | Ga0587072_084270 | 3300059643 | Unclassified | 691 |
| 1050 | Ga0587072_100957 | 3300059643 | Unclassified | 648 |
| 1051 | Ga0587072_128880 | 3300059643 | Bacteria | 594 |
| 1052 | Ga0587075_070050 | 3300059644 | Unclassified | 650 |
| 1053 | Ga0587075_077047 | 3300059644 | Unclassified | 630 |
| 1054 | Ga0587075_083655 | 3300059644 | Unclassified | 613 |
| 1055 | Ga0587075_118425 | 3300059644 | Bacteria | 546 |
| 1056 | Ga0587076_085433 | 3300059645 | Unclassified | 681 |
| 1057 | Ga0587076_094687 | 3300059645 | Unclassified | 658 |
| 1058 | Ga0587078_050123 | 3300059646 | Unclassified | 610 |
| 1059 | Ga0587078_069344 | 3300059646 | Unclassified | 548 |
| 1060 | Ga0587079_077455 | 3300059647 | Bacteria | 754 |
| 1061 | Ga0587079_092227 | 3300059647 | Unclassified | 710 |
| 1062 | Ga0587079_102913 | 3300059647 | Unclassified | 684 |
| 1063 | Ga0587114_062209 | 3300059655 | Unclassified | 657 |
| 1064 | Ga0587120_027023 | 3300059659 | Unclassified | 572 |
| 1065 | Ga0587071_067916 | 3300060344 | Bacteria | 770 |
| 1066 | Ga0587071_086753 | 3300060344 | Unclassified | 705 |
| 1067 | Ga0587071_139071 | 3300060344 | Unclassified | 595 |
| 1068 | Ga0587071_223528 | 3300060344 | Unclassified | 502 |
| 1069 | Ga0587111_0225910 | 3300060346 | Unclassified | 543 |
| 1070 | Ga0587111_0276795 | 3300060346 | Bacteria | 506 |
| 1071 | Ga0501082_0001011 | 3300060353 | Bacteria | 24862 |
| 1072 | Ga0501082_0191781 | 3300060353 | Bacteria | 1777 |
| 1073 | Ga0495587_0480134 | |||
| 1074 | Ga0007416J51690_1013359 | |||
| 1075 | Ga0007416J51690_1025011 | |||
| 1076 | Ga0007429J51699_1032875 | |||
| 1077 | Ga0032354_1062511 | |||
| 1078 | Ga0032354_1129990 | |||
| 1079 | Ga0058859_10036752 | |||
| 1080 | Ga0058859_11813184 | |||
| 1081 | Ga0058863_10006110 | |||
| 1082 | Ga0058863_10013946 | |||
| 1083 | Ga0058863_11422661 | |||
| 1084 | Ga0058863_11901776 | |||
| 1085 | Ga0058863_11909333 | |||
| 1086 | Ga0058861_10027171 | |||
| 1087 | Ga0058861_10035865 | |||
| 1088 | Ga0058861_10036023 | |||
| 1089 | Ga0058861_11706520 | |||
| 1090 | Ga0058861_11913154 | |||
| 1091 | Ga0058861_12073310 | |||
| 1092 | Ga0058860_12213440 | |||
| 1093 | Ga0058862_10116057 | |||
| 1094 | Ga0058862_10228250 | |||
| 1095 | Ga0058862_10278851 | |||
| 1096 | Ga0058862_12178942 | |||
| 1097 | Ga0058862_12428114 | |||
| 1098 | Ga0058862_12686673 | |||
| 1099 | Ga0058862_12802510 | |||
| 1100 | Ga0058862_12804914 | |||
| 1101 | Ga0070658_10008829 | |||
| 1102 | Ga0070658_10226099 | |||
| 1103 | Ga0070658_10519613 | |||
| 1104 | Ga0070683_100000001 | |||
| 1105 | Ga0070683_100022915 | |||
| 1106 | Ga0070683_100038893 | |||
| 1107 | Ga0070683_100054219 | |||
| 1108 | Ga0070683_100061290 | |||
| 1109 | Ga0070683_100244381 | |||
| 1110 | Ga0070683_100656785 | |||
| 1111 | Ga0070683_100657397 | |||
| 1112 | Ga0070690_101244188 | |||
| 1113 | Ga0070670_100893190 | |||
| 1114 | Ga0068869_100067634 | |||
| 1115 | Ga0068869_100421917 | |||
| 1116 | Ga0068869_100720918 | |||
| 1117 | Ga0068869_101424304 | |||
| 1118 | Ga0070666_10168301 | |||
| 1119 | Ga0070666_10409305 | |||
| 1120 | Ga0070680_100031554 | |||
| 1121 | Ga0070680_100252333 | |||
| 1122 | Ga0070682_100158440 | |||
| 1123 | Ga0068868_100024051 | |||
| 1124 | Ga0068868_100439309 | |||
| 1125 | Ga0070660_100014980 | |||
| 1126 | Ga0070689_100442340 | |||
| 1127 | Ga0070691_10006445 | |||
| 1128 | Ga0070691_10355526 | |||
| 1129 | Ga0070687_100167317 | |||
| 1130 | Ga0070661_100703345 | |||
| 1131 | Ga0070692_10219952 | |||
| 1132 | Ga0070668_101378446 | |||
| 1133 | Ga0070671_101239316 | |||
| 1134 | Ga0070673_100334150 | |||
| 1135 | Ga0070673_100765047 | |||
| 1136 | Ga0070659_101615453 | |||
| 1137 | Ga0070667_100092216 | |||
| 1138 | Ga0070667_100182268 | |||
| 1139 | Ga0070709_10092478 | |||
| 1140 | Ga0070709_10126660 | |||
| 1141 | Ga0070709_10206798 | |||
| 1142 | Ga0070709_10256376 | |||
| 1143 | Ga0070709_10297640 | |||
| 1144 | Ga0070709_10320184 | |||
| 1145 | Ga0070714_100025710 | |||
| 1146 | Ga0070714_100169245 | |||
| 1147 | Ga0070714_100257901 | |||
| 1148 | Ga0070714_100435930 | |||
| 1149 | Ga0070714_100441594 | |||
| 1150 | Ga0070713_100074305 | |||
| 1151 | Ga0070713_100110137 | |||
| 1152 | Ga0070713_101081401 | |||
| 1153 | Ga0070713_101095892 | |||
| 1154 | Ga0070713_101487743 | |||
| 1155 | Ga0070713_101895228 | |||
| 1156 | Ga0070710_11199849 | |||
| 1157 | Ga0070701_10553390 | |||
| 1158 | Ga0070711_100004562 | |||
| 1159 | Ga0070711_100044240 | |||
| 1160 | Ga0070711_100064146 | |||
| 1161 | Ga0070711_100174741 | |||
| 1162 | Ga0070711_100226766 | |||
| 1163 | Ga0070711_100444574 | |||
| 1164 | Ga0070711_101398209 | |||
| 1165 | Ga0070705_101071906 | |||
| 1166 | Ga0070694_101224232 | |||
| 1167 | Ga0070708_101124760 | |||
| 1168 | Ga0070663_101315287 | |||
| 1169 | Ga0070662_100025113 | |||
| 1170 | Ga0070681_10001226 | |||
| 1171 | Ga0070681_10193737 | |||
| 1172 | Ga0070681_10244197 | |||
| 1173 | Ga0070681_10367054 | |||
| 1174 | Ga0070681_11762422 | |||
| 1175 | Ga0068867_100057154 | |||
| 1176 | Ga0068867_100179015 | |||
| 1177 | Ga0068867_100994803 | |||
| 1178 | Ga0068867_102349879 | |||
| 1179 | Ga0070679_100004342 | |||
| 1180 | Ga0070679_100034644 | |||
| 1181 | Ga0070684_100000055 | |||
| 1182 | Ga0070684_100000804 | |||
| 1183 | Ga0070684_100028183 | |||
| 1184 | Ga0070684_100288429 | |||
| 1185 | Ga0070684_100539954 | |||
| 1186 | Ga0070684_100567628 | |||
| 1187 | Ga0070684_101244647 | |||
| 1188 | Ga0068853_100009043 | |||
| 1189 | Ga0068853_100009601 | |||
| 1190 | Ga0068853_100068604 | |||
| 1191 | Ga0068853_100386265 | |||
| 1192 | Ga0068853_100871243 | |||
| 1193 | Ga0068853_101631797 | |||
| 1194 | Ga0070695_101569537 | |||
| 1195 | Ga0070696_100668232 | |||
| 1196 | Ga0070696_101768278 | |||
| 1197 | Ga0070693_101567328 | |||
| 1198 | Ga0070665_100013006 | |||
| 1199 | Ga0070665_101368567 | |||
| 1200 | Ga0068855_100002589 | |||
| 1201 | Ga0068855_100036280 | |||
| 1202 | Ga0068855_100040037 | |||
| 1203 | Ga0068855_100049370 | |||
| 1204 | Ga0068855_100083019 | |||
| 1205 | Ga0068855_100271247 | |||
| 1206 | Ga0068855_100316386 | |||
| 1207 | Ga0068855_101563392 | |||
| 1208 | Ga0070664_100346943 | |||
| 1209 | Ga0070664_100439754 | |||
| 1210 | Ga0070664_101110834 | |||
| 1211 | Ga0068857_100002208 | |||
| 1212 | Ga0068857_100107611 | |||
| 1213 | Ga0068854_100830986 | |||
| 1214 | Ga0068854_101440149 | |||
| 1215 | Ga0068856_100001254 | |||
| 1216 | Ga0068856_100107869 | |||
| 1217 | Ga0068856_100115246 | |||
| 1218 | Ga0068856_100188706 | |||
| 1219 | Ga0068856_100266548 | |||
| 1220 | Ga0068856_100608086 | |||
| 1221 | Ga0068856_102257916 | |||
| 1222 | Ga0068852_100011174 | |||
| 1223 | Ga0068852_100223223 | |||
| 1224 | Ga0068852_100351687 | |||
| 1225 | Ga0068859_100168351 | |||
| 1226 | Ga0068859_100350553 | |||
| 1227 | Ga0068859_100367690 | |||
| 1228 | Ga0068859_100633120 | |||
| 1229 | Ga0068859_101154522 | |||
| 1230 | Ga0068859_101412919 | |||
| 1231 | Ga0068864_100021313 | |||
| 1232 | Ga0068851_10058786 | |||
| 1233 | Ga0068851_10184982 | |||
| 1234 | Ga0068851_10304360 | |||
| 1235 | Ga0068870_10164181 | |||
| 1236 | Ga0068863_100041419 | |||
| 1237 | Ga0068863_100985331 | |||
| 1238 | Ga0068863_101395987 | |||
| 1239 | Ga0068858_100006091 | |||
| 1240 | Ga0068858_100056033 | |||
| 1241 | Ga0068858_100389088 | |||
| 1242 | Ga0068858_100480855 | |||
| 1243 | Ga0068858_101051510 | |||
| 1244 | Ga0068860_100021448 | |||
| 1245 | Ga0068860_100047825 | |||
| 1246 | Ga0068860_100197021 | |||
| 1247 | Ga0068860_100430205 | |||
| 1248 | Ga0068860_100771280 | |||
| 1249 | Ga0070717_10052611 | |||
| 1250 | Ga0070717_10121425 | |||
| 1251 | Ga0070717_10152411 | |||
| 1252 | Ga0070717_11045536 | |||
| 1253 | Ga0070715_10138352 | |||
| 1254 | Ga0070715_10270897 | |||
| 1255 | Ga0070716_100668203 | |||
| 1256 | Ga0070716_101222833 | |||
| 1257 | Ga0097621_100102184 | |||
| 1258 | Ga0097621_100116366 | |||
| 1259 | Ga0097621_100140014 | |||
| 1260 | Ga0097621_100163492 | |||
| 1261 | Ga0097621_100319702 | |||
| 1262 | Ga0097621_101587200 | |||
| 1263 | Ga0097621_102024294 | |||
| 1264 | Ga0068871_100024178 | |||
| 1265 | Ga0068871_100040183 | |||
| 1266 | Ga0068871_100064880 | |||
| 1267 | Ga0068871_100108329 | |||
| 1268 | Ga0068871_100326117 | |||
| 1269 | Ga0068871_100542290 | |||
| 1270 | Ga0068871_100618954 | |||
| 1271 | Ga0068871_100790804 | |||
| 1272 | Ga0068865_100051116 | |||
| 1273 | Ga0068865_101026261 | |||
| 1274 | Ga0097620_100168354 | |||
| 1275 | Ga0097620_100350530 | |||
| 1276 | Ga0097620_100367690 | |||
| 1277 | Ga0097620_100633152 | |||
| 1278 | Ga0097620_101154447 | |||
| 1279 | Ga0097620_101412936 | |||
| 1280 | Ga0105240_10000829 | |||
| 1281 | Ga0105240_10093595 | |||
| 1282 | Ga0105240_10108584 | |||
| 1283 | Ga0105240_10332966 | |||
| 1284 | Ga0105240_10444469 | |||
| 1285 | Ga0105240_11242126 | |||
| 1286 | Ga0105245_10020408 | |||
| 1287 | Ga0105245_10058904 | |||
| 1288 | Ga0105245_10083205 | |||
| 1289 | Ga0105245_10223221 | |||
| 1290 | Ga0105245_10248179 | |||
| 1291 | Ga0105245_11042230 | |||
| 1292 | Ga0105247_10069579 | |||
| 1293 | Ga0105247_10350240 | |||
| 1294 | Ga0105247_10363326 | |||
| 1295 | Ga0105243_10063119 | |||
| 1296 | Ga0105243_10105483 | |||
| 1297 | Ga0105243_10837275 | |||
| 1298 | Ga0105243_12012923 | |||
| 1299 | Ga0105241_10025477 | |||
| 1300 | Ga0105241_10078194 | |||
| 1301 | Ga0105241_10127667 | |||
| 1302 | Ga0105242_10049623 | |||
| 1303 | Ga0105242_10074272 | |||
| 1304 | Ga0105242_10094868 | |||
| 1305 | Ga0105242_10157356 | |||
| 1306 | Ga0105242_10220513 | |||
| 1307 | Ga0105242_10346031 | |||
| 1308 | Ga0105242_10563877 | |||
| 1309 | Ga0105242_13045702 | |||
| 1310 | Ga0105248_10004753 | |||
| 1311 | Ga0105248_10142004 | |||
| 1312 | Ga0105248_10459438 | |||
| 1313 | Ga0105248_10487646 | |||
| 1314 | Ga0105248_10799619 | |||
| 1315 | Ga0105248_11022121 | |||
| 1316 | Ga0105237_10003993 | |||
| 1317 | Ga0105237_10040664 | |||
| 1318 | Ga0105237_10042692 | |||
| 1319 | Ga0105237_10147684 | |||
| 1320 | Ga0105238_10004598 | |||
| 1321 | Ga0105238_10010164 | |||
| 1322 | Ga0105238_10032511 | |||
| 1323 | Ga0105238_10059927 | |||
| 1324 | Ga0105238_10072953 | |||
| 1325 | Ga0105238_10162485 | |||
| 1326 | Ga0105238_10170378 | |||
| 1327 | Ga0105249_10166756 | |||
| 1328 | Ga0099796_10152405 | |||
| 1329 | Ga0105239_10000926 | |||
| 1330 | Ga0105239_10022062 | |||
| 1331 | Ga0105239_10056505 | |||
| 1332 | Ga0105239_10085123 | |||
| 1333 | Ga0105239_10146928 | |||
| 1334 | Ga0105239_10197583 | |||
| 1335 | Ga0105239_11844964 | |||
| 1336 | Ga0105239_12557853 | |||
| 1337 | Ga0105246_10081902 | |||
| 1338 | Ga0105246_10166893 | |||
| 1339 | Ga0105246_10300499 | |||
| 1340 | Ga0105246_10392871 | |||
| 1341 | Ga0105246_10545120 | |||
| 1342 | Ga0105246_10683099 | |||
| 1343 | Ga0154019_127005 | |||
| 1344 | Ga0154016_101392 | |||
| 1345 | Ga0154012_152883 | |||
| 1346 | Ga0154010_120373 | |||
| 1347 | Ga0154010_178522 | |||
| 1348 | Ga0157373_10374805 | |||
| 1349 | Ga0157371_10955368 | |||
| 1350 | Ga0157370_10002259 | |||
| 1351 | Ga0157370_10006665 | |||
| 1352 | Ga0157370_10015036 | |||
| 1353 | Ga0157370_10658725 | |||
| 1354 | Ga0157369_10001763 | |||
| 1355 | Ga0157369_10010501 | |||
| 1356 | Ga0157369_10020251 | |||
| 1357 | Ga0157369_10201472 | |||
| 1358 | Ga0157369_10244220 | |||
| 1359 | Ga0157374_10071396 | |||
| 1360 | Ga0157374_10146595 | |||
| 1361 | Ga0157374_10167973 | |||
| 1362 | Ga0157374_10203395 | |||
| 1363 | Ga0157374_10204469 | |||
| 1364 | Ga0157374_10370856 | |||
| 1365 | Ga0157374_12259327 | |||
| 1366 | Ga0157378_10013083 | |||
| 1367 | Ga0157378_10037067 | |||
| 1368 | Ga0157378_10329109 | |||
| 1369 | Ga0157378_10355245 | |||
| 1370 | Ga0157378_10597681 | |||
| 1371 | Ga0157378_10816708 | |||
| 1372 | Ga0157378_11450252 | |||
| 1373 | Ga0157378_11480992 | |||
| 1374 | Ga0163162_10000923 | |||
| 1375 | Ga0163162_10005655 | |||
| 1376 | Ga0163162_10402041 | |||
| 1377 | Ga0163162_10629304 | |||
| 1378 | Ga0163162_12530344 | |||
| 1379 | Ga0157372_10001934 | |||
| 1380 | Ga0157372_10073578 | |||
| 1381 | Ga0157372_10370841 | |||
| 1382 | Ga0157372_10819539 | |||
| 1383 | Ga0157372_10970089 | |||
| 1384 | Ga0157375_10008225 | |||
| 1385 | Ga0157375_10204024 | |||
| 1386 | Ga0157375_10343638 | |||
| 1387 | Ga0157375_12366330 | |||
| 1388 | Ga0163163_10003605 | |||
| 1389 | Ga0163163_10055316 | |||
| 1390 | Ga0163163_10509371 | |||
| 1391 | Ga0163163_10514585 | |||
| 1392 | Ga0163163_10778397 | |||
| 1393 | Ga0163163_11248862 | |||
| 1394 | Ga0157380_10783863 | |||
| 1395 | Ga0157379_10058078 | |||
| 1396 | Ga0157379_10251105 | |||
| 1397 | Ga0157379_10666931 | |||
| 1398 | Ga0157376_10443107 | |||
| 1399 | Ga0157376_11169402 | |||
| 1400 | Ga0182007_10210276 | |||
| 1401 | Ga0182005_1302459 | |||
| 1402 | Ga0163161_11603956 | |||
| 1403 | Ga0184595_131066 | |||
| 1404 | Ga0184596_108050 | |||
| 1405 | Ga0184596_122188 | |||
| 1406 | Ga0184592_113146 | |||
| 1407 | Ga0184592_114756 | |||
| 1408 | Ga0184592_115460 | |||
| 1409 | Ga0184593_105699 | |||
| 1410 | Ga0184593_108382 | |||
| 1411 | Ga0184593_119644 | |||
| 1412 | Ga0184593_132516 | |||
| 1413 | Ga0184594_110722 | |||
| 1414 | Ga0184594_122686 | |||
| 1415 | Ga0184594_125428 | |||
| 1416 | Ga0184598_129099 | |||
| 1417 | Ga0184599_139300 | |||
| 1418 | Ga0184599_145306 | |||
| 1419 | Ga0184599_147059 | |||
| 1420 | Ga0184600_102034 | |||
| 1421 | Ga0184600_108952 | |||
| 1422 | Ga0197907_10163410 | |||
| 1423 | Ga0197907_10286402 | |||
| 1424 | Ga0197907_10312743 | |||
| 1425 | Ga0197907_10430539 | |||
| 1426 | Ga0197907_10476928 | |||
| 1427 | Ga0197907_10739022 | |||
| 1428 | Ga0197907_10758757 | |||
| 1429 | Ga0197907_10823823 | |||
| 1430 | Ga0197907_10966821 | |||
| 1431 | Ga0197907_10977523 | |||
| 1432 | Ga0197907_11038682 | |||
| 1433 | Ga0197907_11098372 | |||
| 1434 | Ga0197907_11120220 | |||
| 1435 | Ga0197907_11144601 | |||
| 1436 | Ga0197907_11251078 | |||
| 1437 | Ga0197907_11283622 | |||
| 1438 | Ga0197907_11325985 | |||
| 1439 | Ga0197907_11350630 | |||
| 1440 | Ga0206356_10034966 | |||
| 1441 | Ga0206356_10091394 | |||
| 1442 | Ga0206356_10092759 | |||
| 1443 | Ga0206356_10244916 | |||
| 1444 | Ga0206356_10324049 | |||
| 1445 | Ga0206356_10327438 | |||
| 1446 | Ga0206356_10526821 | |||
| 1447 | Ga0206356_10547674 | |||
| 1448 | Ga0206356_10791083 | |||
| 1449 | Ga0206356_11077895 | |||
| 1450 | Ga0206356_11177492 | |||
| 1451 | Ga0206356_11250494 | |||
| 1452 | Ga0206356_11349583 | |||
| 1453 | Ga0206356_11604026 | |||
| 1454 | Ga0206356_11760482 | |||
| 1455 | Ga0206349_1104886 | |||
| 1456 | Ga0206349_1114993 | |||
| 1457 | Ga0206349_1347378 | |||
| 1458 | Ga0206349_1413762 | |||
| 1459 | Ga0206349_1438462 | |||
| 1460 | Ga0206349_1587264 | |||
| 1461 | Ga0206349_1588263 | |||
| 1462 | Ga0206349_1643279 | |||
| 1463 | Ga0206349_1726888 | |||
| 1464 | Ga0206349_1803995 | |||
| 1465 | Ga0206349_1889273 | |||
| 1466 | Ga0206355_1203027 | |||
| 1467 | Ga0206355_1419348 | |||
| 1468 | Ga0206355_1428624 | |||
| 1469 | Ga0206355_1432907 | |||
| 1470 | Ga0206355_1522010 | |||
| 1471 | Ga0206355_1523680 | |||
| 1472 | Ga0206355_1552828 | |||
| 1473 | Ga0206355_1621660 | |||
| 1474 | Ga0206355_1634635 | |||
| 1475 | Ga0206355_1659624 | |||
| 1476 | Ga0206351_10061856 | |||
| 1477 | Ga0206351_10083253 | |||
| 1478 | Ga0206351_10092054 | |||
| 1479 | Ga0206351_10106405 | |||
| 1480 | Ga0206351_10113413 | |||
| 1481 | Ga0206351_10150188 | |||
| 1482 | Ga0206351_10287561 | |||
| 1483 | Ga0206351_10308606 | |||
| 1484 | Ga0206351_10395597 | |||
| 1485 | Ga0206351_10514131 | |||
| 1486 | Ga0206351_10551231 | |||
| 1487 | Ga0206351_10686524 | |||
| 1488 | Ga0206351_10931400 | |||
| 1489 | Ga0206352_10038551 | |||
| 1490 | Ga0206352_10042034 | |||
| 1491 | Ga0206352_10079511 | |||
| 1492 | Ga0206352_10097143 | |||
| 1493 | Ga0206352_10141324 | |||
| 1494 | Ga0206352_10325671 | |||
| 1495 | Ga0206352_10375107 | |||
| 1496 | Ga0206352_10398875 | |||
| 1497 | Ga0206352_10403950 | |||
| 1498 | Ga0206352_10495749 | |||
| 1499 | Ga0206352_10509139 | |||
| 1500 | Ga0206352_10520289 | |||
| 1501 | Ga0206352_10710552 | |||
| 1502 | Ga0206352_10734954 | |||
| 1503 | Ga0206352_11197174 | |||
| 1504 | Ga0206352_11224948 | |||
| 1505 | Ga0206352_11263999 | |||
| 1506 | Ga0206350_10002123 | |||
| 1507 | Ga0206350_10186125 | |||
| 1508 | Ga0206350_10271673 | |||
| 1509 | Ga0206350_10277469 | |||
| 1510 | Ga0206350_10280083 | |||
| 1511 | Ga0206350_10314210 | |||
| 1512 | Ga0206350_10347331 | |||
| 1513 | Ga0206350_10568611 | |||
| 1514 | Ga0206350_10672396 | |||
| 1515 | Ga0206350_10707583 | |||
| 1516 | Ga0206350_10901464 | |||
| 1517 | Ga0206350_10972182 | |||
| 1518 | Ga0206350_11196424 | |||
| 1519 | Ga0206350_11240623 | |||
| 1520 | Ga0206350_11359846 | |||
| 1521 | Ga0206350_11630401 | |||
| 1522 | Ga0206354_10093064 | |||
| 1523 | Ga0206354_10289752 | |||
| 1524 | Ga0206354_10475303 | |||
| 1525 | Ga0206354_10814056 | |||
| 1526 | Ga0206354_10890264 | |||
| 1527 | Ga0206354_11213096 | |||
| 1528 | Ga0206354_11296545 | |||
| 1529 | Ga0206354_11479014 | |||
| 1530 | Ga0206354_11493054 | |||
| 1531 | Ga0206354_11647079 | |||
| 1532 | Ga0206354_11706144 | |||
| 1533 | Ga0206353_10158651 | |||
| 1534 | Ga0206353_10572510 | |||
| 1535 | Ga0206353_10866201 | |||
| 1536 | Ga0206353_10976632 | |||
| 1537 | Ga0206353_11042202 | |||
| 1538 | Ga0206353_11337192 | |||
| 1539 | Ga0206353_11566893 | |||
| 1540 | Ga0206353_11707724 | |||
| 1541 | Ga0206353_11840281 | |||
| 1542 | Ga0154015_1016038 | |||
| 1543 | Ga0154015_1049429 | |||
| 1544 | Ga0154015_1067378 | |||
| 1545 | Ga0154015_1072462 | |||
| 1546 | Ga0154015_1087282 | |||
| 1547 | Ga0154015_1335253 | |||
| 1548 | Ga0154015_1352349 | |||
| 1549 | Ga0154015_1376847 | |||
| 1550 | Ga0154015_1510902 | |||
| 1551 | Ga0154015_1550972 | |||
| 1552 | Ga0154015_1638450 | |||
| 1553 | Ga0154015_1691846 | |||
| 1554 | Ga0213875_10007485 | |||
| 1555 | Ga0213875_10260284 | |||
| 1556 | Ga0224712_10105281 | |||
| 1557 | Ga0224712_10142192 | |||
| 1558 | Ga0224712_10150481 | |||
| 1559 | Ga0224712_10208253 | |||
| 1560 | Ga0224712_10223459 | |||
| 1561 | Ga0224712_10227935 | |||
| 1562 | Ga0224712_10247429 | |||
| 1563 | Ga0224712_10262858 | |||
| 1564 | Ga0224712_10286167 | |||
| 1565 | Ga0224712_10288503 | |||
| 1566 | Ga0224712_10338083 | |||
| 1567 | Ga0224712_10363854 | |||
| 1568 | Ga0224712_10365560 | |||
| 1569 | Ga0224712_10367148 | |||
| 1570 | Ga0224712_10367804 | |||
| 1571 | Ga0224712_10406662 | |||
| 1572 | Ga0224712_10453664 | |||
| 1573 | Ga0224712_10513098 | |||
| 1574 | Ga0224712_10523685 | |||
| 1575 | Ga0224712_10564328 | |||
| 1576 | Ga0247551_103423 | |||
| 1577 | Ga0247551_105418 | |||
| 1578 | Ga0247553_111119 | |||
| 1579 | Ga0207656_10262907 | |||
| 1580 | Ga0207710_10100248 | |||
| 1581 | Ga0207710_10222260 | |||
| 1582 | Ga0207680_10239761 | |||
| 1583 | Ga0207680_10382069 | |||
| 1584 | Ga0207685_10558980 | |||
| 1585 | Ga0207699_10331229 | |||
| 1586 | Ga0207699_10390028 | |||
| 1587 | Ga0207699_10608186 | |||
| 1588 | Ga0207699_10635269 | |||
| 1589 | Ga0207699_10714513 | |||
| 1590 | Ga0207645_10418558 | |||
| 1591 | Ga0207705_10215742 | |||
| 1592 | Ga0207684_10895795 | |||
| 1593 | Ga0207654_10009344 | |||
| 1594 | Ga0207654_10017392 | |||
| 1595 | Ga0207654_10023665 | |||
| 1596 | Ga0207654_10197787 | |||
| 1597 | Ga0207707_10037603 | |||
| 1598 | Ga0207707_10428463 | |||
| 1599 | Ga0207707_11449010 | |||
| 1600 | Ga0207695_10001355 | |||
| 1601 | Ga0207695_10006537 | |||
| 1602 | Ga0207695_10024661 | |||
| 1603 | Ga0207695_10075817 | |||
| 1604 | Ga0207695_10371909 | |||
| 1605 | Ga0207695_11183479 | |||
| 1606 | Ga0207671_10081536 | |||
| 1607 | Ga0207671_10106286 | |||
| 1608 | Ga0207671_11328503 | |||
| 1609 | Ga0207693_10415347 | |||
| 1610 | Ga0207663_10035710 | |||
| 1611 | Ga0207663_10075867 | |||
| 1612 | Ga0207663_10170153 | |||
| 1613 | Ga0207663_10211060 | |||
| 1614 | Ga0207663_10315906 | |||
| 1615 | Ga0207663_10340171 | |||
| 1616 | Ga0207663_10473217 | |||
| 1617 | Ga0207660_10046329 | |||
| 1618 | Ga0207657_10020879 | |||
| 1619 | Ga0207657_10038937 | |||
| 1620 | Ga0207657_10260454 | |||
| 1621 | Ga0207657_10437745 | |||
| 1622 | Ga0207649_10123326 | |||
| 1623 | Ga0207649_10283281 | |||
| 1624 | Ga0207649_11242558 | |||
| 1625 | Ga0207652_10052648 | |||
| 1626 | Ga0207681_11693893 | |||
| 1627 | Ga0207694_10000486 | |||
| 1628 | Ga0207694_10008252 | |||
| 1629 | Ga0207694_10036963 | |||
| 1630 | Ga0207694_10057844 | |||
| 1631 | Ga0207694_10077794 | |||
| 1632 | Ga0207694_10128618 | |||
| 1633 | Ga0207650_10757229 | |||
| 1634 | Ga0207687_10003031 | |||
| 1635 | Ga0207687_10009317 | |||
| 1636 | Ga0207687_10055636 | |||
| 1637 | Ga0207687_10406608 | |||
| 1638 | Ga0207687_10577098 | |||
| 1639 | Ga0207700_10009283 | |||
| 1640 | Ga0207700_10047296 | |||
| 1641 | Ga0207700_10130289 | |||
| 1642 | Ga0207700_10209698 | |||
| 1643 | Ga0207664_10010090 | |||
| 1644 | Ga0207664_10294525 | |||
| 1645 | Ga0207644_10256437 | |||
| 1646 | Ga0207644_10391657 | |||
| 1647 | Ga0207690_11302999 | |||
| 1648 | Ga0207686_10024798 | |||
| 1649 | Ga0207686_10034301 | |||
| 1650 | Ga0207686_10080074 | |||
| 1651 | Ga0207686_10095777 | |||
| 1652 | Ga0207686_10109803 | |||
| 1653 | Ga0207686_10236013 | |||
| 1654 | Ga0207686_11265091 | |||
| 1655 | Ga0207709_10039104 | |||
| 1656 | Ga0207709_10614814 | |||
| 1657 | Ga0207709_10908798 | |||
| 1658 | Ga0207709_11796403 | |||
| 1659 | Ga0207670_10784218 | |||
| 1660 | Ga0207669_10295227 | |||
| 1661 | Ga0207704_10882377 | |||
| 1662 | Ga0207704_11249553 | |||
| 1663 | Ga0207665_10306055 | |||
| 1664 | Ga0207665_10510214 | |||
| 1665 | Ga0207665_10654607 | |||
| 1666 | Ga0207665_11166410 | |||
| 1667 | Ga0207711_10004077 | |||
| 1668 | Ga0207711_10938176 | |||
| 1669 | Ga0207689_10100874 | |||
| 1670 | Ga0207689_10505756 | |||
| 1671 | Ga0207689_10713638 | |||
| 1672 | Ga0207661_10000005 | |||
| 1673 | Ga0207661_10025795 | |||
| 1674 | Ga0207661_10050703 | |||
| 1675 | Ga0207661_10188557 | |||
| 1676 | Ga0207661_10393579 | |||
| 1677 | Ga0207679_10175003 | |||
| 1678 | Ga0207679_11391241 | |||
| 1679 | Ga0207667_10002176 | |||
| 1680 | Ga0207667_10003779 | |||
| 1681 | Ga0207667_10051139 | |||
| 1682 | Ga0207667_10071077 | |||
| 1683 | Ga0207667_10088668 | |||
| 1684 | Ga0207667_10144205 | |||
| 1685 | Ga0207667_10306893 | |||
| 1686 | Ga0207667_10854959 | |||
| 1687 | Ga0207651_10318233 | |||
| 1688 | Ga0207651_10602773 | |||
| 1689 | Ga0207651_11325089 | |||
| 1690 | Ga0207712_10145673 | |||
| 1691 | Ga0207712_10505903 | |||
| 1692 | Ga0207640_11261932 | |||
| 1693 | Ga0207640_11515428 | |||
| 1694 | Ga0207658_10244451 | |||
| 1695 | Ga0207658_10545478 | |||
| 1696 | Ga0207677_10317416 | |||
| 1697 | Ga0207677_10810944 | |||
| 1698 | Ga0207677_11495811 | |||
| 1699 | Ga0207703_10026180 | |||
| 1700 | Ga0207703_10028191 | |||
| 1701 | Ga0207703_10483307 | |||
| 1702 | Ga0207703_10732030 | |||
| 1703 | Ga0207703_11474770 | |||
| 1704 | Ga0207639_10031691 | |||
| 1705 | Ga0207639_10510184 | |||
| 1706 | Ga0207639_10672018 | |||
| 1707 | Ga0207639_10827326 | |||
| 1708 | Ga0207678_10668483 | |||
| 1709 | Ga0207708_10962309 | |||
| 1710 | Ga0207702_10006005 | |||
| 1711 | Ga0207702_10085210 | |||
| 1712 | Ga0207702_10242169 | |||
| 1713 | Ga0207702_10624992 | |||
| 1714 | Ga0207702_10666763 | |||
| 1715 | Ga0207702_11818994 | |||
| 1716 | Ga0207641_10031537 | |||
| 1717 | Ga0207641_10920370 | |||
| 1718 | Ga0207648_10114069 | |||
| 1719 | Ga0207648_10295481 | |||
| 1720 | Ga0207648_11589517 | |||
| 1721 | Ga0207648_11826327 | |||
| 1722 | Ga0207676_10019659 | |||
| 1723 | Ga0207674_10000361 | |||
| 1724 | Ga0207674_10002055 | |||
| 1725 | Ga0207674_10024159 | |||
| 1726 | Ga0207674_10697052 | |||
| 1727 | Ga0207675_100472765 | |||
| 1728 | Ga0207698_10001862 | |||
| 1729 | Ga0207698_10048734 | |||
| 1730 | Ga0207698_10289891 | |||
| 1731 | Ga0207698_10733726 | |||
| 1732 | Ga0207698_11211148 | |||
| 1733 | Ga0268266_10007479 | |||
| 1734 | Ga0268266_11176573 | |||
| 1735 | Ga0268264_10064789 | |||
| 1736 | Ga0268264_10285804 | |||
| 1737 | Ga0268264_10302641 | |||
| 1738 | Ga0268264_11181187 | |||
| 1739 | Ga0265323_10001695 | |||
| 1740 | Ga0265338_10159741 | |||
| 1741 | Ga0265762_1016992 | |||
| 1742 | Ga0265762_1081893 | |||
| 1743 | Ga0265762_1145244 | |||
| 1744 | Ga0265775_114080 | |||
| 1745 | Ga0265767_105531 | |||
| 1746 | Ga0265767_106996 | |||
| 1747 | Ga0265767_113693 | |||
| 1748 | Ga0265766_1005331 | |||
| 1749 | Ga0265766_1011308 | |||
| 1750 | Ga0265766_1012062 | |||
| 1751 | Ga0265766_1015637 | |||
| 1752 | Ga0265766_1022342 | |||
| 1753 | Ga0265777_112541 | |||
| 1754 | Ga0265777_113152 | |||
| 1755 | Ga0265777_121229 | |||
| 1756 | Ga0265776_104550 | |||
| 1757 | Ga0265776_111230 | |||
| 1758 | Ga0265764_108395 | |||
| 1759 | Ga0265764_110609 | |||
| 1760 | Ga0265772_103116 | |||
| 1761 | Ga0265769_109336 | |||
| 1762 | Ga0265769_117898 | |||
| 1763 | Ga0265769_118683 | |||
| 1764 | Ga0265761_104165 | |||
| 1765 | Ga0247549_101811 | |||
| 1766 | Ga0247549_102985 | |||
| 1767 | Ga0265768_102420 | |||
| 1768 | Ga0265768_103921 | |||
| 1769 | Ga0265768_104251 | |||
| 1770 | Ga0265768_105373 | |||
| 1771 | Ga0265768_105600 | |||
| 1772 | Ga0265768_107355 | |||
| 1773 | Ga0265768_108783 | |||
| 1774 | Ga0265768_110710 | |||
| 1775 | Ga0265768_113662 | |||
| 1776 | Ga0265768_116321 | |||
| 1777 | Ga0265768_117686 | |||
| 1778 | Ga0265771_1018396 | |||
| 1779 | Ga0265771_1027765 | |||
| 1780 | Ga0265774_106374 | |||
| 1781 | Ga0265773_1003870 | |||
| 1782 | Ga0265773_1024359 | |||
| 1783 | Ga0265760_10067456 | |||
| 1784 | Ga0265760_10209722 | |||
| 1785 | Ga0265760_10303651 | |||
| 1786 | Ga0265760_10307115 | |||
| 1787 | Ga0265328_10180763 | |||
| 1788 | Ga0265325_10125088 | |||
| 1789 | Ga0265339_10065374 | |||
| 1790 | Ga0265331_10230953 | |||
| 1791 | Ga0265316_10014783 | |||
| 1792 | Ga0265316_10038490 | |||
| 1793 | Ga0265316_10196052 | |||
| 1794 | Ga0265316_10198072 | |||
| 1795 | Ga0265316_10450397 | |||
| 1796 | Ga0265313_10007638 | |||
| 1797 | Ga0265313_10255839 | |||
| 1798 | Ga0310103_139079 | |||
| 1799 | Ga0310111_133895 | |||
| 1800 | Ga0265314_10011041 | |||
| 1801 | Ga0265314_10282918 | |||
| 1802 | Ga0265314_10362416 | |||
| 1803 | Ga0265342_10146176 | |||
| 1804 | Ga0265342_10225076 | |||
| 1805 | Ga0247548_104373 | |||
| 1806 | Ga0247548_104387 | |||
| 1807 | Ga0247548_105395 | |||
| 1808 | Ga0247548_107682 | |||
| 1809 | Ga0316042_120450 | |||
| 1810 | Ga0316042_124683 | |||
| 1811 | Ga0316043_123481 | |||
| 1812 | Ga0307411_12286721 | |||
| 1813 | Ga0316053_107474 | |||
| 1814 | Ga0316053_112606 | |||
| 1815 | Ga0316053_112983 | |||
| 1816 | Ga0316053_119800 | |||
| 1817 | Ga0373926_0260165 | |||
| 1818 | Ga0373926_0448359 | |||
| 1819 | Ga0373934_0006374 | |||
| 1820 | Ga0373934_0026633 | |||
| 1821 | Ga0373934_0052051 | |||
| 1822 | Ga0373934_0187541 | |||
| 1823 | Ga0373944_0042562 | |||
| 1824 | Ga0373923_0011794 | |||
| 1825 | Ga0373923_0034984 | |||
| 1826 | Ga0373923_0256953 | |||
| 1827 | Ga0373936_0229698 | |||
| 1828 | Ga0373936_0605373 | |||
| 1829 | Ga0373941_0470512 | |||
| 1830 | Ga0373953_0027981 | |||
| 1831 | Ga0373953_0102277 | |||
| 1832 | Ga0373953_0283290 | |||
| 1833 | Ga0373953_0349863 | |||
| 1834 | Ga0373953_0462313 | |||
| 1835 | Ga0373954_0035650 | |||
| 1836 | Ga0373954_0047998 | |||
| 1837 | Ga0373954_0051631 | |||
| 1838 | Ga0373954_0103732 | |||
| 1839 | Ga0373954_0313979 | |||
| 1840 | Ga0373956_0085248 | |||
| 1841 | Ga0373956_0095264 | |||
| 1842 | Ga0373943_0034131 | |||
| 1843 | Ga0373943_0572867 | |||
| 1844 | Ga0373946_0154161 | |||
| 1845 | Ga0373955_0026031 | |||
| 1846 | Ga0373955_0041996 | |||
| 1847 | Ga0373955_0188013 | |||
| 1848 | Ga0373955_0219194 | |||
| 1849 | Ga0373955_0322560 | |||
| 1850 | Ga0373955_0724206 | |||
| 1851 | Ga0373924_0103536 | |||
| 1852 | Ga0373924_0119838 | |||
| 1853 | Ga0373924_0153523 | |||
| 1854 | Ga0373924_0153887 | |||
| 1855 | Ga0373935_0049020 | |||
| 1856 | Ga0373935_0125561 | |||
| 1857 | Ga0373935_0197072 | |||
| 1858 | Ga0373935_0353913 | |||
| 1859 | Ga0373935_0645587 | |||
| 1860 | Ga0373927_0009527 | |||
| 1861 | Ga0373927_0009834 | |||
| 1862 | Ga0373927_0202633 | |||
| 1863 | Ga0373927_0470575 | |||
| 1864 | Ga0373927_0585743 | |||
| 1865 | Ga0373927_0613715 | |||
| 1866 | Ga0373933_0096385 | |||
| 1867 | Ga0373933_0245989 | |||
| 1868 | Ga0373933_0308105 | |||
| 1869 | Ga0373933_0361868 | |||
| 1870 | Ga0373933_0374373 | |||
| 1871 | Ga0373947_0057530 | |||
| 1872 | Ga0373947_0099908 | |||
| 1873 | Ga0373947_0180196 | |||
| 1874 | Ga0373947_0266469 | |||
| 1875 | Ga0373947_0270836 | |||
| 1876 | Ga0373947_0298871 | |||
| 1877 | Ga0373937_0001443 | |||
| 1878 | Ga0373937_0033209 | |||
| 1879 | Ga0373937_0047511 | |||
| 1880 | Ga0373937_0111072 | |||
| 1881 | Ga0373937_0115609 | |||
| 1882 | Ga0373937_0178912 | |||
| 1883 | Ga0373937_0214781 | |||
| 1884 | Ga0373937_0369841 | |||
| 1885 | Ga0373937_0505633 | |||
| 1886 | Ga0373937_1445312 | |||
| 1887 | Ga0265778_034197 | |||
| 1888 | Ga0265778_034457 | |||
| 1889 | Ga0265778_035199 | |||
| 1890 | Ga0265778_035321 | |||
| 1891 | Ga0265778_049605 | |||
| 1892 | Ga0265778_052249 | |||
| 1893 | Ga0265778_055338 | |||
| 1894 | Ga0265778_059524 | |||
| 1895 | Ga0265778_062280 | |||
| 1896 | Ga0265778_063876 | |||
| 1897 | Ga0372808_062442 | |||
| 1898 | Ga0310109_029066 | |||
| 1899 | Ga0373925_0014727 | |||
| 1900 | Ga0373925_0050539 | |||
| 1901 | Ga0373925_0156161 | |||
| 1902 | Ga0373925_0193112 | |||
| 1903 | Ga0373925_0571288 | |||
| 1904 | Ga0436364_0483352 | |||
| 1905 | Ga0436364_1424611 | |||
| 1906 | Ga0436361_0609805 | |||
| 1907 | Ga0436362_0834658 | |||
| 1908 | Ga0451839_1486827 | |||
| 1909 | Ga0451577_0744043 | |||
| 1910 | Ga0453683_0665519 | |||
| 1911 | Ga0453683_1181748 | |||
| 1912 | Ga0451576_0093362 | |||
| 1913 | Ga0451576_0216282 | |||
| 1914 | Ga0495592_0037718 | |||
| 1915 | Ga0495603_0439947 | |||
| 1916 | Ga0495651_0088399 | |||
| 1917 | Ga0495651_0231365 | |||
| 1918 | Ga0495651_0269354 | |||
| 1919 | Ga0495653_0357491 | |||
| 1920 | Ga0495653_0495917 | |||
| 1921 | Ga0495580_0002824 | |||
| 1922 | Ga0495580_0014057 | |||
| 1923 | Ga0495580_0073559 | |||
| 1924 | Ga0495580_0093911 | |||
| 1925 | Ga0495580_0149751 | |||
| 1926 | Ga0495580_0314626 | |||
| 1927 | Ga0495580_0865340 | |||
| 1928 | Ga0495582_0024647 | |||
| 1929 | Ga0495639_0065672 | |||
| 1930 | Ga0495664_0009808 | |||
| 1931 | Ga0495584_0380670 | |||
| 1932 | Ga0495594_0135237 | |||
| 1933 | Ga0495608_0097082 | |||
| 1934 | Ga0495608_0256644 | |||
| 1935 | Ga0495608_0317436 | |||
| 1936 | Ga0495618_0057915 | |||
| 1937 | Ga0495628_0056689 | |||
| 1938 | Ga0495628_0230076 | |||
| 1939 | Ga0495628_0563263 | |||
| 1940 | Ga0495628_0601798 | |||
| 1941 | Ga0495630_0158571 | |||
| 1942 | Ga0495666_0259402 | |||
| 1943 | Ga0495666_0314441 | |||
| 1944 | Ga0495666_0528245 | |||
| 1945 | Ga0495652_0054747 | |||
| 1946 | Ga0495665_0085093 | |||
| 1947 | Ga0495665_0130196 | |||
| 1948 | Ga0495665_0276636 | |||
| 1949 | Ga0495665_0594338 | |||
| 1950 | Ga0495640_0042576 | |||
| 1951 | Ga0495586_0137070 | |||
| 1952 | Ga0495587_0002664 | |||
| 1953 | Ga0495587_0100531 | |||
| 1954 | Ga0495598_0282068 | |||
| 1955 | Ga0495645_0009769 | |||
| 1956 | Ga0495645_0149465 | |||
| 1957 | Ga0495645_0191205 | |||
| 1958 | Ga0495645_0445545 | |||
| 1959 | Ga0495667_0018037 | |||
| 1960 | Ga0495667_0063533 | |||
| 1961 | Ga0495667_0105123 | |||
| 1962 | Ga0495634_0082539 | |||
| 1963 | Ga0495635_0057514 | |||
| 1964 | Ga0495635_0368607 | |||
| 1965 | Ga0495588_0397347 | |||
| 1966 | Ga0495599_0018742 | |||
| 1967 | Ga0495599_0055259 | |||
| 1968 | Ga0495623_0176017 | |||
| 1969 | Ga0495623_0261789 | |||
| 1970 | Ga0495646_0171974 | |||
| 1971 | Ga0495613_0047957 | |||
| 1972 | Ga0495624_0700896 | |||
| 1973 | Ga0495600_0044898 | |||
| 1974 | Ga0495581_0237527 | |||
| 1975 | Ga0495581_0497618 | |||
| 1976 | Ga0495604_0359783 | |||
| 1977 | Ga0495636_0183151 | |||
| 1978 | Ga0495674_0011815 | |||
| 1979 | Ga0495674_0037580 | |||
| 1980 | Ga0495674_0321693 | |||
| 1981 | Ga0495680_0059182 | |||
| 1982 | Ga0495680_0228717 | |||
| 1983 | Ga0495675_0076480 | |||
| 1984 | Ga0495675_0381919 | |||
| 1985 | Ga0495675_0393300 | |||
| 1986 | Ga0495684_0008037 | |||
| 1987 | Ga0495684_0031099 | |||
| 1988 | Ga0495684_0077934 | |||
| 1989 | Ga0495684_0120513 | |||
| 1990 | Ga0495684_0639423 | |||
| 1991 | Ga0495593_0648413 | |||
| 1992 | Ga0495602_0051852 | |||
| 1993 | Ga0495602_0093611 | |||
| 1994 | Ga0496104_0101947 | |||
| 1995 | Ga0496104_0438639 | |||
| 1996 | Ga0496104_1882721 | |||
| 1997 | Ga0496106_0308257 | |||
| 1998 | Ga0496109_1602131 | |||
| 1999 | Ga0496112_0995844 | |||
| 2000 | Ga0496112_1368449 | |||
| 2001 | Ga0496115_0121493 | |||
| 2002 | Ga0496115_0198712 | |||
| 2003 | Ga0496115_0239406 | |||
| 2004 | Ga0501315_026868 | |||
| 2005 | Ga0501315_081096 | |||
| 2006 | Ga0501317_083756 | |||
| 2007 | Ga0501318_067550 | |||
| 2008 | Ga0501031_0130126 | |||
| 2009 | Ga0501032_0004512 | |||
| 2010 | Ga0501033_0018380 | |||
| 2011 | Ga0501033_0884578 | |||
| 2012 | Ga0501034_0055543 | |||
| 2013 | Ga0501036_0000169 | |||
| 2014 | Ga0501037_0011724 | |||
| 2015 | Ga0501038_0002204 | |||
| 2016 | Ga0501039_0175851 | |||
| 2017 | Ga0501043_0003790 | |||
| 2018 | Ga0501046_0002817 | |||
| 2019 | Ga0501047_0017475 | |||
| 2020 | Ga0501048_0025322 | |||
| 2021 | Ga0501067_0003565 | |||
| 2022 | Ga0501068_0005161 | |||
| 2023 | Ga0501069_0001178 | |||
| 2024 | Ga0501070_0050742 | |||
| 2025 | Ga0501072_0000228 | |||
| 2026 | Ga0501072_0406388 | |||
| 2027 | Ga0501073_0193908 | |||
| 2028 | Ga0501074_0197581 | |||
| 2029 | Ga0501076_0928061 | |||
| 2030 | Ga0501077_0028626 | |||
| 2031 | Ga0501079_0014673 | |||
| 2032 | Ga0501080_0004398 | |||
| 2033 | Ga0501083_0002357 | |||
| 2034 | Ga0501035_0136922 | |||
| 2035 | Ga0501044_0116689 | |||
| 2036 | Ga0495601_0794973 | |||
| 2037 | Ga0495595_0306611 | |||
| 2038 | Ga0495619_0752095 | |||
| 2039 | Ga0500568_0001338 | |||
| 2040 | Ga0501084_0092592 | |||
| 2041 | Ga0587084_090064 | |||
| 2042 | Ga0587093_047786 | |||
| 2043 | Ga0587093_050051 | |||
| 2044 | Ga0587093_065788 | |||
| 2045 | Ga0587093_068119 | |||
| 2046 | Ga0587066_061551 | |||
| 2047 | Ga0587066_102918 | |||
| 2048 | Ga0587066_104024 | |||
| 2049 | Ga0587066_146328 | |||
| 2050 | Ga0587066_153999 | |||
| 2051 | Ga0587073_0052707 | |||
| 2052 | Ga0587073_0069974 | |||
| 2053 | Ga0587073_0109333 | |||
| 2054 | Ga0587073_0126078 | |||
| 2055 | Ga0587073_0146779 | |||
| 2056 | Ga0587073_0190954 | |||
| 2057 | Ga0587073_0193838 | |||
| 2058 | Ga0587073_0260070 | |||
| 2059 | Ga0587073_0265993 | |||
| 2060 | Ga0587077_040997 | |||
| 2061 | Ga0587077_097589 | |||
| 2062 | Ga0587077_100953 | |||
| 2063 | Ga0587080_094101 | |||
| 2064 | Ga0587080_135879 | |||
| 2065 | Ga0587082_088263 | |||
| 2066 | Ga0587082_104567 | |||
| 2067 | Ga0587082_123694 | |||
| 2068 | Ga0587083_0168097 | |||
| 2069 | Ga0587083_0168412 | |||
| 2070 | Ga0587083_0206380 | |||
| 2071 | Ga0587083_0237041 | |||
| 2072 | Ga0587083_0258100 | |||
| 2073 | Ga0587085_105987 | |||
| 2074 | Ga0587085_120242 | |||
| 2075 | Ga0587085_141271 | |||
| 2076 | Ga0587086_055793 | |||
| 2077 | Ga0587086_068505 | |||
| 2078 | Ga0587086_086595 | |||
| 2079 | Ga0587089_074111 | |||
| 2080 | Ga0587089_078824 | |||
| 2081 | Ga0587089_110288 | |||
| 2082 | Ga0587090_065786 | |||
| 2083 | Ga0587090_081775 | |||
| 2084 | Ga0587090_124410 | |||
| 2085 | Ga0587091_078069 | |||
| 2086 | Ga0587091_082016 | |||
| 2087 | Ga0587091_137550 | |||
| 2088 | Ga0587091_140650 | |||
| 2089 | Ga0587091_150925 | |||
| 2090 | Ga0587091_173606 | |||
| 2091 | Ga0587091_188868 | |||
| 2092 | Ga0587091_194360 | |||
| 2093 | Ga0587091_201551 | |||
| 2094 | Ga0587092_067731 | |||
| 2095 | Ga0587094_057810 | |||
| 2096 | Ga0587094_067914 | |||
| 2097 | Ga0587094_081792 | |||
| 2098 | Ga0587094_089939 | |||
| 2099 | Ga0587106_060438 | |||
| 2100 | Ga0587106_065488 | |||
| 2101 | Ga0587101_061231 | |||
| 2102 | Ga0587101_144055 | |||
| 2103 | Ga0587109_108740 | |||
| 2104 | Ga0587109_109504 | |||
| 2105 | Ga0587109_115197 | |||
| 2106 | Ga0587113_030418 | |||
| 2107 | Ga0587113_042682 | |||
| 2108 | Ga0587115_047786 | |||
| 2109 | Ga0587115_057442 | |||
| 2110 | Ga0587117_073614 | |||
| 2111 | Ga0587117_112923 | |||
| 2112 | Ga0587128_076503 | |||
| 2113 | Ga0587130_046106 | |||
| 2114 | Ga0587067_109173 | |||
| 2115 | Ga0587067_163176 | |||
| 2116 | Ga0587067_165199 | |||
| 2117 | Ga0587068_103913 | |||
| 2118 | Ga0587069_092722 | |||
| 2119 | Ga0587069_125654 | |||
| 2120 | Ga0587069_129958 | |||
| 2121 | Ga0587072_084270 | |||
| 2122 | Ga0587072_100957 | |||
| 2123 | Ga0587072_128880 | |||
| 2124 | Ga0587075_070050 | |||
| 2125 | Ga0587075_077047 | |||
| 2126 | Ga0587075_083655 | |||
| 2127 | Ga0587075_118425 | |||
| 2128 | Ga0587076_085433 | |||
| 2129 | Ga0587076_094687 | |||
| 2130 | Ga0587078_050123 | |||
| 2131 | Ga0587078_069344 | |||
| 2132 | Ga0587079_077455 | |||
| 2133 | Ga0587079_092227 | |||
| 2134 | Ga0587079_102913 | |||
| 2135 | Ga0587114_062209 | |||
| 2136 | Ga0587120_027023 | |||
| 2137 | Ga0587071_067916 | |||
| 2138 | Ga0587071_086753 | |||
| 2139 | Ga0587071_139071 | |||
| 2140 | Ga0587071_223528 | |||
| 2141 | Ga0587111_0225910 | |||
| 2142 | Ga0587111_0276795 | |||
| 2143 | Ga0501082_0001011 | |||
| 2144 | Ga0501082_0191781 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ptg-assembly2.cif.gz_A | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.8919 | 1 | 112 |
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.8836 | 1 | 113 |
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.8453 | 1 | 113 |
| 6ptg-assembly2.cif.gz_A | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.8431 | 1 | 112 |
| 7khe-assembly1.cif.gz_M | escherichia coli rna polymerase and rrnbp1 promoter pre-open complex with dksa/ppgpp | 0.8267 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.8139 | 1 | 112 | 1.20.120.910 |
| af_E7F021_97_223_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8032 | 1 | 74 | 3.30.40.10 |
| 1tjlB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.7772 | 1 | 118 | 1.20.120.910 |
| af_Q6YZ03_33_177_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.77 | 1 | 75 | 1.20.140.40 |
| 4nsmA00 | Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.7534 | 2 | 75 | 6.10.250.2770 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350UG21-F1-model_v4 | TraR/DksA family transcriptional regulator | 0.9775 | 1 | 112 |
GO:0008270
|
| AF-A0A7Y2D351-F1-model_v4 | TraR/DksA family transcriptional regulator | 0.9542 | 1 | 115 |
GO:0008270
|
| AF-A0A838HDC5-F1-model_v4 | TraR/DksA C4-type zinc finger protein | 0.9514 | 4 | 105 |
GO:0008270
|
| AF-A0A3M4RXC8-F1-model_v4 | Uncharacterized protein | 0.944 | 1 | 112 |
|
| AF-E6X2P0-F1-model_v4 | Transcriptional regulator, TraR/DksA family | 0.9427 | 1 | 111 |
GO:0008270
|